1NAAA

Cellobiose dehydrogenase flavoprotein fragment in complex with cellobionolactam
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
541
structure length
541
Chain Sequence
TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the reductive half-reaction in cellobiose dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
total genus 185
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1naaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1naaA01
2GH5A 1CC4A 2A8XA 1E7PA 2WQYA 4U8KA 3C4AA 1GESA 1NDAA 1H6VA 4GDPA 1CHUA 1E39A 3NTAA 3UTFA 4Z25A 1OJDA 3FMWA 1GRFA 1N4WA 4U2SA 3CPHG 3GRSA 3SM8A 3AE2A 3R9UA 4APNA 1L9EA 2BS3A 3ICRA 5IQ1A 1EL7A 4H4XA 4YSXA 3DJDA 4U8PA 2WOVA 4B64A 3F8PA 2E5VA 2ZBWA 4B67A 3AB1A 3DH9A 1FECA 4FK1A 5EB4A 1NAAA 3CNPA 1BZLA 2YLSA 1F8RA 2VVMA 2YQUA 3LOVA 2OLOA 1GRTA 4BV6A 4IVOB 3COXA 1CJCA 2R4JA 5TR3A 2XVEA 3V3NA 2BACA 5J60A 2C76A 3GYIA 4Z43A 4UDPA 1FEBA 1OJAA 5ER0A 4UDQA 1MXTA 3ATRA 1LQUA 3D1CA 2V3AA 2ZZBA 4ICYA 4K5RA 4B68A 4M52A 1LV0A 1LTXR 1M6IA 1ZY8A 1K0IA 1Y0PA 4CCRA 2BXRA 2AAQA 2HQMA 1GPEA 3AECA 3VR8A 1OJCA 1DODA 2E1MA 1TYTA 3CGEA 1H81A 4CNJA 4ADWA 4I58A 1JEHA 4O5UA 3K7TA 2EQ8A 3UKLA 1TDFA 2GRTA 3G5RA 4JNQA 4GUVA 4CBQA 4OCGA 5KRQA 4PABA 4JY2A 4D03A 2WU2A 3QFAA 4IVMB 5KXJA 1NHPA 3VRDB 2ACZA 2APGA 2FJBA 3KLJA 4XWZA 4NTEA 3QSSA 1GERA 2BA9A 2YAUA 2WPFA 3AYJA 4H4RA 4O5QA 1PJ7A 2Y6RA 5M10A 4TM1A 1XANA 3RNMA 4EMIA 1PBCA 2R45A 4TLXA 1TDEA 3DA1A 2IIDA 3ALJA 2XDOA 2X8HA 3LZWA 4EIQA 5DBJA 1MOKA 1NHRA 1GTHA 4JY3A 1UKVG 3G5QA 3IWAA 5LV9A 3UKKA 3AE5A 3FBSA 4TM0A 2GQFA 2JB2A 2OAMA 1Z6LA 3JSKA 2O9ZA 2V61A 3ADAB 3CGBA 3H8IA 5FS8A 2YWLA 3AE3A 1NHSA 1TRBA 1LVLA 2WPCA 2WDRA 3UKFA 3P9UA 1GV4A 4NEVA 4AP3A 4CCQA 2V3BA 2XVFA 2JB1A 2RGJA 3P4SA 4BK1A 1EL8A 3QJ4A 4CRTA 1P2HA 3SQPA 4TM4A 5FS7A 4CY6A 1CJ4A 3GRTA 4Z44A 2EQ6A 2C64A 3NTDA 1COYA 3FG2P 2GR0A 1E6EA 4WCTA 5EOWA 4C3YA 2YVGA 4H2NA 1D4DA 2XVIA 4H4ZA 4KPRA 4GCMA 2EQ9A 2XLPA 5KOXA 4K22A 5BRTA 2JB3A 1JOAA 2VQBA 4XWRA 3H4KA 2GMHA 3NK0X 1D4CA 2WETA 2YG7A 4H7UA 1ONFA 4KX6A 1NPXA 2QCUA 1KNPA 1E1LA 3NGCX 5IQ4A 4H4UA 1GREA 1Y56A 3L8KA 3S61A 3DK8A 4J36A 3BI4A 1JNRA 4OPTA 1JRZA 3GDPA 3V3OA 2C75A 1O5WA 4YXDA 2GR3A 4NEWA 3P4QA 1JRYA 4EM3A 1B8SA 4PAAA 3UKAA 1LPFA 2IVEA 1YQ4A 5GRTA 5KVIA 4U8NA 1ZKQA 1DJNA 3QFBA 2NVKX 1AOGA 2XLSA 2A89A 3BNMA 1D5TA 3KKJA 1RYIA 2X99A 3GSIA 3Q9TA 3UOXA 1D7LA 1CC6A 3ISHA 3LXDA 4OPGA 1X31B 1CF3A 4JN9A 4ZCCA 4BJYA 4J34A 4YTPA 4EQXA 4GF7A 5EB5A 4J31A 2BXSA 1YQ3A 1ZK7A 4C74A 3WE0A 1QJDA 3ABVA 1CJ3A 3AD7B 3M13A 1TDKA 2YG3A 4U8MA 4B66A 2GR2A 2WOWA 4X9MA 4U8LA 3NT6A 2RGOA 4FDCB 4Z2TA 1GT8A 4WX1A 1XDIA 3AE6A 3IHGA 1IUWA 4AP1A 3LJPA 1IJHA 3SFEA 3AYLA 5KVHA 4REKA 2BYBA 1RSGA 4P9SA 3NNEA 4Y4NA 2CVJA 3NHOX 4RSLA 4JQ9A 1PXBA 5FMHA 1PHHA 5L46A 1Q9IA 3F8RA 3CIRA 1XHCA 4MJWA 4A65A 3DJJA 4DSGA 4YT0A 3QSEA 2YG6A 2R0CA 2C72A 3RP6A 1IUUA 4IA5A 3AEEA 3QVRA 2YG5A 1KDGA 2Z5XA 2B7SA 2ZZCA 5FS6A 3G5SA 3M0OA 3CGCA 4TLZA 3VRAA 4ZCDA 4A5LA 1GRGA 2VVLG 2B9XA 4J56A 4B69A 5JCIA 1F6MA 1NG4A 2XFPA 2XCGA 3NN0X 3URHA 2FBWA 1Y56B 1GETA 4LA1A 3UP5A 1REOA 2BABA 1DXLA 1TYPA 2BC0A 1Q1RA 4XXGA 4GRTA 3ICSA 4E0VA 3GMBA 3PVCA 2CFYA 3II4A 3KD9A 2GEWA 4H2PA 4A9WA 1OJTA 3AE9A 2JKCA 4A6NB 1H7WA 1B4VA 1B5QA 2X8GA 2FJAA 3DK4A 3HZLA 4Z26A 4ZN0A 1IUVA 2WBAA 1V59A 3AEDA 2PYXA 3LZXA 3I6DA 4H4YA 3UKPA 3K7QX 1VG0A 4UP3A 3AE1A 3UKQA 5C3JA 4H4QA 5C2TA 2EQ7A 3C96A 3VQRA 4DNAA 2C3CA 1DNCA 3ITJA 2YVFA 4OPIA 1K0LA 1PDHA 3KVEA 2X8CA 4AT0A 2WS3A 2BCGG 4GR1A 4OPLA 1MO9A 5KWFA 1E1MA 1PN0A 3B3RA 3UTHA 2GF3A 2YR5A 4CY8A 3P1WA 3UP4A 1IUTA 3CNDA 3NYFA 2B76A 2V5ZA 3UOVA 1QO8A 3FPZA 3ALLA 4H4VA 1F3PA 2V60A 1GNDA 4OPUA 2Q6UA 2A87A 2TPRA 1FL2A 2VRMA 1IUXA 4J2WA 4IA6A 1KF6A 2JK6A 4HB9A 1GTEA 4HA6A 3F8DA 3ALMA 4FK1C 4OVIA 2BS4A 3AWIA 1CL0A 4X4JA 2GB0A 4K7ZA 2VRLA 1SEZA 1Q1WA 3V76A 1H82A 1YQZA 1ZP0A 1K4QA 3BHKA 2DKHA 4EQWA 1DJQA 1S2QA 2B7RA 4H2RA 1PS9A 3GMCA 2C73A 1RP0A 3LADA 1JNZA 4H4PA 2I0ZA 3NKSA 5U1OA 2FJDA 3NN6X 4DSHA 1ZOVA 3AD9B 2YLRA 3BI2A 3CGDA 4NZHA 2YR6A 3NRNA 1N4UA 5FS9A 2XVHA 5HYMA 2YLWA 3NK2X 1FCDA 3UKHA 3KPFA 4N9XA 2GMJA 4C3XA 2J3NA 2YLXA 4IV9A 2BS2A 4FX9A 1DOEA 2C67A 2X3NA 3NIXA 1O94A 3NK1X 2JBVA 4EQRA 2PHHA 4NTDA 4EQSA 4A6NA 3EF6A 1NENA 3B6DA 1CC2A 4H4SA 2YLTA 1IUSA 1OJ9A 3UTEA 1GRAA 5HY5A 1ZDLA 3REDA 1H7XA 2VVLA 4K2XA 4X9NA 4BK3A 3CPIG 2XFQA 1EL9A 2B9WA 2XFUA 3DJEA 2Y6QA 4Z2UA 1EBDA 2RABA 2WOIA 4EM4A 4RG4A 3T37A 1S3BA 3IHMA 3AE7A 2ZZ0A 1D7YA 4YSZA 1XPQA 3VRBA 1JRXA 4U8JA 2C66A 2C65A 3CPJG 1O95A 4BURA 2WPEA 4GDEA 4U8IA 1JU2A 2XFOA 3AEAA 3P4RA 1N4VA 1GXFA 2OALA 4AT2A 2WP9A 1KSSA 1PBEA 3CN8A 1PXAA 2Q7VA 2X50A 3CNSA 1TDNA 4LU6A 4YTNA 4EMJA 1BF3A 1PBBA 1ZOYA 3QSMA 1S3EA 1E1NA 1L0VA 2BK3A 4Z2RA 1CJ2A 3IC9A 1H84A 4C77A 2TMDA 2BCPA 2WDVA 2YVJA 3UTGA 1B37A 2XYOA 3KU9A 2VOUA 4LIIA 1PBDA 2WHDA 2WESA 2FJEA 2OA1A 1VDCA 3AXBA 1GOSA 2AR8A 3LB8A 1VQWA 4H2QA 3DGHA 3NG7X 5U63A 4B63A 1L9CA 2YG4A 4J33A 4OPCA 1BWCA 1M64A 3NLCA 1KSUA 1PJ6A 1GRHA 3UOYA 1LQTA 1GRBA 1VG9A 4ECHA 4D04A 2NPXA 2R46A 2C3DA 2CULA 4J57A 1GEUA 4B1BA 5KOWA 4BK2A 3OZ2A 5JCMA 1BKWA 3GYJA 1DOCA 3CTYA 3AEFA 2B9YA 4YKFA 4DGKA 4UDRA 2JAEA 1FOHA 3M12A 2E4GA 1D4EA 3IF9A 3I3LA 4JDRA 2R0PA 3Q6JA 3CNTA 4RG3A 5BULA 4AOXA 3BI5A 3EANA 4U8OA 1NEKA 2Q0KA 3PO7A 4Y4MA 4YTMA 5GSNA 2IVDA 2ARDA 2VZ2A 3SGLA 1ZMCA 1L9DA 1F8WA 3GD4A 3VR9A 1ZMDA 1W4XA 2WU5A 3AE8A 2QA1A 2WP5A 2YR4A 3AEBA 3RHAA 1LJ1A 5JCLA 1K0JA 2XLRA 2QAEA 3EAOA 4YSYA 1S2YA 3DK9A 1F8SA 2C70A 2YM1A 3NYEA 3K7MX 3NH3X 3EPTA 2WP6A 4U2LA 4Y4LA 2OLNA 1GALA 1PBFA 2AQJA 3RP7A 3GWFA 1H83A 1KFYA 3BHFA 2R0GA 2F5ZA 2GAHB 2H88A 2Z5YA 3C4NA 2H89A 5BVAA 4AOSA 4H4TA 1BGNA 2R9ZA 2BK5A 4YWOA 2BK4A 5BUKA 3UOZA 2VQ7A 3CNJA 3PS9A 2YM2A 3AE4A 4NTCA 4A99A 3O0HA 2XLUA 3UCLA 2R4EA 3FIMB 3ATQA 3DGZA 4K8DA 3S5WA 2GAGB 3DJGX 5JCNA 1ZX9A 3ZYXA 1N1PA 1BGJA 1DOBA 3DMEA 3AYIA 3KA7A 2QA2A 1PJ5A 4YSHA 2GQWA 4H50A 5JCKA 1FEAA 4B65A 2CDUA 5CKUA 4BJZA 2GV8A 1HYUA 2XVJA 4H4WA 2YLZA 5U25A 1ELIA 3K30A 3SFDA 5HXIA 4U2TA 1EL5A 5M0ZA 1GSNA 1H86A 1YY5A 1CBOA 2Q0LA 1E1KA 1KNRA 4EIPA 3OC4A 2XFNA 1NG3A 4CNKA 2V6OA 3NYCA 2DKIA 3P4PA 4USQA 4USRA 4A7AA 5J7XA 1NHQA 3GD3A 4EMWA 3AD8B 1TDOA 2UZZA 4TM3A 4JNAA 3ICTA 5EBKA 1QLBA 3E1TA 3QVPA 3L1RA 2XLTA 3H8LA 1YKJA 4K5SA 2GVCA 4OPDA 3GDNA 2WDQA 2C7GA 4I59A 2BC1A 2WEUA 3GWDA 1VRQB 5CQFA 3RP8A 5HHFA 4YKGA 2GR1A 3AEGA 1P2EA 2W0HA 2RGHA 3BNUA 3D8XA 1PXCA 3ZDNA 4A79A 5IPYA 4C5OA 4Z24A
