1NAAA

Cellobiose dehydrogenase flavoprotein fragment in complex with cellobionolactam
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
541
structure length
541
Chain Sequence
b'TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose dehydrogenase
publication title Mechanism of the reductive half-reaction in cellobiose dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 185
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1naaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1naaA01
3SFEA 1E7PA 2QAEA 3G5RA 3BI4A 5BUKA 1CBOA 5CQFA 4J57A 3GMBA 1P2EA 1PJ5A 1JU2A 3C4AA 3AD7B 1DOEA 3DGHA 3KLJA 5LV9A 2R9ZA 1N1PA 2C7GA 4AP3A 1K0JA 3H8IA 3I3LA 1GRAA 5KRQA 2R4EA 3K7QX 1LVLA 1S2YA 3OZ2A 3GDPA 1NHPA 2BABA 4K5SA 3UOYA 2YR4A 3ZDNA 2H88A 1V59A 5EOWA 3II4A 3H8LA 1JEHA 2EQ6A 5KOXA 3ITJA 1L0VA 3AE7A 3CN8A 4H2RA 4YKFA 3RP7A 3CGBA 3LOVA 1KFYA 4K5RA 2OAMA 3FIMB 3DJJA 5HXIA 4H2PA 1L9CA 1VQWA 3CPIG 5BULA 2AR8A 1NHRA 4LIIA 2FJDA 5KVIA 3NKSA 2C72A 4IVMB 1E39A 3P1WA 3WE0A 3QJ4A 4AT2A 2FJEA 4FK1A 4YSXA 3BHFA 2W0HA 1D4EA 2AQJA 2VOUA 2VRMA 4RSLA 2RGJA 2BS4A 3S61A 4CNJA 1Z6LA 3DMEA 1PXCA 3I6DA 1CC6A 2C66A 3O0HA 3ICSA 1S3BA 3D1CA 4JQ9A 2BS3A 4H2NA 2JB3A 4IA5A 4IA6A 4EMWA 4YSZA 2OA1A 4NEWA 4JN9A 1E1MA 1RSGA 4GR1A 3VRDB 4H4QA 1NG4A 1EL5A 1XPQA 2GMJA 2WPFA 2IVDA 4EQXA 1PBCA 4J56A 2E5VA 3GMCA 2XVFA 2VQ7A 3ALJA 1GETA 2Q0KA 1NENA 2GQWA 3AE6A 3QSEA 2YVGA 3GSIA 1D7LA 3AEAA 2QA2A 4Z44A 2GR3A 2C64A 2C3CA 1PBBA 3Q9TA 3ICTA 3UOVA 3PVCA 2GEWA 1KNRA 1E1NA 1GRTA 1OJTA 2B9WA 2WEUA 4RG4A 4E0VA 1W4XA 4BV6A 5JCIA 2A89A 2XVEA 4DNAA 2XFUA 2E4GA 3V76A 3K7MX 1BWCA 2RABA 2WPEA 2YG6A 1B4VA 4C3XA 1CHUA 4PABA 5IQ4A 4O5QA 4GUVA 1GESA 4CCQA 2WU5A 1F3PA 4RG3A 3KVEA 1TDKA 1KDGA 2GR2A 3NRNA 2YVFA 1GPEA 1ZKQA 2WOIA 1DXLA 1FEAA 5GRTA 3AB1A 1HYUA 2F5ZA 4TLZA 4WCTA 2YG5A 3LXDA 2WHDA 1NEKA 4OPUA 4CRTA 1Y0PA 3AE3A 3AE4A 1E1KA 1VG0A 2XCGA 4CBQA 4B64A 1AOGA 2RGOA 2EQ7A 3AYIA 1B5QA 1P2HA 2Z5YA 3AE5A 2YLTA 1EBDA 4ICYA 4OPIA 5M10A 3AEGA 3V3NA 2OLOA 1PJ7A 2JB2A 2CFYA 4JY3A 2XFNA 4USQA 5BRTA 1S2QA 3RNMA 3UKLA 4BURA 4CY8A 4HA6A 1DODA 4J33A 1O95A 5FS9A 2X50A 2Z5XA 4A5LA 2B7SA 2QCUA 5JCNA 3G5SA 4ZCDA 2WBAA 1H86A 2V61A 4AOSA 4B67A 1LQUA 2Q6UA 2YG4A 1IUTA 2YLWA 1ONFA 2A87A 2R0PA 5DBJA 1JNRA 1NPXA 1ZMCA 3AECA 5HYMA 1K4QA 2EQ9A 2GVCA 2JBVA 2GR0A 4K7ZA 1IUXA 1PXAA 4YTPA 4U2LA 2Q0LA 2JK6A 1TDEA 1OJ9A 1O5WA 2XLUA 1PBDA 4TM3A 2XYOA 5KVHA 3CPHG 1L9DA 1PXBA 5FS6A 2FBWA 4J34A 3UTFA 4YT0A 5BVAA 4K22A 5KXJA 3P4RA 1DJNA 4A99A 3CGCA 4H4PA 4U8JA 2V3BA 1GSNA 1F8WA 5FS8A 3V3OA 4U2TA 3NK1X 4H4RA 3AE2A 3CNDA 4YXDA 4K2XA 1BGJA 1XDIA 3REDA 2XFOA 2R4JA 1TYTA 4UDQA 3RP8A 1NDAA 4X9MA 4GDEA 3AE9A 3S5WA 1CF3A 1H7WA 2C73A 2OALA 2WU2A 2IVEA 3CNPA 2B9YA 4H4VA 2YM2A 4H4ZA 3AWIA 1YKJA 4Z43A 2V6OA 2OLNA 1PDHA 4XWZA 1H7XA 2X8CA 1VG9A 1XHCA 2WDQA 2Y6QA 1ZOVA 2BK3A 4TM1A 4C3YA 4H7UA 3R9UA 5U1OA 3SQPA 1VDCA 3UOZA 3K30A 4TM0A 3HZLA 4J2WA 1DOBA 1D4DA 2XLPA 4EMJA 3CNSA 4GCMA 2RGHA 2GQFA 3Q6JA 3B6DA 2DKHA 4Z2UA 4U2SA 1KNPA 1H6VA 3EF6A 1TDOA 3ATRA 2PHHA 3NHOX 4AT0A 2YVJA 3AD8B 3UTHA 5L46A 1N4VA 3UP4A 3AD9B 4I58A 5IQ1A 2B9XA 1FOHA 1IUUA 4OPGA 1F6MA 2GAGB 3C96A 4EQWA 2V5ZA 4HB9A 2I0ZA 3SGLA 1ZY8A 3QVRA 2R46A 1Q1WA 1IUVA 1IUWA 4A9WA 1EL8A 3NG7X 3NYCA 4D03A 4YSHA 5JCKA 3QSMA 2WS3A 3RHAA 1PN0A 3NYEA 5KWFA 3KD9A 3CTYA 1NHQA 1CJCA 2WP5A 4H4YA 4U8LA 1FCDA 1JRXA 3K7TA 3RP6A 2VVMA 1GRGA 4D04A 5EB5A 1KF6A 3H4KA 1PJ6A 2PYXA 4ADWA 4GF7A 3NTAA 2YG3A 1LPFA 2ZZCA 4WX1A 5JCMA 4U8MA 4X4JA 3DJDA 1O94A 4CCRA 1UKVG 2GH5A 1PBEA 2XVIA 5U25A 4ECHA 1H83A 4MJWA 4BK1A 2VVLG 1F8SA 3IHMA 1N4WA 1TDNA 2XFPA 3P4QA 1K0LA 3M0OA 3BNUA 1M6IA 2TPRA 1MXTA 1BF3A 1ZOYA 3GD3A 1S3EA 2JKCA 1BZLA 4U8OA 1GALA 1M64A 5KOWA 5J60A 3M12A 1BGNA 1D5TA 1TDFA 2BC1A 3ABVA 2XVHA 3UKFA 2XDOA 2ZZBA 2GAHB 4Z24A 2YR5A 4UDRA 1FEBA 3VR8A 4C74A 3AXBA 5EBKA 2R0GA 2IIDA 2WQYA 1KSUA 2ACZA 4USRA 2GF3A 2FJBA 3EPTA 3IWAA 4U8KA 4JDRA 1H81A 2HQMA 1GT8A 4REKA 4NTDA 1JNZA 2C67A 2E1MA 1ELIA 3UTGA 2BCPA 1JOAA 1SEZA 3L1RA 4Y4NA 1L9EA 3GD4A 1F8RA 3LB8A 4H4WA 4U8NA 4Y4LA 3BI5A 5U63A 1QJDA 1GREA 2BXSA 3DH9A 5C3JA 1ZK7A 2GR1A 3FBSA 1CC4A 3QSSA 4H2QA 2VQBA 1QO8A 2BS2A 1LV0A 3UKAA 2GV8A 3VRAA 4AP1A 3P4SA 5M0ZA 2C3DA 1H82A 4FK1C 3KU9A 2BA9A 2DKIA 2VRLA 4BJYA 2NVKX 4JNQA 2YR6A 3VRBA 4OPLA 4Z2RA 5HHFA 3P4PA 3ATQA 3ICRA 3UTEA 2JB1A 3FG2P 2EQ8A 3FPZA 3GDNA 4U8IA 4A65A 1H84A 1FL2A 4B1BA 5GSNA 3CPJG 3UKQA 4KX6A 1IJHA 3GWDA 3UOXA 2BXRA 3DJGX 1IUSA 1LTXR 2B7RA 2O9ZA 3SFDA 2C70A 2BACA 4TLXA 1Y56B 4K8DA 2YLSA 4ZCCA 4H4UA 1COYA 3AEDA 1OJDA 4TM4A 3SM8A 2YAUA 4GRTA 2YLRA 3VR9A 2Q7VA 2ARDA 1CJ4A 3QVPA 4Y4MA 1D7YA 4APNA 3NIXA 4B65A 2WDVA 3CIRA 4C5OA 4EM3A 1GEUA 3AYLA 4NTEA 3VQRA 2WOWA 1Q1RA 2AAQA 4EQRA 3AE8A 3NYFA 3AEEA 3DA1A 4GDPA 4IV9A 1X31B 2B76A 3KPFA 1CC2A 2X8HA 3CNTA 1OJCA 4I59A 2CDUA 5EB4A 4Z25A 1REOA 3DGZA 3CGEA 2XLTA 4LA1A 3D8XA 4OPDA 4UDPA 4XXGA 2H89A 5JCLA 2WDRA 1B8SA 4B66A 4UP3A 3NN0X 1RYIA 1CL0A 1CJ3A 4J31A 3UP5A 1E6EA 3CGDA 1N4UA 3IF9A 4NEVA 5ER0A 2QA1A 4M52A 3BNMA 2C76A 3NTDA 4O5UA 1K0IA 4NTCA 4H4TA 2X3NA 1GV4A 3QFBA 3UKKA 1DOCA 1ZMDA 3URHA 2FJAA 2YWLA 3EANA 3KKJA 3ALLA 3NN6X 3P9UA 3ISHA 4C77A 4A79A 4YTMA 3PO7A 1ZX9A 2BCGG 3T37A 2TMDA 1GERA 3UKPA 3DK8A 2GB0A 4DSGA 4YKGA 4EMIA 4B63A 1Y56A 4CNKA 1D4CA 3GRSA 2XLSA 2WP9A 4LU6A 4OPTA 3JSKA 3QFAA 5TR3A 2XFQA 4Z2TA 4U8PA 2ZBWA 3F8RA 1RP0A 4X9NA 3ZYXA 5IPYA 1PBFA 3LJPA 3NT6A 3GYJA 2BK5A 2CULA 4DGKA 3EAOA 4AOXA 1EL7A 3AYJA 1XANA 1E1LA 3ADAB 4FDCB 4YSYA 4OCGA 2WP6A 1NG3A 3ALMA 3F8PA 1GTEA 3PS9A 4EM4A 2XLRA 3C4NA 1NHSA 4DSHA 1TRBA 2GRTA 2XVJA 1EL9A 3L8KA 4BK2A 3NGCX 3NLCA 1GTHA 1NAAA 4FX9A 4JY2A 3AEBA 4A6NB 2NPXA 3GWFA 3NK2X 4ZN0A 2A8XA 2V3AA 2YG7A 1YY5A 1GRHA 4YTNA 3DJEA 1LJ1A 1VRQB 5C2TA 1OJAA 2X99A 4H50A 1DNCA 1MO9A 2CVJA 1GRFA 2C75A 2X8GA 2WESA 3BI2A 4PAAA 4OPCA 2VVLA 1ZP0A 2BK4A 2WPCA 4P9SA 2JAEA 4A7AA 1Q9IA 2R0CA 5FS7A 5CKUA 3COXA 3KA7A 5FMHA 2J3NA 4OVIA 1FECA 4XWRA 3AE1A 4B69A 2R45A 3NH3X 4NZHA 1GXFA 3LZWA 4EQSA 1JRZA 1YQZA 4JNAA 4BJZA 1LQTA 3DK4A 1BKWA 4H4XA 2UZZA 4BK3A 2Y6RA 3NK0X 1YQ4A 3FMWA 3G5QA 3IC9A 3OC4A 4EIPA 1KSSA 3UKHA 4H4SA 2C65A 1CJ2A 4Z26A 1GNDA 2WOVA 1GOSA 1QLBA 4YWOA 2ZZ0A 2WETA 3B3RA 3LZXA 1MOKA 2BC0A 4KPRA 1PS9A 2YLXA 2YQUA 3UCLA 1JRYA 4B68A 3IHGA 4IVOB 1GRBA 3AEFA 3LADA 1YQ3A 3GRTA 3F8DA 3GYIA 4CY6A 1DJQA 3M13A 1PHHA 5J7XA 3DK9A 5HY5A 2YM1A 4N9XA 2BYBA 4J36A 3NNEA 1B37A 1ZDLA 2APGA 2YLZA 1TYPA 2GMHA 4A6NA 2VZ2A 3CNJA 4EIQA 2V60A 3E1TA 3BHKA
