1NAAA

Cellobiose dehydrogenase flavoprotein fragment in complex with cellobionolactam
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
541
structure length
541
Chain Sequence
TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the reductive half-reaction in cellobiose dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cellobiose dehydrogenase
total genus 185
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1naaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1naaA01
3K7QX 3NRNA 5DBJA 1K0JA 4U8MA 1B4VA 1QJDA 1VQWA 2YQUA 2ZBWA 1FEAA 3OC4A 4OPLA 2GH5A 3RNMA 5KVHA 2GQWA 5CKUA 1NPXA 5JCLA 3AE4A 1QO8A 2GAGB 4YT0A 4Z26A 1N4WA 3WE0A 4BK3A 4NTEA 1TYTA 1NHPA 5JCKA 3PS9A 3GMBA 3C4NA 3CGBA 2YR6A 4H4PA 4I59A 1Y56A 2YLWA 3AE9A 2HQMA 4BV6A 5TR3A 3VR9A 2Y6RA 2H89A 4EQRA 1OJTA 2WDRA 2XFQA 2WPEA 3BI4A 3UTEA 1CJ3A 1PN0A 3CPIG 4H4VA 2FJAA 2JKCA 4C3YA 1JNZA 1E6EA 3VRBA 2XFPA 3NIXA 3V76A 1VDCA 4B1BA 2V6OA 2XFOA 3NN6X 3AE7A 4Z25A 4DSGA 5M0ZA 2E5VA 2JB2A 3IHGA 2Z5YA 1BF3A 1GRBA 1GRHA 1BZLA 4YKGA 3P4SA 3DGZA 3ICRA 2C67A 5ER0A 4A79A 3UOYA 3GYIA 3LADA 3OZ2A 4U8JA 2WOVA 5KOWA 1KF6A 2WU5A 3AYLA 1ZOYA 3NT6A 1LQTA 4H50A 3CPJG 4J34A 2C64A 1DJQA 4Z2UA 3NTAA 3P4PA 2BXRA 4YWOA 1EL9A 3BI2A 3VQRA 1H86A 2C73A 3GD3A 1FCDA 1F3PA 3KU9A 1D4CA 3M12A 1BWCA 3R9UA 3KD9A 2EQ7A 1NG3A 3CNTA 3CTYA 4U8IA 1EL7A 2ARDA 3GSIA 1GEUA 2BC0A 3UKAA 3GYJA 1JRXA 2UZZA 2WP5A 3ATQA 2GB0A 2V60A 3AXBA 3F8PA 3NHOX 4GR1A 2RGJA 3CPHG 4TLZA 3QSMA 3UP5A 2XVHA 2GR2A 4H4YA 1OJAA 1PJ7A 3ZDNA 4DSHA 2XYOA 3NYEA 4FK1C 3UTGA 4CY8A 3DMEA 1O5WA 4D04A 4TLXA 2ACZA 3H4KA 2GMJA 2CULA 4APNA 3AYIA 1Q1RA 2Q6UA 3FMWA 4OVIA 1YY5A 3RP6A 3G5RA 1IUVA 3CNSA 