1NA1A

The structure of hrv14 when complexed with pleconaril
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
b'TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
molecule tags Virus
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1A00
2RMU1 2BFUL 2XBO1 3VBFB 1H8TA 4GH4A 1HRI1 2R071 1NOVA 2RS11 4CDQC 2BBVA 1ND2C 4N53A 3CJIC 4WM8C 3TN93 5AC93 1VBE2 4QPIC 4RHV3 3S6PA 4PDWC 4N53B 4FTBA 1AR92 2WS93 4N43B 4Q4Y1 4RR3B 1VB2A 1VBB3 1EV11 1OHFA 1PVC2 2RS53 2ZAHA 5C9AA 5BNNC 3VBUB 5JZGB 5CFDA 2WFF3 4QPIB 4Q4V1 5C9AB 1PGL1 4RS5C 4RQPB 1RUD3 3JD71 1BEV2 1CD3G 4CDUA 1X33A 4Q4X3 1NCRC 1VRH3 1FPN2 1ZBA2 1EAH1 1V9U1 5ABJC 1BBT2 1NCQB 1RHI2 1K5MA 5C8CC 4WM7B 1VBE3 1V9U3 2RM22 1AR63 5C4WC 1R1A2 4WM7A 1VBD1 1QJU1 1AYM3 4RR3A 3VBHB 1NY71 2GH8A 5C8CA 4Y5Z0 1VRH2 4CEYC 1VBA1 1NA1B 1NG0A 4QPIA 3CJIB 4WM8B 5D8AB 5BNNA 2X5IA 1AR83 1RUH2 3CJIA 4WM8A 2PLV2 3TN92 1RB8G 1H8TC 1D4M1 5L7OC 1RMU3 5DDJ3 1ZBE3 1COV2 2WLPA 1NY72 1HRV1 1AR71 4RS5B 1HRV3 1RUG2 1BBT3 1RHI3 4RR3C 2X5IC 1QJU2 1W39A 2RS13 3ZFEC 1ND2A 1V9U2 1VBD3 2HWF1 4CDWC 2TBVA 1BBT1 1RHI1 4FSJA 4RQPC 1HX6A 2HWB1 5CFDC 1R091 1NA1A 1EAH2 5A32B 4IV3C 2PLV1 4CDWA 1Z7S3 4JGZB 4YVWB 2FZ2A 1RUH1 1HRV2 1RUG3 5CFCB 1K5MC 1VBA2 1PO23 2MEV3 2RM23 3ZFGA 1TME2 1A6CA 1RUE3 5J96B 2RS31 1AR61 2WFF1 1NA1C 5L7OB 4JGZC 3FBMA 3VDDB 1AYN2 4GB33 1MEC3 1AYN3 1HQNA 2BFUS 1M06G 2HWB3 2XBO2 1OOPB 1RUJ1 1FPN1 2R042 3VBSC 1C8M3 1RUD1 1TMF1 1PIV2 4IV3A 3DPRB 1TME3 1AUYA 2HWD1 1E57A 1AR73 2R062 1AR72 1RMU1 3ZFEA 3VBSA 3TN91 2MEV2 4GH4B 1MEC2 4Q4Y2 4CEWB 3VBSB 5L7OA 1RUF1 1RVF1 4CDXC 1AL23 1AR91 5JZGC 1AL22 5GKAC 5ACA2 2RR12 4JGZA 2DF7A 1NCRB 2WWSA 3ZFFC 1AYN1 1FOD3 3JD73 2FZ1A 1HRI3 1X36A 2R073 5C4WA 4WM7C 3J8F3 1HRI2 2R072 1ND3B 3J8F2 4AEDA 4GMP0 5C4WB 4Q4W3 3ZFGB 1RUF2 1RVF2 1ASJ1 1PIV3 4JGYB 1VBB1 1RUJ3 1VBC2 2MEV1 1HXS1 2RMU2 4AEDC 4CEYB 4GB31 1BEV1 4Q4V3 4GB32 1POV0 4Q4V2 5AC91 1RUD2 4BCUA 1R093 1BMV1 2R043 3NAPC 1QQP1 2HWE2 1ASJ3 1PIV1 4YVWA 4FTEA 1SMVA 3LOBA 3J8F1 3ZFFA 3ZFEB 1NCQA 2RMU3 5A33A 4FTSA 3ZXAC 1AR62 4CDQB 2WZR3 1QJX1 2HWC1 3ZFFB 2XPJA 4RFT0 4CDXB 4CEWA 1PO11 3JB8A 5DDJ1 4CEYA 1AL21 4CDXA 1BEV3 2QQPA 1GFF2 5CFDB 5ABJB 1FPN3 5ACA3 3IDEA 4Q4X2 1RUI1 4YVWC 4CDUB 2RR11 4QPGB 1VBA3 3ZFGC 1PO22 2R061 1R092 1FMD2 5FMOL 5J98B 2VQ0A 1RMU2 1ZBE2 3NAPA 1TMF3 1MEC1 4RHV2 1R083 3JBG3 3DPRC 3NAPB 3VBRC 1RUC1 1HXS3 4IV1C 2RS33 1HXS2 1RUE1 1PVC3 1PGW1 2RS52 2HWB2 3VBOC 1VBB2 4GH4C 5C8CB 4Q4W1 2HWF2 3VDDC 1H8TB 1D4M2 2PLV3 1C8M2 1AR82 5BNNB 4Z92B 4NWWA 1Z7S2 1FMD1 1ZBA3 4CDWB 2R063 3DPRA 5FMOS 1PO21 1OPOA 1TME1 4PDWA 4IV1A 1AR93 5CFCA 2RS32 2WS91 1Z7S1 4QPGC 1VRH1 4CEWC 5BNOC 4YVSA 3JBG1 1R082 1MQTB 1AL0G 1R1A1 1QJY2 1D4M3 1AYM2 1MQTA 3VBFC 1VB4A 1PGW2 1AR81 1OOPA 2X5IB 1DDLA 4QPGA 2HWF3 5BNPC 3VBHC 1C8M1 1NCRA 1IHMA 2RM21 1MQTC 1ZBE1 1FMD3 5D8AC 4EJRA 1QQP3 1RUE2 1AYM1 5K0UA 1RUG1 4N53C 2ZZQA 1R1A3 3HAGA 1PO13 1COV1 1ZBA1 3JBG2 1QJY3 3VBHA 3VBRA 1QJY1 3VBOB 1WCDJ 4N43C 2WS92 1QJU3 1R081 4YVSB 1RUI2 5JZGA 3VBOA 5D8AA 2BUKA 5A32A 1EV13 4Q4X1 1B35A 2HWE3 1RUH3 2RR13 1C8NA 1RUC3 2IZWA 1NCQC 1B35B 1COV3 4CDUC 1POV1 4GMP1 4IV3B 4N43A 5BNOB 2RS12 4Q4W2 4LLFA 1QQP2 2RS51 1RUI3 1OOPC 5BNOA 2BPA2 4Q4Y3 1VBC3 5K0UC 1VAKA 1QJZA 4RHV1 4RQPA 3VBFA 1BMV2 4SBVA 5BNPB 3JB4C 1RUC2 1FOD1 1F2NA 1FOD2 5BNPA 5FOJB 4YVSC 1EV12 5AC92 1PGL2 2HWD3 4Y4YA 1ASJ2 5K0UB 1RVF3 1RUF3 1ND3A 4NWVA 1PVC1 1VBC1 1RUJ2 2R041 5DDJ2 3VBRB 4PDWB 1PO12 4IV1B 4JGYA 1QJX3 2HWC3 1QJX2 2HWC2 3VDDA 1VBD2 2Y26A 1POV3 4CDQA 5ABJA 2GSYA 1ND3C 2WFF2 3VBUA 1VBE1 2XBO3 4JGYC 2HWE1 1B35C 2ZTNA 1CJDA 1EAH3 5CFCC 5ACA1 4AEDB 4RS5A 4GMP3 3M8LA 3VBUC 3JD72 2HWD2 5LK7B 1K5MB 1F8VA 1ND2B 5C9AC 1TMF2 2WZR2 5A33B 2WZR1
chains in the Genus database with same CATH superfamily
4PBPA 1FV3A 2RMU1 4ISRA 4AEMA 4QX0A 4ZU4A 4BQ1A 2QUOA 1H8TA 4GH4A 2H0BA 3ON7A 2R16A 3JCIA 5FRAA 2P34A 5FY8A 5CBLA 1W3XA 4AQ6A 4IEVA 2RS11 4CDQC 5A3UA 1OUSA 4YM1A 5LA1A 4AI9A 1YJKA 2Q0AA 4N53A 4A6SA 3OPWA 5FYTA 4E9KA 4EV0A 3AJYA 3U4XA 3K75B 2XJPA 2DBNA 2W95A 3T2PA 4NN0A 4RHV3 3S6PA 3DCQA 1IS5A 3HQUA 2D6LX 2X8KA 4N53B 5DAVA 4FTBA 4IUGA 4DQAA 4KMQA 4CYDA 3VZOA 4R4ZA 1UCXA 2JDUA 2XWBB 2CWSA 4XZPA 1AR92 4AAPA 1GWKA 2VBBA 5DUWA 3J7LA 3K2OA 1ZRCA 1OKOA 3FN9A 5G05L 1IS4A 1YCIA 3HBKA 3N9OA 1E5SA 4XETA 2PHTA 2A6WA 2XJVA 3WW2A 3S0MA 3FBYA 5BNNC 1QJEA 2PELA 3M3EA 1QDCA 4K3UA 1CAWB 4ZU7A 1JOBA 4Y1YA 2VCAA 1BLZA 3OUJA 4YGDA 1H9PA 4PLMA 5FK8A 5FXZA 4CDUA 1UD1A 5CKNA 3NL1A 1DZRA 1ZBA2 5FZ4A 3SQOA 1G6NA 1EAH1 2RE9A 1DQ5A 1HB1A 3ROUA 1GYKA 1GZWA 3UT0A 5ABJC 1RHI2 3ACFA 1J3RA 3MLJA 3NV2A 4YGCA 4HN0A 1GKBA 2GNMA 1RL3A 1SEFA 1NXMA 4BQYA 1AXKA 2P3YA 2B8MA 4IEUA 3BUCA 4LUKA 1O59A 1XNDA 1R1A2 2ZKLA 4HANA 2GC3A 3IAPA 3ZPYA 2Q1MA 3OD0A 2D5FA 4M00A 4Q8KA 1D0GA 4A2UA 4C1XA 3VHPA 1Z78A 1BHGA 4RR3A 4BDVB 3PNAA 3GBFA 1NY71 4IE7A 4BA6A 4Y5Z0 1VRH2 4LIUA 1ZZ9A 2VMGA 1YHFA 2GN3A 2DCTA 2QQJA 1NG0A 5FZFA 5A7WA 3BPSA 4B7EA 4CCNA 5KXDA 1LAJA 2BGCA 5FYCA 3ZYBA 2BNNA 3B02A 2XWJB 4L2NA 2O1QA 4OULA 3AKRA 4JCKA 4CCMA 