chains in the Genus database with same CATH superfamily
3SFEA 1E7PA 2QAEA 3G5RA 3BI4A 5BUKA 1CBOA 5CQFA 4J57A 3GMBA 1P2EA 1PJ5A 1JU2A 3C4AA 3AD7B 1DOEA 3DGHA 3KLJA 3T0KA 5LV9A 2R9ZA 1N1PA 2C7GA 4AP3A 1K0JA 3H8IA 3I3LA 1GRAA 3HYXA 5KRQA 2R4EA 3K7QX 1LVLA 1S2YA 3OZ2A 3GDPA 1NHPA 2BABA 4K5SA 3UOYA 2YR4A 3ZDNA 2H88A 1V59A 5EOWA 3II4A 3H8LA 1JEHA 2EQ6A 5KOXA 3ITJA 1L0VA 3AE7A 3CN8A 4H2RA 4YKFA 3RP7A 5C3JA 3CGBA 3LOVA 1KFYA 2C4CA 4K5RA 2OAMA 3FIMB 3DJJA 5HXIA 4H2PA 1L9CA 1VQWA 3CPIG 5BULA 2AR8A 1NHRA 4LIIA 2FJDA 5KVIA 3NKSA 2C72A 4IVMB 1E39A 3P1WA 3WE0A 3QJ4A 4AT2A 2FJEA 4FK1A 4YSXA 3BHFA 2W0HA 1D4EA 2AQJA 2VOUA 2VRMA 4RSLA 2RGJA 2BS4A 3S61A 4CNJA 1Z6LA 3DMEA 1PXCA 3I6DA 1CC6A 2C66A 3O0HA 3ICSA 1S3BA 3D1CA 4JQ9A 2BS3A 4H2NA 2JB3A 4IA5A 4IA6A 4EMWA 4YSZA 2OA1A 4NEWA 4JN9A 1E1MA 1RSGA 4GR1A 3VRDB 5KMPA 4H4QA 1NG4A 1EL5A 1XPQA 2GMJA 2WPFA 2IVDA 4EQXA 1PBCA 4J56A 2E5VA 3GMCA 2XVFA 2VQ7A 3ALJA 1GETA 2Q0KA 1NENA 2GQWA 3AE6A 3QSEA 2YVGA 3GSIA 1D7LA 3AEAA 2QA2A 4Z44A 2GR3A 2C64A 2C3CA 1PBBA 3Q9TA 3ICTA 3UOVA 3PVCA 2GEWA 1KNRA 1E1NA 1GRTA 1OJTA 2B9WA 2WEUA 4RG4A 4II3A 1W4XA 4BV6A 4E0VA 5JCIA 2A89A 2XVEA 4DNAA 2XFUA 2E4GA 3V76A 3K7MX 1BWCA 2RABA 2WPEA 2YG6A 1B4VA 4C3XA 1CHUA 4PABA 5IQ4A 4O5QA 4GUVA 1GESA 4CCQA 2WU5A 1F3PA 4RG3A 3KVEA 1TDKA 1KDGA 2GR2A 3NRNA 2YVFA 1GPEA 1ZKQA 2WOIA 1DXLA 1FEAA 5GRTA 3AB1A 1HYUA 2F5ZA 4TLZA 4WCTA 2YG5A 3LXDA 2WHDA 1NEKA 4OPUA 4CRTA 1Y0PA 3AE3A 3AE4A 1E1KA 1VG0A 2XCGA 4CBQA 3SX6A 4B64A 1AOGA 2RGOA 2EQ7A 3AYIA 1B5QA 1P2HA 2Z5YA 3AE5A 2YLTA 1EBDA 4ICYA 4OPIA 5M10A 3AEGA 3V3NA 2OLOA 1PJ7A 2JB2A 2CFYA 4JY3A 2XFNA 4USQA 5BRTA 1S2QA 3RNMA 3UKLA 4BURA 4CY8A 4HA6A 1DODA 4J33A 1O95A 5FS9A 2X50A 2Z5XA 4A5LA 2B7SA 2QCUA 5JCNA 3G5SA 4ZCDA 2WBAA 1H86A 2V61A 4AOSA 4NNJA 4B67A 1LQUA 2Q6UA 2YG4A 1IUTA 2YLWA 1ONFA 2A87A 2R0PA 5DBJA 1JNRA 1NPXA 1ZMCA 3AECA 5HYMA 1K4QA 2EQ9A 2JBVA 2GVCA 2GR0A 4K7ZA 1IUXA 1PXAA 4YTPA 4U2LA 2Q0LA 2JK6A 1TDEA 1OJ9A 1O5WA 2XLUA 1PBDA 4TM3A 2XYOA 5KVHA 3CPHG 1L9DA 1PXBA 5FS6A 2FBWA 4J34A 3UTFA 4YT0A 5BVAA 4K22A 3SY4A 5KXJA 3P4RA 1DJNA 4A99A 3CGCA 4H4PA 4U8JA 2V3BA 1GSNA 1F8WA 5FS8A 3V3OA 4U2TA 3NK1X 4H4RA 3AE2A 3CNDA 4YXDA 4K2XA 3REDA 1BGJA 1XDIA 2XFOA 2R4JA 1TYTA 4UDQA 3RP8A 1NDAA 4X9MA 4GDEA 3AE9A 3S5WA 1CF3A 1H7WA 2C73A 2OALA 2WU2A 2IVEA 3CNPA 2B9YA 4H4VA 2YM2A 4H4ZA 3AWIA 1YKJA 4Z43A 2V6OA 2OLNA 1PDHA 4XWZA 1H7XA 2X8CA 1VG9A 1XHCA 2WDQA 2Y6QA 1ZOVA 2BK3A 4TM1A 4C3YA 4H7UA 3R9UA 5U1OA 3SQPA 1VDCA 3UOZA 3K30A 3SYIA 3HYWA 4TM0A 3HZLA 4J2WA 1DOBA 1D4DA 2XLPA 4EMJA 3CNSA 4GCMA 2RGHA 2GQFA 3Q6JA 3B6DA 2BRYA 2DKHA 4U2SA 1KNPA 4Z2UA 1H6VA 3EF6A 1TDOA 3ATRA 2PHHA 3T2KA 3NHOX 4AT0A 2YVJA 3AD8B 3UTHA 5L46A 1N4VA 3UP4A 3AD9B 4I58A 5IQ1A 2B9XA 1FOHA 1IUUA 4OPGA 1F6MA 2GAGB 3C96A 3T14A 4EQWA 2V5ZA 4HB9A 2I0ZA 3SGLA 1ZY8A 3QVRA 2R46A 1Q1WA 1IUVA 1IUWA 4A9WA 3SZ0A 1EL8A 3NG7X 3NYCA 4D03A 4YSHA 5JCKA 3QSMA 2WS3A 3RHAA 1PN0A 3NYEA 5KWFA 3KD9A 3CTYA 1NHQA 3CMMA 1CJCA 2WP5A 4H4YA 4U8LA 1FCDA 1JRXA 3K7TA 4G6HA 3RP6A 2VVMA 1GRGA 4D04A 5EB5A 1KF6A 3H4KA 1PJ6A 2PYXA 4ADWA 4GF7A 3NTAA 2YG3A 1LPFA 2ZZCA 4WX1A 5JCMA 4U8MA 4X4JA 3DJDA 1O94A 4CCRA 1UKVG 2GH5A 1PBEA 2XVIA 5U25A 4ECHA 1H83A 4MJWA 4BK1A 2VVLG 3SZFA 1F8SA 3IHMA 1N4WA 1TDNA 2XFPA 3P4QA 1K0LA 3M0OA 3BNUA 1M6IA 2TPRA 1MXTA 1BF3A 1ZOYA 3GD3A 1S3EA 2JKCA 1BZLA 4U8OA 1GALA 1M64A 5KOWA 5J60A 3M12A 1BGNA 1D5TA 1TDFA 2BC1A 3ABVA 2XVHA 3UKFA 2XDOA 2ZZBA 2GAHB 4Z24A 2YR5A 4UDRA 1FEBA 3VR8A 4C74A 3AXBA 4GAPA 2R0GA 5EBKA 2IIDA 2WQYA 1KSUA 2ACZA 4USRA 2GF3A 2FJBA 3EPTA 3IWAA 4U8KA 4JDRA 1H81A 2HQMA 1GT8A 4REKA 4NTDA 1JNZA 2C67A 2E1MA 1ELIA 3UTGA 2BCPA 1JOAA 1SEZA 3L1RA 4Y4NA 1L9EA 3GD4A 1F8RA 3LB8A 4H4WA 4U8NA 4Y4LA 3BI5A 5U63A 1QJDA 1GREA 2BXSA 3DH9A 4G73A 1ZK7A 2GR1A 3FBSA 1CC4A 3QSSA 4H2QA 2VQBA 1QO8A 2BS2A 1LV0A 3UKAA 2GV8A 3VRAA 4AP1A 3P4SA 5M0ZA 2C3DA 1H82A 4FK1C 3KU9A 2BA9A 2DKIA 2VRLA 2BRAA 4BJYA 2NVKX 4JNQA 2YR6A 3SZCA 4OPLA 3VRBA 5KMQA 4Z2RA 5HHFA 3HYVA 3P4PA 3ATQA 3ICRA 3UTEA 2JB1A 3FG2P 2EQ8A 3GDNA 3FPZA 4U8IA 4A65A 1H84A 1FL2A 4B1BA 5GSNA 3CPJG 3UKQA 4KX6A 1IJHA 3GWDA 3UOXA 2BXRA 3DJGX 1IUSA 1LTXR 2B7RA 2O9ZA 3SFDA 2C70A 2BACA 4TLXA 1Y56B 4K8DA 2YLSA 4ZCCA 4H4UA 1COYA 3AEDA 1OJDA 4TM4A 3SM8A 2YAUA 4GRTA 2YLRA 3VR9A 2Q7VA 2ARDA 1CJ4A 3T31A 3QVPA 4Y4MA 1D7YA 4APNA 3NIXA 4B65A 2WDVA 3CIRA 4C5OA 4EM3A 1GEUA 3AYLA 4NTEA 4GAVA 3VQRA 2WOWA 1Q1RA 2AAQA 4EQRA 3AE8A 3NYFA 3AEEA 3GYXA 3DA1A 4GDPA 4IV9A 5KMSA 1X31B 4NWZA 2B76A 3KPFA 1CC2A 2X8HA 3CNTA 1OJCA 4I59A 2CDUA 5EB4A 4Z25A 1REOA 3DGZA 3CGEA 2XLTA 4LA1A 3D8XA 4OPDA 4UDPA 4XXGA 2H89A 5JCLA 2WDRA 1B8SA 4B66A 5KMRA 4UP3A 3NN0X 1RYIA 1CL0A 1CJ3A 4J31A 3UP5A 1E6EA 3CGDA 1N4UA 3IF9A 4NEVA 5ER0A 2QA1A 4M52A 3BNMA 2C76A 3NTDA 4O5UA 1K0IA 4NTCA 4H4TA 2X3NA 1GV4A 3QFBA 3UKKA 1DOCA 1ZMDA 3URHA 2FJAA 2YWLA 3EANA 3KPKA 3KKJA 3ALLA 3NN6X 3P9UA 3ISHA 4C77A 4A79A 4YTMA 3PO7A 1ZX9A 2BCGG 3T37A 2TMDA 1GERA 3UKPA 3DK8A 2GB0A 4DSGA 4YKGA 4EMIA 4B63A 1Y56A 4CNKA 1D4CA 3GRSA 2XLSA 2WP9A 4LU6A 4OPTA 3JSKA 3QFAA 5TR3A 2XFQA 4Z2TA 4U8PA 2ZBWA 4G9KA 3F8RA 1RP0A 4X9NA 3ZYXA 5IPYA 3LJPA 1PBFA 3NT6A 3GYJA 2BK5A 2CULA 4DGKA 3EAOA 4AOXA 1EL7A 3AYJA 1XANA 