1NA1A

The structure of hrv14 when complexed with pleconaril
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
273
structure length
273
Chain Sequence
TVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHFNGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFTYVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKVGDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVKIRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coat protein VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 44
structure length 273
sequence length 273
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1na1A00
1AYN3 1K5MB 5BNNC 1VRH2 1FPN2 1Z7S1 1POV3 2ZTNA 4WM7A 4NWWA 3ZFFB 1NG0A 1ASJ1 1R082 3VBRA 3CJIA 1PGW1 1HRI2 1HXS1 3VBUB 1FMD2 1B35A 5ABJB 5C8CC 2RS31 2RMU1 5BNPA 5CFDA 5ACA1 4EJRA 1NA1A 1WCDJ 4QPGA 3NAPB 4RR3A 1V9U3 1QJU2 1VBB3 1H8TC 3ZFEB 4AEDA 1VB4A 1RUH2 4Q4Y3 4YVWC 4Y5Z0 4LLFA 5A33B 1VRH1 1FPN1 2WS93 1NOVA 3DPRB 4JGZA 3ZFGC 4CDXC 1X33A 5LK7B 4GB33 1R081 4Q4V2 5C4WB 1HRI1 1VBE3 1FMD1 4N53A 1AYM2 3VBHC 1TME3 1FOD1 4PDWC 2HWC3 1PIV2 4GMP1 4JGYB 1EV13 1QJU1 2BFUL 2RS53 1ND2C 1NA1C 1RUH1 1ZBA2 1AR82 1OOPB 4RR3C 1R1A2 1AL23 2FZ2A 4RS5B 4Q4V1 1RMU3 2ZZQA 2WLPA 3JBG2 4CEYC 1F2NA 4YVSA 1AYM1 2IZWA 2HWB2 5A32B 1NCRA 2X5IA 3HAGA 1R092 4CEWA 1PIV1 3JD73 2BPA2 1AR92 2R062 2VQ0A 1VBC2 5L7OC 4WM7B 2WFF2 1K5MC 3VBOA 1ZBA1 1GFF2 4CDUA 3VBRB 1R1A1 3CJIB 4Q4W2 1C8M2 4RFT0 5DDJ2 1B35B 3JBG1 1AYN2 5BNPB 5CFDB 3VBUC 1QJY3 1NA1B 4QPGB 1RUC2 2HWB1 2Y26A 1RUJ3 3TN93 4AEDB 1PGL2 1CD3G 1R091 2GSYA 1VBD3 1AR91 3ZFEC 1AR63 2MEV2 1NCRC 4JGZB 4SBVA 4RHV2 1VBC1 1MQTA 2WFF1 5AC93 1D4M3 5FMOL 3DPRC 4RQPB 1RUI3 1PO21 4Q4W1 1C8M1 1MEC2 1TMF3 1PO13 1POV0 4N53B 5DDJ1 5C4WC 2TBVA 1E57A 2RR12 4IV1A 1EAH2 1RUC1 2RS12 2BFUS 1BMV2 2HWE2 1QQP3 1QJX3 1PGL1 1RVF2 4JGYC 1NY72 1BEV3 1RUE2 1ZBE3 2MEV1 1RHI3 1PVC2 2XBO3 4RHV1 2R043 1OOPC 2BBVA 1NCQA 2FZ1A 5BNOA 1MEC1 5K0UA 4RS5C 3IDEA 1MQTC 4YVSB 1NCRB 2X5IB 1Z7S3 2RR11 2QQPA 1EAH1 1C8NA 4CEWB 2RS11 2HWE1 1ASJ3 2RM22 4Q4X2 4IV3A 3VDDB 2HWF2 4QPIA 4IV1C 2PLV2 1HXS3 1RVF1 4RQPA 1NY71 3VBOB 1RUE1 4CDUB 2RS33 2RMU3 4WM7C 1PVC1 5ACA3 1HRV2 3VBRC 3CJIC 2WZR2 5C9AB 1B35C 1NCQC 5BNPC 5CFDC 1RUD2 1VRH3 1FPN3 1VBA2 4QPGC 1AL0G 3FBMA 1RUF2 2RM21 4Q4X1 1R083 2HWF1 2DF7A 4AEDC 5FMOS 2PLV1 4NWVA 1AR72 1HRI3 1M06G 1MQTB 2ZAHA 1FMD3 4JGZC 2R072 4IV3C 4CDWA 1FOD3 1HRV1 1COV2 4RQPC 1RUG2 4GMP3 1SMVA 1QJU3 4IV1B 1AR62 4BCUA 1VB2A 2WZR1 4N53C 3VDDA 4Y4YA 1RUH3 2HWD2 1RUD1 1VBA1 3J8F2 4Z92B 1RUF1 1AR81 5CFCB 4Q4V3 1BBT2 3VBSA 1AR71 1NCQB 1AYM3 2R071 5BNOB 4FTSA 5C9AA 3VBFA 1ND3A 5J96B 5K0UB 5D8AB 4CDQA 1COV1 1PIV3 1RUG1 4YVSC 4WM8A 1IHMA 4FTEA 2R061 2X5IC 4IV3B 2HWD1 1ZBA3 3S6PA 1R1A3 4QPIB 4CEWC 3J8F1 3VDDC 1V9U2 1BBT1 3JBG3 1VBB2 5JZGA 3VBOC 4Q4Y2 4CDUC 1AYN1 1VAKA 2WS92 1POV1 2HWB3 5C8CA 4GB32 3ZXAC 1R093 1AR93 5C9AC 2RMU2 1VBE2 5CFCA 1H8TA 1VBC3 2WFF3 1TME2 3ZFGA 1PO23 2HWC2 4Q4W3 1C8M3 4CDXA 2GH8A 4N43B 5DDJ3 4GH4B 3M8LA 1V9U1 1EV12 4CDWB 1VBB1 5D8AA 2RS52 2XPJA 4Q4Y1 1RUC3 1RB8G 2WS91 3VBHA 5JZGC 1AL22 1BMV1 4GB31 4PDWA 1RMU2 2MEV3 1VBE1 4RHV3 1FOD2 1ND2A 1TME1 2WWSA 3VBSB 2HWC1 1MEC3 5CFCC 3JD72 1CJDA 1EV11 3VBFB 4CEYA 1ND3B 2RR13 2RS51 1F8VA 1EAH3 4CDQB 5BNOC 2RS13 3JB8A 2HWE3 5K0UC 1QJZA 1AL21 5D8AC 4WM8B 3LOBA 4FTBA 1RVF3 1DDLA 1RMU1 1RUE3 4GMP0 5BNNB 5FOJB 1QJY2 1PVC3 4N43A 1OHFA 4GH4A 5L7OA 1K5MA 4QPIC 1RUJ2 3TN92 5JZGB 3ZFFA 3JD71 1VBD2 4FSJA 5C8CB 3VBUA 5AC92 1D4M2 1X36A 5ABJA 2RM23 4Q4X3 1RUI2 2HWF3 1A6CA 1TMF2 2PLV3 1PO12 1H8TB 3NAPA 4YVWB 3ZFEA 1QJY1 3ZFGB 1HRV3 4CDXB 1OPOA 5A33A 1QQP2 1QJX2 3DPRA 1RUJ1 3TN91 2WZR3 4N43C 1VBD1 4GH4C 1BEV2 1HX6A 4CDWC 2BUKA 1ZBE2 1AR61 5C4WA 3VBHB 1RHI2 1RUD3 2XBO2 1AUYA 1VBA3 5J98B 2R042 5AC91 4PDWB 1PO22 3ZFFC 1D4M1 1RUF3 1AR83 5GKAC 5BNNA 1RUI1 1TMF1 1PO11 1AR73 1ND2B 5ABJC 4JGYA 2R073 1Z7S2 4RR3B 3JB4C 1ASJ2 3NAPC 1COV3 1RUG3 1OOPA 1QQP1 3VBSC 1QJX1 4CEYB 1PGW2 1HQNA 1HXS2 4RS5A 1BEV1 2R063 3VBFC 1ND3C 1ZBE1 2RS32 2HWD3 1RHI1 2XBO1 5ACA2 4CDQC 2R041 3J8F3 4YVWA 1W39A 5A32A 1BBT3 4WM8C 5L7OB
chains in the Genus database with same CATH superfamily
4LHSA 2VY0A 3LEKA 5I93A 2ETEA 2A6YA 1N3QA 2GC1A 1WD4A 3LQCA 4NRPA 1W8UA 4UFJA 3ZFFB 1NG0A 3CIHA 3HN1A 5JMCA 2NYYA 2GH2A 3PU8A 4NPRA 2WNVC 3CJIA 5A1LA 5T3NA 5LRRA 5FKBA 4AI8A 5I0RA 2VOXA 4FPJA 5ABJB 4YM3A 2A3YA 2RMU1 4RGKA 3PL0A 4ARYA 2ADDA 5CVRA 4EJRA 4F83A 4ASKA 3IB3A 4QPGA 5T5JA 3VB9A 1WBFA 3D0JA 2CY6A 1STMA 2D97A 4RR3A 3OEBA 4AGRA 5BV6A 1VBB3 2BNMA 3NJVA 4XURA 3GBGA 1D0HA 3I59A 4OMCA 4YVWC 2QE3A 4XHXA 3C2UA 2CWMA 1SEFA 1V6NA 1RGSA 2QDRA 4R4XA 2Z5WA 2XJUA 3QACA 2XKOA 4XFIA 4H3WA 2O14A 2W95A 4LEJA 4QM8A 2W46A 1HRI1 3WW2A 1VBE3 3U75A 5LBEA 1LHVA 4BIOA 4KG0A 2VCMA 3SXWA 3P3PA 4NRQA 3RGBA 1I5PA 4AVVA 4PDWC 1WGPA 2ARAA 2WT0A 2HWC3 3OGVA 5B4NA 4LT5A 1OQDA 4NPMA 2DYCA 2J42A 1Q8PA 3HBKA 1YRZA 4UFMA 4CUBA 3A23A 1EV13 1LOCA 1QJU1 3FX3A 1HV1A 4XUNA 1CPNA 2QNKA 3U07A 2YFZA 3WG1A 4PF5A 2WC2A 1WWYA 1R64A 5CG9A 2ET1A 2HLEA 1R1A2 3I2HA 4R9DA 3E5UA 4Q4V1 5I0UA 2ZEWA 1RMU3 4CEYC 2D98A 