1RB8G 5IK8A 4B4PA 1G9AA 5DDJ3 1ZBE3 3I3EA 4S2GA 1HRV1 3ST7A 1MS4A 2VZVA 4Y26A 2VNVA 1OH4A 2YU2A 1VRBA 3LQCA 1BBT3 1N3OA 2DUQA 2H0VA 5FY0A 5C3RA 1YUDA 2E53A 1LOAA 2RS13 3I7DA 2W9XA 1VBD3 2J1UA 3BIWE 3K48A 3ENRA 4GKYA 4MH0E 1BBT1 4P02B 5FYBA 3UK9A 4BHPA 1LHNA 3S5AA 5FKCA 1W6QB 1HX6A 5AFBA 1W90A 2WQ4A 3WDUA 3LB9A 3NV4A 2VGDA 1QNYA 2XL9A 3O1VA 1Y4WA 4FPYA 1R091 3MLKA 1SCRA 4IV3C 4NPMA 2PLV1 3HN1A 2WO1A 3AFKA 3URFA 3AX4A 1J58A 4WVWA 2FZ2A 3ORJA 1LESA 2GZWA 2N7GA 5CA6A 1HRV2 1RUG3 4YFZA 2ZMLA 1XC6A 2CAUA 1NZCA 2DCJA 3ZX7A 1F15A 1LOEA 4PI0A 2W5FA 4UFMA 5C3QA 2VCBA 2JDMA 1W9SA 2VNOA 4PCRA 3F95A 4XBNA 2EAAA 2OVUA 3AKQA 4A6OA 4CU7A 5JXHA 1O4ZA 1W03A 3KVAA 2B7YA 2P1BA 2IXLA 1IG3A 3RDIA 1RJ7A 5L7OB 3DN7A 1V0AA 5EJ1B 2DUPA 2AZ5A 3FLTA 1XBFA 5BY5A 3LZZA 5L36A 3SH4A 4W50A 2ZGUA 5FZMA 2QCSB 3FFQA 4AVSA 4MXWA 3KB5A 4NUBA 2NQYA 1OOPB 3HT2A 4XF1A 5GLUA 5H9RA 2GDFA 3SNMA 3VBSC 3ZIXA 4EN9B 1C8M3 1UZ0A 1LCLA 2D3SA 4LBMA 1Y9QA 3S7EA 3O1SA 3H9AA 2ADDA 5FJHA 1PIV2 4ZZ8A 2W91A 5JI9A 4XHBA 2ZEZA 3THDA 3EBRA 2QZ2A 5FPXA 5C5TA 4QHOA 4X6QB 2Y34A 1YI7A 5TSWA 2HH9A 1G8WA 3V0AA 2D7FA 2W87A 5IVVA 1J3PA 1UYPA 4MGIE 5CISA 5DAXA 2VW0A 4YW2A 2I45A 2YC0A 2JDNA 4META 3HR9A 4R8HA 3GF6A 1UXZA 4X8NA 1FT9A 2D6OX 1MZ6A 4FFGA 5D2AA 1RVF1 3SCFA 5T5JA 1HW5A 1AR91 1XE8A 2EXKA 2EXIA 5GKAC 4AVAA 5M0TA 3CMGA 4JQRA 3CHXA 4LO8A 5DG2A 5A7QA 1WW4A 1Q8VA 4LEJA 1DQ0A 1PGSA 1AYN1 3POGA 4XQDA 3WG1A 3C8XA 1AXYA 2R073 3JD73 4KL1A 3BN6A 2WFPA 2R072 3LA7A 4IE0A 1JYIA 5I0TA 4FPGA 3C7GA 4GMP0 2GALA 2JIJA 3U4SA 4NIDA 3ZFGB 3T4HB 1RVF2 1RITA 3NNMA 4MGSA 5I8TA 4D7TA 4D6SA 1W0NA 4JGYB 2HKXA 2X53S 2VM9A 2G4IA 1NYWA 2C0ZA 2PHRA 2MNGA 1VBC2 2ZAAA 1JBCA 2XR4A 1TQ5A 2VU9A 3OSDA 4LA3A 2RMU2 2JDYA 2VCMA 4XE9A 2P3KA 3K77A 4P9IA 2FQPA 1BEV1 2J42A 1V6KA 2WWUA 5H9QA 3E5XA 1POV0 4GB32 2K9ZA 1BK0A 1TG7A 4DB5A 1UO9A 1LEMA 3D6EA 3OGSA 1CAVA 4QD2A 4EWDA 2B4KA 1H1IA 2VL4A 3MV01 4W8JA 4LK6A 3UGGA 1XXNA 4KNCA 1UY4A 2H6CA 4WV8A 2FMYA 4E4DX 1ASJ3 1PIV1 1ACCA 3LEIA 4DMIA 5A3PA 1UYZA 4QB6A 5KC5A 5LEJA 3KS7A 3H3ZA 4FTEA 4QGNA 1MZEA 2EA7A 3J8F1 3O14A 3ZFFA 1EYBA 2GP3A 4RD7A 1E5IA 4CU9A 4Y1XA 2JWPA 4CXYA 4HVQA 2RJ2A 2WZR3 1KEXA 4IE4A 5G04L 3ZFFB 4RFT0 3WP3A 3ACHA 3ZXDA 4Y1VA 4JX0A 4CDXB 3GGLA 1ZRFA 3RYPA 5DDJ1 3IM0A 4PI2A 1JTZX 4CCDA 1UMZA 5FP3A 1GQGA 1AL21 3WW4A 1IKQA 2JG8C 2O14A 4CEYA 4CDXA 2F6BA 1H6XA 1W2NA 2OUHA 3NKGA 3OD4A 5FPVA 5JXJA 3AM2A 5CFDB 5ABJB 1FPN3 4XMAA 5ACA3 2EXJA 3KD4A 3IDEA 4R9DA 4Q4X2 2RDSA 2YFZA 3PVEA 3V0BB 5ERLA 3K3NA 2VTFA 2DTWA 4AQTA 1DU3D 4NRPA 1YLLA 4QPGB 1O5LA 4XPVA 1POQA 2A71A 2I74A 1ZA4A 3NV3A 1LOBA 1ENRA 4ARXA 5JXIA 3BOWA 1ULPA 1R092 1O3QA 1FX5A 2ZGNA 4Y24A 3R4UA 2VQ0A 3TAYA 3VD9A 2WJSA 2ZGQA 4GJYA 3ES4A 3NAPA 4Z2AA 1YYNA 4RHV2 2G1MA 3CZUA 1OQ1A 4Y22B 3AYCA 3JBG3 1GBGA 2QNKA 4PJYA 1HKDA 3NAPB 3VZNA 1H1AA 2G19A 4IGQA 3W5MA 3FC0A 4MV2A 2A7AA 3RJRA 4RGKA 3LPGA 2VQTA 4PHZA 2J1EA 2DVBA 1XB9A 5F39A 2IXIA 1Y43B 2EICA 1H8TB 1S55A 2ZHLA 2RHPA 1DCSA 1DHKB 3T2OA 4AEKA 1WUVA 4MG2A 1K42A 1GQHA 2JEMA 3N9PA 4F83A 2R0FA 2V5DA 5EQUA 2UYAA 4FAGA 1ZZ7A 2ZA9A 2WNOA 4OQ9A 4Z92B 4EN6B 1FMD1 4E27A 3OCPA 5F8PA 2AUYA 5A7SA 4HPKB 3ITQA 2R063 2QVSB 1PO21 2IFRA 2YFUA 4AI8A 3HNMA 4QU1A 2Y6KA 4ZU5A 4HT1T 2DVFA 1AR93 2YC4A 1HLCA 2ET7A 4NROA 5J36A 2UY9A 3LPFA 3A4UA 2I07B 2Q1ZB 2ZGMA 1VRH1 2WSVA 5BNOB 1GOHA 1ULCA 2WNUB 4YVSA 2Q8EA 4EN7B 2IXCA 4NAMA 1R1A1 5BPXA 1SFNA 4BK4A 1CGPA 4CRQA 4WVMA 1SHWB 2WNUA 4FBFA 3AZXA 3NJZA 5FCCA 1CZTA 1QNWA 3ZMNA 3NJVA 1WLTA 4AGRA 3KGLA 4O9EA 2HEWF 5IW0A 1YQCA 2LROA 3USUB 2J1SA 3H1YA 5GZEA 1GWLA 5GZFA 1W8WA 1NT0A 2J1AA 5BNPC 2W1UA 1V6NA 1ZNPA 4MOAA 1JYVA 1DZQA 3A21A 3VKMA 1BKZA 3UGFA 2ERFA 3P3NA 4Q0VA 2RJKA 4FP2A 2L9LA 3ZYJB 5F3EA 1QQP3 3GZUC 1RGSA 4HKWA 5K0UA 1RUG1 1DQ4A 4LHNA 1NLRA 5FXXA 2W0XA 5I8SA 4D94A 1QJY3 4PQ9A 1ST8A 2H6BA 2ZBJA 1PX3A 1R081 2WYFA 5F3IA 4AW7A 4IL7A 2CL2A 4XF9A 2JE8A 3OGVA 4LNVA 3NRUA 2ZX2A 5JZGA 2BUKA 1UPIA 3JXSA 2UWBA 2XLAA 5A32A 3DL3A 4YW7A 4FQZA 5FAXA 5FZLA 2R1DA 3B9IA 4FQ4A 4UFHA 4TLGA 1NLQA 1OT5A 5FZ9A 3HJRA 5CIRA 4D3WA 4CUAA 5FY4A 3NNGA 4YZ5A 3ZXKA 5FMCA 3VHOA 4H55A 4XBQA 3GXUA 1OD5A 1YQ5A 2OQ6A 2WWJA 4CDUC 4IV3B 4LITA 3DUIA 3FHQA 4ZS2A 2QE3A 4MO3M 1UXXX 2RS12 1QH7A 2VW1A 1CQ9A 4IETA 4Q8LA 4Q4W2 4R4XA 4UW5A 5FO8B 4Q0SA 2VUAA 5A3WA 2RS51 3SCHA 3WHTA 3NNLA 1XNTA 5BNOA 4G9SB 1LGBA 5F9TA 1MS8A 5LA2A 3CKHA 1QJZA 4XTMA 1D7PM 1UMHA 2OKXA 5C71A 4GALA 4RHV1 2YHJA 1SACA 2VH9A 2UWAA 1US3A 1QXRA 3VBFA 4A44A 1BMV2 4QXBA 3KF3A 3AYEA 1ZZ6A 2BEOA 4Q0UA 2KD7A 1YXWA 2PAEA 1S0BA 4AL9A 1PHMA 4KWLA 4TWTA 5ANQA 5A7OA 4DIQA 5IVYA 1XYOA 2VOVA 2PMWB 2UY8A 5FOJB 4YVSC 1DZTA 2DDUA 3UKNA 5A6XA 4GWMA 2P17A 3FLPA 1ODMA 2B42B 3WXPA 1RUJ2 1QEXA 2XLGA 1LOFA 4AAXA 5DDJ2 2DCYA 4PDWB 2W68A 3TB0A 4FPCA 2GC2A 1QJX3 4GXLA 3RNSA 4KBBA 5CNAA 3OBRA 3RPQA 4EQVA 5C33A 5I0RA 1QDOA 3VKFC 1LU2A 2EALA 2GSYA 3WZ1A 4MXWB 4V1PA 1W6OA 2WFF2 5D1IA 3WG2A 2QJVA 1U0AA 1ZRIA 2WLQA 1NE6A 2AC1A 3MIFA 5T50A 4XF4A 3S7IA 3ZM8A 1JYCA 3WT3A 1W0OA 5F37A 4ZXEA 5FXVA 4NIGA 1SQ4A 1X50A 3Q8CA 5FBJA 3U78A 