1E1LA 3ADAB 4G6GA 4FDCB 4YSYA 4OCGA 2WP6A 1NG3A 3ALMA 3F8PA 1GTEA 3PS9A 4EM4A 2XLRA 5KNLA 3C4NA 1NHSA 4DSHA 1TRBA 2GRTA 2XVJA 1EL9A 3L8KA 4BK2A 3NGCX 3NLCA 1GTHA 1NAAA 4FX9A 4JY2A 3AEBA 4A6NB 2NPXA 3GWFA 3NK2X 4ZN0A 2A8XA 2V3AA 2YG7A 1YY5A 3SZWA 1GRHA 4YTNA 3DJEA 1LJ1A 1VRQB 5C2TA 1OJAA 2X99A 4H50A 1DNCA 1MO9A 2CVJA 1GRFA 2C75A 2X8GA 2WESA 3BI2A 4PAAA 4OPCA 2VVLA 1ZP0A 2BK4A 2WPCA 4P9SA 2JAEA 4A7AA 1Q9IA 2R0CA 5FS7A 5CKUA 3COXA 3KA7A 5FMHA 2J3NA 4OVIA 1FECA 4XWRA 3AE1A 4B69A 2R45A 3NH3X 4NZHA 1GXFA 3LZWA 4EQSA 1JRZA 1YQZA 4JNAA 3SXIA 1LQTA 3DK4A 3T2YA 4BJZA 1BKWA 4H4XA 2UZZA 4BK3A 2Y6RA 3NK0X 1YQ4A 3FMWA 3G5QA 3IC9A 3OC4A 4EIPA 1KSSA 3UKHA 4H4SA 2C65A 1CJ2A 4Z26A 1GNDA 2WOVA 1GOSA 1QLBA 4YWOA 2ZZ0A 2WETA 3B3RA 3LZXA 1MOKA 2BC0A 4KPRA 1PS9A 2YLXA 2YQUA 3UCLA 1JRYA 4II2A 4B68A 3IHGA 4IVOB 1GRBA 3AEFA 3LADA 1YQ3A 3GRTA 3F8DA 3GYIA 3T2ZA 4CY6A 1DJQA 3M13A 1PHHA 5J7XA 3DK9A 5HY5A 2YM1A 4G74A 4N9XA 2BYBA 4J36A 3NNEA 1B37A 1ZDLA 2APGA 2YLZA 1TYPA 2GMHA 4A6NA 2VZ2A 3CNJA 4EIQA 2V60A 3E1TA 3BHKA
chains in the Genus database with same CATH topology
3SFEA 1E7PA 2QAEA 3G5RA 3BI4A 5BUKA 1CBOA 5CQFA 4J57A 3GMBA 1P2EA 1PJ5A 1JU2A 3C4AA 3AD7B 1DOEA 3DGHA 3KLJA 3T0KA 5LV9A 2R9ZA 1N1PA 2C7GA 4AP3A 1K0JA 3H8IA 3I3LA 1GRAA 3HYXA 5KRQA 2R4EA 3K7QX 1LVLA 1S2YA 3OZ2A 3GDPA 1NHPA 2BABA 4K5SA 3UOYA 2YR4A 3ZDNA 2H88A 1V59A 5EOWA 3II4A 3H8LA 1JEHA 2EQ6A 5KOXA 3ITJA 1L0VA 3AE7A 3CN8A 4H2RA 4YKFA 3RP7A 5C3JA 3CGBA 3LOVA 1KFYA 2C4CA 4K5RA 2OAMA 3FIMB 3DJJA 5HXIA 4H2PA 1L9CA 1VQWA 3CPIG 5BULA 2AR8A 1NHRA 4LIIA 2FJDA 5KVIA 3NKSA 2C72A 4IVMB 1E39A 3P1WA 3WE0A 3QJ4A 4AT2A 2FJEA 4FK1A 4YSXA 3BHFA 2W0HA 1D4EA 2AQJA 2VOUA 2VRMA 4RSLA 2RGJA 2BS4A 3S61A 4CNJA 1Z6LA 3DMEA 1PXCA 3I6DA 1CC6A 2C66A 3O0HA 3ICSA 1S3BA 3D1CA 4JQ9A 2BS3A 4H2NA 2JB3A 4IA5A 4IA6A 4EMWA 4YSZA 2OA1A 4NEWA 4JN9A 1E1MA 1RSGA 4GR1A 3VRDB 5KMPA 4H4QA 1NG4A 1EL5A 1XPQA 2GMJA 2WPFA 2IVDA 4EQXA 1PBCA 4J56A 2E5VA 3GMCA 2XVFA 2VQ7A 3ALJA 1GETA 2Q0KA 1NENA 2GQWA 3AE6A 3QSEA 2YVGA 3GSIA 1D7LA 3AEAA 2QA2A 4Z44A 2GR3A 2C64A 2C3CA 1PBBA 3Q9TA 3ICTA 3UOVA 3PVCA 2GEWA 1KNRA 1E1NA 1GRTA 1OJTA 2B9WA 2WEUA 4RG4A 4II3A 1W4XA 4BV6A 4E0VA 5JCIA 2A89A 2XVEA 4DNAA 2XFUA 2E4GA 3V76A 3K7MX 1BWCA 2RABA 2WPEA 2YG6A 1B4VA 4C3XA 1CHUA 4PABA 5IQ4A 4O5QA 4GUVA 1GESA 4CCQA 2WU5A 1F3PA 4RG3A 3KVEA 1TDKA 1KDGA 2GR2A 3NRNA 2YVFA 1GPEA 1ZKQA 2WOIA 1DXLA 1FEAA 5GRTA 3AB1A 1HYUA 2F5ZA 4TLZA 4WCTA 2YG5A 3LXDA 2WHDA 1NEKA 4OPUA 4CRTA 1Y0PA 3AE3A 3AE4A 1E1KA 1VG0A 2XCGA 4CBQA 3SX6A 4B64A 1AOGA 2RGOA 2EQ7A 3AYIA 1B5QA 1P2HA 2Z5YA 3AE5A 2YLTA 1EBDA 4ICYA 4OPIA 5M10A 3AEGA 3V3NA 2OLOA 1PJ7A 2JB2A 2CFYA 4JY3A 2XFNA 4USQA 5BRTA 1S2QA 3RNMA 3UKLA 4BURA 4CY8A 4HA6A 1DODA 4J33A 1O95A 5FS9A 2X50A 2Z5XA 4A5LA 2B7SA 2QCUA 5JCNA 3G5SA 4ZCDA 2WBAA 1H86A 2V61A 4AOSA 4NNJA 4B67A 1LQUA 2Q6UA 2YG4A 1IUTA 2YLWA 1ONFA 2A87A 2R0PA 5DBJA 1JNRA 1NPXA 1ZMCA 3AECA 5HYMA 1K4QA 2EQ9A 2JBVA 2GVCA 2GR0A 4K7ZA 1IUXA 1PXAA 4YTPA 4U2LA 2Q0LA 2JK6A 1TDEA 1OJ9A 1O5WA 2XLUA 1PBDA 4TM3A 2XYOA 5KVHA 3CPHG 1L9DA 1PXBA 5FS6A 2FBWA 4J34A 3UTFA 4YT0A 5BVAA 4K22A 3SY4A 5KXJA 3P4RA 1DJNA 4A99A 3CGCA 4H4PA 4U8JA 2V3BA 1GSNA 1F8WA 5FS8A 3V3OA 4U2TA 3NK1X 4H4RA 3AE2A 3CNDA 4YXDA 4K2XA 3REDA 1BGJA 1XDIA 2XFOA 2R4JA 1TYTA 4UDQA 3RP8A 1NDAA 4X9MA 4GDEA 3AE9A 3S5WA 1CF3A 1H7WA 2C73A 2OALA 2WU2A 2IVEA 3CNPA 2B9YA 4H4VA 2YM2A 4H4ZA 3AWIA 1YKJA 4Z43A 2V6OA 2OLNA 1PDHA 4XWZA 1H7XA 2X8CA 1VG9A 1XHCA 2WDQA 2Y6QA 1ZOVA 2BK3A 4TM1A 4C3YA 4H7UA 3R9UA 5U1OA 3SQPA 1VDCA 3UOZA 3K30A 3SYIA 3HYWA 4TM0A 3HZLA 4J2WA 1DOBA 1D4DA 2XLPA 4EMJA 3CNSA 4GCMA 2RGHA 2GQFA 3Q6JA 3B6DA 2BRYA 2DKHA 4U2SA 1KNPA 4Z2UA 1H6VA 3EF6A 1TDOA 3ATRA 2PHHA 3T2KA 3NHOX 4AT0A 2YVJA 3AD8B 3UTHA 5L46A 1N4VA 3UP4A 3AD9B 4I58A 5IQ1A 2B9XA 1FOHA 1IUUA 4OPGA 1F6MA 2GAGB 3C96A 3T14A 4EQWA 2V5ZA 4HB9A 2I0ZA 3SGLA 1ZY8A 3QVRA 2R46A 1Q1WA 1IUVA 1IUWA 4A9WA 3SZ0A 1EL8A 3NG7X 3NYCA 4D03A 4YSHA 5JCKA 3QSMA 2WS3A 3RHAA 1PN0A 3NYEA 5KWFA 3KD9A 3CTYA 1NHQA 3CMMA 1CJCA 2WP5A 4H4YA 4U8LA 1FCDA 1JRXA 3K7TA 4G6HA 3RP6A 2VVMA 1GRGA 4D04A 5EB5A 1KF6A 3H4KA 1PJ6A 2PYXA 4ADWA 4GF7A 3NTAA 2YG3A 1LPFA 2ZZCA 4WX1A 5JCMA 4U8MA 4X4JA 3DJDA 1O94A 4CCRA 1UKVG 2GH5A 1PBEA 2XVIA 5U25A 4ECHA 1H83A 4MJWA 4BK1A 2VVLG 3SZFA 1F8SA 3IHMA 1N4WA 1TDNA 2XFPA 3P4QA 1K0LA 3M0OA 3BNUA 1M6IA 2TPRA 1MXTA 1BF3A 1ZOYA 3GD3A 1S3EA 2JKCA 1BZLA 4U8OA 1GALA 1M64A 5KOWA 5J60A 3M12A 1BGNA 1D5TA 1TDFA 2BC1A 3ABVA 2XVHA 3UKFA 2XDOA 2ZZBA 2GAHB 4Z24A 2YR5A 4UDRA 1FEBA 3VR8A 4C74A 3AXBA 4GAPA 2R0GA 5EBKA 2IIDA 2WQYA 1KSUA 2ACZA 4USRA 2GF3A 2FJBA 3EPTA 3IWAA 4U8KA 4JDRA 1H81A 2HQMA 1GT8A 4REKA 4NTDA 1JNZA 2C67A 2E1MA 1ELIA 3UTGA 2BCPA 1JOAA 1SEZA 3L1RA 4Y4NA 1L9EA 3GD4A 1F8RA 3LB8A 4H4WA 4U8NA 4Y4LA 3BI5A 5U63A 1QJDA 1GREA 2BXSA 3DH9A 4G73A 1ZK7A 2GR1A 3FBSA 1CC4A 3QSSA 4H2QA 2VQBA 1QO8A 2BS2A 1LV0A 3UKAA 2GV8A 3VRAA 4AP1A 3P4SA 5M0ZA 2C3DA 1H82A 4FK1C 3KU9A 2BA9A 2DKIA 2VRLA 2BRAA 4BJYA 2NVKX 4JNQA 2YR6A 3SZCA 4OPLA 3VRBA 5KMQA 4Z2RA 5HHFA 3HYVA 3P4PA 3ATQA 3ICRA 3UTEA 2JB1A 3FG2P 2EQ8A 3GDNA 3FPZA 4U8IA 4A65A 1H84A 1FL2A 4B1BA 5GSNA 3CPJG 3UKQA 4KX6A 1IJHA 3GWDA 3UOXA 2BXRA 3DJGX 1IUSA 1LTXR 2B7RA 2O9ZA 3SFDA 2C70A 2BACA 4TLXA 1Y56B 4K8DA 2YLSA 4ZCCA 4H4UA 1COYA 3AEDA 1OJDA 4TM4A 3SM8A 2YAUA 4GRTA 2YLRA 3VR9A 2Q7VA 2ARDA 1CJ4A 3T31A 3QVPA 4Y4MA 1D7YA 4APNA 3NIXA 4B65A 2WDVA 3CIRA 4C5OA 4EM3A 1GEUA 3AYLA 4NTEA 4GAVA 3VQRA 2WOWA 1Q1RA 2AAQA 4EQRA 3AE8A 3NYFA 3AEEA 3GYXA 3DA1A 4GDPA 4IV9A 5KMSA 1X31B 4NWZA 2B76A 3KPFA 1CC2A 2X8HA 3CNTA 1OJCA 4I59A 2CDUA 5EB4A 4Z25A 1REOA 3DGZA 3CGEA 2XLTA 4LA1A 3D8XA 4OPDA 4UDPA 4XXGA 2H89A 5JCLA 2WDRA 1B8SA 4B66A 5KMRA 4UP3A 3NN0X 1RYIA 1CL0A 1CJ3A 4J31A 3UP5A 1E6EA 3CGDA 1N4UA 3IF9A 4NEVA 5ER0A 2QA1A 4M52A 3BNMA 2C76A 3NTDA 4O5UA 1K0IA 4NTCA 4H4TA 