3RVHA 2BNOA 5FY9A 1PMHX 5G05L 4XPVA 2DVGA 5JOXA 2HYKA 1LGBA 4MGSA 1AYM1 5AFBA 2BGCA 1CIWA 1GWLA 4QX7A 3RRDA 5FYBA 2ZKNA 3BGAA 4XF1A 3AP9A 1UIJA 3N7KA 5FLHA 4MVTA 5TSWA 3AJZA 4HFSA 2OPKA 1OFSA 2YHJA 4YW1A 4L11A 4QKNA 1JYWA 3LPGA 2XJSA 5DQ0A 5HCBA 3U78A 2WFF2 2JG9C 1K5MC 2J1VA 5DAXA 3LSEA 4QXHA 2VZRA 4A44A 3B93A 1UU5A 4F3JA 1UZZA 5FPXA 4ISQA 1B35B 1X8MA 2C0ZA 1C1LA 2D6LX 4Y33A 3JBG1 4DIQA 4EN6B 5A3MA 2Q1ZB 4Q1RA 1AYN2 4Y20B 5FK7A 5FZ1A 3VGIA 3VBUC 4E8DA 2JE7A 1MZ5A 1ULOA 1N1TA 2MNGA 3L2YA 3LEMA 4ET7A 2HWB1 4OI1A 2Y26A 3LDRA 3NV4A 1XE0A 1VBD3 5FFOC 2JIJA 3S30A 3BU0A 2PFWA 2HKXA 3HJRA 3LIGA 2ARCA 4RHV2 5LRSA 4CU7A 1MQTA 1WW7A 3O1SA 2JWPA 3GZAA 1D4M3 2BZDA 3LFIA 4XETA 1YLLA 1H1AA 4IE0A 1S0JA 1NQDA 1RUI3 3ON7A 2I45A 3M3CA 4Q4W1 1C8M1 1G9AA 4AFCA 5FPUA 2DTYA 4N53B 3BIEA 4JCKA 1YFUA 5FJHA 5C4WC 2Q30A 2QQMA 3ACLA 2QVSB 4NO4A 1OVSA 2TBVA 2B9UA 5GLWA 2RR12 3IDAA 2ZGPA 2JG9B 2BJSA 4H7MA 2BFUS 2HWE2 3CKHA 2E7AA 1PK6B 2Y34A 3MLLA 2ZAAA 5KHIA 5L73A 1ZZCA 4FXGB 2GNDA 2Q8CA 1PGL1 1RVF2 2A6VA 3POBA 5A7PA 4JGYC 3T4VA 4NVPA 1YIFA 3KQ4B 1S0CA 4JQRA 4YZ3A 5L9RA 5JIUA 3CLPA 2CYFA 3IAPA 3NNLA 2ZBJA 3KGZA 5K4LA 4IESA 4LNVA 3IAQA 3LOIA 4IEQA 2WNUC 1AF9A 4LHNA 1OQ1A 5LATA 3S5QA 3ZR6A 1WCSA 2XL7A 5B2GB 1A8DA 5FP9A 3NJZA 3ZOIA 5JR2A 5FUIA 1W8ZA 2K9ZA 1AZDA 2ZGUA 3ZSMA 3EYPA 3AP5A 3AZXA 4M0HA 4MO3M 2R49A 3K51A 4FP3A 4E2GA 5GZGA 1W8FA 2GMMA 3U37A 3Q8CA 1C8NA 1S2EA 4QQHA 2RS11 2JE9A 4NPLA 5FP4A 1LOEA 3VDDB 1E5HA 2EALA 4B1LA 4B4PA 4YM1A 4AVTA 1YYNA 3ILRA 4QT6A 2Q8OA 4LE3A 1NY71 3VBOB 3PVBB 3ZPYA 4D0QA 2EICA 4CP2A 2G9GA 5A7OA 1WW6A 4CDUB 4CPBA 4WM7C 3CZJA 4U2AA 5IK8A 4W6YA 5M0TA 5LBFA 2GC2A 4A3ZA 3VBRC 4DUVA 1W0OA 1YQ6A 3OUIA 2A3WA 4LITA 1W6PB 3POFA 4ITCA 2OX0A 4Y3OA 5C9AB 1TNFA 1BVP1 1MS0A 3B5LB 3TB0A 3ZSLA 3Q8FA 4OHZA 1NCQC 3PNAA 4BZ4A 4DXSA 4C1XA 5CFDC 1LENA 2R0HA 4Q1PA 3WQ7A 1LOBA 4ZY9A 3FBMA 2WNUB 3INAA 4I30A 3OYWA 3E5QA 3W5MA 2FDJA 3VL9A 5FXVA 1TQ5A 2DF7A 2FBEA 4NIAA 1Y9MA 2Q4SA 5JI7A 3AK0A 4NWVA 2XH6A 1LGCA 1AX1A 2ZHNA 2TNFA 3R4UA 1JUIA 3AKRA 1NE4A 1OURA 3EB7A 3CU7A 1W6NA 1XYPA 4L97A 5FO8B 5IK7A 3TAYA 1FOD3 1HRV1 4OUMA 2JDNA 1ONAA 2VULA 3WOGA 2NQYA 3O14A 4BQ4A 3RMXA 1RUG2 2A71A 4N7IA 4JKLA 3GCWA 2KA3A 3WNPA 2B42B 1VB2A 2WZR1 4Y24A 4BCUA 3ZSJA 4C8DA 4GULA 1W8HA 3VDDA 4TXWA 4A7KA 3N9LA 3D6EA 2HWD2 2VQAA 5FRAA 3ZX7A 2Z42A 3C7GA 3CF6E 2FMYA 3CDZB 3ELNA 4OZOA 2WDBA 4A45A 4ES9A 3DCQA 4LHLA 1AR81 2GNTA 1D7PM 4Y1YA 1M4WA 1QNWA 1BBT2 2EIEA 5DABA 2DCYA 2RVAA 3AMMA 3VBSA 5A6ZA 1JYIA 2V4AA 3MZHA 4J6GA 4P5HA 3O1UA 4DXTA 2YUEA 1DYKA 1NCQB 3CJXA 2CDPA 2R071 5FZKA 2Q1FA 5BNOB 2XVGA 1W6PA 4KWLA 5DAVA 1ND3A 4DXZA 5KHHA 5C9AA 3UESA 3MHZA 3WNKA 3ZSEA 3PIGA 3PUAA 2PAMA 1QH6A 2GALA 2CTVA 1ULEA 3BYWA 5HBAA 1W2OA 1X7NA 5JVVA 5FR3A 3AYDA 4YVSC 3M2MA 4JAAA 4V2WA 3GYDA 4FTEA 2PA7A 1YUDA 5LB6A 1C1FA 5FMDA 4COZA 3T0BA 4WVMA 2XL9A 3WF4A 2VW1A 1QMJA 3WLUA 2DVBA 1XXNA 1R1A3 1UD1A 2GN7A 4CEWC 4FCAA 1GMMA 1S0DA 4B4QA 1OMIA 1H2KA 4KI5M 3VKOA 5KC6A 4LIVA 1AX0A 2FD8A 4WVZA 1QDCA 1XNAA 2A6WA 2JKBA 3A7QA 2QZ2A 3TNPB 4JVAA 2DFBA 3AMHA 3AP6A 3M7AA 1UOGA 4C1WA 4IUGA 4YW4A 5A7NA 3WG2A 2JB8A 1SQ4A 2P5BA 2WS92 4DNYA 4E8CA 4K6BA 5T50A 4QX2A 4CCJA 4GB32 4NJ4A 3ZXAC 1US3A 2BWAA 3KCYA 3QCWA 4YRDA 3WDTA 4QU1A 5IHRA 3PMEA 4B4RA 2VU9A 2DUOA 4HT1T 5FXWA 1RXGA 4HPKB 1YFWA 2XUEA 3BKZA 1H8TA 4P9GA 4KMQA 2WFF3 3Q9OA 4B3NA 1UO9A 3IWZA 2AYHA 2XDVA 3KD4A 1XOYA 3MFAA 1PO23 4CU9A 1GLHA 4XXPA 3WUDA 4XBNA 3KV4A 1EP0A 1JOBA 1PNFA 4LO8A 3M8LA 4NAMA 5LA9A 1GOHA 4NHYA 3BIWE 1VBB1 4HMZA 2Y6HA 3RSJA 2VOVA 2KXLA 5IVYA 2XPJA 1GBGA 1U5YA 4YZ1A 3ZO0B 4UOJA 4FBFA 4YLZA 4DRRA 4A41A 3UJQA 1BMV1 2E51A 3GBWA 3NNMA 3RWKX 2EA7A 4ZONA 4D7TA 1TG7A 1ZZBA 2VXRA 4BA6A 4UF0B 4LMFA 2B45X 2XLAA 4PT6A 4U36A 5J1XA 2ZX2A 1VBE1 2YG0A 1J83A 3AZZA 1XQNA 3NSTA 4RHV3 3VZNA 4JDOA 4XYXA 4C91A 1ND2A 1LOFA 1GYKA 1ZYBA 3C7EA 2VMCA 4FPKA 1DG6A 2HWC1 3OB8A 4OHXA 4EROA 5CFCC 2CGPA 2WZEA 4K9SA 2CDOA 1HLCA 1EV11 1UQXA 2P34A 4E4HA 4KG8A 3H0OA 2VTXJ 3PDQA 2RR13 4FOWA 3O0VA 2YB7A 5FZDA 3H3LA 1H1MA 3JB8A 2HWE3 4D6QA 4R8HA 4QQPA 3FLTA 1JZ3A 2VH9A 4K40A 1QOSA 1PHMA 3TBDA 4OI2A 3LOBA 3RZZA 1RVF3 4AEKA 5A1AA 4FTBA 1RMU1 3R0RA 3UKNA 4GWIA 1VP6A 5I8YA 4XHBA 4GMP0 4XJ9A 5FZ4A 1QJY2 4FPHA 3THTA 2UURA 1PGSA 1OHFA 5F5CA 5JOYA 1IGOA 3NQHA 4TWTA 2OKXA 3VD5A 3WY6A 3ROUA 1HDKA 2D7FA 2GP3A 1QDOA 2V5DA 2YU1A 2YXSA 4K8FA 2QQKA 4YWAA 3SH4A 1T6GC 1K42A 4QX8A 1AX2A 1C57A 2WZPP 4D94A 4NE9A 5F9TA 5H9PA 1IQDC 1BYHA 1DZQA 2QJVA 4FPFA 3OBZA 2VXJA 3ORJA 3UK9A 4YSFA 5C8CB 1E5IA 3TEWA 1W6OB 5EQUA 5DG1A 4M00A 4DMIA 4ZU7A 3NKTA 4AI1A 4AQ6A 4HKLA 2ILMA 1I3HA 5IAVA 4LBOA 4ONUA 4XJ8A 5F5AA 5CA6A 3E6BA 3SC7X 3AYCA 5A3LA 3ZIXA 1AXYA 4AOCA 2PQSA 2XG3A 3A0KA 1U5IA 2R6QA 4OMDA 3OJBA 3ZFEA 5ANNA 3ZFGB 3U4SA 2VCCA 3AZVA 5J3UA 3SEEA 2ZHMA 4HK9A 1DQ6A 4WVVA 5GM0A 1QQP2 5A33A 3R6SA 3DPRA 3IPVB 5E88A 5CKNA 2AEZA 4XACA 1VBD1 4JTNA 1DU3D 5JXJA 2UYBA 3HNBM 2BUKA 1ZBE2 2SLIA 4URTA 3VBHB 3O1MA 1GZWA 1DGLA 2D40A 2ZGMA 2LRPA 5JOWA 2R042 4MGKE 2CWSA 3V65A 1D4M1 3PUHA 1CPMA 1DZTA 2K0GA 1Y4WA 4L9BA 3WT3A 3DEMA 1RUI1 2B4KA 4QX1A 