1US2A 3POBA 4LLOA 5IJRA 5DQ0A 1HJGA 3GCWA 3M8LA 4L0PA 4QAWA 2VMIA 3IBMA 1XYNA 4CCCA 2ATFA 3ZMOA 2ZABA 5FV3A 1TMF2 4AE2A 4HETA 2E6VA 4UW4A 3QH6A 1OF4A 3EYPA 4ZHNA 2BYVE 3AK0A 4ZPIA 3RVHA 5KHGA 4JHZA 4YZ3A 4RFRB 3G6JB 3MHZA 3V56A 5IFTA 2XBO1 4RL7A 3TNQA 3UKVA 2C1FA 3LE0A 1L7LA 1S0FA 3PVOA 3AMHA 2AEYA 1IQDC 1H1MA 2E63A 4UFIA 5LRSA 1DQ2A 1V6LA 3AP9A 2CGNA 3K4AA 3VZJA 1WZXA 2R071 2ZX4A 1SPPA 1ZX5A 2D98A 2YYOA 1YFWA 2D3RA 2YUEA 2MPFA 3WF3A 1S1AA 1ND2C 2BBVA 1SFYA 3ZN5A 1AX1A 3CLPA 4WM8C 1WA4A 3MFAA 3OY8A 3TNPB 3WG4A 4PIXA 3VHNA 3INAA 1HV1A 5FFOC 2GN7A 2LTNA 2E51A 2ET1A 2JG9B 2RJLA 2C9KA 3W20A 2PAKA 5FO7B 5LA0A 1S0JA 2Y8KA 4DUVA 3ACGA 1GQPA 2EXHA 4MX3A 3SITA 1C3HA 4AI1A 3WNNA 3U11A 1PMJX 2UURA 3ZYIB 2P4EA 4RR3B 3VD7A 1IOAA 1EV11 4B29A 4NAOA 5H9PA 3VBUB 5JZGB 3BYWA 2UU8A 4XJZA 3WY6A 3ZPOA 3LWCA 3KHCA 1SLBA 4RS5C 4RQPB 1AF9A 4YW5A 3RQ0A 4QHBA 4N9IA 1UY3A 1X33A 1NCRC 4U36A 2AH2A 3O5SA 1V9U1 3T30A 4OFGA 3WDTA 1GP5A 3M2MA 2Z5WA 1A3KA 3RYKA 4CSWA 4URTA 1UKRA 2BV4A 1V9U3 4OHWA 1L7QA 3GBGA 3NV1A 3VD3A 5IK4A 1AR63 1N3PA 1I5PA 1CPNA 1XNBA 3FX3A 1O4TA 3O12A 1U12A 2I2SA 4PF1A 5C9AA 1VBD1 4A7YA 2XVLA 3RZKA 2YBSA 1OLMA 3WDVA 4JDOA 3BTYA 1GWMA 5IVBA 2IXJA 4PIZA 4UBGA 1XNKA 4Z82A 2QTWB 3D0JA 4CEYC 5IYYA 2ID4A 3LKJA 2O8OA 2TNFA 3UGHA 4BPZA 4BYYA 1VAMA 3MI8A 5BNNA 2X5IA 4YZ2A 3HEIA 1W9YA 1C28A 1TNFA 2PLV2 5CVRA 3N9NA 3GNEA 4OZXA 2WN3A 4QXHA 3TN92 1H8TC 1D4M1 1UN1A 3BB6A 5K9YA 1NY72 3LCPA 4CUGA 3OYWB 3OBAA 2IC1A 5FZCA 4QQOA 1X82A 3RZGA 5FPUA 2X5IC 2W08A 4CXXA 5F6LB 3M1HA 4ZKTB 1ND2A 4M0NA 3L9JT 4Q29A 1F5FA 3O1OA 1UX6A 1CZVA 3AZZA 3KV6A 4LO6B 3WCRA 3WHUA 4UOJA 5BUVA 5J7MA 1MVQA 4FSJA 2JDAA 2ZHKA 4QXCA 4YG6A 3WW1A 5FY7A 2YGLA 4UBHA 4ET7A 2VUJA 2WC2A 4LUMA 3WSOA 3B7MA 1NA1A 2A70A 1EAH2 4OUSA 3KHBA 4DXRA 1PNGA 4JKLA 5L9BA 1HB2A 1HN0A 2GMEA 2A3YA 3N7LA 1MS0A 1GNYA 2V4AA 2YPJA 4HVRA 3QLQA 5FWJA 3RZLA 2VZ3A 1NQDA 1REFA 5BXXA 2FDKA 1SDDB 2MEV3 1NXD1 3RG0A 4DZGA 5LWBA 2B9VA 1TME2 1A6CA 3LDRA 2XUMA 5EWSA 1NKGA 4HFSA 5FPBA 4CU6A 4FXKB 5HCFA 4DXSA 3O1TA 4JRAA 4IE6A 3H7YA 3USUA 4N8MA 1DYKA 1WBLA 1YFYA 1AYN2 4GB33 1PZ9A 2ORXA 1HQNA 3OB8A 4UT5A 2BFUS 1M06G 1CAWA 1W9TA 3RZZA 2PQQA 2BNOA 2R042 4B3NA 1FV2A 3LD8A 4GJZA 3OUHA 1C1FA 5CG9A 1RUD1 3FUOA 1REDA 5IWFA 4ES9A 4MHUA 4K1ZA 4COYA 3OY8B 4QB2A 4D69A 2LALA 1H6YA 1TME3 4V2WA 3A23A 4M01A 1OA2A 1PK6A 3IIIA 4LHSA 1HV0A 4XMIA 4B4QA 3BTZA 4FAHA 1V6MA 1DG6A 4IW3A 1AR72 1OQDA 4AVTA 1RMU1 2XG3A 4K20A 4O7XA 5FPZA 3ZFEA 1OA3A 3VKNA 5A3TA 3VBSA 2PHXA 1BVVA 2MEV2 4RA0A 4UFLA 2PHDA 2R1BA 4Q4Y2 5I8YA 2A75A 5DUVA 1OPMA 2E7QA 2LM3A 3VBSB 2OZJA 2NN8A 4CEWB 3WNPA 3LA3A 4YYOA 1RUF1 4E4SA 2YB7A 3A22A 3AFGA 5ACA2 2Y0OA 4UAPA 2QQMA 3PLQA 3O1UA 1JODA 1W28A 2E33A 2CTVA 4JGZA 3ZYRA 1W9WA 2JXAA 2QFEA 3H8OA 3ZSJA 3KCXA 4QKFA 1ENQA 2WWSA 3N9MA 2NLRA 3BOPA 1FOD3 1HRI3 3T09A 4WM7C 5C3SA 1PNFA 4JZRA 5T5PA 4PQQA 3POIA 4RGAA 5KXEA 3KT1A 2VO5A 4ZS3A 1ULOA 5FXWA 4MGQA 3BI3A 1ASJ1 1PIV3 4XXAA 2F4LA 1VBB1 1VP6A 1REEA 2VPVA 2W47A 2Z42A 4LIVA 2ETEA 2LW8A 5LASA 2OIIA 5EYXA 1HXS1 1WLDA 3D5OA 1WD3A 5E6HA 4URAA 5FUPA 3DECA 1DGLA 1I5ZA 3BKZA 1W06A 3PDQA 4CEYB 4YGEA 4MADA 1AHSA 3H8UA 4GWIA 4XJ9A 3SH3A 1SBDA 4J1WA 1GNZA 2W92A 4Q4V2 2BBAA 3V0BA 2JE9A 4AHWA 1O3RA 2RDRA 5AC91 1MVEA 1W2TA 4UF0A 5C5UA 4BJ0A 5HCAA 4CCJA 3TYJA 1ULDA 3VLBB 4IGPA 1VJ2A 1QWRA 1JUIA 1R093 1BMV1 5GLWA 4UF0B 1W6MB 4Q1PA 2GNTA 4HONA 5FYVA 2C24A 4HSJA 3LOBA 1LGNA 2MHFA 4BM8A 5HV0A 1W6MA 1NAEA 4QKBA 3E5QA 4S2DA 3SKVA 1X8MA 3VD5A 1NCQA 4M3CA 4FTSA 1MS5A 3MUZ1 3ZXAC 1AR62 3HNBM 4F7ZA 2NPIA 2HWC1 5JSPA 4XW3A 5C3PA 2HBUA 3VZLA 4UW3A 1PO11 3AB0A 3KGZA 2GNDA 4NHLA 4KG8A 2ZPXA 4L99A 1GUIA 4QQPA 3ES1A 2XQRA 2IVIB 2JG9C 2XL7A 2QQPA 1IQAA 1O7FA 1GFF2 1ZYBA 2AEZA 3KV5A 5FZOA 4AFCA 1SLAA 3H3LA 1HB3A 3IWZA 3ZN6A 1QOOA 3MEPA 3SCGA 3CIHA 3EMRA 3WW3A 5A6ZA 4MGZE 3WF4A 1P8JA 2Q4SA 3FUQA 3AL6A 2CY6A 2QKDA 4LKSA 5LRRA 3JUUA 5A6YA 1G7YA 2BP6A 2R061 3E97A 5FMOL 4AYUA 2RV9A 5LATA 3VZKA 1RMU2 2PYTA 1UZWA 5FZKA 1ZBE2 4BU2A 4WZCA 1EPWA 4UFJA 4GZ9A 3NJYA 2V09A 1G86A 3AYAA 5FZEA 3DPRC 1SLIA 2IXKA 1ZZBA 2W3JA 3MF9A 3VBRC 5DAQA 3SMHA 2C5DA 1HXS3 3J7NA 2X05A 1XPWA 4NRQA 1CX1A 1LHVA 1RUE1 4L92A 3NKTA 4DUXA 3ZXGA 2HWB2 1CAUB 1AVBA 3OJBA 4GH4C 4HBNA 4P5HA 1I3HA 2HWF2 4QWNA 1ULFA 1W99A 4XOGA 5C8CB 2A6ZA 4XFCA 4TYSA 5IHRA 2PLV3 5LY1A 4INDA 1LULA 1UYYA 2DTYA 2VJXA 1FXZA 5IAXA 4NWWA 1XRUA 4E2SA 1O8PA 1STMA 2ZACA 3EQEA 4K1YA 3UJQA 4OMCA 3K4DA 3SLIA 5GZCA 3AP6A 1TME1 3OF1A 3RZHA 2C6SA 3WDWA 3FZ3A 3SXWA 1QU0A 1DQ6A 2W1SA 2WS91 3IZOA 3N7MA 2FDGA 4QM8A 4CEWC 2JG8B 4LXLA 3SH5A 4NHXA 3JBG1 1FNYA 1MQTB 3P1IA 4XIKA 5FZ8A 4CVUA 4EWAA 5F7UA 1QJY2 4H14A 1IS6A 1JI6A 4B1MA 4QX5A 3Q9OA 5A7PA 1RINA 2JG8A 4AI2A 5FWEA 1MQTA 3M3QA 3PUSA 4U2AA 1L3JA 4EN0A 1DYPA 2F4PA 4FXGB 4NHMA 5KHJA 5KXCA 4NMIA 4LBNA 3OG2A 5C8WA 4CPBD 2CU5A 2HWF3 1YQ2A 1C8M1 3N9QA 3OGJA 4Y1ZA 2DVDA 4MXVA 2CAVA 4R9CA 5I0UA 2RM21 5F3GA 2VW2A 2VVEA 3H7JA 1RJ8A 3PTRB 1WLCA 1C5HA 1ZBE1 4UFKA 4XHXA 3Q8BA 1FMD3 1CJPA 2WR9A 3CL1A 4K6BA 4XABA 4A7ZA 4EJRA 2VTXA 3HAGA 1CVNA 