chains in the Genus database with same CATH superfamily
2GH5A 1CC4A 2A8XA 1E7PA 2WQYA 4U8KA 3C4AA 1GESA 1NDAA 1H6VA 4GDPA 1CHUA 1E39A 3NTAA 4G73A 3UTFA 4Z25A 1OJDA 3FMWA 1GRFA 1N4WA 4U2SA 3CPHG 3GRSA 3T2KA 3SM8A 3KPKA 3AE2A 3R9UA 4APNA 1L9EA 2BS3A 3ICRA 5IQ1A 1EL7A 4H4XA 4YSXA 3DJDA 4U8PA 2WOVA 4B64A 3F8PA 2E5VA 2ZBWA 3SX6A 3AB1A 4B67A 3DH9A 1FECA 4FK1A 5EB4A 1NAAA 3CNPA 1BZLA 2YLSA 1F8RA 2VVMA 2YQUA 3LOVA 2OLOA 1GRTA 4BV6A 3SXIA 4IVOB 3COXA 1CJCA 2R4JA 5TR3A 2XVEA 3V3NA 2BACA 5J60A 2C76A 3GYIA 4Z43A 4UDPA 1FEBA 1OJAA 5ER0A 4UDQA 1MXTA 3ATRA 1LQUA 3D1CA 2V3AA 2ZZBA 4ICYA 4K5RA 4B68A 4M52A 1LV0A 1LTXR 1M6IA 1ZY8A 4NWZA 1K0IA 1Y0PA 4CCRA 2BXRA 2AAQA 2HQMA 3HYVA 1GPEA 3AECA 3VR8A 1OJCA 1DODA 2E1MA 1TYTA 3CGEA 1H81A 4CNJA 4ADWA 4I58A 1JEHA 4O5UA 3K7TA 2EQ8A 3UKLA 1TDFA 2GRTA 3G5RA 4JNQA 4GUVA 4CBQA 5KMSA 4OCGA 5KRQA 4PABA 3HYWA 4JY2A 4D03A 2WU2A 3QFAA 4IVMB 5KXJA 1NHPA 4G6GA 3VRDB 2ACZA 2APGA 2FJBA 3KLJA 4G9KA 4NTEA 3QSSA 4XWZA 1GERA 2BA9A 2YAUA 2WPFA 3AYJA 4H4RA 4O5QA 1PJ7A 2Y6RA 5M10A 4TM1A 1XANA 3RNMA 4EMIA 1PBCA 2R45A 4TLXA 1TDEA 3DA1A 2IIDA 3ALJA 2XDOA 2X8HA 3LZWA 4EIQA 5DBJA 1MOKA 1NHRA 1GTHA 4JY3A 1UKVG 3G5QA 3IWAA 5LV9A 3UKKA 3AE5A 3FBSA 4TM0A 2GQFA 2JB2A 2OAMA 1Z6LA 3JSKA 2O9ZA 2V61A 3ADAB 3CGBA 3H8IA 5FS8A 2YWLA 3AE3A 1NHSA 1TRBA 1LVLA 2WPCA 2WDRA 3UKFA 3P9UA 1GV4A 4NEVA 4AP3A 4CCQA 2V3BA 2XVFA 2JB1A 2RGJA 3P4SA 4BK1A 1EL8A 3QJ4A 4CRTA 1P2HA 3SQPA 4NNJA 4TM4A 5FS7A 4CY6A 1CJ4A 3GRTA 4Z44A 2EQ6A 2C64A 3NTDA 1COYA 3FG2P 2GR0A 1E6EA 4WCTA 5EOWA 4C3YA 2YVGA 4H2NA 1D4DA 2XVIA 4H4ZA 4KPRA 4GCMA 4GAVA 2EQ9A 2XLPA 5KOXA 4K22A 5BRTA 2JB3A 1JOAA 2VQBA 4XWRA 3H4KA 2GMHA 3NK0X 1D4CA 2WETA 2YG7A 4H7UA 1ONFA 4KX6A 1NPXA 2QCUA 1KNPA 1E1LA 3NGCX 5IQ4A 4H4UA 1GREA 1Y56A 3L8KA 3S61A 3DK8A 4J36A 3BI4A 1JNRA 4OPTA 1JRZA 3GDPA 3V3OA 2C75A 1O5WA 4YXDA 2GR3A 4NEWA 3P4QA 1JRYA 4EM3A 1B8SA 4PAAA 3UKAA 1LPFA 2IVEA 1YQ4A 5GRTA 5KVIA 4U8NA 1ZKQA 1DJNA 3QFBA 2NVKX 1AOGA 2XLSA 2A89A 3BNMA 1D5TA 3KKJA 1RYIA 2X99A 3GSIA 3Q9TA 3UOXA 1D7LA 1CC6A 3ISHA 3LXDA 4OPGA 1X31B 1CF3A 4JN9A 4ZCCA 4BJYA 4J34A 4YTPA 4EQXA 5EB5A 4GF7A 4J31A 2BXSA 1YQ3A 1ZK7A 4C74A 3SYIA 3WE0A 1QJDA 3ABVA 1CJ3A 3AD7B 3M13A 1TDKA 2YG3A 4U8MA 4B66A 2GR2A 2WOWA 4X9MA 4U8LA 3NT6A 2RGOA 4FDCB 4Z2TA 1GT8A 4WX1A 1XDIA 3AE6A 3IHGA 1IUWA 4AP1A 3LJPA 1IJHA 3SFEA 3AYLA 5KVHA 4REKA 2BYBA 1RSGA 4P9SA 3NNEA 4Y4NA 2CVJA 3NHOX 4RSLA 4JQ9A 1PXBA 5FMHA 1PHHA 5L46A 1Q9IA 3F8RA 3CIRA 4MJWA 1XHCA 4A65A 3DJJA 4DSGA 4YT0A 3QSEA 2YG6A 2R0CA 2C72A 3RP6A 1IUUA 4IA5A 3AEEA 3QVRA 2YG5A 1KDGA 2Z5XA 2B7SA 2ZZCA 5FS6A 3G5SA 3M0OA 3CGCA 4TLZA 3VRAA 4ZCDA 4A5LA 1GRGA 3HYXA 2C4CA 2B9XA 2VVLG 4J56A 4B69A 1F6MA 5JCIA 1NG4A 2XFPA 2XCGA 3NN0X 3URHA 2FBWA 1Y56B 1GETA 4LA1A 3UP5A 1REOA 2BABA 1DXLA 1TYPA 2BC0A 1Q1RA 4XXGA 4GRTA 3ICSA 3CMMA 3GMBA 3PVCA 4E0VA 2CFYA 3II4A 3KD9A 2GEWA 4H2PA 4A9WA 1OJTA 3AE9A 2JKCA 4A6NB 1H7WA 1B4VA 1B5QA 2X8GA 2FJAA 3DK4A 3HZLA 4Z26A 4ZN0A 1IUVA 2WBAA 1V59A 3AEDA 2PYXA 3LZXA 3I6DA 4H4YA 3UKPA 3K7QX 1VG0A 4UP3A 3AE1A 3UKQA 5C3JA 4H4QA 5C2TA 2EQ7A 3C96A 3VQRA 4DNAA 2C3CA 1DNCA 3ITJA 2YVFA 4OPIA 1K0LA 1PDHA 3KVEA 2X8CA 4AT0A 2WS3A 2BCGG 4GR1A 4OPLA 1MO9A 5KWFA 1E1MA 1PN0A 3B3RA 3UTHA 2GF3A 2YR5A 4CY8A 3P1WA 3UP4A 1IUTA 3CNDA 3NYFA 2B76A 2V5ZA 4G6HA 3UOVA 1QO8A 3FPZA 3ALLA 4H4VA 1F3PA 2V60A 1GNDA 4OPUA 2Q6UA 2A87A 3SZFA 2TPRA 1FL2A 2VRMA 1IUXA 4J2WA 4IA6A 1KF6A 2JK6A 4HB9A 1GTEA 4HA6A 3F8DA 3ALMA 4FK1C 4OVIA 2BS4A 3AWIA 1CL0A 4X4JA 2GB0A 4K7ZA 2VRLA 1SEZA 1Q1WA 3T2ZA 3V76A 1H82A 1YQZA 5KMQA 1ZP0A 1K4QA 3BHKA 2DKHA 4EQWA 1DJQA 1S2QA 2B7RA 4H2RA 1PS9A 3GMCA 3T14A 2C73A 1RP0A 3LADA 1JNZA 4H4PA 2I0ZA 3NKSA 5U1OA 2FJDA 3NN6X 4DSHA 1ZOVA 3AD9B 2YLRA 3BI2A 3CGDA 3T31A 4NZHA 2YR6A 3NRNA 1N4UA 5KMPA 5FS9A 2XVHA 5HYMA 2YLWA 3NK2X 1FCDA 3UKHA 3KPFA 4N9XA 2GMJA 4C3XA 2J3NA 2YLXA 3SY4A 4IV9A 2BS2A 4FX9A 1DOEA 2C67A 2X3NA 3NIXA 1O94A 3NK1X 2JBVA 4EQRA 2PHHA 4NTDA 4EQSA 4A6NA 3EF6A 1NENA 3B6DA 1CC2A 4H4SA 2YLTA 1IUSA 1OJ9A 3UTEA 1GRAA 2BRAA 5HY5A 3REDA 1ZDLA 1H7XA 2VVLA 4K2XA 4X9NA 4BK3A 3CPIG 2XFQA 1EL9A 2B9WA 2XFUA 3DJEA 5KMRA 2Y6QA 4Z2UA 1EBDA 2RABA 2WOIA 4EM4A 4II2A 4RG4A 3T37A 1S3BA 3IHMA 3AE7A 2ZZ0A 1D7YA 4YSZA 1XPQA 3VRBA 1JRXA 4U8JA 2C66A 2C65A 3CPJG 1O95A 4BURA 2WPEA 4GDEA 4U8IA 1JU2A 2XFOA 3AEAA 3P4RA 1N4VA 1GXFA 2OALA 4AT2A 2WP9A 1KSSA 1PBEA 3CN8A 1PXAA 2Q7VA 2X50A 3CNSA 1TDNA 4LU6A 4YTNA 4EMJA 1BF3A 1PBBA 1ZOYA 3QSMA 1S3EA 1E1NA 1L0VA 2BK3A 4Z2RA 1CJ2A 3IC9A 1H84A 4C77A 2TMDA 2BCPA 2WDVA 2YVJA 3UTGA 1B37A 2XYOA 3KU9A 2VOUA 4LIIA 1PBDA 2WHDA 2WESA 3SZCA 2BRYA 2FJEA 2OA1A 1VDCA 3AXBA 1GOSA 2AR8A 3LB8A 1VQWA 4H2QA 3DGHA 3NG7X 5U63A 4B63A 1L9CA 2YG4A 4J33A 4OPCA 1BWCA 1M64A 3NLCA 1KSUA 1PJ6A 1GRHA 3UOYA 1LQTA 1GRBA 1VG9A 4ECHA 4D04A 2NPXA 2R46A 2C3DA 2CULA 4J57A 1GEUA 4B1BA 5KOWA 4BK2A 3OZ2A 5JCMA 1BKWA 3GYJA 1DOCA 3CTYA 3GYXA 3AEFA 2B9YA 4YKFA 4DGKA 4UDRA 2JAEA 1FOHA 3M12A 2E4GA 1D4EA 3IF9A 3I3LA 4JDRA 2R0PA 3Q6JA 3CNTA 4RG3A 5BULA 3SZ0A 4AOXA 3BI5A 3EANA 4U8OA 1NEKA 2Q0KA 3PO7A 4Y4MA 4YTMA 5GSNA 4II3A 2IVDA 2ARDA 2VZ2A 3SGLA 1ZMCA 1L9DA 1F8WA 3GD4A 3VR9A 1ZMDA 1W4XA 2WU5A 3AE8A 2QA1A 2WP5A 2YR4A 3AEBA 3RHAA 1LJ1A 5JCLA 1K0JA 2XLRA 2QAEA 