3ZYXA 2NVKX 1F8WA 2YLRA 2WESA 4A7AA 4ADWA 5JCNA 1NG4A 3SQPA 4YSXA 4XXGA 2YG5A 4K5SA 1F8RA 4YSHA 1E1MA 1RSGA 4BK1A 1FEBA 3ISHA 1GT8A 5BUKA 1L9CA 2YLXA 1OJDA 3V3NA 2JAEA 1S2YA 4JN9A 1GTEA 4U8NA 2XLSA 4TM4A 2RGOA 2BC1A 1H7WA 1PJ6A 3EPTA 4A65A 1PDHA 4U8KA 4H4QA 4A9WA 3AEEA 3AB1A 2YWLA 1LQUA 2Y6QA 2VRLA 1ZKQA 1LV0A 4C5OA 2WEUA 3ALMA 4K8DA 3S61A 1GOSA 1OJCA 1JU2A 2BCGG 2BA9A 2RABA 3G5QA 5M10A 4USRA 1LVLA 2YM1A 1GRTA 2OA1A 1OJ9A 1P2EA 3NYCA 4X4JA 1PS9A 4X9MA 4J33A 1COYA 4WX1A 4OPTA 4EIQA 3NYFA 1DODA 1M64A 3GDPA 4K2XA 3B6DA 3UKLA 3DJDA 1TDKA 4EQWA 4XWRA 2WOWA 1CF3A 4H4UA 4GUVA 2VVLA 1VG0A 2ZZ0A 2VZ2A 4K22A 1DNCA 4KX6A 2IIDA 4FK1A 2XFNA 4UDPA 4EM3A 3PO7A 2B76A 3ATRA 4H4TA 1DOBA 4NTCA 2WHDA 1H7XA 2R45A 3V3OA 1D4DA 4NEVA 2OAMA 1BKWA 3EAOA 3O0HA 3UCLA 3AEAA 3KKJA 1CJ4A 4BJYA 1NEKA 2Q0KA 2FJBA 3DA1A 2FJDA 1PJ5A 3ICTA 4A99A 4U8PA 2E4GA 4DNAA 4Z44A 2R4EA 1QLBA 2W0HA 3LJPA 3DJGX 3C4AA 1S3BA 5EB4A 4CCQA 2GV8A 1O94A 2YLTA 4EQXA 2YVGA 4H4ZA 3ICSA 2A87A 3NK1X 4AP3A 1N4UA 2CFYA 4PABA 5EOWA 4I58A 2R0GA 4IA5A 1YQ3A 4C3XA 1PBBA 3AEDA 3AEGA 3AD9B 4JDRA 1CL0A 5HXIA 5KXJA 1PHHA 4AOSA 5HY5A 1ZK7A 2PYXA 2GEWA 5C2TA 3GRSA 2YLZA 1EL8A 1GPEA 4D03A 4O5QA 2WETA 1YQ4A 3UTFA 2C65A 1ZMDA 3BNUA 3CNJA 3CGCA 4U2SA 2AR8A 1D7LA 3GD4A 4C77A 4FDCB 2Z5XA 5J7XA 2GR3A 4J31A 3L8KA 4P9SA 4IVOB 4RG4A 1XANA 2BS4A 3HZLA 1FOHA 1K0LA 3KA7A 1UKVG 2QA2A 4Z2TA 3D1CA 4Y4LA 2YG7A 2BCPA 2WDVA 2B9XA 2VRMA 2O9ZA 1KDGA 2C3DA 5FS6A 1NDAA 2E1MA 2WDQA 2X8HA 1CC2A 3CNDA 1X31B 5KVIA 1NENA 1GRAA 1W4XA 3URHA 2NPXA 4RG3A 1PBFA 1H81A 5U1OA 4YKFA 3ADAB 3SGLA 4YTNA 3ALJA 3DH9A 2WP6A 3QFAA 4Y4MA 4YSZA 1Q1WA 2DKIA 1BGNA 4J56A 1M6IA 4Z43A 5KWFA 3DK9A 5JCMA 4TM3A 