4K40A 4LO4B 2O0OA 4WZFA 4KGGA 3NQHA 2FCUA 4EYUA 1UAIA 2VOKA 3AKPA 1G9FA 2LUWA 3AKSA 3ILFA 1WCDJ 1W04A 4JC1A 3LSDA 1QJU3 3I2KA 4NO4A 3VBOB 3AMQA 4J25A 4TN7A 3WNLA 2NYYA 4FPJA 2PHWA 1WCKA 2B39A 2D6KA 4XYXA 3U75A 1UY0A 3AP7A 2C26A 3VBOA 4AOCA 5GALA 2CGOA 5FPAA 5IATA 4FPHA 4LT5A 2BVBA 1OXCA 2AGSA 3LEKA 2HBTA 4Q4X1 1ALYA 1J59A 1B35A 1RUH3 1W6PA 4YLZA 2IXHA 1D2QA 2RR13 4MSVA 4HMZA 3RJ2X 4BQXA 3OYWA 1NCQC 1IPSA 1B35B 1PZ7A 1YI9A 3MBWA 5IK5A 4N9HA 3DEMA 4QQLA 5T54A 2NP0A 2XXZA 4AXOA 2W1QA 3DV8A 4N43A 4DO0A 5AVPA 1VLNA 2JE7A 5FP4A 2NMOA 5FYIA 5JXGA 1ZRDA 1JU3A 4LTAA 4I30A 3IDCB 3UKTA 3MFCA 3N7JA 1IPJA 5K0UC 1WKYA 2FMDA 2TUNA 4HSLA 2JD4A 2XKOA 3MUY1 2UWCA 3GJBA 3AYDA 3NJXA 4TXWA 1PZ8A 3V64A 2K46A 3JZVA 3O1PA 1U5ZA 4AGGA 5IK7A 1CPMA 1RUC2 2BTVC 3KLSA 4AK3A 3LIGA 1F2NA 5JR7B 1FOD2 2XHNA 1FAYA 3K4ZA 1EV12 2FCTA 2ZGLA 1JZ4A 1WD4A 5FUIA 5T5LA 5IT6A 4YNIA 1O91A 4B4RA 1ASJ2 2OW4A 4MYEA 4AFMA 4BXSV 2CDPA 5JSRA 1RVF3 1ND3A 2FDJA 3LA2A 1KRIA 1SZBA 1VBC1 4IEYA 3F2ZA 5L9RA 2VZTA 4I09A 3VBRB 1BJQA 4W6XA 4AG4A 1QF3A 2VTXJ 4XAAA 1HQLA 4RYDA 2XJTA 4XFBA 4BXFA 1OH3A 1QJX2 1PX4A 1AX2A 2XHKA 5F5CA 4EZHA 5GLTA 4OHYA 5E8AA 2Y26A 1OVPA 1POV3 3DXTA 2ARBA 4GWJA 3ZYPA 2A3WA 2BOJA 1BK1A 3WQBA 3ECQA 1F31A 2P3IA 2GMPA 4WVMB 2OUJA 2WNVA 3NO8A 2FBEA 4CCLA 4LBLA 2HWE1 4JHTA 2YBPA 4XILA 4AFAA 2WL1A 2WNVB 1CJDA 1I9RA 5FZAA 3JQXA 2NZ9A 4NPLA 1UOBA 3IN9A 4RS5A 5DZGA 4YW4A 4DY5A 4GMP3 4EROA 1Z0HA 3PMEA 5JPMB 4XQ4A 3UYJA 4NIHA 5C9AC 4P14A 1DGRN 4BQ3A 4BLIA 1J3QA 4DINB 3WR0A 5IAVA 3EB7A 1A78A 1DQ1A 4QPYA 5A33B 1C4RA 1Q8QA 1N47A 3FHAA 3CF6E 3L2HA 2LRPA 3VDCA 1H30A 3MW4A 3MV11 3IAQA 2XLFA 2D6PA 2E9QA 5A3OA 2Q8CA 3PUQA 2HEVF 3OOXA 3T2QA 3JU9A 1CAXB 2VNRA 3QD6A 2ES3A 3WVJA 4A45A 5IVCA 1QMJA 1HRI1 2WN2A 3FHIB 1NOVA 4OMDA 4W6YA 3ALQA 3I59A 4QX8A 3CJIC 2Y0IA 3TN93 1HQWA 1JHNA 1UF2C 2XKPA 1CR7A 3KCCA 3POSA 5FZ7A 5HXVA 4QPIC 5L9VA 3CNAA 4PDWC 3WNKA 1Q8SA 3WF2A 5FKBA 1W8ZA 3SEEA 3C7FA 2WINB 1J1LA 1K5JA 2FDIA 1J84A 1QHDA 3D3AA 4KQ7A 4KU7A 4UYBA 3I2DA 3UJOA 3WNMA 4PLNA 4LKFA 5IUQA 3R4SA 3UV9A 4LMFA 3O0WA 1VB2A 1VBB3 4OI2A 2ZAHA 2RS53 1LODA 4XQWA 4OYUA 1H4HA 3UETA 3BGAA 2D40A 2WFF3 5CFDA 4FOVA 5LZ6A 3TEYA 4Q4V1 2A3XA 1PGL1 1ULGA 2CWMA 1GOGA 1RTVA 1RUD3 2HYKA 3JD71 5LBFA 1CD3G 2Q1FA 3AVSA 2JIGA 3CO2A 4ATFA 3O7OA 4Q4X3 1VRH3 1WMFA 1KITA 1FPN2 1MS3A 1V6JA 4LBJA 2BGPA 3SHRA 5FQ0B 1S0DA 1F4HA 2CYFA 4CA9A 4NVPA 2GP5A 2ZGOA 5F6KA 1JYXA 1BBT2 1NCQB 2WA3A 2K0GA 5FQ0A 1K5MA 2J1RA 4FP3A 4MUVA 5C8CC 4WM7B 2B9UA 3MO4A 2RM22 2X29A 2XH6A 3I2FA 3EJKA 3PIGA 1JYTA 1CZSA 3ZVXA 2V5YA 5A1FA 5C4WC 5A6QA 4WM7A 2G9FA 4M3CF 5FR3A 3PTYA 1XNCA 2BOIA 4M3CB 2JDKA 1AYM3 2Q8OA 3GZEA 4B1LA 2BZDA 3WINE 2OS2A 2GH8A 1QXJA 3J7HA 3QOPA 5J37A 4K9SA 2VAUA 3WDYA 4HK8A 4FFIA 1X8EA 2YV8A 1NA1B 4QPIA 2XGXA 4WM8B 3WX5A 4Z2WA 1KDKA 4KWUA 4MGYE 3BIEA 4QX7A 3B93A 5FZOB 1GANA 4IE5A 4GULA 3MIDA 1RUH2 4WM8A 5FZ6A 1VALA 3PU8A 4IXLA 5DMYA 5DZFA 1S2EA 1XU1A 2ZX3A 3I3MA 5AFEA 2WLPA 1AR71 3RZMA 1ONAA 1MZFA 2O8QA 1HRV3 1RUG2 3G7DA 5B4XA 1RHI3 3IIAA 3ZYHA 5CAZA 3LAGA 1SLCA 5J48A 3HOBA 1QJU2 2ENRA 2VQUA 5JOWA 3T4VA 1UIKA 3WDXA 2BQPA 1V9U2 3LSEA 1KJLA 1UU5A 4CDWC 2JB4A 1UOGA 1CAUA 3N9LA 2D6NA 3MGUA 1VMFA 1RHI1 3AJZA 3X29B 4DOUA 4OUEA 4RQPC 4DUWA 1UY2A 2NMNA 2HWB1 1JS9A 2PQSA 4RN5A 2BJSA 2AYHA 4FPOB 2X09A 4N7UA 4Q27A 1JN2P 3RZJA 1KJRA 3RRDA 1FI2A 4LA2A 2VMHA 3I3DA 4YW6A 2AACA 4J1XA 3MW2A 2IVJA 1GZ9A 1Z7S3 2WABA 4YVWB 2ZX1A 5JDBA 5AVAA 3ZDSA 1WMDA 1G9DA 1RUH1 3I2HA 2BVVA 1VBA2 1WWYA 4YGBA 4BZ4A 5KXBA 3E1F1 4ONUA 5FZBA 4D7YA 2VECA 1MACA 1W6NB 1XE7A 4ORFA 3WD5A 4YZ4A 3ZFGA 1JZ5A 2VR4A 1YIPA 2OT7A 4LJHA 1O3TA 1DGRA 2VCCA 3KMHA 1W6NA 1DGWA 3WOGA 5ISLA 2J7MA 3QACA 4Y20B 1H9WA 1VIWB 4PBOA 2CSGA 4QDRA 5CYYA 3VDDB 1JZ2A 1MEC3 4Y5SA 4MGTA 3FL7A 3POYA 4P9YA 1UYXA 1A34A 2XBO2 1NX9A 3PURA 3B5LB 3ZO0B 1LU1A 4ASMB 2Y6FA 2BNMA 4CTEA 4C91A 4BB3A 2EIGA 3RSJA 5F5AA 1TMF1 1VMHA 4IV3A 4H2AA 2OXBA 4E8CA 3U14A 4KI5M 1AR73 3AZYA 2R062 1OLME 4L97A 4LBQB 2RDNA 5FZ1A 2DCKA 4XTPA 1N1SA 3VL9A 2VUDA 4JAAA 3BALA 3P6BA 2FD8A 4EWEA 1H8VA 4TSVA 3TN91 1EY2A 4W6WA 3FWEA 2ILMA 2GNBA 3POJA 4CCKA 3WF0A 5FP7A 1LJ7A 4X6RB 4G4FA 3C7EA 4FOWA 1XYPA 1AL23 3JQWA 3NNJA 4M4PA 4BH9A 5JZGC 2DVAA 1W05A 4DXTA 2V72A 5IVJA 1GP6A 1XOYA 2F17A 1UY1A 4DXZA 3P3PA 4IDZA 1CONA 1XU2A 1NCRB 3HIFA 3ZFFC 5HPOA 5C4WA 1UPSA 1X36A 3ILRA 1OMIA 2QZ3A 3DYPA 4A3XA 3R4DB 2JDHA 4AEDA 1XNAA 5JI7A 3RI9A 1BXHA 3CQOA 1URXA 4JDMA 1BVP1 2AENA 5C4WB 1JH5A 5GLVA 2BU9A 2PHUA 3PL0A 2XJRA 3Q8EA 2AREA 1KDMA 3C7OA 2JDPA 3R0RA 3L2YA 1RUJ3 4HZFA 5C7GA 3M3IA 1RUOA 5BNQA 2A6VA 2QQWA 1LEDA 4PIYA 3WP4A 5T5OA 1QJFA 3PIJA 4LK7A 5FZ0A 3WP6A 4N90A 3C3VA 3DKQA 4AEDC 1TVGA 4ASLA 1Y9GA 2E7TA 2Y64A 3D8CA 4CUCA 3W5NA 2J22A 4OI0A 4PT6A 4CP2A 1WW6A 4BCUA 2VZSA 2WIIB 1N1VA 3ZLIA 2V4VA 1W2OA 1OURA 1W8HA 1JYNA 3N36A 3ZR5A 1LOCA 4ISQA 5FP8A 3HPNA 1UOJA 1XE0A 1HDKA 2GC0A 4YFWA 4LE4A 4F8AA 3OPTA 1T6BX 4LO7A 2JB8A 5A1LA 1EPZA 3V0AB 1O8SA 2P3JA 3H1MA 1V6OA 4FO9A 3RYRA 1LENA 4OQ8A 1MPXA 1N1YA 2ZXQA 5GLZA 2Z79A 4Y33A 4IQPA 4OHVA 