2X3NA 1GV4A 3QFBA 3UKKA 1DOCA 1ZMDA 3URHA 2FJAA 2YWLA 3EANA 3KPKA 3KKJA 3ALLA 3NN6X 3P9UA 3ISHA 4C77A 4A79A 4YTMA 3PO7A 1ZX9A 2BCGG 3T37A 2TMDA 1GERA 3UKPA 3DK8A 2GB0A 4DSGA 4YKGA 4EMIA 4B63A 1Y56A 4CNKA 1D4CA 3GRSA 2XLSA 2WP9A 4LU6A 4OPTA 3JSKA 3QFAA 5TR3A 2XFQA 4Z2TA 4U8PA 2ZBWA 4G9KA 3F8RA 1RP0A 4X9NA 3ZYXA 5IPYA 3LJPA 1PBFA 3NT6A 3GYJA 2BK5A 2CULA 4DGKA 3EAOA 4AOXA 1EL7A 3AYJA 1XANA 1E1LA 3ADAB 4G6GA 4FDCB 4YSYA 4OCGA 2WP6A 1NG3A 3ALMA 3F8PA 1GTEA 3PS9A 4EM4A 2XLRA 5KNLA 3C4NA 1NHSA 4DSHA 1TRBA 2GRTA 2XVJA 1EL9A 3L8KA 4BK2A 3NGCX 3NLCA 1GTHA 1NAAA 4FX9A 4JY2A 3AEBA 4A6NB 2NPXA 3GWFA 3NK2X 4ZN0A 2A8XA 2V3AA 2YG7A 1YY5A 3SZWA 1GRHA 4YTNA 3DJEA 1LJ1A 1VRQB 5C2TA 1OJAA 2X99A 4H50A 1DNCA 1MO9A 2CVJA 1GRFA 2C75A 2X8GA 2WESA 3BI2A 4PAAA 4OPCA 2VVLA 1ZP0A 2BK4A 2WPCA 4P9SA 2JAEA 4A7AA 1Q9IA 2R0CA 5FS7A 5CKUA 3COXA 3KA7A 5FMHA 2J3NA 4OVIA 1FECA 4XWRA 3AE1A 4B69A 2R45A 3NH3X 4NZHA 1GXFA 3LZWA 4EQSA 1JRZA 1YQZA 4JNAA 3SXIA 1LQTA 3DK4A 3T2YA 4BJZA 1BKWA 4H4XA 2UZZA 4BK3A 2Y6RA 3NK0X 1YQ4A 3FMWA 3G5QA 3IC9A 3OC4A 4EIPA 1KSSA 3UKHA 4H4SA 2C65A 1CJ2A 4Z26A 1GNDA 2WOVA 1GOSA 1QLBA 4YWOA 2ZZ0A 2WETA 3B3RA 3LZXA 1MOKA 2BC0A 4KPRA 1PS9A 2YLXA 2YQUA 3UCLA 1JRYA 4II2A 4B68A 3IHGA 4IVOB 1GRBA 3AEFA 3LADA 1YQ3A 3GRTA 3F8DA 3GYIA 3T2ZA 4CY6A 1DJQA 3M13A 1PHHA 5J7XA 3DK9A 5HY5A 2YM1A 4G74A 4N9XA 2BYBA 4J36A 3NNEA 1B37A 1ZDLA 2APGA 2YLZA 1TYPA 2GMHA 4A6NA 2VZ2A 3CNJA 4EIQA 2V60A 3E1TA 3BHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFE A;  1E7P A;  2QAE A;  3G5R A;  3BI4 A;  5BUK A;  1CBO A;  5CQF A;  4J57 A;  3GMB A;  1P2E A;  1PJ5 A;  1JU2 A;  3C4A A;  3AD7 B;  1DOE A;  3DGH A;  3KLJ A;  5LV9 A;  2R9Z A;  1N1P A;  2C7G A;  4AP3 A;  1K0J A;  3H8I A;  3I3L A;  1GRA A;  5KRQ A;  2R4E A;  3K7Q X;  1LVL A;  1S2Y A;  3OZ2 A;  3GDP A;  1NHP A;  2BAB A;  4K5S A;  3UOY A;  2YR4 A;  3ZDN A;  2H88 A;  1V59 A;  5EOW A;  3II4 A;  3H8L A;  1JEH A;  2EQ6 A;  5KOX A;  3ITJ A;  1L0V A;  3AE7 A;  3CN8 A;  4H2R A;  4YKF A;  3RP7 A;  3CGB A;  3LOV A;  1KFY A;  4K5R A;  2OAM A;  3FIM B;  3DJJ A;  5HXI A;  4H2P A;  1L9C A;  1VQW A;  3CPI G;  5BUL A;  2AR8 A;  1NHR A;  4LII A;  2FJD A;  5KVI A;  3NKS A;  2C72 A;  4IVM B;  1E39 A;  3P1W A;  3WE0 A;  3QJ4 A;  4AT2 A;  2FJE A;  4FK1 A;  4YSX A;  3BHF A;  2W0H A;  1D4E A;  2AQJ A;  2VOU A;  2VRM A;  4RSL A;  2RGJ A;  2BS4 A;  3S61 A;  4CNJ A;  1Z6L A;  3DME A;  1PXC A;  3I6D A;  1CC6 A;  2C66 A;  3O0H A;  3ICS A;  1S3B A;  3D1C A;  4JQ9 A;  2BS3 A;  4H2N A;  2JB3 A;  4IA5 A;  4IA6 A;  4EMW A;  4YSZ A;  2OA1 A;  4NEW A;  4JN9 A;  1E1M A;  1RSG A;  4GR1 A;  3VRD B;  4H4Q A;  1NG4 A;  1EL5 A;  1XPQ A;  2GMJ A;  2WPF A;  2IVD A;  4EQX A;  1PBC A;  4J56 A;  2E5V A;  3GMC A;  2XVF A;  2VQ7 A;  3ALJ A;  1GET A;  2Q0K A;  1NEN A;  2GQW A;  3AE6 A;  3QSE A;  2YVG A;  3GSI A;  1D7L A;  3AEA A;  2QA2 A;  4Z44 A;  2GR3 A;  2C64 A;  2C3C A;  1PBB A;  3Q9T A;  3ICT A;  3UOV A;  3PVC A;  2GEW A;  1KNR A;  1E1N A;  1GRT A;  1OJT A;  2B9W A;  2WEU A;  4RG4 A;  4E0V A;  1W4X A;  4BV6 A;  5JCI A;  2A89 A;  2XVE A;  4DNA A;  2XFU A;  2E4G A;  3V76 A;  3K7M X;  1BWC A;  2RAB A;  2WPE A;  2YG6 A;  1B4V A;  4C3X A;  1CHU A;  4PAB A;  5IQ4 A;  4O5Q A;  4GUV A;  1GES A;  4CCQ A;  2WU5 A;  1F3P A;  4RG3 A;  3KVE A;  1TDK A;  1KDG A;  2GR2 A;  3NRN A;  2YVF A;  1GPE A;  1ZKQ A;  2WOI A;  1DXL A;  1FEA A;  5GRT A;  3AB1 A;  1HYU A;  2F5Z A;  4TLZ A;  4WCT A;  2YG5 A;  3LXD A;  2WHD A;  1NEK A;  4OPU A;  4CRT A;  1Y0P A;  3AE3 A;  3AE4 A;  1E1K A;  1VG0 A;  2XCG A;  4CBQ A;  4B64 A;  1AOG A;  2RGO A;  2EQ7 A;  3AYI A;  1B5Q A;  1P2H A;  2Z5Y A;  3AE5 A;  2YLT A;  1EBD A;  4ICY A;  4OPI A;  5M10 A;  3AEG A;  3V3N A;  2OLO A;  1PJ7 A;  2JB2 A;  2CFY A;  4JY3 A;  2XFN A;  4USQ A;  5BRT A;  1S2Q A;  3RNM A;  3UKL A;  4BUR A;  4CY8 A;  4HA6 A;  1DOD A;  4J33 A;  1O95 A;  5FS9 A;  2X50 A;  2Z5X A;  4A5L A;  2B7S A;  2QCU A;  5JCN A;  3G5S A;  4ZCD A;  2WBA A;  1H86 A;  2V61 A;  4AOS A;  4B67 A;  1LQU A;  2Q6U A;  2YG4 A;  1IUT A;  2YLW A;  1ONF A;  2A87 A;  2R0P A;  5DBJ A;  1JNR A;  1NPX A;  1ZMC A;  3AEC A;  5HYM A;  1K4Q A;  2EQ9 A;  2GVC A;  2JBV A;  2GR0 A;  4K7Z A;  1IUX A;  1PXA A;  4YTP A;  4U2L A;  2Q0L A;  2JK6 A;  1TDE A;  1OJ9 A;  1O5W A;  2XLU A;  1PBD A;  4TM3 A;  2XYO A;  5KVH A;  3CPH G;  1L9D A;  1PXB A;  5FS6 A;  2FBW A;  4J34 A;  3UTF A;  4YT0 A;  5BVA A;  4K22 A;  5KXJ A;  3P4R A;  1DJN A;  4A99 A;  3CGC A;  4H4P A;  4U8J A;  2V3B A;  1GSN A;  1F8W A;  5FS8 A;  3V3O A;  4U2T A;  3NK1 X;  4H4R A;  3AE2 A;  3CND A;  4YXD A;  4K2X A;  1BGJ A;  1XDI A;  3RED A;  2XFO A;  2R4J A;  1TYT A;  4UDQ A;  3RP8 A;  1NDA A;  4X9M A;  4GDE A;  3AE9 A;  3S5W A;  1CF3 A;  1H7W A;  2C73 A;  2OAL A;  2WU2 A;  2IVE A;  3CNP A;  2B9Y A;  4H4V A;  2YM2 A;  4H4Z A;  3AWI A;  1YKJ A;  4Z43 A;  2V6O A;  2OLN A;  1PDH A;  4XWZ A;  1H7X A;  2X8C A;  1VG9 A;  1XHC A;  2WDQ A;  2Y6Q A;  1ZOV A;  2BK3 A;  4TM1 A;  4C3Y A;  4H7U A;  3R9U A;  5U1O A;  3SQP A;  1VDC A;  3UOZ A;  3K30 A;  4TM0 A;  3HZL A;  4J2W A;  1DOB A;  1D4D A;  2XLP A;  4EMJ A;  3CNS A;  4GCM A;  2RGH A;  2GQF A;  3Q6J A;  3B6D A;  2DKH A;  4Z2U A;  4U2S A;  1KNP A;  1H6V A;  3EF6 A;  1TDO A;  3ATR A;  2PHH A;  3NHO X;  4AT0 A;  2YVJ A;  3AD8 B;  3UTH A;  5L46 A;  1N4V A;  3UP4 A;  3AD9 B;  4I58 A;  5IQ1 A;  2B9X A;  1FOH A;  1IUU A;  4OPG A;  1F6M A;  2GAG B;  3C96 A;  4EQW A;  2V5Z A;  4HB9 A;  2I0Z A;  3SGL A;  1ZY8 A;  3QVR A;  2R46 A;  1Q1W A;  1IUV A;  1IUW A;  4A9W A;  1EL8 A;  3NG7 X;  3NYC A;  4D03 A;  4YSH A;  5JCK A;  3QSM A;  2WS3 A;  3RHA A;  1PN0 A;  3NYE A;  5KWF A;  3KD9 A;  3CTY A;  1NHQ A;  1CJC A;  2WP5 A;  4H4Y A;  4U8L A;  1FCD A;  1JRX A;  3K7T A;  3RP6 A;  2VVM A;  1GRG