1RTVA 2PXJA 3ALQA 3RMYA 5F3CA 4N9IA 3ZN6A 2LUWA 2YROA 4EN7B 3MIDA 1JZ7A 5HCAA 5BYNA 4C0BA 1SLLA 2PAKA 1OT5A 2XMLA 3V0AA 1ASJ2 3NAPC 4CTEA 1RUG3 2WZ8A 2ZEZA 3POJA 4CP1A 1OOPA 2R16A 2YPJA 4KGQA 1PGW2 1HQNA 2GC3A 3H3ZA 3OTFA 3H42B 4RS5A 2R063 1MZFA 3HMYA 2QTWB 2XKPA 2HWD3 2KR2A 3O5SA 5ACA2 1O3TA 2ZOEB 4CDQC 1NXD1 1GNZA 4XMIA 1DGRN 3AFGA 4YGDA 5FZBA 4OHVA 4XILA 3B69A 3X29B 2YDEA 4XTMA 1W2UA 1UMIA 2G9FA 4XFGA 4M3CA 4UBGA 1BBT3 1J3PA 2XGXA 5EXOA 4EZHA 2FDKA 4RGAA 1GU3A 3V0BA 3N9PA 2VPVA 1H30A 5FLIA 5J48A 5L7OB 3E97A 1LU2A 1XYNA 1FPN2 2D3SA 2ID4A 2F17A 4NWWA 3TYJA 3HBZA 4NN0A 2AC1A 3WR0A 1OC1A 4HANA 3ZYGA 1XE7A 3HPNA 2VZOA 4IEXA 1UY4A 3QH6A 4LUKA 2DCZA 1FMD2 2P3JA 5C71A 5LW9A 4LPLA 1BJQA 5JPMB 1CWPA 5BNPA 2GZWA 2XWBB 2G4IA 5EP9A 1RYYA 2YV8A 5LA0A 3ZN4A 4P9YA 5DMYA 4AG4A 1NA1A 5FZ7A 3WF1A 2PHXA 1Q8VA 1NLRA 1N1SA 3NAPB 2WKKA 5L9BA 4OUEA 1UIKA 4HKWA 1W28A 4IEWA 2VM9A 2WO3A 3D5OA 2QKDA 5FZOB 4MGIE 4K21A 4PI0A 4AEDA 1L3JA 1VB4A 1RUH2 5CEHA 5FZ6A 3ZXLA 4Y5Z0 3BTYA 2WS93 4JGZA 4RGGA 5C70A 4CDXC 3RWNA 3MUZ1 3P5BA 1X33A 4MSVA 3D4KA 4GB33 2ZPXA 1CN1A 3PVEA 2DVDA 3NJXA 2W87A 3MYXA 3O0XA 3ACIA 3WNXA 4RL7A 3T1MA 4Z2AA 2RDRA 2ZEXA 3E6CC 1D0GA 1J59A 4LHKA 2ZA9A 4MHRA 3GALA 1FOD1 3POGA 2C24A 1W90A 1PM4A 3LDKA 3D82A 4LR4A 1PIV2 3ATGA 4YNIA 4LKFA 1TZOA 3VZLA 3MV11 4AHWA 1V00A 3WEZA 3MW4A 2FCTA 2GU9A 2BFUL 1PX4A 3AC0A 4HONA 4QHZA 1GQHA 2ZMKA 4OQ9A 3IN9A 5IVFA 2J1TA 2VVEA 4IW3A 1WMDA 4RR3C 4N8MA 1UOFA 5FPZA 2C9AA 2MHFA 2ZJCA 1DCSA 5JXGA 1UW8A 2WLPA 1F2NA 2H6BA 5KHKA 2DWRA 1O3RA 3NNJA 3PUIA 4HETA 3LIHA 3BUCA 4E2SA 4NHXA 3J7LA 4HG6B 3HNMA 4IE6A 5IVBA 5A32B 5FYVA 1JBCA 1HW5A 1DHKB 2X5IA 3H9AA 3VZMA 5JSOA 3AKTA 5IVJA 1XSQA 1R092 2O8QA 2ZGNA 4A3XA 3RZGA 2IXKA 3ZSKA 4AAXA 1BKZA 2JDUA 3I2KA 3FHQA 3M3EA 3NMBA 4BWOA 5F7UA 4Q26A 4OULA 2IXJA 4DZGA 3MFCA 1VBC2 4A42A 2JE8A 2SBAA 2R1DA 3VDCA 3T0DA 3P6BA 5J36A 3P3NA 1R1A1 2XLGA 3CJIB 2N7GA 1LHWA 2VJXA 1ZNPA 1KXGA 4RFT0 5FTTC 1HKDA 5GZCA 4XOGA 5DDJ2 5J37A 1NE6A 1BQPA 4AF9A 4NOTA 2BQPA 2PHTA 3H1MA 4TYSA 3RDIA 1RUOA 1QJY3 2LROA 5A6XA 2DUPA 1CAWB 4M3CF 4QPGB 2CU5A 5IWFA 4BM8A 4JTOA 2B39A 1NX9A 4QQOA 1VR3A 3T2QA 2R32A 2G19A 3WCRA 3N3HA 4AHZA 2R0FA 2F4PA 1BVVA 1HQLA 1LHNA 2QQOA 1IPKA 2RE9A 3C7FA 2Z79A 2ZGQA 3I59B 4LBNA 5AVAA 4XFCA 1NUKA 2OW4A 1JN2P 3FHAA 2VOKA 4AI9A 2WFF1 1O8PA 2W5FA 3W20A 1UXXX 4UT5A 1BK0A 2B9VA 1ENSA 1KFUL 1PO21 1WLDA 1MEC2 1W9WA 4Y1ZA 4M4RA 1POV0 3DXTA 2EF6A 3LA3A 5FZ8A 4BPZA 1VRBA 4CCNA 3ECQA 4A2UA 5EJ3A 2WYSA 1X9TA 2E31A 3THPA 1JZ5A 1EAH2 2W94A 3VDAA 2XOMA 4E4ZA 2JX9A 3R4DB 4BQ3A 2W91A 4FPLA 1AHSA 3K3OA 1QQP3 3WP4A 3ZYHA 4AVSA 5K7PA 2KM2A 1SACA 2OZ6A 4LKEA 4FQ4A 1DQ0A 4EWDA 2VMEA 4O9EA 3MIHA 3IDBB 1JU3A 1ZBE3 3MPBA 2JG8A 3N9MA 2WSUA 4HN0A 4ZXKA 2NP0A 4QDRA 1PVC2 4OHYA 4RHV1 1V6LA 3AXEA 4CYDA 2R043 4K3UA 4MXVA 3DUIA 3CEWA 4MYEA 4MG2A 4LJHA 2FZ1A 4CP9B 2MPFA 1GUIA 1I9RA 4HL0A 4ZS3A 3WW3A 2FDIA 3CMGA 1CAWA 2PHDA 3MEPA 4LBJA 5K0UA 2JDMA 2VGDA 2XJTA 3DYPA 3MPPG 1MQTC 3RYPA 4EE2A 2DV9A 4D3WA 3IDCB 3SLIA 1GSLA 2RR11 3I3QA 3B01A 3ES1A 1G9FA 1LODA 3U11A 3DYOA 3MLJA 5C7GA 2HWE1 1ASJ3 4Q0PA 4LBQD 4Q4X2 3FC0A 2IXCA 4S2DA 1GKBA 4QPIA 1C3HA 1SLBA 4AI3A 1RVF1 1MR5A 2YBKA 3LAGA 1F9KA 3WP6A 2I07B 5SV5A 5ACA3 4XIOA 5ISLA 1J3RA 3HNYM 5DAQA 2CGOA 1X8EA 4P08A 4K8RB 3K2OA 1GV9A 2HH9A 3RS6A 1B35C 1N3PA 1QH7A 3SEPA 5A7QA 3CL1A 2JDYA 5F6LB 2FCUA 1FPN3 1VBA2 3OG2A 3RFRA 2VZ3A 2DU0A 2K46A 3LWCA 2LS6A 1OUSA 4R52A 1ODMA 3I2GA 3DXUA 1ENXA 4XJAA 1X82A 5FYHA 4Z2WA 5FMOS 1O8SA 2LTNA 1M06G 1MQTB 4CP9A 1A8MA 2HYXA 3CZUA 1FMD3 3D8CA 1VMFA 3UV9A 1D2QA 3VKFC 4CDWA 1OLME 5D1IA 4JHTA 1QU0A 3KCCA 5CKMA 1WA6X 5EJZB 3RZKA 1A34A 4QB2A 1DLCA 4OI4A 3OD0A 3THCA 1W6MA 1SBDA 3KF3A 4RD7A 1ZZ6A 4PLNA 5FP8A 4PBPA 1AR62 4N53C 4XUQA 4MGZE 1JODA 3W59A 1JYTA 5GZEA 4PI2A 1YQ8A 4L99A 2RV9A 4UXAA 2AH2A 3USSA 4B29A 1JYVA 1RUH3 2Q5TA 1GZCA 4AR2A 3AP4A 4RFRB 4Z92B 1SG3A 1OBNA 1PK6C 4QMAA 1QOOA 1IG0A 4FQZA 1JYXA 1L7LA 5FKCA 1BHGA 1PVXA 2E32A 1JOJA 5CG8A 1YQ5A 3MIEA 1F4HA 4IEPA 4AYUA 5KXCA 2D3RA 4NUBA 4QDQA 4CP0A 2VQUA 2Z4FA 4Y1VA 5LBCA 1XNKA 2C1FA 1W0PA 1JZ8A 3I3BA 3VBFA 1YI7A 3NNFA 4V2VA 3ZDVA 2DBIA 5FP3A 1VLNA 3M70A 4LUMA 5LCWL 2A75A 3OGJA 5D8AB 4Z1VA 4CA9A 1PIV3 1RUG1 2JICA 3O1TA 3KT1A 3E5XA 2R30A 1OKOA 1OXCA 3GDBA 4GAZA 1HN0A 2WQ8A 3BTZA 1XU2A 3NO8A 4J1WA 1LB2A 4M01A 1DFQA 1UZ0A 1XPWA 4H7LA 1UU4A 1IHMA 3LA2A 4WM8A 2VG9A 2R061 4CCDA 1AXKA 3BOPA 3E6DA 2HWD1 2JD9A 4PBOA 4B7EA 2D6MA 3ZXJA 3IMMA 2V72A 3HD8B 1WMFA 2ARXA 3MDPA 5F1RA 5FWJA 2VNGA 3RJRA 1DQ1A 2BBAA 3VDDC 3SKJE 2W3JA 1UXZA 1N47A 1WCKA 1BBT1 1QXJA 1ZRIA 4AEMA 3GHMA 2WNVA 3VBOC 4OFGA 4Q4Y2 5JXIA 4CDUC 1VAKA 1Q43A 3PUSA 1PM7A 2YYOA 4H2AA 4RSUA 1T2XA 1EUUA 5EHDA 3RZHA 1R093 1WBLA 3AYAA 4GXLA 2D5FA 3JUUA 1VIWB 1VE0A 2Y38A 4TLFA 1P8JA 3EQEA 5CNAA 5C9AC 1REEA 5KHGA 2RMU2 4KNCA 2ZXQA 4TSVA 1VBC3 1S0IA 1UZYA 3BTAA 2VZ1A 2WL1A 3OYWB 1TME2 4QDSA 3T2TA 4DUWA 5FZHA 5K9YA 4MLOA 2E7TA 3W5NA 3ZYPA 4WV8A 3BI3A 1IQAA 5CISA 4FAHA 2E9QA 4N43B 5DDJ3 3FL7A 1W6NB 5FXXA 4E2QA 1GP4A 4JC1A 1MPXA 2W2IA 4QX0A 1JI6A 2RS52 5D8AA 2QQWA 2CV6A 3RYKA 1YQCA 