3EAOA 4YSYA 1S2YA 3DK9A 1F8SA 2C70A 2YM1A 3NYEA 3K7MX 3NH3X 3EPTA 2WP6A 4U2LA 4Y4LA 1GALA 1PBFA 2AQJA 2OLNA 3RP7A 3SZWA 3GWFA 3T0KA 1H83A 4G74A 1KFYA 3BHFA 2R0GA 2F5ZA 2GAHB 2H88A 2Z5YA 3C4NA 2H89A 5BVAA 4AOSA 4H4TA 1BGNA 2R9ZA 2BK5A 4YWOA 2BK4A 5BUKA 3UOZA 2VQ7A 3CNJA 3PS9A 2YM2A 3AE4A 4NTCA 4A99A 3O0HA 2XLUA 3UCLA 2R4EA 3FIMB 3ATQA 3DGZA 4K8DA 3S5WA 2GAGB 3DJGX 5JCNA 1ZX9A 3T2YA 3ZYXA 5KNLA 1N1PA 1BGJA 1DOBA 3DMEA 3AYIA 3KA7A 2QA2A 1PJ5A 4YSHA 2GQWA 4H50A 5JCKA 1FEAA 4B65A 2CDUA 5CKUA 4BJZA 2GV8A 1HYUA 2XVJA 4H4WA 2YLZA 5U25A 1ELIA 3K30A 3SFDA 5HXIA 4U2TA 1EL5A 5M0ZA 1GSNA 1H86A 1YY5A 1CBOA 2Q0LA 1E1KA 1KNRA 4EIPA 3OC4A 2XFNA 1NG3A 4CNKA 2V6OA 3NYCA 2DKIA 3P4PA 4USQA 4USRA 4A7AA 5J7XA 1NHQA 3GD3A 4EMWA 3AD8B 1TDOA 2UZZA 4TM3A 4GAPA 4JNAA 3ICTA 5EBKA 1QLBA 3E1TA 3QVPA 3L1RA 2XLTA 3H8LA 1YKJA 4K5SA 2GVCA 4OPDA 3GDNA 2WDQA 2C7GA 4I59A 2BC1A 2WEUA 3GWDA 1VRQB 5CQFA 3RP8A 5HHFA 4YKGA 2GR1A 3AEGA 1P2EA 2W0HA 2RGHA 3BNUA 3D8XA 1PXCA 3ZDNA 4A79A 5IPYA 4C5OA 4Z24A
chains in the Genus database with same CATH topology
2GH5A 1CC4A 2A8XA 1E7PA 2WQYA 4U8KA 3C4AA 1GESA 1NDAA 1H6VA 4GDPA 1CHUA 1E39A 3NTAA 4G73A 3UTFA 4Z25A 1OJDA 3FMWA 1GRFA 1N4WA 4U2SA 3CPHG 3GRSA 3T2KA 3SM8A 3KPKA 3AE2A 3R9UA 4APNA 1L9EA 2BS3A 3ICRA 5IQ1A 1EL7A 4H4XA 4YSXA 3DJDA 4U8PA 2WOVA 4B64A 3F8PA 2E5VA 2ZBWA 3SX6A 3AB1A 4B67A 3DH9A 1FECA 4FK1A 5EB4A 1NAAA 3CNPA 1BZLA 2YLSA 1F8RA 2VVMA 2YQUA 3LOVA 2OLOA 1GRTA 4BV6A 3SXIA 4IVOB 3COXA 1CJCA 2R4JA 5TR3A 2XVEA 3V3NA 2BACA 5J60A 2C76A 3GYIA 4Z43A 4UDPA 1FEBA 1OJAA 5ER0A 4UDQA 1MXTA 3ATRA 1LQUA 3D1CA 2V3AA 2ZZBA 4ICYA 4K5RA 4B68A 4M52A 1LV0A 1LTXR 1M6IA 1ZY8A 4NWZA 1K0IA 1Y0PA 4CCRA 2BXRA 2AAQA 2HQMA 3HYVA 1GPEA 3AECA 3VR8A 1OJCA 1DODA 2E1MA 1TYTA 3CGEA 1H81A 4CNJA 4ADWA 4I58A 1JEHA 4O5UA 3K7TA 2EQ8A 3UKLA 1TDFA 2GRTA 3G5RA 4JNQA 4GUVA 4CBQA 5KMSA 4OCGA 5KRQA 4PABA 3HYWA 4JY2A 4D03A 2WU2A 3QFAA 4IVMB 5KXJA 1NHPA 4G6GA 3VRDB 2ACZA 2APGA 2FJBA 3KLJA 4G9KA 4NTEA 3QSSA 4XWZA 1GERA 2BA9A 2YAUA 2WPFA 3AYJA 4H4RA 4O5QA 1PJ7A 2Y6RA 5M10A 4TM1A 1XANA 3RNMA 4EMIA 1PBCA 2R45A 4TLXA 1TDEA 3DA1A 2IIDA 3ALJA 2XDOA 2X8HA 3LZWA 4EIQA 5DBJA 1MOKA 1NHRA 1GTHA 4JY3A 1UKVG 3G5QA 3IWAA 5LV9A 3UKKA 3AE5A 3FBSA 4TM0A 2GQFA 2JB2A 2OAMA 1Z6LA 3JSKA 2O9ZA 2V61A 3ADAB 3CGBA 3H8IA 5FS8A 2YWLA 3AE3A 1NHSA 1TRBA 1LVLA 2WPCA 2WDRA 3UKFA 3P9UA 1GV4A 4NEVA 4AP3A 4CCQA 2V3BA 2XVFA 2JB1A 2RGJA 3P4SA 4BK1A 1EL8A 3QJ4A 4CRTA 1P2HA 3SQPA 4NNJA 4TM4A 5FS7A 4CY6A 1CJ4A 3GRTA 4Z44A 2EQ6A 2C64A 3NTDA 1COYA 3FG2P 2GR0A 1E6EA 4WCTA 5EOWA 4C3YA 2YVGA 4H2NA 1D4DA 2XVIA 4H4ZA 4KPRA 4GCMA 4GAVA 2EQ9A 2XLPA 5KOXA 4K22A 5BRTA 2JB3A 1JOAA 2VQBA 4XWRA 3H4KA 2GMHA 3NK0X 1D4CA 2WETA 2YG7A 4H7UA 1ONFA 4KX6A 1NPXA 2QCUA 1KNPA 1E1LA 3NGCX 5IQ4A 4H4UA 1GREA 1Y56A 3L8KA 3S61A 3DK8A 4J36A 3BI4A 1JNRA 4OPTA 1JRZA 3GDPA 3V3OA 2C75A 1O5WA 4YXDA 2GR3A 4NEWA 3P4QA 1JRYA 4EM3A 1B8SA 4PAAA 3UKAA 1LPFA 2IVEA 1YQ4A 5GRTA 5KVIA 4U8NA 1ZKQA 1DJNA 3QFBA 2NVKX 1AOGA 2XLSA 2A89A 3BNMA 1D5TA 3KKJA 1RYIA 2X99A 3GSIA 3Q9TA 3UOXA 1D7LA 1CC6A 3ISHA 3LXDA 4OPGA 1X31B 1CF3A 4JN9A 4ZCCA 4BJYA 4J34A 4YTPA 4EQXA 5EB5A 4GF7A 4J31A 2BXSA 1YQ3A 1ZK7A 4C74A 3SYIA 3WE0A 1QJDA 3ABVA 1CJ3A 3AD7B 3M13A 1TDKA 2YG3A 4U8MA 4B66A 2GR2A 2WOWA 4X9MA 4U8LA 3NT6A 2RGOA 4FDCB 4Z2TA 1GT8A 4WX1A 1XDIA 3AE6A 3IHGA 1IUWA 4AP1A 3LJPA 1IJHA 3SFEA 3AYLA 5KVHA 4REKA 2BYBA 1RSGA 4P9SA 3NNEA 4Y4NA 2CVJA 3NHOX 4RSLA 4JQ9A 1PXBA 5FMHA 1PHHA 5L46A 1Q9IA 3F8RA 3CIRA 4MJWA 1XHCA 4A65A 3DJJA 4DSGA 4YT0A 3QSEA 2YG6A 2R0CA 2C72A 3RP6A 1IUUA 4IA5A 3AEEA 3QVRA 2YG5A 1KDGA 2Z5XA 2B7SA 2ZZCA 5FS6A 3G5SA 3M0OA 3CGCA 4TLZA 3VRAA 4ZCDA 4A5LA 1GRGA 3HYXA 2C4CA 2B9XA 2VVLG 4J56A 4B69A 1F6MA 5JCIA 1NG4A 2XFPA 2XCGA 3NN0X 3URHA 2FBWA 1Y56B 1GETA 4LA1A 3UP5A 1REOA 2BABA 1DXLA 1TYPA 2BC0A 1Q1RA 4XXGA 4GRTA 3ICSA 3CMMA 3GMBA 3PVCA 4E0VA 2CFYA 3II4A 3KD9A 2GEWA 4H2PA 4A9WA 1OJTA 3AE9A 2JKCA 4A6NB 1H7WA 1B4VA 1B5QA 2X8GA 2FJAA 3DK4A 3HZLA 4Z26A 4ZN0A 1IUVA 2WBAA 1V59A 3AEDA 2PYXA 3LZXA 3I6DA 4H4YA 3UKPA 3K7QX 1VG0A 4UP3A 3AE1A 3UKQA 5C3JA 4H4QA 5C2TA 2EQ7A 3C96A 3VQRA 4DNAA 2C3CA 1DNCA 3ITJA 2YVFA 4OPIA 1K0LA 1PDHA 3KVEA 2X8CA 4AT0A 2WS3A 2BCGG 4GR1A 4OPLA 1MO9A 5KWFA 1E1MA 1PN0A 3B3RA 3UTHA 2GF3A 2YR5A 4CY8A 3P1WA 3UP4A 1IUTA 3CNDA 3NYFA 2B76A 2V5ZA 4G6HA 3UOVA 1QO8A 3FPZA 3ALLA 4H4VA 1F3PA 2V60A 1GNDA 4OPUA 2Q6UA 2A87A 3SZFA 2TPRA 1FL2A 2VRMA 1IUXA 4J2WA 4IA6A 1KF6A 2JK6A 4HB9A 1GTEA 4HA6A 3F8DA 3ALMA 4FK1C 4OVIA 2BS4A 3AWIA 1CL0A 4X4JA 2GB0A 4K7ZA 2VRLA 1SEZA 1Q1WA 3T2ZA 3V76A 1H82A 1YQZA 5KMQA 1ZP0A 1K4QA 3BHKA 2DKHA 4EQWA 1DJQA 1S2QA 2B7RA 4H2RA 1PS9A 3GMCA 3T14A 2C73A 1RP0A 3LADA 1JNZA 4H4PA 2I0ZA 3NKSA 5U1OA 2FJDA 3NN6X 4DSHA 1ZOVA 3AD9B 2YLRA 3BI2A 3CGDA 3T31A 4NZHA 2YR6A 3NRNA 1N4UA 5KMPA 5FS9A 2XVHA 5HYMA 2YLWA 3NK2X 1FCDA 3UKHA 3KPFA 4N9XA 2GMJA 4C3XA 2J3NA 2YLXA 3SY4A 4IV9A 2BS2A 4FX9A 1DOEA 2C67A 2X3NA 3NIXA 1O94A 3NK1X 2JBVA 4EQRA 2PHHA 4NTDA 4EQSA 4A6NA 3EF6A 1NENA 3B6DA 1CC2A 4H4SA 2YLTA 1IUSA 1OJ9A 3UTEA 1GRAA 2BRAA 5HY5A 3REDA 1ZDLA 1H7XA 2VVLA 4K2XA 4X9NA 4BK3A 3CPIG 2XFQA 1EL9A 2B9WA 2XFUA 3DJEA 5KMRA 2Y6QA 4Z2UA 1EBDA 2RABA 2WOIA 4EM4A 4II2A 4RG4A 3T37A 1S3BA 3IHMA 3AE7A 2ZZ0A 1D7YA 4YSZA 1XPQA 3VRBA 1JRXA 4U8JA 2C66A 2C65A 3CPJG 1O95A 4BURA 2WPEA 4GDEA 4U8IA 1JU2A 2XFOA 3AEAA 3P4RA 1N4VA 1GXFA 2OALA 4AT2A 2WP9A 1KSSA 1PBEA 3CN8A 1PXAA 2Q7VA 2X50A 3CNSA 1TDNA 4LU6A 4YTNA 4EMJA 1BF3A 1PBBA 1ZOYA 3QSMA 1S3EA 1E1NA 1L0VA 2BK3A 4Z2RA 1CJ2A 3IC9A 1H84A 4C77A 2TMDA 2BCPA 2WDVA 2YVJA 3UTGA 1B37A 2XYOA 3KU9A 2VOUA 4LIIA 1PBDA 2WHDA 2WESA 3SZCA 2BRYA 2FJEA 2OA1A 1VDCA 3AXBA 1GOSA 2AR8A 3LB8A 1VQWA 4H2QA 3DGHA 3NG7X 5U63A 4B63A 1L9CA 2YG4A 4J33A 4OPCA 1BWCA 1M64A 3NLCA 1KSUA 1PJ6A 1GRHA 3UOYA 1LQTA 1GRBA 1VG9A 4ECHA 4D04A 2NPXA 2R46A 2C3DA 