4WCTA 1D5TA 2B9WA 1TYPA 2WU2A 4TM1A 2YVFA 3P4RA 1JNRA 3GDNA 1P2HA 1K4QA 4H4SA 1LPFA 4IV9A 3QSEA 2FBWA 2BABA 5IPYA 2B9YA 3QVRA 4EMJA 3F8DA 5FS9A 5IQ4A 4U8OA 2WPCA 5C3JA 3P1WA 4U2LA 2ZZBA 3ABVA 2WOIA 4HA6A 2XFUA 3NH3X 4ZCDA 2A8XA 2C3CA 2BK4A 2R46A 3IHMA 3LZWA 3UTHA 4M52A 1KNPA 1ELIA 3BHFA 5FS8A 2TPRA 4AT0A 4C74A 4ECHA 2BS2A 3AWIA 3P4QA 4YTMA 4CBQA 1F8SA 1IUUA 5EB5A 2X8CA 3T37A 3K30A 5HHFA 4BJZA 1LTXR 2QAEA 3AEFA 1DOEA 1IJHA 3AD8B 3Q6JA 2V61A 3CN8A 3K7MX 1XDIA 2AAQA 3QJ4A 1VRQB 5J60A 3NN0X 4OPIA 5KOXA 1DXLA 3AEBA 2BK5A 2DKHA 3CIRA 4CRTA 3Q9TA 2GF3A 1Y56B 3UKFA 2GR0A 1SEZA 1EBDA 4E0VA 1KSUA 1CJ2A 1GV4A 2I0ZA 4YXDA 1RP0A 1H83A 2F5ZA 3DK8A 2C75A 1JEHA 2APGA 2YAUA 2YR5A 2BYBA 3BNMA 4LIIA 3LZXA 4BK2A 4EQSA 2XVJA 1L0VA 4H2RA 4J57A 3UKHA 2BK3A 3NKSA 1MOKA 3AE3A 1KSSA 1GXFA 3GRTA 4B64A 1N1PA 2V3BA 2WBAA 3DJJA 1B37A 4U8LA 4OPGA 4USQA 1F6MA 1FECA 1XHCA 4AOXA 3IWAA 1RYIA 4GDPA 2EQ6A 3VRDB 2BS3A 2WPFA 3CGEA 1E39A 1IUWA 4JNQA 3RP8A 5JCIA 3AE5A 3F8RA 1JRYA 3QVPA 2R0PA 3UKQA 2GR1A 2EQ9A 4J36A 3COXA 1XPQA 1NHSA 2C76A 3AE1A 1K0IA 1NHRA 4IVMB 3KVEA 4UP3A 2YR4A 1TDFA 3BI5A 1HYUA 2CDUA 4ZCCA 3LB8A 2X50A 3CNPA 2X99A 1H84A 1IUXA 3NGCX 2JB1A 2V5ZA 4EM4A 2B7RA 2BXSA 3AECA 2R4JA 2XLPA 1V59A 2VOUA 4GRTA 4H4RA 1TDNA 1IUTA 1B5QA 3LOVA 4B69A 5BULA 1JOAA 2XLRA 1GSNA 3G5SA 1TRBA 2XLTA 4A6NB 4HB9A 2TMDA 2OALA 4B67A 2AQJA 2PHHA 4JY3A 2J3NA 2C66A 3I3LA 1S3EA 3S5WA 5L46A 1CBOA 4CY6A 1PBDA 3AE8A 2VQBA 3KLJA 3RP7A 1KNRA 1ZDLA 1GRFA 2V3AA 1CC6A 2WS3A 4LA1A 3L1RA 3FPZA 2EQ8A 2A89A 2B7SA 3BHKA 3NK2X 2JBVA 3II4A 4NZHA 2R9ZA 4JY2A 2X8GA 2IVEA 4REKA 1ONFA 3NLCA 2OLOA 5FMHA 4CNKA 4GDEA 3B3RA 4U2TA 3SFEA 1JRZA 2YG3A 1L9EA 1D7YA 4OPDA 