4CUCA 3H1YA 3SITA 2DU1A 1SCSA 1O59A 2QZ3A 2V5YA 2WS91 2JDKA 4DS0A 4NIHA 2EXIA 2B7YA 2RJKA 5E89A 3RZLA 5LA1A 5A7WB 2B46X 1AL22 4NMIA 4GB31 1YI9A 4PJYA 5CZKA 4HN1A 4PDWA 3WQ0A 5I8TA 2E33A 3VD3A 1S0GA 4XJZA 4BE3A 4YARA 3BCWA 1N1VA 2H6CA 1DYOA 4IEUA 5FYCA 2YGMA 2E63A 4CZSA 3DKQA 1H1IA 1U12A 5BY5A 5FMCA 3VDBA 1W99A 4RA0A 5L36A 3EMRA 2NM1A 2ZGKA 4QGNA 1WW4A 3VBSB 1Y7BA 1D4VB 1HN1A 1MEC3 1WCQA 5FY7A 3T08A 4IEOA 3VZOA 3N36A 5JAXA 5IT6A 4FI9A 1W2NA 3R4SA 3APBA 4CEYA 1ND3B 2ZS6B 1O4TA 4IEZA 3KV9A 5LK5A 4I0AA 1F8VA 1EAH3 1ULFA 4UWDA 2XB6C 5BNOC 2A6XA 1QNYA 3MICA 2ZMLA 3BVCA 2AR6A 4H14A 5CB7A 2D6NA 4QHOA 1K12A 4XZPA 4LK7A 3C7OA 4UW3A 2RG4A 4XBLA 4D6RA 2ZGRA 4WVMB 1LGNA 4QXCA 5BNNB 1GP5A 3ETPA 3UKVA 1PVC3 4N43A 5FJKA 3WHTA 1ULCA 5DZEA 5T5PA 5F3GA 1SDWA 1JUHA 1K5MA 5FY5A 4XUOA 1RUJ2 2C4XA 5I0DA 3I3MA 4KBBA 1G9CA 4O61A 2CAVA 4COUA 3AKSA 1HB1A 4MGTA 5A7WA 1QIQA 1JXNA 2ZHLA 2XLFA 4LO6B 1OA2A 1YXWA 3KQRA 3KCXA 2D3PA 4ZXEA 3VBUA 4OUSA 1W8TA 1X36A 4META 5IK5A 1KDMA 4GQ7A 4YM2A 3SMHA 5KXBA 4Q4X3 1CGPA 3I2FA 3OUJA 2AREA 1F15A 1A6CA 4HVOA 4JX0A 4CU8A 2P3KA 1S0BA 1QXPA 1DGWX 1H8TB 1JS9A 2LW8A 3PVNA 5FBJA 1QJY1 3EO6A 3I8TA 5KC5A 2UY8A 1US2A 2P6CA 3SCGA 2O1QA 2YC2A 1UU6A 1IS6A 4BMBA 4Q8LA 1QJX2 5A6QA 2RJLA 3ZYBA 1I1EA 1LNSA 2ES3A 3ZMOA 1LEMA 1BEV2 2YBSA 4Y22A 5DAWA 2OPWA 2PQQA 1LJ7A 3JXSA 1ZZ7A 5C4WA 1RHI2 5JDBA 2XBO2 5IVVA 4LBKA 1AUYA 1GNHA 1SFPA 1VBA3 2PHWA 3KT4A 4HSLA 2XHNA 4Q29A 5J98B 3W9AA 2D6PA 4CCLA 3MI8A 5GJ6A 1F4AA 5GKAC 3WX5A 5BNNA 3NJYA 5EWSA 1GWKA 4HXCA 1N3OA 5A1FA 5JOZA 1XRUA 1ND2B 3N7LA 4JGYA 5C3RA 1Z7S2 5IAXA 5A3NA 3JB4C 4V1PA 5APAA 3ENRA 4CVUA 1IG3A 3A0NA 4XC9A 2EIGA 2OVUA 4LORA 1QQP1 5FPLA 5FYSA 1W9SA 1XC6A 3K4AA 3U1XA 2P17A 3SH3A 3ZXDA 4NIDA 1HXS2 1EYBA 4NROA 1QWRA 1O91A 1OFNA 1ZBE1 2RS32 1LAJA 1EY2A 1JYCA 3KHCA 1GZ9A 3ZM8A 2R041 2GC0A 4MXWA 3VD7A 2VBDA 1W39A 1UYYA 2VW2A 4XCBA 4P9XA 3SKVA 1TE1B 3ZXEA 2A7AA 3LF7A 2WO7A 2FMDA 2AZ5A 1ZA7A 2VMFA 1JZ4A 1AYN3 3H8UA 3RZJA 1VRH2 4HKOA 4AQ2A 4QX5A 2ZTNA 1FV2A 4WM7A 1OD5A 1ASJ1 5FZIA 1R082 3MIGA 3AZYA 2ZKLA 4KL1A 3RZMA 5FP7A 3VBRA 1ODNA 4BB3A 4XAAA 3MV01 1PGW1 5EJ1B 1YFXA 3POEA 3ZMNA 2QFEA 4FT8A 5C8CC 2P6HA 1G86A 5JLVA 3ST7A 5CFDA 5ACA1 3I7DA 1KFXL 4XE9A 5FYTA 1XNTA 1WLTA 3OGSA 4ISRA 4CCEA 5E6HA 1PZ9A 2W47A 2WR9A 3KF5A 3PTYA 2WABA 4KGGA 4QKDA 1GOGA 2ZX1A 1AVBA 3KWVA 4A7ZA 3ZFEB 4OI0A 1ALYA 1W06A 5CU1A 4Q4Y3 1UY3A 5LWBA 4COVA 1W04A 3T0AA 4LLFA 5A33B 1DGRA 3MIFA 1FPN1 2JXAA 3DPRB 4IE5A 4XQ4A 3ZFGC 1NLQA 1U0AA 4YG3A 5LK7B 3OOXA 1LHOA 3BPZA 3KB5A 3F95A 5BXXA 2A70A 1GZWB 4XDPA 4K7JA 2BEOA 5F39A 1W6QA 5LBBA 1FMD1 2AGSA 5JIAA 4PHZA 3VBHC 1TME3 1JHNA 1IPJA 4I3PA 4XJUA 3N9QA 2C9KA 2PMWB 5LA2A 2XHKA 3PHMA 4MV2A 3ZN6B 5A3TA 2Y6LA 3DF0A 2EAKA 3A22A 4KWJA 3T2OA 3NWKA 1QJEA 2XUMA 3KT7A 3Q8EA 2PYTA 2RS53 1W3VA 4O65A 1NA1C 4AXOA 4EN0A 5FDBA 3V0AB 1RUH1 4QWNA 3AVSA 4ZU5A 2NN8A 2BGPA 1OLMA 1ZBA2 3ACFA 1AR82 1OOPB 3T30A 5CYYA 1ENQA 5FZLA 3FUQA 1AL23 5I8SA 3NVCA 2JEMA 4XAEA 4RS5B 1WMXA 2AENA 1LOGA 1UPSA 4ZU4A 5FPVA 5HXVA 3WDWA 4CPBD 3FWEA 2HEYF 2PTMA 3OD4A 2H0BA 2QQIA 4I02A 3EJKA 1OH4A 4YVSA 1UAIA 1UY2A 3H8RA 2WT2A 4GKYA 2QQVA 4M3CB 4E4DX 1PZ8A 4OQ8A 1NCRA 4YGEA 4W6WA 4QGLA 3V0BB 4CEWA 1PIV1 2WA3A 4COWA 4QAWA 1CX1A 4ES8A 1AR92 3POSA 2BPA2 2QCSB 2VQ0A 1OH3A 3AFKA 1H6YA 5IK4A 5L7OC 2PAEA 1R1ZA 4AGVA 1PMIA 1VMJA 1CONA 2VOTA 1ZZ8A 5FIXA 3ZXGA 4E27A 5JSRA 5FYMA 3ACGA 3BTXA 5EV7A 4ASMB 3VZJA 3WV6A 5D21A 3USUA 5L9VA 3I97A 3LD8A 4XW3A 1RITA 3OY8A 3BU7A 3LCPA 4GKXA 5L19A 3U10A 1KJLA 5BNPB 2QDNA 4CSWA 4F8AA 2J7MA 4FFFA 1VAMA 1NA1B 3DYMA 4MH0E 1RUC2 4D7YA 4DY5A 3FN9A 4BXSV 2ZZJA 3QD6A 1A3KA 4NHMA 1RUJ3 3UKTA 2JDHA 2X10A 4AEDB 1CD3G 1R091 1IPSA 1H4GA 2GSYA 4MOAA 4XEZA 3QBQA 4IGOA 4YFWA 4PLMA 4Z07A 4JGZB 2MEV2 4PF1A 1XU1A 3GHNA 3DL3A 1VBC1 5LY1A 2YC4A 3UGHA 3PIJA 5FMOL 2ZEYA 1QXRA 2WN2A 4HVRA 4RQPB 4YW7A 5JUVA 4EV0A 2VMIA 4P9WA 4IXLA 3HIFA 3LKJA 4NRMA 5FYYA 1UYPA 1UX6A 2F6BA 5DDJ1 4YM0A 1SLTA 3ZYIB 4NHKA 1E57A 4ATEA 4WBBA 1G8WA 2JKXA 4IV1A 5I0TA 1U5XA 1WA4A 5F5IA 3KLSA 4S2FA 1BMV2 2AACA 3WCSA 4XF3A 3WHUA 2VMDA 4XQWA 1QJX3 3S5AA 2C26A 1OKQA 2ORXA 2Q8EA 4HVQA 3UNPA 2A1XA 2ZABA 3OGRA 3TNQA 1BEV3 1RUE2 3NRUA 5FLJA 3T2PA 4BQWA 3QLQA 2OYZA 1NZIA 4ASLA 5FZEA 1CAUA 1RHI3 2XBO3 1DZRA 1DIWA 4CUGA 5FO9B 5JWPA 1BK1A 4P9IA 5T55A 2BBVA 1W3XA 4XCAA 1LEDA 1ULGA 2UWBA 2BTVC 1MEC1 3IDEA 2XVKA 4ORFA 4Q8KA 3DV8A 4QQLA 3J7NA 4Q0SA 3IIIA 1ZRDA 4XDOA 5F2SA 1V0AA 2X5IB 1Z7S3 2QQPA 2B8MA 1GQGA 1EAH1 1L7RA 1RL3A 2P2KA 3OBAA 2RM22 4AVBA 3PVOA 4C90A 4IV3A 1NXMA 2HWF2 2KD7A 1LKNA 4NR1A 4WZFA 4XBQA 1CVNA 2PLV2 1HXS3 1LHUA 1WLCA 3BODA 4RQPA 1MZ6A 3R05A 2RS33 4XUPA 5H9QA 3P1IA 1PVC1 3J26N 1KJRA 3LDBA 3PLQA 3JQWA 2Y6KA 4X6RB 3J9SA 3OF1A 3M3QA 1HQWA 3HOBA 1TNRA 2GDFA 3CJIC 2JG8C 1OSGA 2WQ4A 2VTFA 3B9IA 2QQJA 4LBMA 4BLIA 2BWCA 5FZGA 5EYXA 4QXKA 5JCTA 1UF2C 1RUD2 1H4HA 2D5HA 1VRH3 3UT0A 2XQRA 2QBXA 5JXHA 4QPGC 5BNQA 1AL0G 3D3AA 1Q8OA 1RUF2 3VUOA 2X09A 3HWJA 2NMNA 4LXLA 4Q4X1 1R083 4LTAA 4Q0VA 5DG2A 3KS7A 1FAYA 2WBKA 3RI9A 1GP6A 1X50A 2PHUA 2ORZA 1AR72 5KXEA 4GIQA 1Q56A 2BNNA 2ZAHA 