2CULA 4J57A 1GEUA 4B1BA 5KOWA 4BK2A 3OZ2A 5JCMA 1BKWA 3GYJA 1DOCA 3CTYA 3GYXA 3AEFA 2B9YA 4YKFA 4DGKA 4UDRA 2JAEA 1FOHA 3M12A 2E4GA 1D4EA 3IF9A 3I3LA 4JDRA 2R0PA 3Q6JA 3CNTA 4RG3A 5BULA 3SZ0A 4AOXA 3BI5A 3EANA 4U8OA 1NEKA 2Q0KA 3PO7A 4Y4MA 4YTMA 5GSNA 4II3A 2IVDA 2ARDA 2VZ2A 3SGLA 1ZMCA 1L9DA 1F8WA 3GD4A 3VR9A 1ZMDA 1W4XA 2WU5A 3AE8A 2QA1A 2WP5A 2YR4A 3AEBA 3RHAA 1LJ1A 5JCLA 1K0JA 2XLRA 2QAEA 3EAOA 4YSYA 1S2YA 3DK9A 1F8SA 2C70A 2YM1A 3NYEA 3K7MX 3NH3X 3EPTA 2WP6A 4U2LA 4Y4LA 1GALA 1PBFA 2AQJA 2OLNA 3RP7A 3SZWA 3GWFA 3T0KA 1H83A 4G74A 1KFYA 3BHFA 2R0GA 2F5ZA 2GAHB 2H88A 2Z5YA 3C4NA 2H89A 5BVAA 4AOSA 4H4TA 1BGNA 2R9ZA 2BK5A 4YWOA 2BK4A 5BUKA 3UOZA 2VQ7A 3CNJA 3PS9A 2YM2A 3AE4A 4NTCA 4A99A 3O0HA 2XLUA 3UCLA 2R4EA 3FIMB 3ATQA 3DGZA 4K8DA 3S5WA 2GAGB 3DJGX 5JCNA 1ZX9A 3T2YA 3ZYXA 5KNLA 1N1PA 1BGJA 1DOBA 3DMEA 3AYIA 3KA7A 2QA2A 1PJ5A 4YSHA 2GQWA 4H50A 5JCKA 1FEAA 4B65A 2CDUA 5CKUA 4BJZA 2GV8A 1HYUA 2XVJA 4H4WA 2YLZA 5U25A 1ELIA 3K30A 3SFDA 5HXIA 4U2TA 1EL5A 5M0ZA 1GSNA 1H86A 1YY5A 1CBOA 2Q0LA 1E1KA 1KNRA 4EIPA 3OC4A 2XFNA 1NG3A 4CNKA 2V6OA 3NYCA 2DKIA 3P4PA 4USQA 4USRA 4A7AA 5J7XA 1NHQA 3GD3A 4EMWA 3AD8B 1TDOA 2UZZA 4TM3A 4GAPA 4JNAA 3ICTA 5EBKA 1QLBA 3E1TA 3QVPA 3L1RA 2XLTA 3H8LA 1YKJA 4K5SA 2GVCA 4OPDA 3GDNA 2WDQA 2C7GA 4I59A 2BC1A 2WEUA 3GWDA 1VRQB 5CQFA 3RP8A 5HHFA 4YKGA 2GR1A 3AEGA 1P2EA 2W0HA 2RGHA 3BNUA 3D8XA 1PXCA 3ZDNA 4A79A 5IPYA 4C5OA 4Z24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH5 A;  1CC4 A;  2A8X A;  1E7P A;  2WQY A;  4U8K A;  3C4A A;  1GES A;  1NDA A;  1H6V A;  4GDP A;  1CHU A;  1E39 A;  3NTA A;  3UTF A;  4Z25 A;  1OJD A;  3FMW A;  1GRF A;  1N4W A;  4U2S A;  3CPH G;  3GRS A;  3SM8 A;  3AE2 A;  3R9U A;  4APN A;  1L9E A;  2BS3 A;  3ICR A;  5IQ1 A;  1EL7 A;  4H4X A;  4YSX A;  3DJD A;  4U8P A;  2WOV A;  4B64 A;  3F8P A;  2E5V A;  2ZBW A;  4B67 A;  3AB1 A;  3DH9 A;  1FEC A;  4FK1 A;  5EB4 A;  1NAA A;  3CNP A;  1BZL A;  2YLS A;  1F8R A;  2VVM A;  2YQU A;  3LOV A;  2OLO A;  1GRT A;  4BV6 A;  4IVO B;  3COX A;  1CJC A;  2R4J A;  5TR3 A;  2XVE A;  3V3N A;  2BAC A;  5J60 A;  2C76 A;  3GYI A;  4Z43 A;  4UDP A;  1FEB A;  1OJA A;  5ER0 A;  4UDQ A;  1MXT A;  3ATR A;  1LQU A;  3D1C A;  2V3A A;  2ZZB A;  4ICY A;  4K5R A;  4B68 A;  4M52 A;  1LV0 A;  1LTX R;  1M6I A;  1ZY8 A;  1K0I A;  1Y0P A;  4CCR A;  2BXR A;  2AAQ A;  2HQM A;  1GPE A;  3AEC A;  3VR8 A;  1OJC A;  1DOD A;  2E1M A;  1TYT A;  3CGE A;  1H81 A;  4CNJ A;  4ADW A;  4I58 A;  1JEH A;  4O5U A;  3K7T A;  2EQ8 A;  3UKL A;  1TDF A;  2GRT A;  3G5R A;  4JNQ A;  4GUV A;  4CBQ A;  4OCG A;  5KRQ A;  4PAB A;  4JY2 A;  4D03 A;  2WU2 A;  3QFA A;  4IVM B;  5KXJ A;  1NHP A;  3VRD B;  2ACZ A;  2APG A;  2FJB A;  3KLJ A;  4XWZ A;  4NTE A;  3QSS A;  1GER A;  2BA9 A;  2YAU A;  2WPF A;  3AYJ A;  4H4R A;  4O5Q A;  1PJ7 A;  2Y6R A;  5M10 A;  4TM1 A;  1XAN A;  3RNM A;  4EMI A;  1PBC A;  2R45 A;  4TLX A;  1TDE A;  3DA1 A;  2IID A;  3ALJ A;  2XDO A;  2X8H A;  3LZW A;  4EIQ A;  5DBJ A;  1MOK A;  1NHR A;  1GTH A;  4JY3 A;  1UKV G;  3G5Q A;  3IWA A;  5LV9 A;  3UKK A;  3AE5 A;  3FBS A;  4TM0 A;  2GQF A;  2JB2 A;  2OAM A;  1Z6L A;  3JSK A;  2O9Z A;  2V61 A;  3ADA B;  3CGB A;  3H8I A;  5FS8 A;  2YWL A;  3AE3 A;  1NHS A;  1TRB A;  1LVL A;  2WPC A;  2WDR A;  3UKF A;  3P9U A;  1GV4 A;  4NEV A;  4AP3 A;  4CCQ A;  2V3B A;  2XVF A;  2JB1 A;  2RGJ A;  3P4S A;  4BK1 A;  1EL8 A;  3QJ4 A;  4CRT A;  1P2H A;  3SQP A;  4TM4 A;  5FS7 A;  4CY6 A;  1CJ4 A;  3GRT A;  4Z44 A;  2EQ6 A;  2C64 A;  3NTD A;  1COY A;  3FG2 P;  2GR0 A;  1E6E A;  4WCT A;  5EOW A;  4C3Y A;  2YVG A;  4H2N A;  1D4D A;  2XVI A;  4H4Z A;  4KPR A;  4GCM A;  2EQ9 A;  2XLP A;  5KOX A;  4K22 A;  5BRT A;  2JB3 A;  1JOA A;  2VQB A;  4XWR A;  3H4K A;  2GMH A;  3NK0 X;  1D4C A;  2WET A;  2YG7 A;  4H7U A;  1ONF A;  4KX6 A;  1NPX A;  2QCU A;  1KNP A;  1E1L A;  3NGC X;  5IQ4 A;  4H4U A;  1GRE A;  1Y56 A;  3L8K A;  3S61 A;  3DK8 A;  4J36 A;  3BI4 A;  1JNR A;  4OPT A;  1JRZ A;  3GDP A;  3V3O A;  2C75 A;  1O5W A;  4YXD A;  2GR3 A;  4NEW A;  3P4Q A;  1JRY A;  4EM3 A;  1B8S A;  4PAA A;  3UKA A;  1LPF A;  2IVE A;  1YQ4 A;  5GRT A;  5KVI A;  4U8N A;  1ZKQ A;  1DJN A;  3QFB A;  2NVK X;  1AOG A;  2XLS A;  2A89 A;  3BNM A;  1D5T A;  3KKJ A;  1RYI A;  2X99 A;  3GSI A;  3Q9T A;  3UOX A;  1D7L A;  1CC6 A;  3ISH A;  3LXD A;  4OPG A;  1X31 B;  1CF3 A;  4JN9 A;  4ZCC A;  4BJY A;  4J34 A;  4YTP A;  4EQX A;  4GF7 A;  5EB5 A;  4J31 A;  2BXS A;  1YQ3 A;  1ZK7 A;  4C74 A;  3WE0 A;  1QJD A;  3ABV A;  1CJ3 A;  3AD7 B;  3M13 A;  1TDK A;  2YG3 A;  4U8M A;  4B66 A;  2GR2 A;  2WOW A;  4X9M A;  4U8L A;  3NT6 A;  2RGO A;  4FDC B;  4Z2T A;  1GT8 A;  4WX1 A;  1XDI A;  3AE6 A;  3IHG A;  1IUW A;  4AP1 A;  3LJP A;  1IJH A;  3SFE A;  3AYL A;  5KVH A;  4REK A;  2BYB A;  1RSG A;  4P9S A;  3NNE A;  4Y4N A;  2CVJ A;  3NHO X;  4RSL A;  4JQ9 A;  1PXB A;  5FMH A;  1PHH A;  5L46 A;  1Q9I A;  3F8R A;  3CIR A;  1XHC A;  4MJW A;  4A65 A;  3DJJ A;  4DSG A;  4YT0 A;  3QSE A;  2YG6 A;  2R0C A;  2C72 A;  3RP6 A;  1IUU A;  4IA5 A;  3AEE A;  3QVR A;  2YG5 A;  1KDG A;  2Z5X A;  2B7S A;  2ZZC A;  5FS6 A;  3G5S A;  3M0O A;  3CGC A;  4TLZ A;  3VRA A;  4ZCD A;  4A5L A;  1GRG A;  2VVL G;  2B9X A;  4J56 A;  4B69 A;  5JCI A;  1F6M A;  1NG4 A;  2XFP A;  2XCG A;  3NN0 X;  3URH A;  2FBW A;  1Y56 B;  1GET A;  4LA1 A;  3UP5 A;  1REO A;  2BAB A;  1DXL A;  1TYP A;  2BC0 A;  1Q1R A;  4XXG A;  4GRT A;  3ICS A;  4E0V A;  3GMB A;  3PVC A;  2CFY A;  3II4 A;  3KD9 A;  2GEW A;  4H2P A;  4A9W A;  1OJT A;  3AE9 A;  2JKC A;  4A6N B;  1H7W A;  1B4V A;  1B5Q A;  2X8G A;  2FJA A;  3DK4 A;  3HZL A;  4Z26 A;  4ZN0 A;  1IUV A;  2WBA A;  1V59 A;  3AED A;  2PYX A;  3LZX A;  3I6D A;  4H4Y A;  3UKP A;  3K7Q X;  1VG0 A;  4UP3 A;  3AE1 