2D3PA 3JB8A 4UWDA 2WNEA 5EJZB 2A5ZA 4DFSA 2D43A 3ZSLA 1EUTA 4O65A 2VZPA 5F2WA 4QGLA 4IEWA 1O4YA 5J3UA 4KGQA 1SPPB 3NMBA 3PJQA 5CADA 3VB9A 4D6RA 4YVWC 1N1TA 1HJFA 5JIAA 4CDUB 4QQHA 2RR11 4YG0A 1YWKA 2BWCA 3OUIA 4A3ZA 1APNA 1VBA3 5FZIA 1YJLA 4NHYA 3ZFGC 1C5IA 4NRMA 2SBAA 1B09A 1XJAA 2WAAA 2WUHA 2Y60A 4P08A 4PLOA 4ARYA 3T0DA 2DU0A 2J1TA 4KG0A 2JG9A 4ZXKA 3PVBB 1GV9A 2WQZC 2YG0A 4R9AA 2OPWA 4KWKA 3HMYA 1MEC1 1NQJA 2OA2A 4NOTA 1R083 3ZSKA 2VZRA 3GYDA 1V70A 2XVKA 3AXDA 1Y9MA 5C70A 1RUC1 3MYXA 1Q8OA 2G9ZA 2XVGA 3FJSA 2BDRA 5FZDA 2Y38A 2VE1A 3HBZA 3BODA 3T2TA 2HYXA 1DBNA 1PVC3 1UZZA 4Q2FA 3T08A 2JKBA 1N3QA 2Q5TA 2WO2A 1CWPA 2DUOA 1O5UA 2EF6A 2VZQA 1V00A 3VDDC 4A41A 3HNYM 4CXWA 3H8XA 3Q8FA 3ME2A 1WCSA 4MHRA 1GOFA 1YQ8A 1DLLA 1E5RA 3RWKX 4I0BA 2W2IA 3RI8A 3W9AA 3OBTA 3J9SA 1ZBA3 4CDWB 3KVBA 5FTTC 4GWNA 1C1LA 5KC6A 3KWVA 1OPOA 2WSUA 1UQXA 4M3CE 2Z2SB 4S2HA 5DXDA 4AVBA 4IV1A 3LDKA 5CFCA 2RS32 4OVEA 1GR3A 1YIFA 1GLHA 2R0HA 3V65A 5J1XA 2ZOEB 4QPGC 2ORZA 2A6XA 4I02A 5BNOC 1U5XA 2XMLA 1XSQA 5JOXA 2P2KA 4A7KA 5E88A 3T3YA 5FYHA 5HCBA 3U37A 1D4M3 3LEMA 1AYM2 1UZVA 2Y6LA 3ZYGA 2R6QA 2IWGB 1VB4A 1F35A 4L8QA 3TWIA 1AR81 4COZA 1CIYA 2X5IB 5GM0A 5EIYB 4YW3A 1W6PB 1OLRA 4AHYA 1DDLA 4QPGA 1K3IA 4IEZA 5JVVA 3KV4A 4GIQA 5FPLA 5BYNA 1NCRA 4JKMA 3B01A 1IHMA 1JXNA 2YBKA 3DYMA 4FFHA 1W0PA 4BE3A 1F5JA 3NWKA 4P5YA 5FK7A 4AZZA 1MQTC 5D8AC 1DLCA 1T2XA 1AYM1 5HBAA 4LBQD 2HLEA 5C3OA 2ZZQA 4BQ5A 3GALA 5A3MA 3GZAA 1PO13 5KWRA 5LW9A 4RSUA 4OI1A 4BWOA 2BRTA 2K2SA 5LCWL 1QJY1 2R7EB 3KT4A 3M3CA 2GU9A 1A8DA 4N43C 5JUVA 2Z69A 3S30A 2PN5A 2DFCA 2GAUA 1L7RA 3BTXA 5FY5A 3PUIA 2PHFA 1OD3A 4NPRA 3MW3A 4CE8A 5JWPA 2LS6A 1EV13 4D6QA 1AJOA 3EXUA 1NZIA 4LULA 4PF5A 4AR2A 5I93A 2QQIA 4QQ2A 4XF3A 4AQSA 2VXJA 1W8UA 1RUC3 5EYYA 2IZWA 3SEPA 3J7MA 4X8PA 5E89A 4QKDA 1COV3 4M0HA 5T55A 2ZGTA 1J1TA 1POV1 2EIBA 3POWA 3DYOA 1GICA 4P9JA 2D97A 1G9BA 4XFIA 5FLJA 5EXOA 4E4ZA 3H42B 4LLFA 4RGGA 1K12A 5F5QA 4COVA 5B4NA 3ZDVA 1H2NA 1VBC3 5LBCA 4P00B 5A1AA 2VMCA 3W58A 4Z8BA 3AVRA 4BIFA 4QPWA 1D0HA 2DURA 2YY1A 3VV1A 3AMNA 5FY9A 3JB4C 1S2BA 5BNPB 2P5BA 3ZXLA 4DEVA 5DUXA 1S0IA 4J6GA 4JKKA 3ZKYA 5FUNA 3ZXFA 4LO5B 5BNPA 3IPVA 3E6BA 4MLOA 5LB6A 1FYUA 4GKXA 2JD9A 1A8MA 2HWD3 2ZGPA 3CZJA 2XOMA 3D82A 2GH2A 2JX9A 3N3HA 4P9LA 2PHLA 1QOTA 4CUBA 5K0UB 4GD4A 1RUF3 4NWVA 1PVC1 3IDAA 2R041 1TZOA 1S2KA 2D5HA 1H2LA 2EAKA 3WP5A 2Y6JA 3K51A 3OTFA 2ZZJA 2KA3A 2HWC3 4JGYA 4LBOA 2WKKA 3B00A 3O1RA 1NE4A 2VOXA 3VDDA 4XFAA 2FDHA 4AEJA 1H0BA 2YDEA 4COWA 4CDQA 5GZGA 4CP0A 1ND3C 1D2SA 1DF0A 1J83A 5CKQA 2OZ6A 3GZTB 2W1WA 5D21A 5A7WB 3VBUA 2EIEA 1VBE1 3PJYA 4XXPA 4CP9B 3PU3A 4D0QA 4TZDA 3HWJA 3MIEA 4JGYC 4AVCA 3B3QE 3I59B 4CPBA 5EPAA 1JOPA 4CP9A 1O6UA 4LHLA 4QDSA 1MR5A 4AF9A 5IVEA 3ZXJA 5K7PA 3ETPA 5CFCC 4HK9A 2VOWA 1TNRA 2FHRA 4LBQA 4FCAA 5A3LA 2CHHA 3VBUC 3JD72 1FNZA 3NVCA 5LK7B 5FYUA 3I3BA 1F8VA 4C8DA 2A73B 2QQNA 3NW4A 1SFPA 1AJKA 4EZ4A 2WZR2 4AFDA 3VN4A 2WZR1 1WCUA 5H9SA 4M4RA 1EUUA 4IEQA 1WA6X 3ZN4A 3NSTA 5HI0A 5I0SA 5FJKA 2BFUL 1H4GA 3VBFB 3O1MA 1GZCA 4IESA 5L19A 1ZM1A 2DYCA 3CBNA 2ZEWA 4IERA 1AXZA 4QDQA 1ZVFA 2X10A 3USSA 3O0VA 3PUAA 5KR7A 2OQ7A 5CG8A 5EP9A 4XUQA 3P5BA 3PHMA 5I0DA 1ODNA 1QIQA 5AC93 4YWAA 1VBE2 1SBEA 4LBKA 1SG3A 1C57A 4LKEA 4XIOA 5LBEA 1RXGA 4XDPA 2CV6A 3WEZA 5JSOA 1ZZ8A 4BMBA 2WS93 3I3QA 3EO6A 4N43B 1HB4A 3EHKA 3GHNA 3U1XA 3I2IA 2PFWA 4KWJA 2JJ6A 3A7QA 4W4ZA 4Q4Y1 2GC1A 3T0BA 3BVCA 1LNSA 1OHFA 1PVC2 1ZZCA 2DFBA 2KXLA 2YU1A 3J4UH 3B9CA 4ZONA 4XCAA 4DNYA 1M4WA 1QOSA 4FPFA 5C6CA 5A3NA 1SBFA 1GSLA 4QPIB 1DP0A 4DRVA 3T0AA 3AXEA 2WZEA 4XEZA 5C9AB 1T6GC 1BEV2 1WGPA 3ZSEA 2ARAA 5JMOA 4GAZA 2ZHMA 5T3NA 2C9AA 4K8FA 2CNAA 1VR3A 4UI9L 4NIAA 3I2GA 3B69A 5FYZA 1G9CA 2VBPA 4W65A 3VKLA 4I0AA 4DRRA 5DAWA 2QQOA 3LFIA 3SISA 3HQRA 3BU7A 3R05A 1VBE3 1NLSA 1S0CA 1QKQA 3TEXA 4YM2A 1YFXA 5DABA 4JV4A 4NHKA 2W52A 3IT8A 1UIJA 1SLTA 1WLWA 1QJU1 3BU0A 3APBA 4BLJA 5FYMA 1LHWA 3VBHB 2Q8DA 1UU4A 4LOSA 4YRDA 1KGYA 2V73A 2VBDA 1IS3A 5C8CA 1VBA1 2KR2A 2WZ8A 1HIXA 3HN3A 4B8EA 4KU8A 4C0HA 3CJIB 4KBZA 3ACLA 5KHIA 4C1WA 2D44A 5D8AB 2XUEA 5JIUA 5LA9A 5F32A 1AR83 3CJIA 3H0OA 1ZREA 1Y3TA 3SKJE 1UOFA 4YSFA 2VUCA 2YGMA 2E32A 3THCA 4DY3A 5L7OC 1RMU3 3N7KA 3ELNA 3QBQA 5IFPA 5JOYA 1COV2 4BOWA 1PK6C 4RS5B 1RIRA 3KCYA 4BQ2A 4RR3C 1OFNA 4JDNA 1R64A 1W39A 3ZFEC 1MZ5A 1SCSA 2R30A 4AI3A 2HWF1 2VULA 4QX1A 1LHUA 1O3SA 2W39A 2YXSA 2TBVA 3LOIA 3GHMA 1QGLA 4WBBA 1F9KA 1GU3A 2HJIA 1U5IA 1WCQA 4YM0A 4YZ1A 4OCTA 3WNXA 3POEA 4E8DA 1AZDA 1Q56A 5CFDC 2WQ8A 4HOOA 5CU1A 4TTGA 3I49A 3ZKUA 1CAXA 1IKPA 4LPLA 5A32B 1I1EA 4XJUA 1IZ3A 3D4KA 1XSRA 4CDWA 4OHXA 4GA9A 4HKLA 1YQ6A 4JGZB 2XDVA 1AX0A 3MIBA 2ARXA 3MPBA 4QXKA 1YEWA 1OKQA 2JDZA 1X9TA 5CFCB 4ITCA 2WT1A 1K5MC 1W8TA 3A0KA 5DG1A 2ZEXA 1PO23 4JRLA 5KHKA 2GMMA 3QH7A 2RM23 4I3PA 4P9XA 5F1RA 4IEPA 1OF3A 4XAEA 1RUE3 2WDBA 2QQLA 1YC61 2DVGA 1WBFA 2VC9A 4FOQA 4V2VA 4ZZ5A 2RS31 5J96B 2C4XA 1OC1A 1AR61 3VHRA 2WFF1 3K46A 4OZOA 1IPKA 1SDWA 1NA1C 1Q3EA 3I8TA 3LDBA 4JGZC 4WVZA 3FBMA 3H50A 3BTAA 1V6IA 3M70A 5SV5A 