2XJVA 2W1QA 2P3YA 3BN6A 1SBEA 2VZSA 1YIPA 4ZZ8A 3GBFA 5GLTA 3VKMA 4CRQA 4Y5TA 4YW3A 2L9LA 1COV2 3B3QE 1OPMA 2WO2A 4GMP3 4O7XA 4LA3A 4EYUA 1KS4A 1W9TA 1MACA 1XE8A 1MS4A 4L0PA 3WP5A 5CBLA 3FZ3A 2W39A 1UN1A 1YWKA 1Z78A 4Y4YA 4AVAA 3HR9A 2BV4A 2W9XA 5FAXA 3IMNA 1J1LA 1VBA1 5FBZA 1CX4A 1ZX5A 3J8F2 4XZUG 5FK8A 3ZIWA 1CAXA 4NIGA 4YW2A 5FXZA 3KGLA 3TOJA 4Z8BA 1MVEA 4BQXA 1BCXA 2LM3A 1PNGA 1S1AA 2JG8B 3PURA 1JZ6A 4XMAA 1H8VA 5FO7B 2NZ9A 2DUQA 5LY2A 3DECA 2Y6GA 2BVBA 3EHKA 5J96B 1JU4A 1ZRRA 5K0UB 3PJQA 4CXYA 1VMHA 2XONA 4GALA 4CDQA 4DO0A 4EN9B 3LZZA 3GGLA 1W2AX 5IFPA 3JCIA 2DURA 1QF3A 1UKGA 2V73A 1QHDA 1OA3A 1E5RA 2E6VA 2HEVF 2JECA 2ADEA 2P37A 3BPSA 3KSCA 3LA7A 3OBTA 4QPYA 3SCFA 1XYOA 2W1WA 3ZPOA 4BJ0A 5FY8A 4MUVA 4YZ4A 1ZBA3 3HT1A 4CU6A 5HPOA 4FP2A 4QPIB 5C5TA 1NKGA 3K4DA 2B5HA 2OUHA 1IOAA 2NMOA 3I54A 1EUTA 1V9U2 3VHNA 3FFQA 3QH7A 5JZGA 1F5JA 1K5JA 4I0BA 2WIIB 4XF0A 3FMGA 3W21A 5DUXA 3O1VA 2J22A 1YC61 1TEIA 1AYN1 4KWUA 3GZTB 4KU8A 1H2MA 3HQXA 5C8WA 4YW5A 2VR4A 4JHZA 4CCKA 4ZKTB 3AKPA 5SV8A 2WO1A 2NLRA 4KH9A 4OCTA 4TN7A 1AR93 1LTEA 3U4XA 3ZKUA 5GZDA 2A6ZA 3O1PA 4MX3A 4FOVA 3RI8A 3PU3A 1CZTA 3AB0A 3GJAA 4BK4A 5FY0A 4QHBA 4FVVA 4B7KA 3D0SA 4AEJA 3PUQA 2RDSA 4CDXA 2WT1A 4YG0A 4GA9A 4LQRA 2GH8A 4GJZA 4JV4A 4GH4B 5EYYA 1REDA 3POIA 4CDWB 1O7FA 4FPCA 4Z82A 4LKSA 1FNYA 5FUNA 3UGFA 4A7YA 3WP3A 3A21A 2Y64A 5E1RA 4Q4Y1 1RUC3 1F5FA 1W6MB 2D6KA 2I74A 2R7EB 3ZXFA 1RB8G 1QEXA 1SFYA 5HV4A 1XBFA 3TWIA 3UETA 4YFZA 2VZTA 4AI2A 2IUWA 2VTXA 2VUDA 4M4PA 1U5ZA 3K4ZA 2ZX4A 4FFHA 3EBRA 2MEV3 3KZ4C 1NQJA 1GICA 1FOD2 5H9SA 2JJ6A 1JYNA 1CJPA 4AWDA 1TME1 1S4CA 2VZUA 5F37A 5E16A 4HK8A 3GCXA 5FQ0A 2QUOA 3JD72 5KHJA 3OPZA 1OI6A 2ZGOA 2WNOA 1CJDA 2E7QA 3HN3A 5GLZA 3S0MA 1WKYA 4QD2A 3VBFB 3WDVA 3LFMA 2RS51 3OPTA 3J7HA 3VLBB 1ACCA 1KITA 1SDDB 3RYRA 4I01A 2O8OA 2ZGTA 4GD4A 5CKQA 3O12A 1Q3EA 4QB1A 3O0WA 1AL21 5D8AC 5JR7B 2Z69A 1EPZA 1YFYA 3IKWA 4WM8B 1DDLA 2Y6JA 1FT9A 3ITQA 4LE4A 1X9PA 1O3SA 1RUE3 2I2SA 4UW6A 2GMPA 5FYUA 3T4HB 4N7UA 3AVRA 1VAVA 4GH4A 2DCTA 5DAPA 4INDA 2YC0A 1O5LA 4ATFA 4UBHA 4P00B 5D2AA 3TN92 4M0NA 2GN3A 4AHYA 1V6MA 2WNVB 3UL2A 4FOQA 4XIKA 3ZFFA 2IXHA 5FCCA 2DCJA 2VUAA 4QGMA 4IDZA 1L7QA 5GLVA 4DEVA 4LIUA 2K2SA 1GQPA 3OUHA 4IE7A 2YPDA 1XSRA 3KM5A 2EAAA 4K1YA 4BQ5A 1CESA 5AC92 1O3QA 2CSGA 3IZOA 3B9CA 5ABJA 2RM23 3POWA 3H7JA 2HWF3 3NW4A 1C5HA 1GOFA 2X53S 1TMF2 2GMEA 2PLV3 1PO12 1W8OA 5CIRA 3H7YA 4X8PA 4J1XA 3MW3A 1RINA 4N9HA 1AXZA 1SLAA 2RJ2A 1UOBA 4YVWB 4CCMA 2VVFA 1H2LA 1Y43B 4AFDA 5J09A 3M3OA 1I5ZA 3FUOA 3FLRA 1UNBA 3RJ2X 1RUJ1 1HB4A 2Q8DA 5T52A 5FOBB 4N43C 4L92A 2RHPA 1KGYA 1HIXA 2OQ6A 3MO4A 1DLLA 4LULA 4Y5SA 3WF0A 2TUNA 1RJ8A 1UCXA 1W8WA 2VUJA 1RUD3 4BQ2A 3AJYA 3S7IA 3SHRA 2J1RA 4PDWB 1PO22 1ZREA 1RUF3 2ZGLA 2WAAA 5IJRA 2RDQA 3I49A 5HI0A 2IFRA 4Y26A 2IXIA 2YGLA 2ZX3A 1MS5A 4DINB 4L8QA 1AR73 4OYUA 4BQYA 2ZMNA 1QY4A 1S55A 1TVGA 3N9NA 2J1EA 5LZ6A 5F3EA 1IS3A 1UZVA 5F8PA 3L2HA 1S2BA 1YCIA 3K77A 3WDUA 2VBPA 3HVDA 1COV3 3SNMA 1OVPA 3FE5A 3GJBA 4DB5A 5FY4A 3VBSC 1QJX1 5HXMA 4C0HA 4CEYB 1POQA 3T3YA 3OCPA 1KQRA 4PQ9A 3LEIA 5F3IA 2UYAA 3S7EA 3W58A 4BISA 4DQAA 4AE2A 5A3PA 3NKGA 1BEV1 1UY0A 1ND3C 3AMNA 4G4FA 4SLIA 5FZFA 4HZFA 1RHI1 2A3XA 2XBO1 4XUTA 5FV3A 1JOPA 4XFFA 3LEGA 3J8F3 1VALA 4YVWA 3BB6A 3WXPA 1ENRA 2G9ZA 5KR7A 2CGNA 3VN4A 2BW8A 3ZKYA 5IFTA 1V6IA 1XB9A 4J25A 1FYUA 3KVBA 3JU9A 4Q27A 1WLWA 1V6KA 2DTWA 4CXWA 3WG3A 4JQTA 3ZVXA 1K5MB 5BNNC 1VJ2A 1Z7S1 1POV3 3WNLA 3BOWA 4AFBA 4GWJA 4QM9A 4M3CE 2UY9A 1Q8SA 2VVDA 5FUPA 3BALA 3AM2A 2F4LA 3NV1A 3WVJA 2EIBA 3QOPA 1HRI2 4JDNA 1HXS1 4DFSA 1YEWA 3VBUB 1V70A 4XFAA 1B35A 3WG4A 3FLPA 1CZVA 2RS31 1YJKA 2UWCA 2ZX0A 4IERA 1UMZA 2ERFA 4Y20A 4BYYA 2H0VA 1IZ3A 1B09A 1OLRA 1SZBA 4IGQA 3CQOA 1CZSA 1WCDJ 4JDMA 3ASIA 5DPNA 3H8OA 2HEWF 4YG6A 1E5SA 1SLIA 4MGQA 1V9U3 4ARXA 1QJU2 2YU2A 1H8TC 1KD7A 5A80A 2X29A 5C3OA 3B7MA 2GNMA 4CCCA 2W92A 3HT2A 3GXUA 1VRH1 1NOVA 3HQRA 2CNAA 2PHRA 2EXJA 1HJFA 3N7MA 4YGCA 4YGBA 5FZMA 3UJOA 4DPNA 2WNEA 4NIIA 1R081 3B02A 4FXKB 4Q4V2 4Y22B 5IVCA 4PIZA 5C4WB 5CADA 5KBFA 3FJSA 4AL9A 2YFUA 4FFGA 5EPAA 4LO5B 4XF9A 4EN8B 1EPWA 4N53A 4QX3A 1AYM2 2VCAA 4AQSA 1Y3TA 2WN3A 1OUXA 4I3GA 2EXKA 4IL7A 1ST8A 4Y1UA 2FDFA 4X8NA 1NT0A 2JG9A 1BZWA 1J84A 4GMP1 2XVLA 4URAA 1ZA4A 2IVIB 2ZGSA 1PK6A 4JGYB 3O1RA 3KHBA 5JMOA 4UFIA 1W03A 1YNAA 2W0XA 4CXXA 2DVFA 1UY1A 1ND2C 1LOFC 4I2OA 2HBTA 4ZS2A 3GZEA 2YBPA 4YW6A 1NAEA 4P9LA 3GZUC 4DY3A 1C5IA 5T5OA 3RPQA 4GZ9A 1UX7A 3VZKA 4FAGA 1J58A 2FZ2A 1REFA 2JIGA 2BP6A 2VZVA 2O0OA 1HJGA 2ZZQA 1T6BX 3JBG2 4G3YC 1UWWA 4MXWB 5HCFA 3N4MA 4YZ2A 2BYVE 2IZWA 1URXA 3LSDA 2HWB2 3HAGA 4BOWA 3JZVA 4UYBA 4LA2A 1HB2A 1MS1A 4JRAA 3U0ZA 4DXRA 2BOIA 4AHXA 3JD73 1JTZX 1J1TA 1FX5A 1S0EA 1W9YA 2R062 3DKWA 4GWNA 4G9SB 3WSOA 1HB3A 1QOTA 4IGPA 5GLUA 4FPEA 4WM7B 5FYIA 3NV2A 1LESA 3ME2A 5B4XA 1GWMA 4S2HA 4FOYA 1ZBA1 1GFF2 3VBOA 4CDUA 2JDPA 4QB6A 4JKMA 5ERLA 4KWKA 1PX3A 3H50A 3VBRB 2VC9A 3H3UA 4LLOA 4Q4W2 1C8M2 3WINE 3HEIA 1OA4A 4XDQA 4N90A 4EWEA 2Y33A 1FV3A 1APNA 4B1MA 1UPIA 3I4IA 3N35A 3VD9A 5AVPA 3CBNA 3O7OA 5CFDB 2NPIA 1BXHA 5C33A 