A;  3UKQ A;  5C3J A;  4H4Q A;  5C2T A;  2EQ7 A;  3C96 A;  3VQR A;  4DNA A;  2C3C A;  1DNC A;  3ITJ A;  2YVF A;  4OPI A;  1K0L A;  1PDH A;  3KVE A;  2X8C A;  4AT0 A;  2WS3 A;  2BCG G;  4GR1 A;  4OPL A;  1MO9 A;  5KWF A;  1E1M A;  1PN0 A;  3B3R A;  3UTH A;  2GF3 A;  2YR5 A;  4CY8 A;  3P1W A;  3UP4 A;  1IUT A;  3CND A;  3NYF A;  2B76 A;  2V5Z A;  3UOV A;  1QO8 A;  3FPZ A;  3ALL A;  4H4V A;  1F3P A;  2V60 A;  1GND A;  4OPU A;  2Q6U A;  2A87 A;  2TPR A;  1FL2 A;  2VRM A;  1IUX A;  4J2W A;  4IA6 A;  1KF6 A;  2JK6 A;  4HB9 A;  1GTE A;  4HA6 A;  3F8D A;  3ALM A;  4FK1 C;  4OVI A;  2BS4 A;  3AWI A;  1CL0 A;  4X4J A;  2GB0 A;  4K7Z A;  2VRL A;  1SEZ A;  1Q1W A;  3V76 A;  1H82 A;  1YQZ A;  1ZP0 A;  1K4Q A;  3BHK A;  2DKH A;  4EQW A;  1DJQ A;  1S2Q A;  2B7R A;  4H2R A;  1PS9 A;  3GMC A;  2C73 A;  1RP0 A;  3LAD A;  1JNZ A;  4H4P A;  2I0Z A;  3NKS A;  5U1O A;  2FJD A;  3NN6 X;  4DSH A;  1ZOV A;  3AD9 B;  2YLR A;  3BI2 A;  3CGD A;  4NZH A;  2YR6 A;  3NRN A;  1N4U A;  5FS9 A;  2XVH A;  5HYM A;  2YLW A;  3NK2 X;  1FCD A;  3UKH A;  3KPF A;  4N9X A;  2GMJ A;  4C3X A;  2J3N A;  2YLX A;  4IV9 A;  2BS2 A;  4FX9 A;  1DOE A;  2C67 A;  2X3N A;  3NIX A;  1O94 A;  3NK1 X;  2JBV A;  4EQR A;  2PHH A;  4NTD A;  4EQS A;  4A6N A;  3EF6 A;  1NEN A;  3B6D A;  1CC2 A;  4H4S A;  2YLT A;  1IUS A;  1OJ9 A;  3UTE A;  1GRA A;  5HY5 A;  1ZDL A;  3RED A;  1H7X A;  2VVL A;  4K2X A;  4X9N A;  4BK3 A;  3CPI G;  2XFQ A;  1EL9 A;  2B9W A;  2XFU A;  3DJE A;  2Y6Q A;  4Z2U A;  1EBD A;  2RAB A;  2WOI A;  4EM4 A;  4RG4 A;  3T37 A;  1S3B A;  3IHM A;  3AE7 A;  2ZZ0 A;  1D7Y A;  4YSZ A;  1XPQ A;  3VRB A;  1JRX A;  4U8J A;  2C66 A;  2C65 A;  3CPJ G;  1O95 A;  4BUR A;  2WPE A;  4GDE A;  4U8I A;  1JU2 A;  2XFO A;  3AEA A;  3P4R A;  1N4V A;  1GXF A;  2OAL A;  4AT2 A;  2WP9 A;  1KSS A;  1PBE A;  3CN8 A;  1PXA A;  2Q7V A;  2X50 A;  3CNS A;  1TDN A;  4LU6 A;  4YTN A;  4EMJ A;  1BF3 A;  1PBB A;  1ZOY A;  3QSM A;  1S3E A;  1E1N A;  1L0V A;  2BK3 A;  4Z2R A;  1CJ2 A;  3IC9 A;  1H84 A;  4C77 A;  2TMD A;  2BCP A;  2WDV A;  2YVJ A;  3UTG A;  1B37 A;  2XYO A;  3KU9 A;  2VOU A;  4LII A;  1PBD A;  2WHD A;  2WES A;  2FJE A;  2OA1 A;  1VDC A;  3AXB A;  1GOS A;  2AR8 A;  3LB8 A;  1VQW A;  4H2Q A;  3DGH A;  3NG7 X;  5U63 A;  4B63 A;  1L9C A;  2YG4 A;  4J33 A;  4OPC A;  1BWC A;  1M64 A;  3NLC A;  1KSU A;  1PJ6 A;  1GRH A;  3UOY A;  1LQT A;  1GRB A;  1VG9 A;  4ECH A;  4D04 A;  2NPX A;  2R46 A;  2C3D A;  2CUL A;  4J57 A;  1GEU A;  4B1B A;  5KOW A;  4BK2 A;  3OZ2 A;  5JCM A;  1BKW A;  3GYJ A;  1DOC A;  3CTY A;  3AEF A;  2B9Y A;  4YKF A;  4DGK A;  4UDR A;  2JAE A;  1FOH A;  3M12 A;  2E4G A;  1D4E A;  3IF9 A;  3I3L A;  4JDR A;  2R0P A;  3Q6J A;  3CNT A;  4RG3 A;  5BUL A;  4AOX A;  3BI5 A;  3EAN A;  4U8O A;  1NEK A;  2Q0K A;  3PO7 A;  4Y4M A;  4YTM A;  5GSN A;  2IVD A;  2ARD A;  2VZ2 A;  3SGL A;  1ZMC A;  1L9D A;  1F8W A;  3GD4 A;  3VR9 A;  1ZMD A;  1W4X A;  2WU5 A;  3AE8 A;  2QA1 A;  2WP5 A;  2YR4 A;  3AEB A;  3RHA A;  1LJ1 A;  5JCL A;  1K0J A;  2XLR A;  2QAE A;  3EAO A;  4YSY A;  1S2Y A;  3DK9 A;  1F8S A;  2C70 A;  2YM1 A;  3NYE A;  3K7M X;  3NH3 X;  3EPT A;  2WP6 A;  4U2L A;  4Y4L A;  2OLN A;  1GAL A;  1PBF A;  2AQJ A;  3RP7 A;  3GWF A;  1H83 A;  1KFY A;  3BHF A;  2R0G A;  2F5Z A;  2GAH B;  2H88 A;  2Z5Y A;  3C4N A;  2H89 A;  5BVA A;  4AOS A;  4H4T A;  1BGN A;  2R9Z A;  2BK5 A;  4YWO A;  2BK4 A;  5BUK A;  3UOZ A;  2VQ7 A;  3CNJ A;  3PS9 A;  2YM2 A;  3AE4 A;  4NTC A;  4A99 A;  3O0H A;  2XLU A;  3UCL A;  2R4E A;  3FIM B;  3ATQ A;  3DGZ A;  4K8D A;  3S5W A;  2GAG B;  3DJG X;  5JCN A;  1ZX9 A;  3ZYX A;  1N1P A;  1BGJ A;  1DOB A;  3DME A;  3AYI A;  3KA7 A;  2QA2 A;  1PJ5 A;  4YSH A;  2GQW A;  4H50 A;  5JCK A;  1FEA A;  4B65 A;  2CDU A;  5CKU A;  4BJZ A;  2GV8 A;  1HYU A;  2XVJ A;  4H4W A;  2YLZ A;  5U25 A;  1ELI A;  3K30 A;  3SFD A;  5HXI A;  4U2T A;  1EL5 A;  5M0Z A;  1GSN A;  1H86 A;  1YY5 A;  1CBO A;  2Q0L A;  1E1K A;  1KNR A;  4EIP A;  3OC4 A;  2XFN A;  1NG3 A;  4CNK A;  2V6O A;  3NYC A;  2DKI A;  3P4P A;  4USQ A;  4USR A;  4A7A A;  5J7X A;  1NHQ A;  3GD3 A;  4EMW A;  3AD8 B;  1TDO A;  2UZZ A;  4TM3 A;  4JNA A;  3ICT A;  5EBK A;  1QLB A;  3E1T A;  3QVP A;  3L1R A;  2XLT A;  3H8L A;  1YKJ A;  4K5S A;  2GVC A;  4OPD A;  3GDN A;  2WDQ A;  2C7G A;  4I59 A;  2BC1 A;  2WEU A;  3GWD A;  1VRQ B;  5CQF A;  3RP8 A;  5HHF A;  4YKG A;  2GR1 A;  3AEG A;  1P2E A;  2W0H A;  2RGH A;  3BNU A;  3D8X A;  1PXC A;  3ZDN A;  4A79 A;  5IPY A;  4C5O A;  4Z24 A; 
#chains in the Genus database with same CATH topology
 2GH5 A;  1CC4 A;  2A8X A;  1E7P A;  2WQY A;  4U8K A;  3C4A A;  1GES A;  1NDA A;  1H6V A;  4GDP A;  1CHU A;  1E39 A;  3NTA A;  4G73 A;  3UTF A;  4Z25 A;  1OJD A;  3FMW A;  1GRF A;  1N4W A;  4U2S A;  3CPH G;  3GRS A;  3T2K A;  3SM8 A;  3KPK A;  3AE2 A;  3R9U A;  4APN A;  1L9E A;  2BS3 A;  3ICR A;  5IQ1 A;  1EL7 A;  4H4X A;  4YSX A;  3DJD A;  4U8P A;  2WOV A;  4B64 A;  3F8P A;  2E5V A;  2ZBW A;  3SX6 A;  3AB1 A;  4B67 A;  3DH9 A;  1FEC A;  4FK1 A;  5EB4 A;  1NAA A;  3CNP A;  1BZL A;  2YLS A;  1F8R A;  2VVM A;  2YQU A;  3LOV A;  2OLO A;  1GRT A;  4BV6 A;  3SXI A;  4IVO B;  3COX A;  1CJC A;  2R4J A;  5TR3 A;  2XVE A;  3V3N A;  2BAC A;  5J60 A;  2C76 A;  3GYI A;  4Z43 A;  4UDP A;  1FEB A;  1OJA A;  5ER0 A;  4UDQ A;  1MXT A;  3ATR A;  1LQU A;  3D1C A;  2V3A A;  2ZZB A;  4ICY A;  4K5R A;  4B68 A;  4M52 A;  1LV0 A;  1LTX R;  1M6I A;  1ZY8 A;  4NWZ A;  1K0I A;  1Y0P A;  4CCR A;  2BXR A;  2AAQ A;  2HQM A;  3HYV A;  1GPE A;  3AEC A;  3VR8 A;  1OJC A;  1DOD A;  2E1M A;  1TYT A;  3CGE A;  1H81 A;  4CNJ A;  4ADW A;  4I58 A;  1JEH A;  4O5U A;  3K7T A;  2EQ8 A;  3UKL A;  1TDF A;  2GRT A;  3G5R A;  4JNQ A;  4GUV A;  4CBQ A;  5KMS