3UL2A 1CIWA 1RUNA 5FBZA 1KD7A 5FYYA 1AYN3 5T52A 3AZWA 4ZY9A 2HWB3 3RS6A 4XBLA 2VMEA 3BPZA 5J09A 5CZKA 1RUJ1 1FPN1 2BWAA 2PAMA 3VZMA 1SLLA 3FLRA 3J26N 1W8OA 5JLVA 3FE5A 3DPRB 4H7LA 1AUYA 2VZ1A 4Y22A 2AR6A 2HWD1 3WF1A 1E57A 2XJQA 3KQRA 4MZUA 5F2SA 1JYWA 3D0SA 3GM8A 3AKTA 3LGRA 3A0NA 2ARCA 2VQAA 1CX4A 1DIWA 2R49A 3IB3A 3AMMA 3DGTA 3O0XA 5DAPA 4OI4A 1D4VB 4XJWA 3R6SA 4MVTA 4GH4B 5HXMA 4AWDA 1MEC2 3LFMA 5FY1A 4JVAA 1W9FA 3AL5A 5APAA 3KT7A 5L7OA 3MPPG 4QX3A 5CKMA 2RVAA 4CDXC 2DU1A 1AL22 1W6OB 4FPLA 3QCWA 4QU2A 2DWRA 3M3OA 4Z1VA 3AP4A 2RR12 4QKNA 4O9GA 4XACA 3C7HA 4QB1A 2DF7A 1OQEA 1U5YA 2ZMNA 3CDZB 4HPKA 4I0WB 3TRSB 2WRAA 2RDQA 4IGOA 2FZ1A 2JICA 2ADEA 4QM9A 3J8F3 1HRI2 3NNFA 1E5HA 3I4IA 1ND3B 4NR1A 3J8F2 2BGOA 1KQRA 2WAOA 5FZGA 1GZTA 4Q4W3 1RUF2 1LGCA 5DN2A 3U10A 5CB7A 3WCSA 4AGVA 4A4AA 4XF0A 2D6MA 4Q26A 4QT6A 5A7NA 3H8RA 3LF7A 4Q5OA 2MEV1 1KS5A 3HD8B 4OLLA 2JENA 2QDNA 5EHDA 1UNBA 5FMDA 4GB31 3MDPA 3VDAA 3WUDA 5JOZA 3MZHA 2TEPA 4Q4V3 5FIXA 2QQUA 3CJXA 1S0GA 3GBWA 5EZWA 1RUD2 5KBFA 3ETQA 1GZWB 1HN1A 5LBBA 2R043 3NAPC 4BISA 1UW8A 2QQVA 4S2FA 1QQP1 2HWE2 5FP9A 4UW6A 5HV4A 1PK6B 1WW5A 4YVWA 4E2GA 1DGWX 1SMVA 1YRZA 1RC6A 4BQWA 2XJUA 1LHOA 4Q0QA 2VNGA 2XB6C 2ZJCA 3ZFEB 2B5HA 3I2OA 5I91A 5K4LA 3MLLA 2RMU3 5A33A 3UESA 4SLIA 4CCEA 2YZ4A 4LQRA 4HVOA 5FZ3A 2HEYF 1KFUL 4CDQB 1S4CA 1QJX1 4XUTA 2XPJA 2VVDA 4Y4RA 4R9BA 4XURA 3OEBA 4CEWA 2WT2A 1ENXA 4OHZA 4HN1A 3TEZA 3ABZA 3ACIA 3ZSMA 4DS0A 1BEV3 2WNUC 4XDOA 4XFGA 4Y20A 2G9GA 2PXJA 3RMYA 2CGPA 1OI6A 4XCBA 2ZGKA 2E7AA 1OLQA 1RUI1 2Y6GA 4QHZA 5LK5A 1CAVB 2WYSA 4AQ2A 5LEKA 4Q1RA 3MF6A 4FT8A 3W59A 3MIGA 4UXAA 1W8FA 3I54A 1RYYA 2RG4A 5E16A 1PO22 4AI0A 3MIHA 4QMAA 5FLIA 3U0ZA 1BCXA 4MGKE 1LKNA 5JAXA 1VPHA 3C2UA 4L9BA 5FLHA 1FMD2 4XDQA 4I01A 4YG3A 5FZHA 5J98B 1W8NA 2YROA 1JZ3A 3WQ1A 1TMF3 3N35A 3OGGA 3THPA 3HT1A 4K7JA 1Q43A 3OEAA 1QH6A 5JMCA 3WNOA 2FCVA 2W94A 4CZSA 2IFWA 4IV1C 2RS33 3ZXEA 2D93A 1HXS2 2WO3A 3AC0A 4R52A 3TOJA 2ZS6B 4YARA 3WUCA 1S0EA 1UZYA 1PGW1 2RS52 4FFFA 4TLFA 3ATGA 3VBOC 1VBB2 4DPNA 3KF5A 1LRHA 5SV8A 2EIDA 1K45A 4Q4W1 4EE2A 5DZEA 1H2MA 4LKDA 4DEQA 5FOBB 1D4M2 4FI9A 1MS9A 3DXUA 1C8M2 1AR82 1BQPA 4Y3OA 2B46X 3OGRA 5KHHA 2WBKA 5BNNB 3RGBA 4O61A 4AVVA 1JW6A 1W2UA 1Z7S2 3I2JA 2QBXA 2Y6HA 3IMMA 1Q5OA 3KZ4C 5L73A 3WQ7A 5IVFA 3VL8A 1JZ8A 1R1ZA 2BERA 3DPRA 2P6HA 5FMOS 1Y7BA 4HKOA 1Q8PA 5EJ3A 4PDWA 1I6XA 4D7SA 4E2QA 3KV9A 5GJ6A 1GMMA 1OFSA 2R32A 4XUPA 4XZUG 1YO8A 3HQXA 4NIIA 4LOTA 4AHZA 2WA4A 2DCZA 4IEXA 3VGIA 1Z7S1 3UNPA 1DYOA 1KS4A 5EV7A 1ZA7A 4XFFA 2UYBA 4B7KA 4G3YC 1R082 4QGMA 1AL0G 2ZX0A 4LR4A 3Q8AA 1H2KA 4NJ4A 1PMIA 2PA7A 4CU8A 5GZDA 4E4HA 5F3CA 1RXFA 1W3VA 5EFUA 3PMSA 5FMBA 2DV9A 2XONA 3H1WA 3PVNA 5E1RA 3VBFC 1LR5A 1OA4A 3ZOIA 3VDBA 2E26A 3ZN6B 1PGW2 1OOPA 2DBIA 3GCXA 1WW7A 4LHKA 1DFQA 2JECA 3T1LA 2WT0A 5A80A 1OVSA 3WG3A 3ASIA 4K8RB 3VBHC 4AHXA 4K21A 1LECA 4CP1A 1JU4A 1PVXA 3E6DA 4HXCA 3ILNA 2YPDA 3T1MA 5CEHA 3DKWA 4LE3A 3BCWA 1RUE2 1ENSA 2NM1A 2QQKA 3VD4A 1W2AX 4N53C 3WQ0A 1R1A3 2YC2A 4FPKA 2FDFA 1COV1 1CESA 1ZBA1 3JBG2 4C0BA 3VBHA 4D8MA 3FFZA 4JQTA 3VBRA 5JPNB 1BZWA 1GNHA 2VVFA 2WS92 4Y1UA 2Q30A 4YVSB 4XC9A 2Z4FA 1RUI2 4ATEA 1LOGA 3IDBB 5DPNA 3ZIWA 5D8AA 2WO7A 1LTEA 3RMXA 2J1VA 3PUHA 1LB2A 2VD7A 4FVVA 1NUKA 2HWE3 3IPVB 1PM7A 4HG6B 1C8NA 2ZGRA 5ANNA 2VG9A 1ULEA 3SC7X 3E6CC 5FO9B 2KM2A 3GDBA 2ZCWA 4P9GA 4JTNA 1QY4A 4CCOA 4GMP1 1X9PA 2VY0A 4LORA 1KFXL 4HLTA 3W21A 4EN8B 3ZR6A 3RFRA 2A1XA 3WLUA 1OSGA 1IGOA 1XQNA 5BV6A 1QQP2 1RUI3 1JMUB 2A6YA 4XUOA 4XJAA 4I2OA 1KXGA 1OOPC 2BPA2 1QXPA 1WMXA 2WNVC 2XQXA 4Q4Y3 1F4AA 2PTMA 1VAKA 3TEWA 3U07A 3THTA 4YM3A 4ASKA 2VMFA 2SLIA 4BIOA 4RQPA 3DF0A 4FPEA 1PM4A 3KM5A 4NE9A 4SBVA 1JZ7A 5JR2A 5A70A 4KH9A 2ZEYA 1EP0A 2VOTA 3HVDA 2QDRA 1FOD1 1TE1B 4H7MA 4IEOA 1ZRRA 4XFHA 2P37A 2IUWA 3FMGA 4P9WA 5FYSA 4BK5A 5F5IA 3OPZA 1CN1A 3H3UA 4FOYA 4XJ8A 4YW1A 4BQ4A 1OUXA 4Y4YA 4H3WA 5AC92 1JHJA 2ZMKA 4Y5TA 2BW8A 1PGL2 2B45X 4Q0PA 1IG0A 2E31A 4C90A 1VMJA 1YFUA 4ES8A 1TEIA 2VZOA 4JTOA 3N4MA 1UL9A 1UKGA 4GQ7A 2ZHNA 4QX2A 1JOJA 3E5UA 3LEGA 4COUA 1JUHA 4Z07A 1PO12 4IV1B 2W46A 2YMZA 2VMDA 2HWC2 2VXRA 3MICA 3OBZA 3M4FA 3ZYFA 5FDBA 4I3GA 4XVHA 2CDOA 3POFA 4OUMA 1VBD2 2JKXA 3M7AA 2ZKNA 5JCTA 3IMNA 5ABJA 1W6QA 2OYZA 4N7IA 1WMEA 1VAVA 1BYHA 2OPKA 3CEWA 3LIHA 1UMIA 3RWNA 5K8SA 2XBO3 1JZ6A 2VZUA 4AFBA 1B35C 1FATA 5DUUA 4XUNA 5FREA 2WZPP 3S5QA 1X7NA 2ZTNA 1VE0A 4A42A 5HCHA 1UU6A 3WV6A 1EAH3 2P6CA 1MS1A 1UWWA 3KQ4B 3VKOA 2EVXA 3AP5A 1LOFC 3GJAA 4WVVA 5LY2A 4YPJA 4AEDB 5ACA1 3S57A 3KSCA 2OX0A 3B94A 2HWD2 3AZVA 1OBNA 1YNAA 4L11A 1K5MB 3CU7A 1ND2B 1UX7A 2ZGSA 4BMEA 2Y33A 1GP4A 3AMPA 1PMHX 3IKWA 3VUOA 3I97A 4F3JA 2XJSA 4HL0A 5B2GB 3TBDA 3K3OA
chains in the Genus database with same CATH topology