2P1BA 4XXAA 2BGOA 4AK3A 1Q8QA 1YJLA 1W05A 2GAUA 5DZGA 1NZCA 3VHOA 1ULPA 4QXBA 5EIYB 4FPYA 4QQ2A 4UFLA 1SPPB 3ZYRA 3TEYA 3I2OA 1SHWB 4KBZA 3TN93 5JSPA 2OIIA 4P9JA 3RQ0A 1PGL2 2WNUA 3WQBA 1WW5A 2WA4A 3LPFA 3M3IA 5IW0A 1H9WA 1AR91 3POYA 2IVJA 3ZFEC 1WUVA 1AR63 3G6JB 1NCRC 4FFIA 1KRIA 2JD4A 4KU7A 4SBVA 3TEZA 5AC93 1XJAA 3WDYA 3K75B 3DPRC 3H8XA 1QGLA 2WFPA 2YZ4A 1KDKA 4KQ7A 5DUVA 3MIBA 1TMF3 2PN5A 2OXBA 3ABZA 4Q0UA 1PO13 1W6QB 4TLGA 2V4VA 3VL8A 4AVCA 1G9DA 1S0FA 1IS4A 1W0NA 3PTRB 4QKBA 4R9AA 5FPBA 2VO5A 5FREA 1DQ4A 3RNSA 1DQ5A 1QKQA 3ZDSA 2XJPA 4BMEA 1UZWA 5EFUA 3SQOA 3DGTA 3AL6A 1RUC1 2RS12 3HQUA 2DDUA 4LK6A 5HV0A 2Z2SB 3GNEA 1FXZA 1FATA 1RJ7A 3I3DA 3N7JA 4PQQA 4W6XA 3ZLIA 4IE4A 5BUVA 1AJOA 1NY72 3B94A 4FO9A 5C6CA 5ANQA 1MS9A 5C3QA 2MEV1 4AFAA 1W9FA 3S57A 4LO7A 3I3EA 3KV5A 1OF3A 4JKKA 2Y6FA 1O4ZA 1OOPC 1NCQA 2ENRA 5GALA 1CR7A 1WMEA 2BU9A 3DN7A 5FMBA 4EZ4A 5BNOA 3WQ1A 3K3NA 5FYZA 1C28A 2HBUA 1ZVFA 2VNVA 4IETA 4RS5C 5E8AA 2VW0A 4IQPA 4YVSB 1LR5A 1SPPA 1W2TA 4NHLA 1UKRA 2WAOA 2ZACA 1NCRB 4IEVA 3UYJA 4O9GA 3FHIB 2IXLA 5IYYA 2XQXA 2DFCA 1XNDA 3IT8A 4CEWB 4UFKA 4BU2A 3E1F1 1QJFA 2BVVA 2JB4A 4IV1C 4P14A 3OPWA 3WNNA 4OHWA 2VNOA 1GZTA 4D69A 1RUE1 3VHRA 5FWEA 3WNMA 2RMU3 3TEXA 1HRV2 5CAZA 4JZRA 4B8EA 1YHFA 4Y1XA 5IUQA 3USUB 2CAUA 1LCLA 1O4YA 3OY8B 2P3IA 4QPWA 2WUHA 2VMHA 4ZPIA 3AP7A 2WZR2 2PHFA 2FHRA 4NAOA 3K48A 2RDNA 2VZPA 1IS5A 5BNPC 1F35A 2WQZC 1DGWA 4HPKA 4WVWA 4OLLA 4HBNA 3C8XA 4CUAA 2Y60A 3N9OA 2RM21 4UI9L 2UWAA 4DUXA 2HWF1 2VNRA 5IVEA 3LE0A 1JZ2A 3ZN5A 3MF6A 4AEDC 4DEQA 1Y9QA 2PLV1 1RIRA 2QQLA 4A6SA 1LECA 1HRI3 1XNBA 4L2NA 5A3UA 4JGZC 2QQUA 3IIAA 2E53A 1JHJA 2R072 4IV3C 4S2GA 5FOJB 5FZ0A 4A4AA 2IC1A 5I91A 3MF9A 1OD3A 4RQPC 3I2DA 5F6KA 3WDXA 3ZR5A 2J1SA 4XTPA 5J7MA 1AJKA 2Y0OA 1SMVA 2XJRA 5A3OA 1MZEA 1QJU3 4PIYA 4IV1B 3OGGA 1IKQA 2VZQA 3AMPA 5FZ3A 4AZZA 4BDVB 3SCHA 5I0SA 4ZZ5A 2C5DA 2XJQA 2PHLA 1RUD1 4PIXA 4UF0A 5DXDA 2W1UA 4BQ1A 2P4EA 2VOWA 1PMJX 4LBQB 3I2IA 1C4RA 1RUF1 2Y0IA 3AXDA 4UAPA 5CFCB 4I09A 2FCVA 1IKPA 2WYFA 4Q4V3 5A3WA 3F2ZA 2BRTA 1CAUB 3O1OA 1K45A 2FDHA 1AR71 3JQXA 3L9JT 3NL1A 5DUWA 2PELA 4UW5A 1AYM3 4FTSA 1WZXA 1LULA 2OUJA 4W4ZA 1SCRA 4MADA 2VUCA 2XWJB 1ZRFA 4LOTA 1JW6A 1COV1 2ATFA 2AUYA 1NLSA 2VCBA 2X8KA 5LASA 3ZXKA 2YMZA 1S2KA 2GNBA 4BLJA 4K20A 3KVAA 4K1ZA 5FZ9A 2X5IC 4IV3B 1DYPA 3MLKA 3J7MA 1RC6A 2IFWA 3ETQA 4HLTA 3S6PA 4EWAA 3RG0A 2BDRA 4TZDA 3J8F1 2W1SA 1H2NA 4GJYA 5DZFA 1GANA 4RN5A 3THDA 3J4UH 2WWUA 3JBG3 4YPJA 1VBB2 2GP5A 4E9KA 4LO4B 4D7SA 1CQ9A 1N1YA 4LOSA 3AYEA 5C3SA 3WD5A 4XFBA 4BHPA 1POV1 2HWB3 3CO2A 3M1HA 5C8CA 1W6OA 1O5UA 5LEJA 1MVQA 1W8NA 5H9RA 2WWJA 2D44A 2VL4A 3C7HA 2FQPA 4COYA 1BLZA 4LBQA 4IEYA 3WZ1A 3AKQA 3IM0A 3GF6A 2X05A 1VBE2 4W65A 5CFCA 3VD4A 2WJSA 4CE8A 3MUY1 4Q2FA 2DBNA 4PLOA 1KEXA 3V64A 2VBBA 3TRSB 3C3VA 3ZFGA 1XNCA 3LB9A 2HWC2 4Q4W3 1C8M3 3VHPA 1ZM1A 4H55A 4A6OA 5FZAA 1ZRCA 3T1LA 1V9U1 1EV12 1JMUB 3IPVA 1PZ7A 3ILFA 4D6SA 5A6YA 2VQTA 5C5UA 3SH5A 1MS3A 3WF2A 2Q1MA 4MZUA 4WZCA 3OBRA 1V6JA 3Q8AA 3VBHA 4LKDA 5C3PA 2R1BA 5JZGC 3IBMA 1Z0HA 2VMGA 1J3QA 1RMU2 1DP0A 4F7ZA 5K8SA 4QKFA 1SFNA 2Y8KA 1I6XA 4AI0A 3SISA 1CAXB 3K46A 1CAVB 1LOAA 2DCKA 2ZCWA 4PCRA 2WWSA 2EXHA 1O6UA 3EXUA 5EZWA 5JI9A 5F5QA 1LRHA 2Q0AA 5LEKA 3B00A 4MGYE 3U14A 5FZCA 4MHUA 3CNAA 2WLQA 3I2JA 3VV1A 3ZYFA 1WD3A 5IATA 1SLCA 4ZHNA 4R9BA 4BIFA 3NNGA 2J1UA 3GM8A 1OF4A 2ET7A 2A5ZA 1RXFA 5F32A 4CDQB 1HV0A 2TEPA 3WF3A 4AFMA 2RS13 4P5YA 1Y9GA 4W8JA 1ZZ9A 1G6NA 2D6OX 4AQTA 3ACHA 5K0UC 1F31A 1QJZA 2EVXA 1G9BA 5KXDA 3ES4A 2OZJA 3H1WA 3FBYA 4XABA 3MGUA 1G7YA 2XR4A 4FPGA 2JDAA 5A70A 3V56A 5L7OA 1KS5A 3AMQA 4P02B 4QPIC 4AW7A 5JZGB 2IWGB 1OLQA 4BK5A 2OQ7A 1UMHA 3JD71 1VBD2 3ZYJB 3ILNA 4JRLA 4GWMA 4XQDA 3UGGA 4FSJA 4UW4A 1DBNA 2EIDA 4D8MA 2CL2A 1YQ2A 5A7SA 3AL5A 2DVAA 1D4M2 3A4UA 4FPOB 3OEAA 2D93A 3KV6A 2BERA 2YY1A 1RUI2 2QQNA 4CCOA 1YO8A 1CAVA 2ZHKA 1H9PA 3LGRA 3WUCA 4AGGA 4YZ5A 3NAPA 4XFHA 2WRAA 1WCUA 4TTGA 2W08A 3AX4A 5DUUA 1V6OA 3OSDA 5FZOA 2CHHA 2AEYA 2J1AA 5BPXA 1LU1A 2HJIA 1HRV3 4CDXB 4DOUA 4HSJA 1SBFA 2VE1A 5T5LA 2ARBA 1OPOA 1GNYA 4XVHA 2OT7A 3TN91 3AZWA 1FI2A 5DN2A 1A78A 1GR3A 2WZR3 1K3IA 4I0WB 4OVEA 3CHXA 4GH4C 4X6QB 1HX6A 4CDWC 5JPNB 4W50A 5FPAA 1AR61 4Q5OA 2A73B 1UL9A 1H6XA 1H0BA 1VPHA 3MW2A 5AC91 3ZFFC 3MBWA 1UYXA 4HOOA 1AR83 1UOJA 2FDGA 4Q0QA 1DF0A 3VKLA 5G04L 1TMF1 4YYOA 1PO11 2VAUA 3G7DA 2W52A 2WSVA 1FNZA 2WINB 4R9CA 2UU8A 5ABJC 1RUNA 2R073 4Y4RA 2W68A 5HCHA 4OZXA 5GZFA 3T09A 4RR3B 3WW4A 1ULDA 2V09A 5FQ0B 4E4SA 1UYZA 3PJYA 2JENA 1Q5OA 3PMSA 4XJWA 3URFA 4BH9A 2G1MA 3KMHA 1MS8A 4LBLA 1NYWA 4R4ZA 2D43A 1D2SA 2JDZA 3VBFC 1CIYA 3WNOA 5KWRA 2OA2A 5AFEA 4RYDA 3Q8BA 5F2WA 5T54A 2C6SA 4UFHA 4AAPA 4DRVA 3WW1A 2VECA 3VKNA 2LALA 3FFZA 1JH5A 2BOJA 4XF4A 4BXFA 5A32A 3NV3A 2E26A 4QU2A 4WM8C 4EQVA 2OS2A 1OQEA 2VD7A 1DQ2A 5FY1A 3M4FA 2XXZA
chains in the Genus database with same CATH topology