A;  4OCG A;  5KRQ A;  4PAB A;  3HYW A;  4JY2 A;  4D03 A;  2WU2 A;  3QFA A;  4IVM B;  5KXJ A;  1NHP A;  4G6G A;  3VRD B;  2ACZ A;  2APG A;  2FJB A;  3KLJ A;  4G9K A;  4NTE A;  3QSS A;  4XWZ A;  1GER A;  2BA9 A;  2YAU A;  2WPF A;  3AYJ A;  4H4R A;  4O5Q A;  1PJ7 A;  2Y6R A;  5M10 A;  4TM1 A;  1XAN A;  3RNM A;  4EMI A;  1PBC A;  2R45 A;  4TLX A;  1TDE A;  3DA1 A;  2IID A;  3ALJ A;  2XDO A;  2X8H A;  3LZW A;  4EIQ A;  5DBJ A;  1MOK A;  1NHR A;  1GTH A;  4JY3 A;  1UKV G;  3G5Q A;  3IWA A;  5LV9 A;  3UKK A;  3AE5 A;  3FBS A;  4TM0 A;  2GQF A;  2JB2 A;  2OAM A;  1Z6L A;  3JSK A;  2O9Z A;  2V61 A;  3ADA B;  3CGB A;  3H8I A;  5FS8 A;  2YWL A;  3AE3 A;  1NHS A;  1TRB A;  1LVL A;  2WPC A;  2WDR A;  3UKF A;  3P9U A;  1GV4 A;  4NEV A;  4AP3 A;  4CCQ A;  2V3B A;  2XVF A;  2JB1 A;  2RGJ A;  3P4S A;  4BK1 A;  1EL8 A;  3QJ4 A;  4CRT A;  1P2H A;  3SQP A;  4NNJ A;  4TM4 A;  5FS7 A;  4CY6 A;  1CJ4 A;  3GRT A;  4Z44 A;  2EQ6 A;  2C64 A;  3NTD A;  1COY A;  3FG2 P;  2GR0 A;  1E6E A;  4WCT A;  5EOW A;  4C3Y A;  2YVG A;  4H2N A;  1D4D A;  2XVI A;  4H4Z A;  4KPR A;  4GCM A;  4GAV A;  2EQ9 A;  2XLP A;  5KOX A;  4K22 A;  5BRT A;  2JB3 A;  1JOA A;  2VQB A;  4XWR A;  3H4K A;  2GMH A;  3NK0 X;  1D4C A;  2WET A;  2YG7 A;  4H7U A;  1ONF A;  4KX6 A;  1NPX A;  2QCU A;  1KNP A;  1E1L A;  3NGC X;  5IQ4 A;  4H4U A;  1GRE A;  1Y56 A;  3L8K A;  3S61 A;  3DK8 A;  4J36 A;  3BI4 A;  1JNR A;  4OPT A;  1JRZ A;  3GDP A;  3V3O A;  2C75 A;  1O5W A;  4YXD A;  2GR3 A;  4NEW A;  3P4Q A;  1JRY A;  4EM3 A;  1B8S A;  4PAA A;  3UKA A;  1LPF A;  2IVE A;  1YQ4 A;  5GRT A;  5KVI A;  4U8N A;  1ZKQ A;  1DJN A;  3QFB A;  2NVK X;  1AOG A;  2XLS A;  2A89 A;  3BNM A;  1D5T A;  3KKJ A;  1RYI A;  2X99 A;  3GSI A;  3Q9T A;  3UOX A;  1D7L A;  1CC6 A;  3ISH A;  3LXD A;  4OPG A;  1X31 B;  1CF3 A;  4JN9 A;  4ZCC A;  4BJY A;  4J34 A;  4YTP A;  4EQX A;  5EB5 A;  4GF7 A;  4J31 A;  2BXS A;  1YQ3 A;  1ZK7 A;  4C74 A;  3SYI A;  3WE0 A;  1QJD A;  3ABV A;  1CJ3 A;  3AD7 B;  3M13 A;  1TDK A;  2YG3 A;  4U8M A;  4B66 A;  2GR2 A;  2WOW A;  4X9M A;  4U8L A;  3NT6 A;  2RGO A;  4FDC B;  4Z2T A;  1GT8 A;  4WX1 A;  1XDI A;  3AE6 A;  3IHG A;  1IUW A;  4AP1 A;  3LJP A;  1IJH A;  3SFE A;  3AYL A;  5KVH A;  4REK A;  2BYB A;  1RSG A;  4P9S A;  3NNE A;  4Y4N A;  2CVJ A;  3NHO X;  4RSL A;  4JQ9 A;  1PXB A;  5FMH A;  1PHH A;  5L46 A;  1Q9I A;  3F8R A;  3CIR A;  4MJW A;  1XHC A;  4A65 A;  3DJJ A;  4DSG A;  4YT0 A;  3QSE A;  2YG6 A;  2R0C A;  2C72 A;  3RP6 A;  1IUU A;  4IA5 A;  3AEE A;  3QVR A;  2YG5 A;  1KDG A;  2Z5X A;  2B7S A;  2ZZC A;  5FS6 A;  3G5S A;  3M0O A;  3CGC A;  4TLZ A;  3VRA A;  4ZCD A;  4A5L A;  1GRG A;  3HYX A;  2C4C A;  2B9X A;  2VVL G;  4J56 A;  4B69 A;  1F6M A;  5JCI A;  1NG4 A;  2XFP A;  2XCG A;  3NN0 X;  3URH A;  2FBW A;  1Y56 B;  1GET A;  4LA1 A;  3UP5 A;  1REO A;  2BAB A;  1DXL A;  1TYP A;  2BC0 A;  1Q1R A;  4XXG A;  4GRT A;  3ICS A;  3CMM A;  3GMB A;  3PVC A;  4E0V A;  2CFY A;  3II4 A;  3KD9 A;  2GEW A;  4H2P A;  4A9W A;  1OJT A;  3AE9 A;  2JKC A;  4A6N B;  1H7W A;  1B4V A;  1B5Q A;  2X8G A;  2FJA A;  3DK4 A;  3HZL A;  4Z26 A;  4ZN0 A;  1IUV A;  2WBA A;  1V59 A;  3AED A;  2PYX A;  3LZX A;  3I6D A;  4H4Y A;  3UKP A;  3K7Q X;  1VG0 A;  4UP3 A;  3AE1 A;  3UKQ A;  5C3J A;  4H4Q A;  5C2T A;  2EQ7 A;  3C96 A;  3VQR A;  4DNA A;  2C3C A;  1DNC A;  3ITJ A;  2YVF A;  4OPI A;  1K0L A;  1PDH A;  3KVE A;  2X8C A;  4AT0 A;  2WS3 A;  2BCG G;  4GR1 A;  4OPL A;  1MO9 A;  5KWF A;  1E1M A;  1PN0 A;  3B3R A;  3UTH A;  2GF3 A;  2YR5 A;  4CY8 A;  3P1W A;  3UP4 A;  1IUT A;  3CND A;  3NYF A;  2B76 A;  2V5Z A;  4G6H A;  3UOV A;  1QO8 A;  3FPZ A;  3ALL A;  4H4V A;  1F3P A;  2V60 A;  1GND A;  4OPU A;  2Q6U A;  2A87 A;  3SZF A;  2TPR A;  1FL2 A;  2VRM A;  1IUX A;  4J2W A;  4IA6 A;  1KF6 A;  2JK6 A;  4HB9 A;  1GTE A;  4HA6 A;  3F8D A;  3ALM A;  4FK1 C;  4OVI A;  2BS4 A;  3AWI A;  1CL0 A;  4X4J A;  2GB0 A;  4K7Z A;  2VRL A;  1SEZ A;  1Q1W A;  3T2Z A;  3V76 A;  1H82 A;  1YQZ A;  5KMQ A;  1ZP0 A;  1K4Q A;  3BHK A;  2DKH A;  4EQW A;  1DJQ A;  1S2Q A;  2B7R A;  4H2R A;  1PS9 A;  3GMC A;  3T14 A;  2C73 A;  1RP0 A;  3LAD A;  1JNZ A;  4H4P A;  2I0Z A;  3NKS A;  5U1O A;  2FJD A;  3NN6 X;  4DSH A;  1ZOV A;  3AD9 B;  2YLR A;  3BI2 A;  3CGD A;  3T31 A;  4NZH A;  2YR6 A;  3NRN A;  1N4U A;  5KMP A;  5FS9 A;  2XVH A;  5HYM A;  2YLW A;  3NK2 X;  1FCD A;  3UKH A;  3KPF A;  4N9X A;  2GMJ A;  4C3X A;  2J3N A;  2YLX A;  3SY4 A;  4IV9 A;  2BS2 A;  4FX9 A;  1DOE A;  2C67 A;  2X3N A;  3NIX A;  1O94 A;  3NK1 X;  2JBV A;  4EQR A;  2PHH A;  4NTD A;  4EQS A;  4A6N A;  3EF6 A;  1NEN A;  3B6D A;  1CC2 A;  4H4S A;  2YLT A;  1IUS A;  1OJ9 A;  3UTE A;  1GRA A;  2BRA A;  5HY5 A;  3RED A;  1ZDL A;  1H7X A;  2VVL A;  4K2X A;  4X9N A;  4BK3 A;  3CPI G;  2XFQ A;  1EL9 A;  2B9W A;  2XFU A;  3DJE A;  5KMR A;  2Y6Q A;  4Z2U A;  1EBD A;  2RAB A;  2WOI A;  4EM4 A;  4II2 A;  4RG4 A;  3T37 A;  1S3B A;  3IHM A;  3AE7 A;  2ZZ0 A;  1D7Y A;  4YSZ A;  1XPQ A;  3VRB A;  1JRX A;  4U8J A;  2C66 A;  2C65 A;  3CPJ G;  1O95 A;  4BUR A;  2WPE A;  4GDE A;  4U8I A;  1JU2 A;  2XFO A;  3AEA A;  3P4R A;  1N4V A;  1GXF A;  2OAL A;  4AT2 A;  2WP9 A;  1KSS A;  1PBE A;  3CN8 A;  1PXA A;  2Q7V A;  2X50 A;  3CNS A;  1TDN A;  4LU6 A;  4YTN A;  4EMJ A;  1BF3 A;  1PBB A;  1ZOY A;  3QSM A;  1S3E A;  1E1N A;  1L0V A;  2BK3 A;  4Z2R A;  1CJ2 A;  3IC9 A;  1H84 A;  4C77 A;  2TMD A;  2BCP A;  2WDV A;  2YVJ A;  3UTG A;  1B37 A;  2XYO A;  3KU9 A;  2VOU A;  4LII A;  1PBD A;  2WHD A;  2WES A;  3SZC A;  2BRY A;  2FJE A;  2OA1 A;  1VDC A;  3AXB A;  1GOS A;  2AR8 A;  3LB8 A;  1VQW A;  4H2Q A;  3DGH A;  3NG7 X;  5U63 A;  4B63 A;  1L9C A;  2YG4 A;  4J33 A;  4OPC A;  1BWC A;  1M64 A;  3NLC A;  1KSU A;  1PJ6 