4PBPA 1FV3A 2RMU1 4ISRA 4AEMA 4ZU4A 4BQ1A 2QUOA 1H8TA 4GH4A 2H0BA 2R16A 3JCIA 5FRAA 2P34A 5CBLA 4AQ6A 4IEVA 2RS11 4CDQC 4YM1A 1YJKA 2Q0AA 4N53A 4E9KA 4EV0A 3AJYA 3U4XA 2XJPA 4NN0A 4RHV3 3S6PA 1IS5A 2D6LX 2X8KA 4N53B 4FTBA 4DQAA 4CYDA 3VZOA 4R4ZA 1UCXA 2XWBB 4XZPA 2CWSA 1AR92 5DUWA 1ZRCA 1IS4A 1YCIA 4XETA 2PHTA 2A6WA 2XJVA 3WW2A 3S0MA 3FBYA 5BNNC 2PELA 3M3EA 1QDCA 4K3UA 1CAWB 4ZU7A 4Y1YA 4YGDA 1H9PA 4PLMA 4CDUA 1UD1A 3NL1A 1DZRA 1ZBA2 1G6NA 1EAH1 2RE9A 1DQ5A 3ROUA 1GYKA 1GZWA 5ABJC 1RHI2 1J3RA 3MLJA 3NV2A 4YGCA 4HN0A 1GKBA 2GNMA 1RL3A 1SEFA 1NXMA 1AXKA 2B8MA 4IEUA 4LUKA 1XNDA 1R1A2 2ZKLA 4HANA 2GC3A 3ZPYA 2Q1MA 3OD0A 2D5FA 4M00A 4Q8KA 1D0GA 4A2UA 4C1XA 3VHPA 1Z78A 4RR3A 3PNAA 3GBFA 1NY71 4BA6A 4Y5Z0 1VRH2 1ZZ9A 2VMGA 1YHFA 2GN3A 2DCTA 1NG0A 5KXDA 4B7EA 2BGCA 2BNNA 3B02A 2XWJB 4L2NA 2O1QA 4OULA 3AKRA 4JCKA 1RB8G 5IK8A 4B4PA 1G9AA 5DDJ3 1ZBE3 4S2GA 1HRV1 3ST7A 1MS4A 4Y26A 1BBT3 1N3OA 2DUQA 2H0VA 1YUDA 2E53A 1LOAA 2RS13 3I7DA 1VBD3 3BIWE 3K48A 3ENRA 4GKYA 4MH0E 1BBT1 3UK9A 4BHPA 1LHNA 1W6QB 1HX6A 5AFBA 2WQ4A 3WDUA 3LB9A 3NV4A 2VGDA 1QNYA 2XL9A 4FPYA 1R091 3MLKA 1SCRA 4IV3C 2PLV1 3HN1A 3AFKA 3URFA 3AX4A 1J58A 4WVWA 2FZ2A 1LESA 2GZWA 2N7GA 5CA6A 1HRV2 1RUG3 4YFZA 2ZMLA 2DCJA 2CAUA 1NZCA 3ZX7A 1LOEA 2VNOA 4PCRA 4XBNA 2EAAA 2OVUA 3AKQA 1O4ZA 2B7YA 2IXLA 3RDIA 1RJ7A 5L7OB 3DN7A 2DUPA 2AZ5A 3FLTA 5BY5A 3LZZA 5L36A 3SH4A 2ZGUA 2QCSB 3FFQA 4AVSA 4MXWA 3KB5A 2NQYA 1OOPB 3HT2A 4XF1A 5GLUA 5H9RA 2GDFA 3SNMA 3VBSC 3ZIXA 4EN9B 1C8M3 1LCLA 2D3SA 4LBMA 1Y9QA 3S7EA 3H9AA 1PIV2 5JI9A 4XHBA 3EBRA 2QZ2A 5FPXA 4X6QB 1YI7A 5TSWA 3V0AA 1G8WA 2D7FA 1J3PA 4MGIE 2VW0A 4YW2A 2I45A 2YC0A 4META 3HR9A 4R8HA 3GF6A 3SCFA 4X8NA 1FT9A 2D6OX 1MZ6A 1RVF1 5T5JA 1HW5A 1AR91 1XE8A 2EXKA 2EXIA 5GKAC 4AVAA 4JQRA 4LO8A 5DG2A 1WW4A 1Q8VA 4LEJA 1DQ0A 1PGSA 1AYN1 4XQDA 3WG1A 3JD73 1AXYA 2R073 4KL1A 2WFPA 2R072 3LA7A 1JYIA 5I0TA 4FPGA 4GMP0 2GALA 3ZFGB 5I8TA 1RVF2 1RITA 4D7TA 4JGYB 2HKXA 2X53S 2G4IA 1NYWA 2C0ZA 2PHRA 2MNGA 1VBC2 2ZAAA 1JBCA 1TQ5A 2VU9A 4LA3A 2RMU2 4XE9A 2P3KA 4P9IA 2FQPA 1BEV1 5H9QA 1V6KA 3E5XA 1POV0 4GB32 2K9ZA 4DB5A 1LEMA 3D6EA 1CAVA 4QD2A 4EWDA 1H1IA 1XXNA 4KNCA 2H6CA 4WV8A 2FMYA 4E4DX 1ASJ3 1PIV1 4DMIA 5KC5A 5LEJA 3KS7A 3H3ZA 4FTEA 4QGNA 1MZEA 2EA7A 3J8F1 3O14A 3ZFFA 1EYBA 4RD7A 4Y1XA 2WZR3 3ZXDA 3ZFFB 4AQTA 4RFT0 3WP3A 4CDXB 4Y1VA 1ZRFA 3RYPA 5DDJ1 3IM0A 1JTZX 1UMZA 1GQGA 1AL21 3WW4A 1IKQA 2JG8C 4CEYA 4CDXA 2F6BA 2OUHA 3NKGA 3OD4A 3AM2A 5CFDB 5ABJB 1FPN3 4XMAA 5ACA3 2EXJA 3KD4A 3IDEA 4R9DA 4Q4X2 3V0BB 3PVEA 2DTWA 1DU3D 1YLLA 4QPGB 1O5LA 4XPVA 2A71A 2I74A 1ZA4A 3NV3A 1LOBA 1ENRA 3BOWA 1R092 1O3QA 1FX5A 2ZGNA 4Y24A 3R4UA 2VQ0A 3TAYA 2WJSA 2ZGQA 3ES4A 3NAPA 1YYNA 4RHV2 1OQ1A 4Y22B 3AYCA 3JBG3 1GBGA 2QNKA 4PJYA 1HKDA 3NAPB 3VZNA 1H1AA 3FC0A 4MV2A 2A7AA 3RJRA 2DVBA 2IXIA 1Y43B 1H8TB 1S55A 2ZHLA 2RHPA 1DHKB 4AEKA 1WUVA 1GQHA 2JEMA 4F83A 2R0FA 2UYAA 1ZZ7A 2ZA9A 4Z92B 4EN6B 1FMD1 4E27A 3OCPA 2AUYA 4HPKB 2R063 2QVSB 1PO21 2IFRA 4AI8A 4ZU5A 4HT1T 2DVFA 1AR93 1HLCA 2ET7A 5J36A 2UY9A 3A4UA 2I07B 2Q1ZB 2ZGMA 1VRH1 2WSVA 1ULCA 2WNUB 4YVSA 4EN7B 2IXCA 1R1A1 5BPXA 1SFNA 1CGPA 4CRQA 4WVMA 2WNUA 4FBFA 3AZXA 3NJZA 5FCCA 1QNWA 3ZMNA 1WLTA 4AGRA 3KGLA 4O9EA 2HEWF 3USUB 3H1YA 5GZEA 5GZFA 5BNPC 1V6NA 1ZNPA 1DZQA 3VKMA 1BKZA 2ERFA 3P3NA 4Q0VA 2RJKA 4FP2A 3ZYJB 1QQP3 3GZUC 1RGSA 4HKWA 5K0UA 1RUG1 1DQ4A 4LHNA 1NLRA 2W0XA 5I8SA 4D94A 1QJY3 4PQ9A 2H6BA 2ZBJA 1R081 4AW7A 4IL7A 2CL2A 4XF9A 4LNVA 2ZX2A 5JZGA 2BUKA 1UPIA 2UWBA 2XLAA 5A32A 3DL3A 4FQZA 5FAXA 2R1DA 3B9IA 4FQ4A 5CIRA 4D3WA 4YZ5A 3ZXKA 3VHOA 4H55A 4XBQA 1OD5A 4CDUC 4IV3B 3DUIA 2QE3A 4R4XA 5BNOB 2RS12 1QH7A 2VW1A 1CQ9A 4IETA 4Q8LA 4Q4W2 4UW5A 5FO8B 4Q0SA 2VUAA 2RS51 3SCHA 3WHTA 5BNOA 4G9SB 1LGBA 5F9TA 1MS8A 1QJZA 4XTMA 4GALA 4RHV1 2YHJA 1SACA 2VH9A 2UWAA 1QXRA 3VBFA 1BMV2 3AYEA 1ZZ6A 2BEOA 4Q0UA 2PAEA 1YXWA 1S0BA 1PHMA 4KWLA 4TWTA 1XYOA 2VOVA 2UY8A 5FOJB 4YVSC 1DZTA 3UKNA 4GWMA 2P17A 3FLPA 2B42B 3WXPA 1RUJ2 2XLGA 1LOFA 5DDJ2 2DCYA 4PDWB 2W68A 3TB0A 4FPCA 2GC2A 1QJX3 4GXLA 3RNSA 4KBBA 5CNAA 3OBRA 3RPQA 5C33A 5I0RA 1QDOA 3VKFC 1LU2A 2EALA 2GSYA 3WZ1A 4MXWB 4V1PA 1W6OA 2WFF2 5D1IA 3WG2A 2QJVA 1U0AA 2WLQA 1NE6A 3MIFA 5T50A 4XF4A 3S7IA 1JYCA 3WT3A 1W0OA 1SQ4A 1X50A 4LLOA 3M8LA 2VMIA 3IBMA 1XYNA 2ATFA 3ZMOA 2ZABA 1TMF2 4AE2A 4HETA 2E6VA 4UW4A 3QH6A 2BYVE 3AK0A 5KHGA 4YZ3A 3G6JB 3V56A 2XBO1 4RL7A 3TNQA 3UKVA 2C1FA 1S0FA 3PVOA 3AMHA 5LRSA 1H1MA 2E63A 1DQ2A 1V6LA 3AP9A 2CGNA 3VZJA 2R071 2ZX4A 1ZX5A 2D98A 2YYOA 1YFWA 2D3RA 2YUEA 2MPFA 2BBVA 1S1AA 1ND2C 1SFYA 3ZN5A 1AX1A 3CLPA 4WM8C 1WA4A 3MFAA 3OY8A 3TNPB 3WG4A 4PIXA 3VHNA 3INAA 1HV1A 5FFOC 2GN7A 2LTNA 2E51A 2ET1A 2JG9B 2RJLA 2PAKA 5FO7B 1S0JA 2EXHA 4MX3A 3SITA 1C3HA 4AI1A 3U11A 2UURA 3ZYIB 4RR3B 1IOAA 1EV11 4B29A 5H9PA 3VBUB 5JZGB 2UU8A 4XJZA 3WY6A 3LWCA 1SLBA 4RS5C 4RQPB 1AF9A 4YW5A 3RQ0A 4QHBA 4N9IA 1X33A 1NCRC 4U36A 2AH2A 3O5SA 1V9U1 4OFGA 3WDTA 3M2MA 2Z5WA 1A3KA 3RYKA 4URTA 1UKRA 1V9U3 4OHWA 3GBGA 3NV1A 5IK4A 1AR63 1N3PA 3FX3A 1CPNA 1XNBA 3O12A 1O4TA 1U12A 2I2SA 1VBD1 4A7YA 2XVLA 3WDVA 4JDOA 2IXJA 4PIZA 4UBGA 1XNKA 4Z82A 4CEYC 3D0JA 3LKJA 2O8OA 2TNFA 4BPZA 4BYYA 1VAMA 3MI8A 5BNNA 2X5IA 4YZ2A 1C28A 1TNFA 2PLV2 5CVRA 3GNEA 4OZXA 3TN92 1H8TC 1D4M1 1UN1A 3BB6A 5K9YA 1NY72 3LCPA 3OYWB 2IC1A 4QQOA 1X82A 2X5IC 2W08A 5F6LB 3M1HA 4ZKTB 