2VY0A 5I93A 2ETEA 2A6YA 1N3QA 2GC1A 1WD4A 3ZFFB 1NG0A 3HN1A 5JMCA 2NYYA 2GH2A 4NPRA 2WNVC 3CJIA 5T3NA 5LRRA 4AI8A 5I0RA 2VOXA 4FPJA 5ABJB 4YM3A 2A3YA 2RMU1 5CVRA 4EJRA 4F83A 4QPGA 5T5JA 1WBFA 3D0JA 2CY6A 2D97A 4RR3A 4AGRA 5BV6A 1VBB3 2BNMA 3GBGA 1D0HA 3I59A 4YVWC 2QE3A 4XHXA 3C2UA 2CWMA 1SEFA 1V6NA 1RGSA 2QDRA 4R4XA 2Z5WA 2XJUA 3QACA 2XKOA 4XFIA 4H3WA 4LEJA 4QM8A 1HRI1 3WW2A 1VBE3 1LHVA 4BIOA 4KG0A 3SXWA 3P3PA 4AVVA 4PDWC 1WGPA 2WT0A 2HWC3 1OQDA 2DYCA 1Q8PA 1YRZA 3FX3A 1EV13 1LOCA 1QJU1 1HV1A 1CPNA 2QNKA 3U07A 3WG1A 4PF5A 2WC2A 5CG9A 2ET1A 1R1A2 4R9DA 3E5UA 4Q4V1 5I0UA 1RMU3 4CEYC 2D98A 2BNOA 4XPVA 2DVGA 5JOXA 2HYKA 1LGBA 1AYM1 5AFBA 2BGCA 1CIWA 3RRDA 2ZKNA 4XF1A 3AP9A 1UIJA 3N7KA 5FLHA 4MVTA 5TSWA 3AJZA 4HFSA 2OPKA 1OFSA 2YHJA 4YW1A 4L11A 2XJSA 5HCBA 2WFF2 2JG9C 1K5MC 3LSEA 3B93A 1UU5A 4F3JA 1UZZA 5FPXA 4ISQA 1B35B 1X8MA 2C0ZA 1C1LA 2D6LX 3JBG1 4EN6B 5A3MA 2Q1ZB 4Q1RA 1AYN2 4Y20B 3VGIA 3VBUC 2JE7A 1MZ5A 1N1TA 2MNGA 3L2YA 2HWB1 4OI1A 2Y26A 3NV4A 1VBD3 5FFOC 3S30A 2PFWA 2HKXA 4RHV2 5LRSA 1MQTA 1WW7A 3GZAA 1D4M3 4XETA 1YLLA 1H1AA 1S0JA 1NQDA 1RUI3 2I45A 3M3CA 4Q4W1 1C8M1 1G9AA 4AFCA 2DTYA 4N53B 4JCKA 1YFUA 5C4WC 2Q30A 3ACLA 2QVSB 4NO4A 2TBVA 2B9UA 5GLWA 2RR12 2ZGPA 2JG9B 4H7MA 2BFUS 2HWE2 2E7AA 1PK6B 3MLLA 2ZAAA 5KHIA 5L73A 1ZZCA 4FXGB 2GNDA 1PGL1 1RVF2 2A6VA 4JGYC 4NVPA 1YIFA 4JQRA 1S0CA 4YZ3A 5JIUA 3CLPA 2CYFA 2ZBJA 3KGZA 4IESA 4LNVA 3LOIA 4IEQA 2WNUC 1AF9A 4LHNA 1OQ1A 1WCSA 2XL7A 5B2GB 1A8DA 3NJZA 2K9ZA 1AZDA 2ZGUA 3ZSMA 3AP5A 3AZXA 4M0HA 5GZGA 2R49A 3K51A 4FP3A 4E2GA 2GMMA 1C8NA 4QQHA 2RS11 2JE9A 1LOEA 3VDDB 2EALA 4B4PA 4YM1A 4AVTA 1YYNA 3ILRA 4QT6A 2Q8OA 4LE3A 1NY71 3VBOB 3PVBB 3ZPYA 4CP2A 2G9GA 4CDUB 1WW6A 4WM7C 4U2AA 5IK8A 4W6YA 2GC2A 3VBRC 1W0OA 2A3WA 1W6PB 4ITCA 5C9AB 1TNFA 1BVP1 1MS0A 3B5LB 3TB0A 3ZSLA 4OHZA 1NCQC 3PNAA 4BZ4A 5CFDC 4C1XA 1LENA 2R0HA 4Q1PA 3WQ7A 1LOBA 3FBMA 2WNUB 3INAA 4I30A 3OYWA 3E5QA 3VL9A 1TQ5A 2DF7A 2FBEA 2Q4SA 5JI7A 3AK0A 4NWVA 2XH6A 1LGCA 1AX1A 2ZHNA 2TNFA 3R4UA 1JUIA 3AKRA 1NE4A 5IK7A 3CU7A 1W6NA 1XYPA 4L97A 5FO8B 3TAYA 1FOD3 1HRV1 4OUMA 1ONAA 2VULA 3WOGA 2NQYA 3O14A 3RMXA 1RUG2 2A71A 4N7IA 2KA3A 2B42B 1VB2A 2WZR1 4Y24A 4BCUA 3ZSJA 4GULA 3VDDA 4A7KA 3D6EA 2HWD2 2VQAA 5FRAA 3ZX7A 2Z42A 3CF6E 2FMYA 3ELNA 4ES9A 4LHLA 1AR81 2GNTA 4Y1YA 1M4WA 1QNWA 1BBT2 2DCYA 3AMMA 3VBSA 1JYIA 3MZHA 4J6GA 4P5HA 2YUEA 1DYKA 1NCQB 3CJXA 2R071 5BNOB 2XVGA 1W6PA 4KWLA 4DXZA 1ND3A 5C9AA 5KHHA 3ZSEA 2PAMA 1QH6A 2GALA 2CTVA 1ULEA 5HBAA 1X7NA 5JVVA 3AYDA 4YVSC 3M2MA 4JAAA 4FTEA 3GYDA 2PA7A 1YUDA 1C1FA 4COZA 4WVMA 2XL9A 2VW1A 1QMJA 3WLUA 2DVBA 1XXNA 1R1A3 1UD1A 2GN7A 4CEWC 4FCAA 1S0DA 4B4QA 1OMIA 1H2KA 3VKOA 5KC6A 1AX0A 4WVZA 1QDCA 2A6WA 2JKBA 2QZ2A 3TNPB 4JVAA 2DFBA 3AMHA 3AP6A 3M7AA 4C1WA 4YW4A 3WG2A 4DNYA 2WS92 1SQ4A 4K6BA 5T50A 4GB32 3ZXAC 2BWAA 3QCWA 3KCYA 4YRDA 3WDTA 3PMEA 4B4RA 2VU9A 2DUOA 4HT1T 4HPKB 1YFWA 1H8TA 4P9GA 2WFF3 3Q9OA 4B3NA 3IWZA 2AYHA 3KD4A 3MFAA 1PO23 1GLHA 4XXPA 3WUDA 4XBNA 1EP0A 1PNFA 4LO8A 3M8LA 3BIWE 1VBB1 4HMZA 3RSJA 2VOVA 2KXLA 2XPJA 1GBGA 1U5YA 4YZ1A 3ZO0B 4FBFA 4YLZA 4DRRA 3UJQA 1BMV1 2E51A 3GBWA 2EA7A 4D7TA 1ZZBA 2VXRA 4BA6A 2B45X 2XLAA 4U36A 2ZX2A 1VBE1 3AZZA 1XQNA 3NSTA 4RHV3 3VZNA 4JDOA 4XYXA 4C91A 1ND2A 1LOFA 1GYKA 1ZYBA 4FPKA 1DG6A 2HWC1 4OHXA 4EROA 5CFCC 2CGPA 4K9SA 1HLCA 1EV11 2P34A 4KG8A 3H0OA 2RR13 4FOWA 3O0VA 1H1MA 3JB8A 2HWE3 4R8HA 4QQPA 3FLTA 2VH9A 4K40A 1QOSA 1PHMA 3TBDA 4OI2A 3LOBA 3RZZA 1RVF3 4AEKA 4FTBA 1RMU1 3R0RA 3UKNA 1VP6A 5I8YA 4XHBA 4GMP0 4XJ9A 3THTA 1QJY2 4FPHA 5FOJB 2UURA 1PGSA 1OHFA 5JOYA 1IGOA 4TWTA 3WY6A 3ROUA 1HDKA 2D7FA 2YXSA 1QDOA 4K8FA 3SH4A 1T6GC 2WZPP 1AX2A 1C57A 4D94A 5F9TA 5H9PA 1BYHA 1DZQA 2QJVA 4FPFA 3UK9A 4YSFA 5C8CB 1W6OB 5DG1A 4M00A 4DMIA 4ZU7A 3NKTA 4AI1A 4AQ6A 4HKLA 2ILMA 1I3HA 4LBOA 4ONUA 4XJ8A 5CA6A 3E6BA 3AYCA 5A3LA 3ZIXA 1AXYA 2XG3A 3A0KA 1U5IA 2R6QA 3OJBA 3ZFEA 3ZFGB 3AZVA 5J3UA 2ZHMA 4HK9A 1DQ6A 4WVVA 5GM0A 1QQP2 5A33A 3R6SA 3DPRA 3IPVB 5E88A 1VBD1 4JTNA 1DU3D 2UYBA 2BUKA 1ZBE2 2SLIA 4URTA 3VBHB 1GZWA 1DGLA 2D40A 2ZGMA 5JOWA 2R042 4MGKE 2CWSA 3V65A 1D4M1 1CPMA 1DZTA 2K0GA 4L9BA 3WT3A 1RUI1 1RTVA 3ALQA 3RMYA 4N9IA 3ZN6A 2LUWA 2YROA 4EN7B 3MIDA 5HCAA 5BYNA 4C0BA 1SLLA 2PAKA 3V0AA 1ASJ2 3NAPC 4CTEA 1RUG3 4CP1A 1OOPA 2R16A 2YPJA 4KGQA 1PGW2 1HQNA 2GC3A 3H3ZA 3OTFA 4RS5A 2R063 1MZFA 3HMYA 2XKPA 2HWD3 3O5SA 5ACA2 1O3TA 2ZOEB 4CDQC 1NXD1 1GNZA 4XMIA 1DGRN 3AFGA 4YGDA 4OHVA 4XILA 3B69A 3X29B 2YDEA 4XTMA 1W2UA 2G9FA 4XFGA 4M3CA 4UBGA 1BBT3 1J3PA 2XGXA 5EXOA 4RGAA 3V0BA 2VPVA 1H30A 5FLIA 5J48A 5L7OB 3E97A 1LU2A 1XYNA 1FPN2 2D3SA 4NWWA 3TYJA 3HBZA 4NN0A 3WR0A 4HANA 3ZYGA 1XE7A 4IEXA 3QH6A 4LUKA 2DCZA 1FMD2 2P3JA 1BJQA 5JPMB 5BNPA 2GZWA 2XWBB 2G4IA 4LT5A 2YV8A 3ZN4A 4P9YA 4AG4A 1NA1A 2PHXA 1Q8VA 1NLRA 1N1SA 3NAPB 2WKKA 1UIKA 4HKWA 4IEWA 3D5OA 2QKDA 4MGIE 4K21A 4AEDA 1L3JA 1VB4A 1RUH2 3ZXLA 4Y5Z0 2WS93 4JGZA 4RGGA 4CDXC 3RWNA 1X33A 4MSVA 3D4KA 4GB33 2ZPXA 1CN1A 3PVEA 2DVDA 3O0XA 3MYXA 3WNXA 4RL7A 3T1MA 3E6CC 1D0GA 1J59A 4LHKA 2ZA9A 3GALA 1FOD1 3D82A 4LR4A 1PIV2 3ATGA 4YNIA 3VZLA 4AHWA 1V00A 3MW4A 2GU9A 2BFUL 1GQHA 2ZMKA 3IN9A 2VVEA 1WMDA 4RR3C 5FPZA 2C9AA 2MHFA 2ZJCA 1UW8A 2WLPA 1F2NA 2H6BA 5KHKA 2DWRA 1O3RA 4HETA 4E2SA 5A32B 1JBCA 1HW5A 1DHKB 2X5IA 3H9AA 3VZMA 