A;  4D04 A;  5EB5 A;  1KF6 A;  3H4K A;  1PJ6 A;  2PYX A;  4ADW A;  4GF7 A;  3NTA A;  2YG3 A;  1LPF A;  2ZZC A;  4WX1 A;  5JCM A;  4U8M A;  4X4J A;  3DJD A;  1O94 A;  4CCR A;  1UKV G;  2GH5 A;  1PBE A;  2XVI A;  5U25 A;  4ECH A;  1H83 A;  4MJW A;  4BK1 A;  2VVL G;  1F8S A;  3IHM A;  1N4W A;  1TDN A;  2XFP A;  3P4Q A;  1K0L A;  3M0O A;  3BNU A;  1M6I A;  2TPR A;  1MXT A;  1BF3 A;  1ZOY A;  3GD3 A;  1S3E A;  2JKC A;  1BZL A;  4U8O A;  1GAL A;  1M64 A;  5KOW A;  5J60 A;  3M12 A;  1BGN A;  1D5T A;  1TDF A;  2BC1 A;  3ABV A;  2XVH A;  3UKF A;  2XDO A;  2ZZB A;  2GAH B;  4Z24 A;  2YR5 A;  4UDR A;  1FEB A;  3VR8 A;  4C74 A;  3AXB A;  5EBK A;  2R0G A;  2IID A;  2WQY A;  1KSU A;  2ACZ A;  4USR A;  2GF3 A;  2FJB A;  3EPT A;  3IWA A;  4U8K A;  4JDR A;  1H81 A;  2HQM A;  1GT8 A;  4REK A;  4NTD A;  1JNZ A;  2C67 A;  2E1M A;  1ELI A;  3UTG A;  2BCP A;  1JOA A;  1SEZ A;  3L1R A;  4Y4N A;  1L9E A;  3GD4 A;  1F8R A;  3LB8 A;  4H4W A;  4U8N A;  4Y4L A;  3BI5 A;  5U63 A;  1QJD A;  1GRE A;  2BXS A;  3DH9 A;  5C3J A;  1ZK7 A;  2GR1 A;  3FBS A;  1CC4 A;  3QSS A;  4H2Q A;  2VQB A;  1QO8 A;  2BS2 A;  1LV0 A;  3UKA A;  2GV8 A;  3VRA A;  4AP1 A;  3P4S A;  5M0Z A;  2C3D A;  1H82 A;  4FK1 C;  3KU9 A;  2BA9 A;  2DKI A;  2VRL A;  4BJY A;  2NVK X;  4JNQ A;  2YR6 A;  3VRB A;  4OPL A;  4Z2R A;  5HHF A;  3P4P A;  3ATQ A;  3ICR A;  3UTE A;  2JB1 A;  3FG2 P;  2EQ8 A;  3FPZ A;  3GDN A;  4U8I A;  4A65 A;  1H84 A;  1FL2 A;  4B1B A;  5GSN A;  3CPJ G;  3UKQ A;  4KX6 A;  1IJH A;  3GWD A;  3UOX A;  2BXR A;  3DJG X;  1IUS A;  1LTX R;  2B7R A;  2O9Z A;  3SFD A;  2C70 A;  2BAC A;  4TLX A;  1Y56 B;  4K8D A;  2YLS A;  4ZCC A;  4H4U A;  1COY A;  3AED A;  1OJD A;  4TM4 A;  3SM8 A;  2YAU A;  4GRT A;  2YLR A;  3VR9 A;  2Q7V A;  2ARD A;  1CJ4 A;  3QVP A;  4Y4M A;  1D7Y A;  4APN A;  3NIX A;  4B65 A;  2WDV A;  3CIR A;  4C5O A;  4EM3 A;  1GEU A;  3AYL A;  4NTE A;  3VQR A;  2WOW A;  1Q1R A;  2AAQ A;  4EQR A;  3AE8 A;  3NYF A;  3AEE A;  3DA1 A;  4GDP A;  4IV9 A;  1X31 B;  2B76 A;  3KPF A;  1CC2 A;  2X8H A;  3CNT A;  1OJC A;  4I59 A;  2CDU A;  5EB4 A;  4Z25 A;  1REO A;  3DGZ A;  3CGE A;  2XLT A;  4LA1 A;  3D8X A;  4OPD A;  4UDP A;  4XXG A;  2H89 A;  5JCL A;  2WDR A;  1B8S A;  4B66 A;  4UP3 A;  3NN0 X;  1RYI A;  1CL0 A;  1CJ3 A;  4J31 A;  3UP5 A;  1E6E A;  3CGD A;  1N4U A;  3IF9 A;  4NEV A;  5ER0 A;  2QA1 A;  4M52 A;  3BNM A;  2C76 A;  3NTD A;  4O5U A;  1K0I A;  4NTC A;  4H4T A;  2X3N A;  1GV4 A;  3QFB A;  3UKK A;  1DOC A;  1ZMD A;  3URH A;  2FJA A;  2YWL A;  3EAN A;  3KKJ A;  3ALL A;  3NN6 X;  3P9U A;  3ISH A;  4C77 A;  4A79 A;  4YTM A;  3PO7 A;  1ZX9 A;  2BCG G;  3T37 A;  2TMD A;  1GER A;  3UKP A;  3DK8 A;  2GB0 A;  4DSG A;  4YKG A;  4EMI A;  4B63 A;  1Y56 A;  4CNK A;  1D4C A;  3GRS A;  2XLS A;  2WP9 A;  4LU6 A;  4OPT A;  3JSK A;  3QFA A;  5TR3 A;  2XFQ A;  4Z2T A;  4U8P A;  2ZBW A;  3F8R A;  1RP0 A;  4X9N A;  3ZYX A;  5IPY A;  1PBF A;  3LJP A;  3NT6 A;  3GYJ A;  2BK5 A;  2CUL A;  4DGK A;  3EAO A;  4AOX A;  1EL7 A;  3AYJ A;  1XAN A;  1E1L A;  3ADA B;  4FDC B;  4YSY A;  4OCG A;  2WP6 A;  1NG3 A;  3ALM A;  3F8P A;  1GTE A;  3PS9 A;  4EM4 A;  2XLR A;  3C4N A;  1NHS A;  4DSH A;  1TRB A;  2GRT A;  2XVJ A;  1EL9 A;  3L8K A;  4BK2 A;  3NGC X;  3NLC A;  1GTH A;  1NAA A;  4FX9 A;  4JY2 A;  3AEB A;  4A6N B;  2NPX A;  3GWF A;  3NK2 X;  4ZN0 A;  2A8X A;  2V3A A;  2YG7 A;  1YY5 A;  1GRH A;  4YTN A;  3DJE A;  1LJ1 A;  1VRQ B;  5C2T A;  1OJA A;  2X99 A;  4H50 A;  1DNC A;  1MO9 A;  2CVJ A;  1GRF A;  2C75 A;  2X8G A;  2WES A;  3BI2 A;  4PAA A;  4OPC A;  2VVL A;  1ZP0 A;  2BK4 A;  2WPC A;  4P9S A;  2JAE A;  4A7A A;  1Q9I A;  2R0C A;  5FS7 A;  5CKU A;  3COX A;  3KA7 A;  5FMH A;  2J3N A;  4OVI A;  1FEC A;  4XWR A;  3AE1 A;  4B69 A;  2R45 A;  3NH3 X;  4NZH A;  1GXF A;  3LZW A;  4EQS A;  1JRZ A;  1YQZ A;  4JNA A;  4BJZ A;  1LQT A;  3DK4 A;  1BKW A;  4H4X A;  2UZZ A;  4BK3 A;  2Y6R A;  3NK0 X;  1YQ4 A;  3FMW A;  3G5Q A;  3IC9 A;  3OC4 A;  4EIP A;  1KSS A;  3UKH A;  4H4S A;  2C65 A;  1CJ2 A;  4Z26 A;  1GND A;  2WOV A;  1GOS A;  1QLB A;  4YWO A;  2ZZ0 A;  2WET A;  3B3R A;  3LZX A;  1MOK A;  2BC0 A;  4KPR A;  1PS9 A;  2YLX A;  2YQU A;  3UCL A;  1JRY A;  4B68 A;  3IHG A;  4IVO B;  1GRB A;  3AEF A;  3LAD A;  1YQ3 A;  3GRT A;  3F8D A;  3GYI A;  4CY6 A;  1DJQ A;  3M13 A;  1PHH A;  5J7X A;  3DK9 A;  5HY5 A;  2YM1 A;  4N9X A;  2BYB A;  4J36 A;  3NNE A;  1B37 A;  1ZDL A;  2APG A;  2YLZ A;  1TYP A;  2GMH A;  4A6N A;  2VZ2 A;  3CNJ A;  4EIQ A;  2V60 A;  3E1T A;  3BHK A; 
#chains in the Genus database with same CATH topology
 3SFE A;  1E7P A;  2QAE A;  3G5R A;  3BI4 A;  5BUK A;  1CBO A;  5CQF A;  4J57 A;  3GMB A;  1P2E A;  1PJ5 A;  1JU2 A;  3C4A A;  3AD7 B;  1DOE A;  3DGH A;  3KLJ A;  3T0K A;  5LV9 A;  2R9Z A;  1N1P A;  2C7G A;  4AP3 A;  1K0J A;  3H8I A;  3I3L A;  1GRA A;  3HYX A;  5KRQ A;  2R4E A;  3K7Q X;  1LVL A;  1S2Y A;  3OZ2 A;  3GDP A;  1NHP A;  2BAB A;  4K5S A;  3UOY A;  2YR4 A;  3ZDN A;  2H88 A;  1V59 A;  5EOW A;  3II4 A;  3H8L A;  1JEH A;  2EQ6 A;  5KOX A;  3ITJ A;  1L0V A;  3AE7 A;  3CN8 A;  4H2R A;  4YKF A;  3RP7 A;  5C3J A;  3CGB A;  3LOV A;  1KFY A;  2C4C A;  4K5R A;  2OAM A;  3FIM B;  3DJJ A;  5HXI A;  4H2P A;  1L9C A;  1VQW A;  3CPI G;  5BUL A;  2AR8 A;  1NHR A;  4LII A;  2FJD A;  5KVI A;  3NKS A;  2C72 A;  4IVM B;  1E39 A;  3P1W A;  3WE0 A;  3QJ4 A;  4AT2 A;  2FJE A;  4FK1 A;  4YSX A;  3BHF A;  2W0H A;  1D4E A;  2AQJ A;  2VOU A;  2VRM A;  4RSL A;  2RGJ A;  2BS4 A;  3S61 A;  4CNJ A;  1Z6L A;  3DME A;  1PXC A;  3I6D A;  1CC6 A;  2C66 A;  3O0H A;  3ICS A;  1S3B A;  3D1C A;  4JQ9 A;  2BS3 A;  4H2N A;  2JB3 A;  4IA5 A;  4IA6 A;  4EMW A;  4YSZ A;  2OA1 A;  4NEW A;  4JN9 A;  1E1M A;  1RSG A;  4GR1 A;  3VRD B;  