4RSLA 4Y4NA 3CGDA 1EL5A 5EBKA 1PBCA 5HYMA 1AOGA 4H2PA 4N9XA 3LXDA 1ZY8A 4JQ9A 4EMIA 1GETA 3ALLA 1MO9A 2YG6A 4Z24A 4AP1A 5U63A 3DK4A 2GVCA 2C72A 1GTHA 1LJ1A 3FBSA 4H2QA 4OPUA 3SM8A 2QCUA 1YQZA 2OLNA 2QA1A 1DJNA 3K7TA 1ZX9A 2JB3A 1GESA 2YM2A 2XVFA 3AE2A 4H7UA 1FL2A 1E1KA 4A6NA 4UDRA 1Q9IA 4BURA 1H6VA 5FS7A 3DGHA 4OPCA 4PAAA 3AD7B 4GF7A 1IUSA 4EMWA 1L9DA 5U25A 2GAHB 3EANA 5GRTA 4YSYA 1PXCA 1D4EA 3AYJA 3RHAA 5BRTA 3FIMB 1MXTA 4DGKA 2GMHA 3DJEA 3EF6A 1BGJA 1H82A 4B65A 4FX9A 2GRTA 2Q0LA 2Q7VA 3M0OA 2FJEA 4A5LA 5KRQA 2ZZCA 3NK0X 4XWZA 2XDOA 4IA6A 4B63A 1B8SA 3KPFA 1PXBA 4ICYA 2YG4A 4TM0A 3AE6A 3H8LA 1E7PA 3IF9A 3GWFA 3VRAA 1TDEA 1ZP0A 1ZOVA 2XLUA 1GNDA 4H2NA 5BVAA 5LV9A 2XCGA 3NTDA 3M13A 5IQ1A 4X9NA 4ZN0A 2RGHA 4NEWA 4KPRA 3IC9A 4CCRA 4YTPA 1E1NA 1O95A 4MJWA 4Z2RA 1GALA 1KFYA 4B66A 3GWDA 4LU6A 2WP9A 4K7ZA 4NTDA 1ZMCA 2C7GA 2CVJA 1DOCA 3UKKA 1YKJA 3GMCA 2X3NA 3NG7X 3P9UA 4J2WA 3UOXA 2YLSA 4JNAA 4B68A 3UOVA 1CJCA 1GERA 1E1LA 1S2QA 3QSSA 1PBEA 1CHUA 4H4XA 2VVLG 2XVIA 4AT2A 2IVDA 3SFDA 4OCGA 3H8IA 3UKPA 3NNEA 1GREA 2XVEA 2YVJA 3JSKA 4O5UA 5GSNA 3UOZA 2H88A 4H4WA 3UP4A 1TDOA 2JK6A 4GCMA 2VQ7A 3I6DA 2BACA 1VG9A 2WQYA 1CC4A 1NHQA 1Z6LA 4EIPA 3E1TA 3PVCA 1N4VA 1Y0PA 3FG2P 3D8XA 1GRGA 3VR8A 3REDA 2C70A 4UDQA 3QFBA 1NAAA 2R0CA 5CQFA 2VVMA 1PXAA 4CNJA 3ITJA 3C96A 2GQFA 1REOA 4K5RA
chains in the Genus database with same CATH superfamily
3K7QX 3NRNA 5DBJA 1K0JA 4U8MA 1B4VA 1QJDA 1VQWA 2YQUA 2ZBWA 1FEAA 3OC4A 4OPLA 2GH5A 3RNMA 5KVHA 2GQWA 5CKUA 1NPXA 5JCLA 3AE4A 3SZFA 1QO8A 2GAGB 4YT0A 4Z26A 1N4WA 3WE0A 4BK3A 4NTEA 1TYTA 1NHPA 5JCKA 3PS9A 3GMBA 3C4NA 3CGBA 2YR6A 4H4PA 4I59A 1Y56A 2YLWA 3AE9A 2HQMA 4BV6A 5TR3A 