A;  1GRH A;  3UOY A;  1LQT A;  1GRB A;  1VG9 A;  4ECH A;  4D04 A;  2NPX A;  2R46 A;  2C3D A;  2CUL A;  4J57 A;  1GEU A;  4B1B A;  5KOW A;  4BK2 A;  3OZ2 A;  5JCM A;  1BKW A;  3GYJ A;  1DOC A;  3CTY A;  3GYX A;  3AEF A;  2B9Y A;  4YKF A;  4DGK A;  4UDR A;  2JAE A;  1FOH A;  3M12 A;  2E4G A;  1D4E A;  3IF9 A;  3I3L A;  4JDR A;  2R0P A;  3Q6J A;  3CNT A;  4RG3 A;  5BUL A;  3SZ0 A;  4AOX A;  3BI5 A;  3EAN A;  4U8O A;  1NEK A;  2Q0K A;  3PO7 A;  4Y4M A;  4YTM A;  5GSN A;  4II3 A;  2IVD A;  2ARD A;  2VZ2 A;  3SGL A;  1ZMC A;  1L9D A;  1F8W A;  3GD4 A;  3VR9 A;  1ZMD A;  1W4X A;  2WU5 A;  3AE8 A;  2QA1 A;  2WP5 A;  2YR4 A;  3AEB A;  3RHA A;  1LJ1 A;  5JCL A;  1K0J A;  2XLR A;  2QAE A;  3EAO A;  4YSY A;  1S2Y A;  3DK9 A;  1F8S A;  2C70 A;  2YM1 A;  3NYE A;  3K7M X;  3NH3 X;  3EPT A;  2WP6 A;  4U2L A;  4Y4L A;  1GAL A;  1PBF A;  2AQJ A;  2OLN A;  3RP7 A;  3SZW A;  3GWF A;  3T0K A;  1H83 A;  4G74 A;  1KFY A;  3BHF A;  2R0G A;  2F5Z A;  2GAH B;  2H88 A;  2Z5Y A;  3C4N A;  2H89 A;  5BVA A;  4AOS A;  4H4T A;  1BGN A;  2R9Z A;  2BK5 A;  4YWO A;  2BK4 A;  5BUK A;  3UOZ A;  2VQ7 A;  3CNJ A;  3PS9 A;  2YM2 A;  3AE4 A;  4NTC A;  4A99 A;  3O0H A;  2XLU A;  3UCL A;  2R4E A;  3FIM B;  3ATQ A;  3DGZ A;  4K8D A;  3S5W A;  2GAG B;  3DJG X;  5JCN A;  1ZX9 A;  3T2Y A;  3ZYX A;  5KNL A;  1N1P A;  1BGJ A;  1DOB A;  3DME A;  3AYI A;  3KA7 A;  2QA2 A;  1PJ5 A;  4YSH A;  2GQW A;  4H50 A;  5JCK A;  1FEA A;  4B65 A;  2CDU A;  5CKU A;  4BJZ A;  2GV8 A;  1HYU A;  2XVJ A;  4H4W A;  2YLZ A;  5U25 A;  1ELI A;  3K30 A;  3SFD A;  5HXI A;  4U2T A;  1EL5 A;  5M0Z A;  1GSN A;  1H86 A;  1YY5 A;  1CBO A;  2Q0L A;  1E1K A;  1KNR A;  4EIP A;  3OC4 A;  2XFN A;  1NG3 A;  4CNK A;  2V6O A;  3NYC A;  2DKI A;  3P4P A;  4USQ A;  4USR A;  4A7A A;  5J7X A;  1NHQ A;  3GD3 A;  4EMW A;  3AD8 B;  1TDO A;  2UZZ A;  4TM3 A;  4GAP A;  4JNA A;  3ICT A;  5EBK A;  1QLB A;  3E1T A;  3QVP A;  3L1R A;  2XLT A;  3H8L A;  1YKJ A;  4K5S A;  2GVC A;  4OPD A;  3GDN A;  2WDQ A;  2C7G A;  4I59 A;  2BC1 A;  2WEU A;  3GWD A;  1VRQ B;  5CQF A;  3RP8 A;  5HHF A;  4YKG A;  2GR1 A;  3AEG A;  1P2E A;  2W0H A;  2RGH A;  3BNU A;  3D8X A;  1PXC A;  3ZDN A;  4A79 A;  5IPY A;  4C5O A;  4Z24 A; 
#chains in the Genus database with same CATH homology
 2GH5 A;  1CC4 A;  2A8X A;  1E7P A;  2WQY A;  4U8K A;  3C4A A;  1GES A;  1NDA A;  1H6V A;  4GDP A;  1CHU A;  1E39 A;  3NTA A;  4G73 A;  3UTF A;  4Z25 A;  1OJD A;  3FMW A;  1GRF A;  1N4W A;  4U2S A;  3CPH G;  3GRS A;  3T2K A;  3SM8 A;  3KPK A;  3AE2 A;  3R9U A;  4APN A;  1L9E A;  2BS3 A;  3ICR A;  5IQ1 A;  1EL7 A;  4H4X A;  4YSX A;  3DJD A;  4U8P A;  2WOV A;  4B64 A;  3F8P A;  2E5V A;  2ZBW A;  3SX6 A;  3AB1 A;  4B67 A;  3DH9 A;  1FEC A;  4FK1 A;  5EB4 A;  1NAA A;  3CNP A;  1BZL A;  2YLS A;  1F8R A;  2VVM A;  2YQU A;  3LOV A;  2OLO A;  1GRT A;  4BV6 A;  3SXI A;  4IVO B;  3COX A;  1CJC A;  2R4J A;  5TR3 A;  2XVE A;  3V3N A;  2BAC A;  5J60 A;  2C76 A;  3GYI A;  4Z43 A;  4UDP A;  1FEB A;  1OJA A;  5ER0 A;  4UDQ A;  1MXT A;  3ATR A;  1LQU A;  3D1C A;  2V3A A;  2ZZB A;  4ICY A;  4K5R A;  4B68 A;  4M52 A;  1LV0 A;  1LTX R;  1M6I A;  1ZY8 A;  4NWZ A;  1K0I A;  1Y0P A;  4CCR A;  2BXR A;  2AAQ A;  2HQM A;  3HYV A;  1GPE A;  3AEC A;  3VR8 A;  1OJC A;  1DOD A;  2E1M A;  1TYT A;  3CGE A;  1H81 A;  4CNJ A;  4ADW A;  4I58 A;  1JEH A;  4O5U A;  3K7T A;  2EQ8 A;  3UKL A;  1TDF A;  2GRT A;  3G5R A;  4JNQ A;  4GUV A;  4CBQ A;  5KMS A;  4OCG A;  5KRQ A;  4PAB A;  3HYW A;  4JY2 A;  4D03 A;  2WU2 A;  3QFA A;  4IVM B;  5KXJ A;  1NHP A;  4G6G A;  3VRD B;  2ACZ A;  2APG A;  2FJB A;  3KLJ A;  4G9K A;  4NTE A;  3QSS A;  4XWZ A;  1GER A;  2BA9 A;  2YAU A;  2WPF A;  3AYJ A;  4H4R A;  4O5Q A;  1PJ7 A;  2Y6R A;  5M10 A;  4TM1 A;  1XAN A;  3RNM A;  4EMI A;  1PBC A;  2R45 A;  4TLX A;  1TDE A;  3DA1 A;  2IID A;  3ALJ A;  2XDO A;  2X8H A;  3LZW A;  4EIQ A;  5DBJ A;  1MOK A;  1NHR A;  1GTH A;  4JY3 A;  1UKV G;  3G5Q A;  3IWA A;  5LV9 A;  3UKK A;  3AE5 A;  3FBS A;  4TM0 A;  2GQF A;  2JB2 A;  2OAM A;  1Z6L A;  3JSK A;  2O9Z A;  2V61 A;  3ADA B;  3CGB A;  3H8I A;  5FS8 A;  2YWL A;  3AE3 A;  1NHS A;  1TRB A;  1LVL A;  2WPC A;  2WDR A;  3UKF A;  3P9U A;  1GV4 A;  4NEV A;  4AP3 A;  4CCQ A;  2V3B A;  2XVF A;  2JB1 A;  2RGJ A;  3P4S A;  4BK1 A;  1EL8 A;  3QJ4 A;  4CRT A;  1P2H A;  3SQP A;  4NNJ A;  4TM4 A;  5FS7 A;  4CY6 A;  1CJ4 A;  3GRT A;  4Z44 A;  2EQ6 A;  2C64 A;  3NTD A;  1COY A;  3FG2 P;  2GR0 A;  1E6E A;  4WCT A;  5EOW A;  4C3Y A;  2YVG A;  4H2N A;  1D4D A;  2XVI A;  4H4Z A;  4KPR A;  4GCM A;  4GAV A;  2EQ9 A;  2XLP A;  5KOX A;  4K22 A;  5BRT A;  2JB3 A;  1JOA A;  2VQB A;  4XWR A;  3H4K A;  2GMH A;  3NK0 X;  1D4C A;  2WET A;  2YG7 A;  4H7U A;  1ONF A;  4KX6 A;  1NPX A;  2QCU A;  1KNP A;  1E1L A;  3NGC X;  5IQ4 A;  4H4U A;  1GRE A;  1Y56 A;  3L8K A;  3S61 A;  3DK8 A;  4J36 A;  3BI4 A;  1JNR A;  4OPT A;  1JRZ A;  3GDP A;  3V3O A;  2C75 A;  1O5W A;  4YXD A;  2GR3 A;  4NEW A;  3P4Q A;  1JRY A;  4EM3 A;  1B8S A;  4PAA A;  3UKA A;  1LPF A;  2IVE A;  1YQ4 A;  5GRT A;  5KVI A;  4U8N A;  1ZKQ A;  1DJN A;  3QFB A;  2NVK X;  1AOG A;  2XLS A;  2A89 A;  3BNM A;  1D5T A;  3KKJ A;  1RYI A;  2X99 A;  3GSI A;  3Q9T A;  3UOX A;  1D7L A;  1CC6 A;  3ISH A;  3LXD A;  4OPG A;  1X31 B;  1CF3 A;  4JN9 A;  4ZCC A;  4BJY A;  4J34 A;  4YTP A;  4EQX A;  5EB5 A;  4GF7 A;  4J31 A;  2BXS A;  1YQ3 A;  1ZK7 A;  4C74 A;  3SYI A;  3WE0 A;  1QJD A;  3ABV A;  1CJ3 A;  3AD7 B;  3M13 A;  1TDK A;  2YG3 A;  4U8M A;  4B66 A;  2GR2 A;  2WOW A;  4X9M A;  4U8L A;  3NT6 A;  2RGO A;  4FDC B;  4Z2T A;  1GT8 A;  4WX1 A;  1XDI A;  3AE6 A;  3IHG A;  1IUW A;  4AP1 A;  3LJP A;  1IJH A;  3SFE A;  3AYL A;  5KVH A;  4REK A;  2BYB A;  1RSG A;  4P9S A;  3NNE