5KMP A;  4H4Q A;  1NG4 A;  1EL5 A;  1XPQ A;  2GMJ A;  2WPF A;  2IVD A;  4EQX A;  1PBC A;  4J56 A;  2E5V A;  3GMC A;  2XVF A;  2VQ7 A;  3ALJ A;  1GET A;  2Q0K A;  1NEN A;  2GQW A;  3AE6 A;  3QSE A;  2YVG A;  3GSI A;  1D7L A;  3AEA A;  2QA2 A;  4Z44 A;  2GR3 A;  2C64 A;  2C3C A;  1PBB A;  3Q9T A;  3ICT A;  3UOV A;  3PVC A;  2GEW A;  1KNR A;  1E1N A;  1GRT A;  1OJT A;  2B9W A;  2WEU A;  4RG4 A;  4II3 A;  1W4X A;  4BV6 A;  4E0V A;  5JCI A;  2A89 A;  2XVE A;  4DNA A;  2XFU A;  2E4G A;  3V76 A;  3K7M X;  1BWC A;  2RAB A;  2WPE A;  2YG6 A;  1B4V A;  4C3X A;  1CHU A;  4PAB A;  5IQ4 A;  4O5Q A;  4GUV A;  1GES A;  4CCQ A;  2WU5 A;  1F3P A;  4RG3 A;  3KVE A;  1TDK A;  1KDG A;  2GR2 A;  3NRN A;  2YVF A;  1GPE A;  1ZKQ A;  2WOI A;  1DXL A;  1FEA A;  5GRT A;  3AB1 A;  1HYU A;  2F5Z A;  4TLZ A;  4WCT A;  2YG5 A;  3LXD A;  2WHD A;  1NEK A;  4OPU A;  4CRT A;  1Y0P A;  3AE3 A;  3AE4 A;  1E1K A;  1VG0 A;  2XCG A;  4CBQ A;  3SX6 A;  4B64 A;  1AOG A;  2RGO A;  2EQ7 A;  3AYI A;  1B5Q A;  1P2H A;  2Z5Y A;  3AE5 A;  2YLT A;  1EBD A;  4ICY A;  4OPI A;  5M10 A;  3AEG A;  3V3N A;  2OLO A;  1PJ7 A;  2JB2 A;  2CFY A;  4JY3 A;  2XFN A;  4USQ A;  5BRT A;  1S2Q A;  3RNM A;  3UKL A;  4BUR A;  4CY8 A;  4HA6 A;  1DOD A;  4J33 A;  1O95 A;  5FS9 A;  2X50 A;  2Z5X A;  4A5L A;  2B7S A;  2QCU A;  5JCN A;  3G5S A;  4ZCD A;  2WBA A;  1H86 A;  2V61 A;  4AOS A;  4NNJ A;  4B67 A;  1LQU A;  2Q6U A;  2YG4 A;  1IUT A;  2YLW A;  1ONF A;  2A87 A;  2R0P A;  5DBJ A;  1JNR A;  1NPX A;  1ZMC A;  3AEC A;  5HYM A;  1K4Q A;  2EQ9 A;  2JBV A;  2GVC A;  2GR0 A;  4K7Z A;  1IUX A;  1PXA A;  4YTP A;  4U2L A;  2Q0L A;  2JK6 A;  1TDE A;  1OJ9 A;  1O5W A;  2XLU A;  1PBD A;  4TM3 A;  2XYO A;  5KVH A;  3CPH G;  1L9D A;  1PXB A;  5FS6 A;  2FBW A;  4J34 A;  3UTF A;  4YT0 A;  5BVA A;  4K22 A;  3SY4 A;  5KXJ A;  3P4R A;  1DJN A;  4A99 A;  3CGC A;  4H4P A;  4U8J A;  2V3B A;  1GSN A;  1F8W A;  5FS8 A;  3V3O A;  4U2T A;  3NK1 X;  4H4R A;  3AE2 A;  3CND A;  4YXD A;  4K2X A;  3RED A;  1BGJ A;  1XDI A;  2XFO A;  2R4J A;  1TYT A;  4UDQ A;  3RP8 A;  1NDA A;  4X9M A;  4GDE A;  3AE9 A;  3S5W A;  1CF3 A;  1H7W A;  2C73 A;  2OAL A;  2WU2 A;  2IVE A;  3CNP A;  2B9Y A;  4H4V A;  2YM2 A;  4H4Z A;  3AWI A;  1YKJ A;  4Z43 A;  2V6O A;  2OLN A;  1PDH A;  4XWZ A;  1H7X A;  2X8C A;  1VG9 A;  1XHC A;  2WDQ A;  2Y6Q A;  1ZOV A;  2BK3 A;  4TM1 A;  4C3Y A;  4H7U A;  3R9U A;  5U1O A;  3SQP A;  1VDC A;  3UOZ A;  3K30 A;  3SYI A;  3HYW A;  4TM0 A;  3HZL A;  4J2W A;  1DOB A;  1D4D A;  2XLP A;  4EMJ A;  3CNS A;  4GCM A;  2RGH A;  2GQF A;  3Q6J A;  3B6D A;  2BRY A;  2DKH A;  4U2S A;  1KNP A;  4Z2U A;  1H6V A;  3EF6 A;  1TDO A;  3ATR A;  2PHH A;  3T2K A;  3NHO X;  4AT0 A;  2YVJ A;  3AD8 B;  3UTH A;  5L46 A;  1N4V A;  3UP4 A;  3AD9 B;  4I58 A;  5IQ1 A;  2B9X A;  1FOH A;  1IUU A;  4OPG A;  1F6M A;  2GAG B;  3C96 A;  3T14 A;  4EQW A;  2V5Z A;  4HB9 A;  2I0Z A;  3SGL A;  1ZY8 A;  3QVR A;  2R46 A;  1Q1W A;  1IUV A;  1IUW A;  4A9W A;  3SZ0 A;  1EL8 A;  3NG7 X;  3NYC A;  4D03 A;  4YSH A;  5JCK A;  3QSM A;  2WS3 A;  3RHA A;  1PN0 A;  3NYE A;  5KWF A;  3KD9 A;  3CTY A;  1NHQ A;  3CMM A;  1CJC A;  2WP5 A;  4H4Y A;  4U8L A;  1FCD A;  1JRX A;  3K7T A;  4G6H A;  3RP6 A;  2VVM A;  1GRG A;  4D04 A;  5EB5 A;  1KF6 A;  3H4K A;  1PJ6 A;  2PYX A;  4ADW A;  4GF7 A;  3NTA A;  2YG3 A;  1LPF A;  2ZZC A;  4WX1 A;  5JCM A;  4U8M A;  4X4J A;  3DJD A;  1O94 A;  4CCR A;  1UKV G;  2GH5 A;  1PBE A;  2XVI A;  5U25 A;  4ECH A;  1H83 A;  4MJW A;  4BK1 A;  2VVL G;  3SZF A;  1F8S A;  3IHM A;  1N4W A;  1TDN A;  2XFP A;  3P4Q A;  1K0L A;  3M0O A;  3BNU A;  1M6I A;  2TPR A;  1MXT A;  1BF3 A;  1ZOY A;  3GD3 A;  1S3E A;  2JKC A;  1BZL A;  4U8O A;  1GAL A;  1M64 A;  5KOW A;  5J60 A;  3M12 A;  1BGN A;  1D5T A;  1TDF A;  2BC1 A;  3ABV A;  2XVH A;  3UKF A;  2XDO A;  2ZZB A;  2GAH B;  4Z24 A;  2YR5 A;  4UDR A;  1FEB A;  3VR8 A;  4C74 A;  3AXB A;  4GAP A;  2R0G A;  5EBK A;  2IID A;  2WQY A;  1KSU A;  2ACZ A;  4USR A;  2GF3 A;  2FJB A;  3EPT A;  3IWA A;  4U8K A;  4JDR A;  1H81 A;  2HQM A;  1GT8 A;  4REK A;  4NTD A;  1JNZ A;  2C67 A;  2E1M A;  1ELI A;  3UTG A;  2BCP A;  1JOA A;  1SEZ A;  3L1R A;  4Y4N A;  1L9E A;  3GD4 A;  1F8R A;  3LB8 A;  4H4W A;  4U8N A;  4Y4L A;  3BI5 A;  5U63 A;  1QJD A;  1GRE A;  2BXS A;  3DH9 A;  4G73 A;  1ZK7 A;  2GR1 A;  3FBS A;  1CC4 A;  3QSS A;  4H2Q A;  2VQB A;  1QO8 A;  2BS2 A;  1LV0 A;  3UKA A;  2GV8 A;  3VRA A;  4AP1 A;  3P4S A;  5M0Z A;  2C3D A;  1H82 A;  4FK1 C;  3KU9 A;  2BA9 A;  2DKI A;  2VRL A;  2BRA A;  4BJY A;  2NVK X;  4JNQ A;  2YR6 A;  3SZC A;  4OPL A;  3VRB A;  5KMQ A;  4Z2R A;  5HHF A;  3HYV A;  3P4P A;  3ATQ A;  3ICR A;  3UTE A;  2JB1 A;  3FG2 P;  2EQ8 A;  3GDN A;  3FPZ A;  4U8I A;  4A65 A;  1H84 A;  1FL2 A;  4B1B A;  5GSN A;  3CPJ G;  3UKQ A;  4KX6 A;  1IJH A;  3GWD A;  3UOX A;  2BXR A;  3DJG X;  1IUS A;  1LTX R;  2B7R A;  2O9Z A;  3SFD A;  2C70 A;  2BAC A;  4TLX A;  1Y56 B;  4K8D A;  2YLS A;  4ZCC A;  4H4U A;  1COY A;  3AED A;  1OJD A;  4TM4 A;  3SM8 A;  2YAU A;  4GRT A;  2YLR A;  3VR9 A;  2Q7V A;  2ARD A;  1CJ4 A;  3T31 A;  3QVP A;  4Y4M A;  1D7Y A;  4APN A;  3NIX A;  4B65 A;  2WDV A;  3CIR A;  4C5O A;  4EM3 A;  1GEU A;  3AYL A;  4NTE A;  4GAV A;  3VQR A;  2WOW A;  1Q1R A;  2AAQ A;  4EQR A;  3AE8 A;  3NYF A;  3AEE A;  3GYX A;  3DA1 A;  4GDP A;  4IV9 A;  5KMS A;  1X31 B;  4NWZ A;  2B76 A;  3KPF A;  1CC2 A;  2X8H A;  3CNT A;  1OJC A;  4I59 A;  2CDU A;  5EB4 A;  4Z25 A;  1REO A;  3DGZ A;  3CGE A;  2XLT A;  4LA1 A;  3D8X A;  4OPD A;  4UDP A;  4XXG A;  2H89 A;  5JCL A;  2WDR A;  1B8S A;  4B66 A;  5KMR A;  4UP3 A;  3NN0 X;  1RYI A;  1CL0 A;  1CJ3 A;  4J31 A;  3UP5 A;  1E6E A;  3CGD A;  1N4U A;  3IF9 A;  4NEV A;  5ER0 A;  2QA1 A;  4M52 