3VR9A 2BRAA 2Y6RA 2H89A 4EQRA 1OJTA 2WDRA 2XFQA 2WPEA 3BI4A 3UTEA 1CJ3A 1PN0A 3CPIG 4H4VA 2FJAA 2JKCA 5KNLA 4C3YA 1JNZA 1E6EA 3VRBA 2XFPA 3NIXA 3V76A 1VDCA 4B1BA 2V6OA 2XFOA 3NN6X 3AE7A 4Z25A 4DSGA 5M0ZA 2E5VA 2JB2A 3IHGA 2Z5YA 1BF3A 1GRBA 1GRHA 1BZLA 4YKGA 3P4SA 3DGZA 3ICRA 2C67A 5ER0A 4A79A 3UOYA 4G6GA 3GYIA 3LADA 3OZ2A 4U8JA 2WOVA 5KOWA 1KF6A 2WU5A 3AYLA 1ZOYA 3NT6A 1LQTA 4H50A 3CPJG 4J34A 2C64A 1DJQA 4Z2UA 3NTAA 3P4PA 2BXRA 4YWOA 1EL9A 3BI2A 3VQRA 1H86A 2C73A 3GD3A 1FCDA 1F3PA 3KU9A 1D4CA 3M12A 1BWCA 3R9UA 3KD9A 2EQ7A 1NG3A 3CNTA 3CTYA 4U8IA 1EL7A 2ARDA 3GSIA 1GEUA 2BC0A 3UKAA 3GYJA 1JRXA 2UZZA 2WP5A 3ATQA 2GB0A 2V60A 3AXBA 3F8PA 3NHOX 4GR1A 2RGJA 3CPHG 4TLZA 3QSMA 3UP5A 2XVHA 2GR2A 4H4YA 1OJAA 1PJ7A 3GYXA 3ZDNA 4G6HA 2XYOA 3NYEA 4FK1C 3UTGA 4CY8A 3DMEA 1O5WA 4D04A 4DSHA 4TLXA 2ACZA 3H4KA 2GMJA 2CULA 4APNA 3AYIA 1Q1RA 2Q6UA 3FMWA 4OVIA 1YY5A 3RP6A 3G5RA 2BRYA 1IUVA 3CNSA 3ZYXA 2NVKX 1F8WA 2YLRA 2WESA 4A7AA 4ADWA 5JCNA 1NG4A 3SQPA 4YSXA 4XXGA 2YG5A 4K5SA 1F8RA 4YSHA 1E1MA 1RSGA 4BK1A 1FEBA 3ISHA 1GT8A 5BUKA 1L9CA 2YLXA 1OJDA 3V3NA 2JAEA 1S2YA 4JN9A 1GTEA 4U8NA 2XLSA 4TM4A 2RGOA 2BC1A 3T31A 1H7WA 1PJ6A 3EPTA 4A65A 1PDHA 4U8KA 4H4QA 4A9WA 3AEEA 3AB1A 2YWLA 1LQUA 3HYVA 2Y6QA 2VRLA 1ZKQA 1LV0A 4C5OA 2WEUA 3ALMA 4K8DA 3S61A 1GOSA 1OJCA 1JU2A 2BCGG 2BA9A 2RABA 3G5QA 5M10A 4USRA 1LVLA 2YM1A 1GRTA 2OA1A 1OJ9A 3SYIA 1P2EA 3NYCA 4X4JA 1PS9A 4X9MA 4J33A 1COYA 4WX1A 4OPTA 3T0KA 4EIQA 3NYFA 1DODA 3GDPA 1M64A 4K2XA 3B6DA 3UKLA 4G9KA 3DJDA 1TDKA 4EQWA 3SZCA 4XWRA 2WOWA 1CF3A 4H4UA 4G73A 2VVLA 4GUVA 1VG0A 2ZZ0A 2VZ2A 4K22A 1DNCA 4KX6A 2IIDA 4FK1A 2XFNA 4UDPA 4EM3A 3PO7A 2B76A 3ATRA 4H4TA 1DOBA 4NTCA 