5JSOA 3AKTA 2O8QA 1R092 2ZGNA 4A3XA 2IXKA 3ZSKA 1BKZA 3M3EA 4BWOA 4Q26A 4OULA 2IXJA 4DZGA 3MFCA 1VBC2 2SBAA 2R1DA 5J36A 3P3NA 1R1A1 2XLGA 3CJIB 2N7GA 1LHWA 5FTTC 1ZNPA 1KXGA 4RFT0 1HKDA 5GZCA 4XOGA 5DDJ2 5J37A 1NE6A 1BQPA 4AF9A 4NOTA 2BQPA 2PHTA 3H1MA 4TYSA 3RDIA 1RUOA 1QJY3 5JSPA 1CAWB 2DUPA 4M3CF 4QPGB 4BM8A 4JTOA 2B39A 4QQOA 1VR3A 2R32A 3WCRA 3N3HA 4AHZA 2R0FA 2F4PA 1BVVA 1HQLA 1LHNA 2RE9A 1IPKA 3I59B 4LBNA 2Z79A 2ZGQA 5AVAA 4XFCA 2OW4A 1JN2P 2VOKA 2WFF1 1ENSA 1KFUL 1PO21 1WLDA 1MEC2 4Y1ZA 1POV0 2EF6A 3LA3A 4BPZA 3ECQA 4A2UA 5EJ3A 3THPA 1EAH2 4E4ZA 2JX9A 3R4DB 4FPLA 1AHSA 3WP4A 1QQP3 4AVSA 5K7PA 2KM2A 1SACA 2OZ6A 4FQ4A 1DQ0A 4EWDA 4O9EA 3MIHA 3IDBB 3MPBA 1ZBE3 2JG8A 4ZXKA 2WSUA 4HN0A 4OHYA 2NP0A 1PVC2 4RHV1 1V6LA 3AXEA 4CYDA 2R043 4K3UA 4MXVA 3DUIA 3CEWA 4MYEA 2FZ1A 2MPFA 1I9RA 4HL0A 3WW3A 1CAWA 2PHDA 3MEPA 4LBJA 5K0UA 2VGDA 2XJTA 3MPPG 3RYPA 1MQTC 2DV9A 4D3WA 3IDCB 3SLIA 1GSLA 2RR11 3B01A 3ES1A 1LODA 1G9FA 3U11A 3MLJA 2HWE1 1ASJ3 4Q0PA 4LBQD 4Q4X2 3FC0A 2IXCA 4S2DA 1GKBA 4QPIA 1C3HA 1SLBA 4AI3A 1RVF1 1MR5A 3LAGA 1F9KA 3WP6A 2I07B 5SV5A 5ACA3 4XIOA 1J3RA 2CGOA 1X8EA 1GV9A 3RS6A 1B35C 1N3PA 1QH7A 3CL1A 5F6LB 1FPN3 1VBA2 3LWCA 2DU0A 4R52A 1ENXA 4XJAA 1X82A 4Z2WA 5FMOS 2LTNA 1M06G 1MQTB 1A8MA 1FMD3 3D8CA 3UV9A 3VKFC 1D2QA 4CDWA 5D1IA 1QU0A 3KCCA 4OI4A 3OD0A 1W6MA 1SBDA 4RD7A 1ZZ6A 4PLNA 4PBPA 1AR62 4N53C 4MGZE 3W59A 5GZEA 4L99A 4UXAA 2AH2A 3USSA 4B29A 1RUH3 2Q5TA 1GZCA 3AP4A 4Z92B 1PK6C 4QMAA 1QOOA 4FQZA 1PVXA 1JOJA 5CG8A 3MIEA 4IEPA 5KXCA 4AYUA 2D3RA 4CP0A 4Y1VA 1XNKA 2C1FA 1W0PA 3VBFA 1YI7A 1VLNA 3M70A 4LUMA 2A75A 3OGJA 5D8AB 4Z1VA 1PIV3 1RUG1 2JICA 3KT1A 3E5XA 2R30A 1XU2A 3NO8A 4J1WA 1LB2A 4M01A 1DFQA 4H7LA 1UU4A 1IHMA 3LA2A 4WM8A 2VG9A 2R061 1AXKA 3BOPA 3E6DA 2HWD1 4PBOA 4B7EA 2D6MA 3ZXJA 3MDPA 1WMFA 2ARXA 5F1RA 2VNGA 3RJRA 1DQ1A 3VDDC 1N47A 1WCKA 1BBT1 1QXJA 4AEMA 3GHMA 2WNVA 3VBOC 4OFGA 4Q4Y2 4CDUC 1VAKA 1Q43A 1PM7A 2YYOA 4RSUA 1R093 1WBLA 3AYAA 4GXLA 2D5FA 3JUUA 1VIWB 2Y38A 4TLFA 3EQEA 5CNAA 5C9AC 1REEA 5KHGA 2RMU2 4KNCA 4TSVA 1VBC3 1S0IA 1UZYA 3BTAA 2WL1A 3OYWB 1TME2 3T2TA 5K9YA 4MLOA 2E7TA 3ZYPA 4WV8A 1IQAA 4FAHA 2E9QA 4N43B 5DDJ3 1W6NB 4E2QA 4JC1A 5D8AA 2RS52 2CV6A 3RYKA 3H1YA 3SITA 2DU1A 1SCSA 2QZ3A 2V5YA 2WS91 4DS0A 2EXIA 2B7YA 2RJKA 5E89A 2B46X 1AL22 4PJYA 4GB31 1YI9A 3WQ0A 5I8TA 4HN1A 4PDWA 1S0GA 4XJZA 4BE3A 4YARA 3BCWA 1N1VA 2H6CA 4IEUA 2YGMA 2E63A 4CZSA 1H1IA 1U12A 5BY5A 4RA0A 5L36A 2NM1A 2ZGKA 4QGNA 1WW4A 3VBSB 1Y7BA 1D4VB 1MEC3 5JAXA 3VZOA 4IEOA 3N36A 5IT6A 3R4SA 3APBA 4CEYA 1ND3B 2ZS6B 1O4TA 4IEZA 5LK5A 4I0AA 1F8VA 1EAH3 1ULFA 2XB6C 5BNOC 2A6XA 1QNYA 3MICA 2ZMLA 2AR6A 4H14A 5CB7A 2D6NA 4XZPA 4UW3A 4XBLA 2ZGRA 4WVMB 1LGNA 5BNNB 3UKVA 1PVC3 4N43A 3WHTA 1ULCA 5DZEA 5T5PA 1SDWA 1JUHA 1K5MA 1RUJ2 4KBBA 1G9CA 2CAVA 4COUA 3AKSA 1JXNA 2ZHLA 2XLFA 4LO6B 1OA2A 1YXWA 3KQRA 3KCXA 2D3PA 3VBUA 4OUSA 4META 1X36A 5IK5A 1KDMA 4GQ7A 4YM2A 3SMHA 5KXBA 4Q4X3 1CGPA 2AREA 1A6CA 4HVOA 2P3KA 1S0BA 1QXPA 1DGWX 1H8TB 3PVNA 1QJY1 3EO6A 3I8TA 5KC5A 2UY8A 3SCGA 2O1QA 1UU6A 1IS6A 4BMBA 4Q8LA 1QJX2 2RJLA 1I1EA 2ES3A 3ZMOA 1LEMA 1BEV2 4Y22A 2PQQA 1LJ7A 5C4WA 1ZZ7A 1RHI2 5JDBA 2XBO2 4LBKA 1AUYA 1GNHA 1VBA3 2PHWA 3KT4A 4HSLA 4Q29A 5J98B 3W9AA 2D6PA 3MI8A 5GJ6A 5GKAC 3WX5A 5BNNA 5EWSA 1N3OA 5JOZA 1XRUA 1ND2B 3N7LA 4JGYA 1Z7S2 3JB4C 4V1PA 3ENRA 3A0NA 2EIGA 2OVUA 1QQP1 3ZXDA 2P17A 3SH3A 1HXS2 1EYBA 1QWRA 1O91A 1OFNA 1ZBE1 2RS32 1EY2A 1JYCA 1GZ9A 2R041 2GC0A 4MXWA 1W39A 2VW2A 4P9XA 1TE1B 3ZXEA 2A7AA 2FMDA 2AZ5A 1AYN3 3H8UA 1VRH2 4HKOA 4AQ2A 4QX5A 2ZTNA 1FV2A 4WM7A 1OD5A 1ASJ1 1R082 3MIGA 3AZYA 2ZKLA 4KL1A 3VBRA 1PGW1 1YFXA 3ZMNA 2QFEA 4FT8A 5C8CC 1G86A 5JLVA 3ST7A 5CFDA 5ACA1 3I7DA 1KFXL 4XE9A 1WLTA 4ISRA 1PZ9A 3PTYA 4KGGA 4A7ZA 2ZX1A 1AVBA 3ZFEB 4OI0A 1ALYA 5CU1A 4Q4Y3 4COVA 4LLFA 5A33B 1DGRA 3MIFA 1FPN1 2JXAA 3DPRB 4XQ4A 3ZFGC 1U0AA 4YG3A 5LK7B 1LHOA 3BPZA 3KB5A 5BXXA 2A70A 1GZWB 4K7JA 2BEOA 1W6QA 1FMD1 2AGSA 5JIAA 3VBHC 1TME3 1JHNA 1IPJA 4I3PA 4XJUA 2XHKA 3PHMA 4MV2A 3ZN6B 3DF0A 2EAKA 4KWJA 3NWKA 2XUMA 3KT7A 5LEKA 2PYTA 2RS53 4AXOA 4EN0A 1NA1C 5FDBA 3V0AB 1RUH1 4ZU5A 2NN8A 1ZBA2 1AR82 1OOPB 1ENQA 3FUQA 1AL23 5I8SA 3NVCA 2JEMA 4RS5B 2AENA 1LOGA 1UPSA 4ZU4A 5HXVA 3WDWA 3FWEA 2HEYF 2PTMA 3OD4A 2H0BA 4I02A 3EJKA 4YVSA 1UAIA 2WT2A 4GKYA 4M3CB 4E4DX 1PZ8A 1NCRA 4YGEA 4W6WA 4QGLA 3V0BB 4CEWA 1PIV1 2WA3A 4COWA 4ES8A 1AR92 3POSA 2BPA2 2QCSB 2VQ0A 3AFKA 5IK4A 5L7OC 2PAEA 1R1ZA 4AGVA 1PMIA 1CONA 1ZZ8A 3ZXGA 4E27A 5JSRA 5EV7A 4ASMB 3VZJA 3WV6A 3USUA 4XW3A 1RITA 3OY8A 3BU7A 3LCPA 4GKXA 5L19A 3U10A 1KJLA 5BNPB 2QDNA 4F8AA 1VAMA 1NA1B 4MH0E 1RUC2 4D7YA 4DY5A 2ZZJA 3QD6A 1A3KA 4NHMA 1RUJ3 3UKTA 4AEDB 1CD3G 1R091 1H4GA 2GSYA 4XEZA 3QBQA 4YFWA 4PLMA 4Z07A 4JGZB 2MEV2 1XU1A 3GHNA 3DL3A 1VBC1 5FMOL 1QXRA 4HVRA 4RQPB 4EV0A 2VMIA 4P9WA 4IXLA 3HIFA 3LKJA 5DDJ1 1UX6A 2F6BA 3ZYIB 4YM0A 1SLTA 4NHKA 1E57A 4ATEA 4WBBA 1G8WA 4IV1A 5I0TA 1U5XA 1WA4A 1BMV2 3KLSA 4S2FA 3WCSA 4XF3A 3WHUA 4XQWA 1QJX3 1OKQA 4HVQA 2ZABA 3TNQA 1BEV3 1RUE2 5FLJA 3QLQA 2OYZA 4ASLA 1CAUA 1RHI3 2XBO3 1DZRA 1DIWA 5FO9B