A;  4Y4N A;  2CVJ A;  3NHO X;  4RSL A;  4JQ9 A;  1PXB A;  5FMH A;  1PHH A;  5L46 A;  1Q9I A;  3F8R A;  3CIR A;  4MJW A;  1XHC A;  4A65 A;  3DJJ A;  4DSG A;  4YT0 A;  3QSE A;  2YG6 A;  2R0C A;  2C72 A;  3RP6 A;  1IUU A;  4IA5 A;  3AEE A;  3QVR A;  2YG5 A;  1KDG A;  2Z5X A;  2B7S A;  2ZZC A;  5FS6 A;  3G5S A;  3M0O A;  3CGC A;  4TLZ A;  3VRA A;  4ZCD A;  4A5L A;  1GRG A;  3HYX A;  2C4C A;  2B9X A;  2VVL G;  4J56 A;  4B69 A;  1F6M A;  5JCI A;  1NG4 A;  2XFP A;  2XCG A;  3NN0 X;  3URH A;  2FBW A;  1Y56 B;  1GET A;  4LA1 A;  3UP5 A;  1REO A;  2BAB A;  1DXL A;  1TYP A;  2BC0 A;  1Q1R A;  4XXG A;  4GRT A;  3ICS A;  3CMM A;  3GMB A;  3PVC A;  4E0V A;  2CFY A;  3II4 A;  3KD9 A;  2GEW A;  4H2P A;  4A9W A;  1OJT A;  3AE9 A;  2JKC A;  4A6N B;  1H7W A;  1B4V A;  1B5Q A;  2X8G A;  2FJA A;  3DK4 A;  3HZL A;  4Z26 A;  4ZN0 A;  1IUV A;  2WBA A;  1V59 A;  3AED A;  2PYX A;  3LZX A;  3I6D A;  4H4Y A;  3UKP A;  3K7Q X;  1VG0 A;  4UP3 A;  3AE1 A;  3UKQ A;  5C3J A;  4H4Q A;  5C2T A;  2EQ7 A;  3C96 A;  3VQR A;  4DNA A;  2C3C A;  1DNC A;  3ITJ A;  2YVF A;  4OPI A;  1K0L A;  1PDH A;  3KVE A;  2X8C A;  4AT0 A;  2WS3 A;  2BCG G;  4GR1 A;  4OPL A;  1MO9 A;  5KWF A;  1E1M A;  1PN0 A;  3B3R A;  3UTH A;  2GF3 A;  2YR5 A;  4CY8 A;  3P1W A;  3UP4 A;  1IUT A;  3CND A;  3NYF A;  2B76 A;  2V5Z A;  4G6H A;  3UOV A;  1QO8 A;  3FPZ A;  3ALL A;  4H4V A;  1F3P A;  2V60 A;  1GND A;  4OPU A;  2Q6U A;  2A87 A;  3SZF A;  2TPR A;  1FL2 A;  2VRM A;  1IUX A;  4J2W A;  4IA6 A;  1KF6 A;  2JK6 A;  4HB9 A;  1GTE A;  4HA6 A;  3F8D A;  3ALM A;  4FK1 C;  4OVI A;  2BS4 A;  3AWI A;  1CL0 A;  4X4J A;  2GB0 A;  4K7Z A;  2VRL A;  1SEZ A;  1Q1W A;  3T2Z A;  3V76 A;  1H82 A;  1YQZ A;  5KMQ A;  1ZP0 A;  1K4Q A;  3BHK A;  2DKH A;  4EQW A;  1DJQ A;  1S2Q A;  2B7R A;  4H2R A;  1PS9 A;  3GMC A;  3T14 A;  2C73 A;  1RP0 A;  3LAD A;  1JNZ A;  4H4P A;  2I0Z A;  3NKS A;  5U1O A;  2FJD A;  3NN6 X;  4DSH A;  1ZOV A;  3AD9 B;  2YLR A;  3BI2 A;  3CGD A;  3T31 A;  4NZH A;  2YR6 A;  3NRN A;  1N4U A;  5KMP A;  5FS9 A;  2XVH A;  5HYM A;  2YLW A;  3NK2 X;  1FCD A;  3UKH A;  3KPF A;  4N9X A;  2GMJ A;  4C3X A;  2J3N A;  2YLX A;  3SY4 A;  4IV9 A;  2BS2 A;  4FX9 A;  1DOE A;  2C67 A;  2X3N A;  3NIX A;  1O94 A;  3NK1 X;  2JBV A;  4EQR A;  2PHH A;  4NTD A;  4EQS A;  4A6N A;  3EF6 A;  1NEN A;  3B6D A;  1CC2 A;  4H4S A;  2YLT A;  1IUS A;  1OJ9 A;  3UTE A;  1GRA A;  2BRA A;  5HY5 A;  3RED A;  1ZDL A;  1H7X A;  2VVL A;  4K2X A;  4X9N A;  4BK3 A;  3CPI G;  2XFQ A;  1EL9 A;  2B9W A;  2XFU A;  3DJE A;  5KMR A;  2Y6Q A;  4Z2U A;  1EBD A;  2RAB A;  2WOI A;  4EM4 A;  4II2 A;  4RG4 A;  3T37 A;  1S3B A;  3IHM A;  3AE7 A;  2ZZ0 A;  1D7Y A;  4YSZ A;  1XPQ A;  3VRB A;  1JRX A;  4U8J A;  2C66 A;  2C65 A;  3CPJ G;  1O95 A;  4BUR A;  2WPE A;  4GDE A;  4U8I A;  1JU2 A;  2XFO A;  3AEA A;  3P4R A;  1N4V A;  1GXF A;  2OAL A;  4AT2 A;  2WP9 A;  1KSS A;  1PBE A;  3CN8 A;  1PXA A;  2Q7V A;  2X50 A;  3CNS A;  1TDN A;  4LU6 A;  4YTN A;  4EMJ A;  1BF3 A;  1PBB A;  1ZOY A;  3QSM A;  1S3E A;  1E1N A;  1L0V A;  2BK3 A;  4Z2R A;  1CJ2 A;  3IC9 A;  1H84 A;  4C77 A;  2TMD A;  2BCP A;  2WDV A;  2YVJ A;  3UTG A;  1B37 A;  2XYO A;  3KU9 A;  2VOU A;  4LII A;  1PBD A;  2WHD A;  2WES A;  3SZC A;  2BRY A;  2FJE A;  2OA1 A;  1VDC A;  3AXB A;  1GOS A;  2AR8 A;  3LB8 A;  1VQW A;  4H2Q A;  3DGH A;  3NG7 X;  5U63 A;  4B63 A;  1L9C A;  2YG4 A;  4J33 A;  4OPC A;  1BWC A;  1M64 A;  3NLC A;  1KSU A;  1PJ6 A;  1GRH A;  3UOY A;  1LQT A;  1GRB A;  1VG9 A;  4ECH A;  4D04 A;  2NPX A;  2R46 A;  2C3D A;  2CUL A;  4J57 A;  1GEU A;  4B1B A;  5KOW A;  4BK2 A;  3OZ2 A;  5JCM A;  1BKW A;  3GYJ A;  1DOC A;  3CTY A;  3GYX A;  3AEF A;  2B9Y A;  4YKF A;  4DGK A;  4UDR A;  2JAE A;  1FOH A;  3M12 A;  2E4G A;  1D4E A;  3IF9 A;  3I3L A;  4JDR A;  2R0P A;  3Q6J A;  3CNT A;  4RG3 A;  5BUL A;  3SZ0 A;  4AOX A;  3BI5 A;  3EAN A;  4U8O A;  1NEK A;  2Q0K A;  3PO7 A;  4Y4M A;  4YTM A;  5GSN A;  4II3 A;  2IVD A;  2ARD A;  2VZ2 A;  3SGL A;  1ZMC A;  1L9D A;  1F8W A;  3GD4 A;  3VR9 A;  1ZMD A;  1W4X A;  2WU5 A;  3AE8 A;  2QA1 A;  2WP5 A;  2YR4 A;  3AEB A;  3RHA A;  1LJ1 A;  5JCL A;  1K0J A;  2XLR A;  2QAE A;  3EAO A;  4YSY A;  1S2Y A;  3DK9 A;  1F8S A;  2C70 A;  2YM1 A;  3NYE A;  3K7M X;  3NH3 X;  3EPT A;  2WP6 A;  4U2L A;  4Y4L A;  1GAL A;  1PBF A;  2AQJ A;  2OLN A;  3RP7 A;  3SZW A;  3GWF A;  3T0K A;  1H83 A;  4G74 A;  1KFY A;  3BHF A;  2R0G A;  2F5Z A;  2GAH B;  2H88 A;  2Z5Y A;  3C4N A;  2H89 A;  5BVA A;  4AOS A;  4H4T A;  1BGN A;  2R9Z A;  2BK5 A;  4YWO A;  2BK4 A;  5BUK A;  3UOZ A;  2VQ7 A;  3CNJ A;  3PS9 A;  2YM2 A;  3AE4 A;  4NTC A;  4A99 A;  3O0H A;  2XLU A;  3UCL A;  2R4E A;  3FIM B;  3ATQ A;  3DGZ A;  4K8D A;  3S5W A;  2GAG B;  3DJG X;  5JCN A;  1ZX9 A;  3T2Y A;  3ZYX A;  5KNL A;  1N1P A;  1BGJ A;  1DOB A;  3DME A;  3AYI A;  3KA7 A;  2QA2 A;  1PJ5 A;  4YSH A;  2GQW A;  4H50 A;  5JCK A;  1FEA A;  4B65 A;  2CDU A;  5CKU A;  4BJZ A;  2GV8 A;  1HYU A;  2XVJ A;  4H4W A;  2YLZ A;  5U25 A;  1ELI A;  3K30 A;  3SFD A;  5HXI A;  4U2T A;  1EL5 A;  5M0Z A;  1GSN A;  1H86 A;  1YY5 A;  1CBO A;  2Q0L A;  1E1K A;  1KNR A;  4EIP A;  3OC4 A;  2XFN A;  1NG3 A;  4CNK A;  2V6O A;  3NYC A;  2DKI A;  3P4P A;  4USQ A;  4USR A;  4A7A A;  5J7X A;  1NHQ A;  3GD3 A;  4EMW A;  3AD8 B;  1TDO A;  2UZZ A;  4TM3 A;  4GAP A;  4JNA A;  3ICT A;  5EBK A;  1QLB A;  3E1T A;  3QVP A;  3L1R A;  2XLT A;  3H8L A;  1YKJ A;  4K5S A;  2GVC A;  4OPD A;  3GDN A;  2WDQ A;  2C7G A;  4I59 A;  2BC1 A;  2WEU A;  3GWD A;  1VRQ B;  5CQF A;  3RP8 A;  5HHF A;  4YKG A;  2GR1 A;  3AEG A;  1P2E A;  2W0H A;  2RGH A;  3BNU A;  3D8X A;  1PXC A;  3ZDN A;  4A79 A;  5IPY A;  4C5O A;  4Z24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...