2WHDA 1H7XA 2R45A 3V3OA 1D4DA 4NEVA 2OAMA 1BKWA 3EAOA 3O0HA 3UCLA 3AEAA 3KKJA 1CJ4A 4BJYA 1NEKA 2Q0KA 2FJBA 3DA1A 2FJDA 1PJ5A 3ICTA 4A99A 4U8PA 2E4GA 4DNAA 4Z44A 2R4EA 1QLBA 4NNJA 3T2YA 2W0HA 3LJPA 3DJGX 5EB4A 1S3BA 3C4AA 4CCQA 2GV8A 1O94A 2YLTA 4EQXA 2YVGA 4H4ZA 3ICSA 5KMQA 2A87A 3NK1X 4AP3A 1N4UA 2CFYA 4PABA 5EOWA 4I58A 2R0GA 4IA5A 1YQ3A 4C3XA 1PBBA 3AEDA 3AEGA 3AD9B 4JDRA 1CL0A 5HXIA 5KXJA 1PHHA 4AOSA 5HY5A 1ZK7A 2PYXA 2GEWA 5C2TA 3GRSA 2YLZA 1EL8A 1GPEA 4D03A 4O5QA 2WETA 1YQ4A 3SZ0A 3UTFA 2C65A 1ZMDA 3BNUA 3CNJA 3T14A 3CGCA 4U2SA 2AR8A 1D7LA 3GD4A 4C77A 4FDCB 2Z5XA 5J7XA 2GR3A 4J31A 3L8KA 4P9SA 4IVOB 4RG4A 1XANA 2BS4A 3HZLA 1FOHA 1K0LA 3KA7A 1UKVG 2QA2A 4Z2TA 3D1CA 2C4CA 2YG7A 2BCPA 2WDVA 2B9XA 2VRMA 4Y4LA 2O9ZA 1KDGA 2C3DA 5FS6A 1NDAA 2E1MA 5KMRA 2WDQA 3T2KA 2X8HA 1CC2A 3CNDA 1X31B 5KVIA 1NENA 1GRAA 1W4XA 3URHA 2NPXA 4RG3A 1PBFA 1H81A 5U1OA 4YKFA 3ADAB 3SGLA 4YTNA 3ALJA 3DH9A 2WP6A 3QFAA 4Y4MA 4YSZA 1Q1WA 2DKIA 1BGNA 4J56A 1M6IA 4Z43A 5KWFA 3DK9A 4II3A 5JCMA 3SXIA 4TM3A 4WCTA 1D5TA 2B9WA 1TYPA 2WU2A 4TM1A 2YVFA 3P4RA 4G74A 1JNRA 3KPKA 3GDNA 1P2HA 1K4QA 4H4SA 1LPFA 4IV9A 3QSEA 2FBWA 2BABA 5IPYA 2B9YA 3QVRA 4EMJA 3F8DA 5FS9A 5IQ4A 4U8OA 2WPCA 5C3JA 3P1WA 4U2LA 2ZZBA 3ABVA 2WOIA 4HA6A 2XFUA 3NH3X 4ZCDA 2A8XA 2C3CA 2BK4A 2R46A 3IHMA 3LZWA 3UTHA 4M52A 1KNPA 1ELIA 3BHFA 5FS8A 2TPRA 4AT0A 4C74A 4ECHA 2BS2A 3AWIA 3P4QA 4YTMA 4CBQA 5EB5A 1IUUA 1F8SA 2X8CA 3T37A 3K30A 5HHFA 4BJZA 1LTXR 2QAEA 3AEFA 1DOEA 1IJHA 3AD8B 3Q6JA 2V61A 3CN8A 3K7MX 1XDIA 2AAQA 3QJ4A 1VRQB 5J60A 3NN0X 4OPIA 5KOXA 1DXLA 3AEBA 2BK5A 2DKHA 3CIRA 4CRTA 3Q9TA 2GF3A 1Y56B 3UKFA 2GR0A 1SEZA 1EBDA 4E0VA 1KSUA 1CJ2A 1GV4A 2I0ZA 