1ND2A 4M0NA 3L9JT 4Q29A 1F5FA 1UX6A 3AZZA 4LO6B 3WCRA 3WHUA 5BUVA 5J7MA 1MVQA 4FSJA 2ZHKA 4YG6A 3WW1A 2YGLA 4UBHA 2VUJA 2WC2A 4LUMA 3B7MA 1NA1A 2A70A 1EAH2 4OUSA 1PNGA 2GMEA 2A3YA 3N7LA 1MS0A 2YPJA 4HVRA 3QLQA 1NQDA 1REFA 5BXXA 2MEV3 1NXD1 3RG0A 4DZGA 1TME2 1A6CA 2XUMA 5EWSA 4HFSA 4FXKB 5HCFA 4JRAA 3H7YA 3USUA 1DYKA 1WBLA 1YFYA 1AYN2 4GB33 1PZ9A 1HQNA 2BFUS 1M06G 1CAWA 3RZZA 2PQQA 2BNOA 2R042 4B3NA 1FV2A 1C1FA 5CG9A 1RUD1 3FUOA 1REDA 4ES9A 4K1ZA 4COYA 3OY8B 4D69A 2LALA 1TME3 4B4QA 4M01A 4XMIA 1OA2A 1PK6A 1HV0A 4FAHA 1V6MA 1DG6A 1AR72 1OQDA 4AVTA 1RMU1 2XG3A 4K20A 3ZFEA 5FPZA 1OA3A 3VKNA 3VBSA 2PHXA 1BVVA 2MEV2 4RA0A 2PHDA 2R1BA 4Q4Y2 5I8YA 2A75A 5DUVA 1OPMA 2E7QA 2LM3A 3VBSB 2OZJA 2NN8A 4CEWB 3LA3A 4YYOA 1RUF1 4E4SA 3AFGA 5ACA2 2Y0OA 3PLQA 2CTVA 4JGZA 3ZYRA 2QFEA 2JXAA 3ZSJA 3KCXA 1ENQA 2WWSA 2NLRA 3BOPA 1FOD3 1HRI3 4WM7C 1PNFA 5T5PA 4RGAA 5KXEA 3KT1A 1ASJ1 1PIV3 4XXAA 2Z42A 1VBB1 1VP6A 1REEA 2VPVA 2ETEA 2OIIA 5EYXA 1HXS1 1WLDA 3D5OA 1WD3A 1DGLA 1I5ZA 4CEYB 4YGEA 1AHSA 3H8UA 4XJ9A 3SH3A 1SBDA 4J1WA 1GNZA 4Q4V2 3V0BA 2JE9A 4AHWA 1O3RA 5AC91 1MVEA 5HCAA 3TYJA 1ULDA 3VLBB 1VJ2A 1QWRA 1JUIA 1R093 1BMV1 5GLWA 1W6MB 4Q1PA 2GNTA 4HSJA 3LOBA 1LGNA 2MHFA 4BM8A 1W6MA 3E5QA 4S2DA 1X8MA 1NCQA 4M3CA 4FTSA 1MS5A 3ZXAC 1AR62 4F7ZA 2NPIA 2HWC1 5JSPA 4XW3A 3VZLA 4UW3A 1PO11 3AB0A 3KGZA 2GNDA 4NHLA 4KG8A 2ZPXA 4L99A 4QQPA 3ES1A 2JG9C 2XL7A 2QQPA 1IQAA 1O7FA 1GFF2 1ZYBA 4AFCA 4COVA 1SLAA 3IWZA 3ZN6A 1QOOA 3MEPA 3SCGA 3WW3A 4MGZE 2Q4SA 3FUQA 2CY6A 2QKDA 5LRRA 3JUUA 1G7YA 2R061 3E97A 5FMOL 4AYUA 1RMU2 2PYTA 1ZBE2 4WZCA 1EPWA 2V09A 1G86A 3AYAA 3DPRC 1SLIA 2IXKA 1ZZBA 3MF9A 3VBRC 3SMHA 2C5DA 1HXS3 1LHVA 1RUE1 4L92A 3NKTA 3ZXGA 2HWB2 1CAUB 1AVBA 3OJBA 4GH4C 4HBNA 4P5HA 1I3HA 2HWF2 4XOGA 1ULFA 5C8CB 2A6ZA 4XFCA 4TYSA 2PLV3 4INDA 1LULA 2DTYA 1FXZA 4NWWA 1XRUA 4E2SA 2ZACA 3EQEA 4K1YA 3UJQA 5GZCA 3SLIA 3AP6A 1TME1 3OF1A 3WDWA 3FZ3A 3SXWA 1QU0A 1DQ6A 2WS91 3N7MA 4QM8A 4CEWC 2JG8B 3SH5A 3JBG1 1FNYA 1MQTB 4XIKA 4EWAA 1QJY2 4H14A 1IS6A 4QX5A 3Q9OA 1RINA 2JG8A 4AI2A 1MQTA 3M3QA 4U2AA 4EN0A 1L3JA 1DYPA 2F4PA 4FXGB 4NHMA 5KHJA 5KXCA 4LBNA 5C8WA 2HWF3 1C8M1 3OGJA 4Y1ZA 2DVDA 4MXVA 2CAVA 4R9CA 5I0UA 2RM21 2VW2A 2VVEA 3H7JA 1RJ8A 1WLCA 1C5HA 1ZBE1 4XHXA 4A7ZA 4HVQA 1FMD3 1CJPA 3CL1A 4K6BA 4EJRA 3HAGA 1CVNA 4K40A 4LO4B 2O0OA 4WZFA 4KGGA 1UAIA 2VOKA 3AKPA 1G9FA 2LUWA 3AKSA 3ILFA 1WCDJ 4JC1A 3VBOB 3LSDA 1QJU3 4NO4A 3AMQA 2NYYA 4FPJA 2PHWA 1WCKA 2B39A 2D6KA 4XYXA 3AP7A 3VBOA 5GALA 2CGOA 4FPHA 4LT5A 2BVBA 2AGSA 4Q4X1 1ALYA 1J59A 1B35A 1RUH3 1W6PA 4YLZA 2IXHA 1D2QA 2RR13 4MSVA 4HMZA 3RJ2X 3OYWA 1NCQC 1B35B 1PZ7A 1YI9A 5IK5A 4N9HA 4QQLA 5T54A 2NP0A 4AXOA 3DV8A 4N43A 5AVPA 1VLNA 2JE7A 2NMOA 1ZRDA 4LTAA 4I30A 3IDCB 3UKTA 3MFCA 3N7JA 1IPJA 5K0UC 2FMDA 2TUNA 4HSLA 2JD4A 2XKOA 2UWCA 3AYDA 3V64A 1PZ8A 3JZVA 1U5ZA 4AGGA 5IK7A 1CPMA 1RUC2 2BTVC 3KLSA 4AK3A 1F2NA 5JR7B 1FOD2 1FAYA 1EV12 2ZGLA 1WD4A 5T5LA 5IT6A 4YNIA 1O91A 4B4RA 1ASJ2 2OW4A 4MYEA 4AFMA 5JSRA 1RVF3 1ND3A 1KRIA 3LA2A 1VBC1 4IEYA 4I09A 3VBRB 1BJQA 4W6XA 4AG4A 1QF3A 1HQLA 2XJTA 4XFBA 1QJX2 2XHKA 1AX2A 5GLTA 4OHYA 5E8AA 2Y26A 1POV3 2ARBA 3ZYPA 2A3WA 1BK1A 3ECQA 1F31A 2P3IA 2GMPA 4WVMB 2OUJA 2WNVA 3NO8A 2FBEA 4LBLA 2HWE1 4XILA 4AFAA 2WL1A 2WNVB 1CJDA 1I9RA 3JQXA 2NZ9A 5DZGA 3IN9A 4RS5A 4YW4A 4DY5A 4GMP3 4EROA 1Z0HA 3PMEA 5JPMB 4XQ4A 5C9AC 4P14A 1DGRN 4BLIA 1J3QA 4DINB 3WR0A 1A78A 1DQ1A 4QPYA 5A33B 1C4RA 1Q8QA 1N47A 3CF6E 3L2HA 1H30A 3MW4A 2XLFA 2D6PA 2E9QA 2HEVF 3JU9A 1CAXB 2VNRA 3QD6A 2ES3A 3WVJA 1QMJA 1HRI1 3FHIB 1NOVA 4W6YA 3ALQA 3I59A 3CJIC 2Y0IA 3TN93 1HQWA 1JHNA 1UF2C 2XKPA 1CR7A 3KCCA 3POSA 4COUA 5HXVA 4QPIC 3CNAA 4PDWC 1Q8SA 2WINB 1J1LA 1QHDA 4KQ7A 4KU7A 3I2DA 3UJOA 4PLNA 5IUQA 3R4SA 3UV9A 3O0WA 1VB2A 1VBB3 4OI2A 2ZAHA 2RS53 1LODA 4XQWA 1H4HA 5CFDA 2D40A 2WFF3 4FOVA 4Q4V1 2A3XA 1PGL1 1ULGA 2CWMA 1RTVA 1RUD3 2HYKA 3JD71 1CD3G 4ATFA 3CO2A 3O7OA 4Q4X3 1VRH3 1WMFA 1KITA 1FPN2 1MS3A 1V6JA 4LBJA 3SHRA 5FQ0B 1S0DA 2CYFA 4NVPA 2ZGOA 5F6KA 1BBT2 1NCQB 2WA3A 2K0GA 5FQ0A 1K5MA 4MUVA 4FP3A 5C8CC 4WM7B 2B9UA 2RM22 2X29A 2XH6A 3EJKA 3ZVXA 2V5YA 5C4WC 4WM7A 2G9FA 4M3CF 3PTYA 1XNCA 4M3CB 1AYM3 2Q8OA 3WINE 2GH8A 1QXJA 3QOPA 5J37A 4K9SA 3WDYA 4HK8A 1X8EA 2YV8A 1NA1B 4QPIA 2XGXA 4WM8B 3WX5A 4Z2WA 1KDKA 4MGYE 3B93A 1GANA 4GULA 3MIDA 1RUH2 4WM8A 1VALA 4IXLA 5DZFA 1XU1A 2ZX3A 5AFEA 2WLPA 1AR71 1ONAA 1MZFA 2O8QA 1HRV3 1RUG2 3G7DA 1RHI3 3IIAA 5CAZA 3LAGA 1SLCA 5J48A 1QJU2 2ENRA 5JOWA 1UIKA 3WDXA 2BQPA 1V9U2 3LSEA 1KJLA 1UU5A 4CDWC 1CAUA 2D6NA 3MGUA 4DOUA 1RHI1 3AJZA 3X29B 4RQPC 2NMNA 2HWB1 2AYHA 4FPOB 4N7UA 4Q27A 1JN2P 1KJRA 3RRDA 1FI2A 4LA2A 2VMHA 4J1XA 3MW2A 1GZ9A 1Z7S3 4YVWB 2ZX1A 5JDBA 5AVAA 3ZDSA 1WMDA 1G9DA 1RUH1 2BVVA 1VBA2 4BZ4A 4YGBA 5KXBA 4ONUA 4D7YA 2VECA 1MACA 1W6NB 1XE7A 4ORFA 3WD5A 4YZ4A 3ZFGA 1YIPA 1O3TA 1DGRA 3KMHA 1W6NA 1DGWA 3WOGA 3QACA 4Y20B 1H9WA 1VIWB 4PBOA 3VDDB 1MEC3 3POYA 4P9YA 2XBO2 3B5LB 3ZO0B 1LU1A 2BNMA 4CTEA 4C91A 2EIGA 3RSJA 1TMF1 4IV3A 1AR73 3AZYA 2R062 4L97A 4LBQB 2DCKA 4XTPA