A;  3BNM A;  2C76 A;  3NTD A;  4O5U A;  1K0I A;  4NTC A;  4H4T A;  2X3N A;  1GV4 A;  3QFB A;  3UKK A;  1DOC A;  1ZMD A;  3URH A;  2FJA A;  2YWL A;  3EAN A;  3KPK A;  3KKJ A;  3ALL A;  3NN6 X;  3P9U A;  3ISH A;  4C77 A;  4A79 A;  4YTM A;  3PO7 A;  1ZX9 A;  2BCG G;  3T37 A;  2TMD A;  1GER A;  3UKP A;  3DK8 A;  2GB0 A;  4DSG A;  4YKG A;  4EMI A;  4B63 A;  1Y56 A;  4CNK A;  1D4C A;  3GRS A;  2XLS A;  2WP9 A;  4LU6 A;  4OPT A;  3JSK A;  3QFA A;  5TR3 A;  2XFQ A;  4Z2T A;  4U8P A;  2ZBW A;  4G9K A;  3F8R A;  1RP0 A;  4X9N A;  3ZYX A;  5IPY A;  3LJP A;  1PBF A;  3NT6 A;  3GYJ A;  2BK5 A;  2CUL A;  4DGK A;  3EAO A;  4AOX A;  1EL7 A;  3AYJ A;  1XAN A;  1E1L A;  3ADA B;  4G6G A;  4FDC B;  4YSY A;  4OCG A;  2WP6 A;  1NG3 A;  3ALM A;  3F8P A;  1GTE A;  3PS9 A;  4EM4 A;  2XLR A;  5KNL A;  3C4N A;  1NHS A;  4DSH A;  1TRB A;  2GRT A;  2XVJ A;  1EL9 A;  3L8K A;  4BK2 A;  3NGC X;  3NLC A;  1GTH A;  1NAA A;  4FX9 A;  4JY2 A;  3AEB A;  4A6N B;  2NPX A;  3GWF A;  3NK2 X;  4ZN0 A;  2A8X A;  2V3A A;  2YG7 A;  1YY5 A;  3SZW A;  1GRH A;  4YTN A;  3DJE A;  1LJ1 A;  1VRQ B;  5C2T A;  1OJA A;  2X99 A;  4H50 A;  1DNC A;  1MO9 A;  2CVJ A;  1GRF A;  2C75 A;  2X8G A;  2WES A;  3BI2 A;  4PAA A;  4OPC A;  2VVL A;  1ZP0 A;  2BK4 A;  2WPC A;  4P9S A;  2JAE A;  4A7A A;  1Q9I A;  2R0C A;  5FS7 A;  5CKU A;  3COX A;  3KA7 A;  5FMH A;  2J3N A;  4OVI A;  1FEC A;  4XWR A;  3AE1 A;  4B69 A;  2R45 A;  3NH3 X;  4NZH A;  1GXF A;  3LZW A;  4EQS A;  1JRZ A;  1YQZ A;  4JNA A;  3SXI A;  1LQT A;  3DK4 A;  3T2Y A;  4BJZ A;  1BKW A;  4H4X A;  2UZZ A;  4BK3 A;  2Y6R A;  3NK0 X;  1YQ4 A;  3FMW A;  3G5Q A;  3IC9 A;  3OC4 A;  4EIP A;  1KSS A;  3UKH A;  4H4S A;  2C65 A;  1CJ2 A;  4Z26 A;  1GND A;  2WOV A;  1GOS A;  1QLB A;  4YWO A;  2ZZ0 A;  2WET A;  3B3R A;  3LZX A;  1MOK A;  2BC0 A;  4KPR A;  1PS9 A;  2YLX A;  2YQU A;  3UCL A;  1JRY A;  4II2 A;  4B68 A;  3IHG A;  4IVO B;  1GRB A;  3AEF A;  3LAD A;  1YQ3 A;  3GRT A;  3F8D A;  3GYI A;  3T2Z A;  4CY6 A;  1DJQ A;  3M13 A;  1PHH A;  5J7X A;  3DK9 A;  5HY5 A;  2YM1 A;  4G74 A;  4N9X A;  2BYB A;  4J36 A;  3NNE A;  1B37 A;  1ZDL A;  2APG A;  2YLZ A;  1TYP A;  2GMH A;  4A6N A;  2VZ2 A;  3CNJ A;  4EIQ A;  2V60 A;  3E1T A;  3BHK A; 
#chains in the Genus database with same CATH homology
 3SFE A;  1E7P A;  2QAE A;  3G5R A;  3BI4 A;  5BUK A;  1CBO A;  5CQF A;  4J57 A;  3GMB A;  1P2E A;  1PJ5 A;  1JU2 A;  3C4A A;  3AD7 B;  1DOE A;  3DGH A;  3KLJ A;  3T0K A;  5LV9 A;  2R9Z A;  1N1P A;  2C7G A;  4AP3 A;  1K0J A;  3H8I A;  3I3L A;  1GRA A;  3HYX A;  5KRQ A;  2R4E A;  3K7Q X;  1LVL A;  1S2Y A;  3OZ2 A;  3GDP A;  1NHP A;  2BAB A;  4K5S A;  3UOY A;  2YR4 A;  3ZDN A;  2H88 A;  1V59 A;  5EOW A;  3II4 A;  3H8L A;  1JEH A;  2EQ6 A;  5KOX A;  3ITJ A;  1L0V A;  3AE7 A;  3CN8 A;  4H2R A;  4YKF A;  3RP7 A;  5C3J A;  3CGB A;  3LOV A;  1KFY A;  2C4C A;  4K5R A;  2OAM A;  3FIM B;  3DJJ A;  5HXI A;  4H2P A;  1L9C A;  1VQW A;  3CPI G;  5BUL A;  2AR8 A;  1NHR A;  4LII A;  2FJD A;  5KVI A;  3NKS A;  2C72 A;  4IVM B;  1E39 A;  3P1W A;  3WE0 A;  3QJ4 A;  4AT2 A;  2FJE A;  4FK1 A;  4YSX A;  3BHF A;  2W0H A;  1D4E A;  2AQJ A;  2VOU A;  2VRM A;  4RSL A;  2RGJ A;  2BS4 A;  3S61 A;  4CNJ A;  1Z6L A;  3DME A;  1PXC A;  3I6D A;  1CC6 A;  2C66 A;  3O0H A;  3ICS A;  1S3B A;  3D1C A;  4JQ9 A;  2BS3 A;  4H2N A;  2JB3 A;  4IA5 A;  4IA6 A;  4EMW A;  4YSZ A;  2OA1 A;  4NEW A;  4JN9 A;  1E1M A;  1RSG A;  4GR1 A;  3VRD B;  5KMP A;  4H4Q A;  1NG4 A;  1EL5 A;  1XPQ A;  2GMJ A;  2WPF A;  2IVD A;  4EQX A;  1PBC A;  4J56 A;  2E5V A;  3GMC A;  2XVF A;  2VQ7 A;  3ALJ A;  1GET A;  2Q0K A;  1NEN A;  2GQW A;  3AE6 A;  3QSE A;  2YVG A;  3GSI A;  1D7L A;  3AEA A;  2QA2 A;  4Z44 A;  2GR3 A;  2C64 A;  2C3C A;  1PBB A;  3Q9T A;  3ICT A;  3UOV A;  3PVC A;  2GEW A;  1KNR A;  1E1N A;  1GRT A;  1OJT A;  2B9W A;  2WEU A;  4RG4 A;  4II3 A;  1W4X A;  4BV6 A;  4E0V A;  5JCI A;  2A89 A;  2XVE A;  4DNA A;  2XFU A;  2E4G A;  3V76 A;  3K7M X;  1BWC A;  2RAB A;  2WPE A;  2YG6 A;  1B4V A;  4C3X A;  1CHU A;  4PAB A;  5IQ4 A;  4O5Q A;  4GUV A;  1GES A;  4CCQ A;  2WU5 A;  1F3P A;  4RG3 A;  3KVE A;  1TDK A;  1KDG A;  2GR2 A;  3NRN A;  2YVF A;  1GPE A;  1ZKQ A;  2WOI A;  1DXL A;  1FEA A;  5GRT A;  3AB1 A;  1HYU A;  2F5Z A;  4TLZ A;  4WCT A;  2YG5 A;  3LXD A;  2WHD A;  1NEK A;  4OPU A;  4CRT A;  1Y0P A;  3AE3 A;  3AE4 A;  1E1K A;  1VG0 A;  2XCG A;  4CBQ A;  3SX6 A;  4B64 A;  1AOG A;  2RGO A;  2EQ7 A;  3AYI A;  1B5Q A;  1P2H A;  2Z5Y A;  3AE5 A;  2YLT A;  1EBD A;  4ICY A;  4OPI A;  5M10 A;  3AEG A;  3V3N A;  2OLO A;  1PJ7 A;  2JB2 A;  2CFY A;  4JY3 A;  2XFN A;  4USQ A;  5BRT A;  1S2Q A;  3RNM A;  3UKL A;  4BUR A;  4CY8 A;  4HA6 A;  1DOD A;  4J33 A;  1O95 A;  5FS9 A;  2X50 A;  2Z5X A;  4A5L A;  2B7S A;  2QCU A;  5JCN A;  3G5S A;  4ZCD A;  2WBA A;  1H86 A;  2V61 A;  4AOS A;  4NNJ A;  4B67 A;  1LQU A;  2Q6U A;  2YG4 A;  1IUT A;  2YLW A;  1ONF A;  2A87 A;  2R0P A;  5DBJ A;  1JNR A;  1NPX A;  1ZMC A;  3AEC A;  5HYM A;  1K4Q A;  2EQ9 A;  2JBV A;  2GVC A;  2GR0 A;  4K7Z A;  1IUX A;  1PXA A;  4YTP A;  4U2L A;  2Q0L A;  2JK6 A;  1TDE A;  1OJ9 A;  1O5W A;  2XLU A;  1PBD A;  4TM3 A;  2XYO A;  5KVH A;  3CPH G;  1L9D A;  1PXB A;  5FS6 A;  2FBW A;  4J34 A;  3UTF A;  4YT0 A;  5BVA A;  4K22 A;  3SY4 A;  5KXJ A;  3P4R A;  1DJN A;  4A99 A;  3CGC A;  4H4P A;  4U8J A;  2V3B A;  1GSN A;  1F8W A;  5FS8 A;  3V3O A;  4U2T A;  3NK1 X;  4H4R A;  3AE2 A;  3CND A;  4YXD A;  4K2X A;  3RED A;  1BGJ A;  1XDI A;  2XFO A;  2R4J A;  1TYT A;  4UDQ A;  3RP8 A;  1NDA A;  4X9M A;  4GDE A;  3AE9 A;  3S5W A;  1CF3 A;  1H7W A;  2C73 A;  2OAL A;  2WU2 A;  2IVE A;  3CNP A;  2B9Y A;  4H4V A;  2YM2 A;  4H4Z A;  3AWI A;  1YKJ A;  4Z43 A;  2V6O A;  2OLN A;  1PDH A;  