4YXDA 1RP0A 1H83A 2F5ZA 3DK8A 2C75A 1JEHA 2APGA 2YAUA 2YR5A 2BYBA 3BNMA 4LIIA 3LZXA 4BK2A 4EQSA 2XVJA 1L0VA 4H2RA 4J57A 3UKHA 2BK3A 3NKSA 1MOKA 3HYXA 3AE3A 1KSSA 1GXFA 3GRTA 4B64A 1N1PA 2V3BA 2WBAA 3DJJA 1B37A 4U8LA 4OPGA 4USQA 1F6MA 1FECA 1XHCA 4AOXA 3IWAA 1RYIA 4GDPA 4NWZA 2EQ6A 3VRDB 2BS3A 2WPFA 3CGEA 1E39A 1IUWA 4JNQA 3RP8A 5JCIA 3AE5A 3F8RA 1JRYA 3QVPA 4II2A 2R0PA 3UKQA 2GR1A 2EQ9A 4J36A 3COXA 1XPQA 1NHSA 2C76A 3AE1A 1K0IA 1NHRA 4IVMB 3KVEA 4UP3A 2YR4A 1TDFA 3BI5A 1HYUA 2CDUA 4ZCCA 3LB8A 2X50A 3CNPA 2X99A 1H84A 1IUXA 3NGCX 2JB1A 2V5ZA 4EM4A 2B7RA 2BXSA 5KMSA 3AECA 2R4JA 2XLPA 1V59A 2VOUA 4GRTA 4H4RA 1TDNA 5KMPA 1IUTA 3T2ZA 1B5QA 3LOVA 4B69A 5BULA 1JOAA 2XLRA 1GSNA 3G5SA 1TRBA 2XLTA 4A6NB 4HB9A 2TMDA 2OALA 4B67A 2AQJA 3SZWA 2PHHA 4JY3A 2J3NA 2C66A 3I3LA 1S3EA 3S5WA 5L46A 1CBOA 4CY6A 1PBDA 3AE8A 2VQBA 3KLJA 3RP7A 1KNRA 1ZDLA 1GRFA 2V3AA 1CC6A 2WS3A 4LA1A 3L1RA 3FPZA 2EQ8A 2A89A 2B7SA 3BHKA 3NK2X 2JBVA 3II4A 4NZHA 2R9ZA 4JY2A 3SY4A 2X8GA 2IVEA 4REKA 1ONFA 3NLCA 2OLOA 5FMHA 4CNKA 4GDEA 3B3RA 4U2TA 3SFEA 1JRZA 2YG3A 1L9EA 1D7YA 4OPDA 4RSLA 4Y4NA 3CGDA 3CMMA 1EL5A 5EBKA 1PBCA 5HYMA 1AOGA 4H2PA 4N9XA 3LXDA 1ZY8A 4JQ9A 4EMIA 1GETA 3ALLA 1MO9A 2YG6A 4Z24A 4AP1A 5U63A 3DK4A 2GVCA 2C72A 1GTHA 1LJ1A 3FBSA 4H2QA 4OPUA 3SM8A 2QCUA 1YQZA 2OLNA 2QA1A 1DJNA 3K7TA 1ZX9A 2JB3A 1GESA 2YM2A 2XVFA 3AE2A 4H7UA 1FL2A 1E1KA 4A6NA 4UDRA 1Q9IA 4BURA 1H6VA 5FS7A 3DGHA 4OPCA 4PAAA 3AD7B 4GF7A 1IUSA 4EMWA 1L9DA 5U25A 2GAHB 3EANA 5GRTA 4YSYA 1PXCA 1D4EA 3AYJA 3RHAA 5BRTA 3FIMB 1MXTA 4DGKA 2GMHA 3DJEA 3EF6A 1BGJA 1H82A 4B65A 4FX9A 2GRTA 2Q0LA 2Q7VA 3M0OA 2FJEA 4A5LA 5KRQA 2ZZCA 3NK0X 4XWZA 2XDOA 4IA6A 4B63A 1B8SA 