4XWZ A;  1H7X A;  2X8C A;  1VG9 A;  1XHC A;  2WDQ A;  2Y6Q A;  1ZOV A;  2BK3 A;  4TM1 A;  4C3Y A;  4H7U A;  3R9U A;  5U1O A;  3SQP A;  1VDC A;  3UOZ A;  3K30 A;  3SYI A;  3HYW A;  4TM0 A;  3HZL A;  4J2W A;  1DOB A;  1D4D A;  2XLP A;  4EMJ A;  3CNS A;  4GCM A;  2RGH A;  2GQF A;  3Q6J A;  3B6D A;  2BRY A;  2DKH A;  4U2S A;  1KNP A;  4Z2U A;  1H6V A;  3EF6 A;  1TDO A;  3ATR A;  2PHH A;  3T2K A;  3NHO X;  4AT0 A;  2YVJ A;  3AD8 B;  3UTH A;  5L46 A;  1N4V A;  3UP4 A;  3AD9 B;  4I58 A;  5IQ1 A;  2B9X A;  1FOH A;  1IUU A;  4OPG A;  1F6M A;  2GAG B;  3C96 A;  3T14 A;  4EQW A;  2V5Z A;  4HB9 A;  2I0Z A;  3SGL A;  1ZY8 A;  3QVR A;  2R46 A;  1Q1W A;  1IUV A;  1IUW A;  4A9W A;  3SZ0 A;  1EL8 A;  3NG7 X;  3NYC A;  4D03 A;  4YSH A;  5JCK A;  3QSM A;  2WS3 A;  3RHA A;  1PN0 A;  3NYE A;  5KWF A;  3KD9 A;  3CTY A;  1NHQ A;  3CMM A;  1CJC A;  2WP5 A;  4H4Y A;  4U8L A;  1FCD A;  1JRX A;  3K7T A;  4G6H A;  3RP6 A;  2VVM A;  1GRG A;  4D04 A;  5EB5 A;  1KF6 A;  3H4K A;  1PJ6 A;  2PYX A;  4ADW A;  4GF7 A;  3NTA A;  2YG3 A;  1LPF A;  2ZZC A;  4WX1 A;  5JCM A;  4U8M A;  4X4J A;  3DJD A;  1O94 A;  4CCR A;  1UKV G;  2GH5 A;  1PBE A;  2XVI A;  5U25 A;  4ECH A;  1H83 A;  4MJW A;  4BK1 A;  2VVL G;  3SZF A;  1F8S A;  3IHM A;  1N4W A;  1TDN A;  2XFP A;  3P4Q A;  1K0L A;  3M0O A;  3BNU A;  1M6I A;  2TPR A;  1MXT A;  1BF3 A;  1ZOY A;  3GD3 A;  1S3E A;  2JKC A;  1BZL A;  4U8O A;  1GAL A;  1M64 A;  5KOW A;  5J60 A;  3M12 A;  1BGN A;  1D5T A;  1TDF A;  2BC1 A;  3ABV A;  2XVH A;  3UKF A;  2XDO A;  2ZZB A;  2GAH B;  4Z24 A;  2YR5 A;  4UDR A;  1FEB A;  3VR8 A;  4C74 A;  3AXB A;  4GAP A;  2R0G A;  5EBK A;  2IID A;  2WQY A;  1KSU A;  2ACZ A;  4USR A;  2GF3 A;  2FJB A;  3EPT A;  3IWA A;  4U8K A;  4JDR A;  1H81 A;  2HQM A;  1GT8 A;  4REK A;  4NTD A;  1JNZ A;  2C67 A;  2E1M A;  1ELI A;  3UTG A;  2BCP A;  1JOA A;  1SEZ A;  3L1R A;  4Y4N A;  1L9E A;  3GD4 A;  1F8R A;  3LB8 A;  4H4W A;  4U8N A;  4Y4L A;  3BI5 A;  5U63 A;  1QJD A;  1GRE A;  2BXS A;  3DH9 A;  4G73 A;  1ZK7 A;  2GR1 A;  3FBS A;  1CC4 A;  3QSS A;  4H2Q A;  2VQB A;  1QO8 A;  2BS2 A;  1LV0 A;  3UKA A;  2GV8 A;  3VRA A;  4AP1 A;  3P4S A;  5M0Z A;  2C3D A;  1H82 A;  4FK1 C;  3KU9 A;  2BA9 A;  2DKI A;  2VRL A;  2BRA A;  4BJY A;  2NVK X;  4JNQ A;  2YR6 A;  3SZC A;  4OPL A;  3VRB A;  5KMQ A;  4Z2R A;  5HHF A;  3HYV A;  3P4P A;  3ATQ A;  3ICR A;  3UTE A;  2JB1 A;  3FG2 P;  2EQ8 A;  3GDN A;  3FPZ A;  4U8I A;  4A65 A;  1H84 A;  1FL2 A;  4B1B A;  5GSN A;  3CPJ G;  3UKQ A;  4KX6 A;  1IJH A;  3GWD A;  3UOX A;  2BXR A;  3DJG X;  1IUS A;  1LTX R;  2B7R A;  2O9Z A;  3SFD A;  2C70 A;  2BAC A;  4TLX A;  1Y56 B;  4K8D A;  2YLS A;  4ZCC A;  4H4U A;  1COY A;  3AED A;  1OJD A;  4TM4 A;  3SM8 A;  2YAU A;  4GRT A;  2YLR A;  3VR9 A;  2Q7V A;  2ARD A;  1CJ4 A;  3T31 A;  3QVP A;  4Y4M A;  1D7Y A;  4APN A;  3NIX A;  4B65 A;  2WDV A;  3CIR A;  4C5O A;  4EM3 A;  1GEU A;  3AYL A;  4NTE A;  4GAV A;  3VQR A;  2WOW A;  1Q1R A;  2AAQ A;  4EQR A;  3AE8 A;  3NYF A;  3AEE A;  3GYX A;  3DA1 A;  4GDP A;  4IV9 A;  5KMS A;  1X31 B;  4NWZ A;  2B76 A;  3KPF A;  1CC2 A;  2X8H A;  3CNT A;  1OJC A;  4I59 A;  2CDU A;  5EB4 A;  4Z25 A;  1REO A;  3DGZ A;  3CGE A;  2XLT A;  4LA1 A;  3D8X A;  4OPD A;  4UDP A;  4XXG A;  2H89 A;  5JCL A;  2WDR A;  1B8S A;  4B66 A;  5KMR A;  4UP3 A;  3NN0 X;  1RYI A;  1CL0 A;  1CJ3 A;  4J31 A;  3UP5 A;  1E6E A;  3CGD A;  1N4U A;  3IF9 A;  4NEV A;  5ER0 A;  2QA1 A;  4M52 A;  3BNM A;  2C76 A;  3NTD A;  4O5U A;  1K0I A;  4NTC A;  4H4T A;  2X3N A;  1GV4 A;  3QFB A;  3UKK A;  1DOC A;  1ZMD A;  3URH A;  2FJA A;  2YWL A;  3EAN A;  3KPK A;  3KKJ A;  3ALL A;  3NN6 X;  3P9U A;  3ISH A;  4C77 A;  4A79 A;  4YTM A;  3PO7 A;  1ZX9 A;  2BCG G;  3T37 A;  2TMD A;  1GER A;  3UKP A;  3DK8 A;  2GB0 A;  4DSG A;  4YKG A;  4EMI A;  4B63 A;  1Y56 A;  4CNK A;  1D4C A;  3GRS A;  2XLS A;  2WP9 A;  4LU6 A;  4OPT A;  3JSK A;  3QFA A;  5TR3 A;  2XFQ A;  4Z2T A;  4U8P A;  2ZBW A;  4G9K A;  3F8R A;  1RP0 A;  4X9N A;  3ZYX A;  5IPY A;  3LJP A;  1PBF A;  3NT6 A;  3GYJ A;  2BK5 A;  2CUL A;  4DGK A;  3EAO A;  4AOX A;  1EL7 A;  3AYJ A;  1XAN A;  1E1L A;  3ADA B;  4G6G A;  4FDC B;  4YSY A;  4OCG A;  2WP6 A;  1NG3 A;  3ALM A;  3F8P A;  1GTE A;  3PS9 A;  4EM4 A;  2XLR A;  5KNL A;  3C4N A;  1NHS A;  4DSH A;  1TRB A;  2GRT A;  2XVJ A;  1EL9 A;  3L8K A;  4BK2 A;  3NGC X;  3NLC A;  1GTH A;  1NAA A;  4FX9 A;  4JY2 A;  3AEB A;  4A6N B;  2NPX A;  3GWF A;  3NK2 X;  4ZN0 A;  2A8X A;  2V3A A;  2YG7 A;  1YY5 A;  3SZW A;  1GRH A;  4YTN A;  3DJE A;  1LJ1 A;  1VRQ B;  5C2T A;  1OJA A;  2X99 A;  4H50 A;  1DNC A;  1MO9 A;  2CVJ A;  1GRF A;  2C75 A;  2X8G A;  2WES A;  3BI2 A;  4PAA A;  4OPC A;  2VVL A;  1ZP0 A;  2BK4 A;  2WPC A;  4P9S A;  2JAE A;  4A7A A;  1Q9I A;  2R0C A;  5FS7 A;  5CKU A;  3COX A;  3KA7 A;  5FMH A;  2J3N A;  4OVI A;  1FEC A;  4XWR A;  3AE1 A;  4B69 A;  2R45 A;  3NH3 X;  4NZH A;  1GXF A;  3LZW A;  4EQS A;  1JRZ A;  1YQZ A;  4JNA A;  3SXI A;  1LQT A;  3DK4 A;  3T2Y A;  4BJZ A;  1BKW A;  4H4X A;  2UZZ A;  4BK3 A;  2Y6R A;  3NK0 X;  1YQ4 A;  3FMW A;  3G5Q A;  3IC9 A;  3OC4 A;  4EIP A;  1KSS A;  3UKH A;  4H4S A;  2C65 A;  1CJ2 A;  4Z26 A;  1GND A;  2WOV A;  1GOS A;  1QLB A;  4YWO A;  2ZZ0 A;  2WET A;  3B3R A;  3LZX A;  1MOK A;  2BC0 A;  4KPR A;  1PS9 A;  2YLX A;  2YQU A;  3UCL A;  1JRY A;  4II2 A;  4B68 A;  3IHG A;  4IVO B;  1GRB A;  3AEF A;  3LAD A;  1YQ3 A;  3GRT A;  3F8D A;  3GYI A;  3T2Z A;  4CY6 A;  1DJQ A;  3M13 A;  1PHH A;  5J7X A;  3DK9 A;  5HY5 A;  2YM1 A;  4G74 A;  4N9X A;  2BYB A;  4J36 A;  3NNE A;  1B37 A;  1ZDL A;  2APG A;  2YLZ A;  1TYP A;  2GMH A;  4A6N A;  2VZ2 A;  3CNJ A;  4EIQ A;  2V60 A;  3E1T A;  3BHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...