3KPFA 1PXBA 4ICYA 2YG4A 4TM0A 3AE6A 3H8LA 1E7PA 3IF9A 3GWFA 3VRAA 1TDEA 1ZP0A 1ZOVA 2XLUA 1GNDA 4H2NA 5BVAA 5LV9A 2XCGA 3NTDA 3M13A 5IQ1A 4X9NA 4ZN0A 2RGHA 4NEWA 4KPRA 3IC9A 4CCRA 4YTPA 1E1NA 4MJWA 1O95A 4GAPA 4Z2RA 1GALA 1KFYA 4B66A 3GWDA 4LU6A 2WP9A 4K7ZA 4NTDA 1ZMCA 2C7GA 2CVJA 1DOCA 3UKKA 1YKJA 3GMCA 2X3NA 3NG7X 3P9UA 4J2WA 3UOXA 2YLSA 4JNAA 4B68A 3UOVA 1CJCA 1GERA 1E1LA 1S2QA 3QSSA 1PBEA 3HYWA 1CHUA 4H4XA 3SX6A 2VVLG 2XVIA 4AT2A 2IVDA 3SFDA 4OCGA 3H8IA 3UKPA 3NNEA 1GREA 2XVEA 2YVJA 3JSKA 4O5UA 5GSNA 3UOZA 2H88A 4H4WA 3UP4A 1TDOA 2JK6A 4GCMA 2VQ7A 3I6DA 2BACA 1VG9A 2WQYA 1CC4A 1NHQA 1Z6LA 4GAVA 4EIPA 3E1TA 3PVCA 1N4VA 1Y0PA 3FG2P 3D8XA 1GRGA 3VR8A 3REDA 2C70A 4UDQA 3QFBA 1NAAA 2R0CA 5CQFA 2VVMA 1PXAA 4CNJA 3ITJA 3C96A 2GQFA 1REOA 4K5RA
chains in the Genus database with same CATH topology
3K7QX 3NRNA 5DBJA 1K0JA 4U8MA 1B4VA 1QJDA 1VQWA 2YQUA 2ZBWA 1FEAA 3OC4A 4OPLA 2GH5A 3RNMA 5KVHA 2GQWA 5CKUA 1NPXA 5JCLA 3AE4A 3SZFA 1QO8A 2GAGB 4YT0A 4Z26A 1N4WA 3WE0A 4BK3A 4NTEA 1TYTA 1NHPA 5JCKA 3PS9A 3GMBA 3C4NA 3CGBA 2YR6A 4H4PA 4I59A 1Y56A 2YLWA 3AE9A 2HQMA 4BV6A 5TR3A 3VR9A 2BRAA 2Y6RA 2H89A 4EQRA 1OJTA 2WDRA 2XFQA 2WPEA 3BI4A 3UTEA 1CJ3A 1PN0A 3CPIG 4H4VA 2FJAA 2JKCA 5KNLA 4C3YA 1JNZA 1E6EA 3VRBA 2XFPA 3NIXA 3V76A 1VDCA 4B1BA 2V6OA 2XFOA 3NN6X 3AE7A 4Z25A 4DSGA 5M0ZA 2E5VA 2JB2A 3IHGA 2Z5YA 1BF3A 1GRBA 1GRHA 1BZLA 4YKGA 3P4SA 3DGZA 3ICRA 2C67A 5ER0A 4A79A 3UOYA 4G6GA 3GYIA 3LADA 3OZ2A 4U8JA 2WOVA 5KOWA 1KF6A 2WU5A 3AYLA 1ZOYA 3NT6A 1LQTA 4H50A 3CPJG 4J34A 2C64A 1DJQA 4Z2UA 3NTAA 3P4PA 2BXRA 4YWOA 1EL9A 3BI2A 3VQRA 1H86A 2C73A 3GD3A 1FCDA 1F3PA 3KU9A 1D4CA 3M12A 1BWCA 3R9UA 3KD9A 2EQ7A 1NG3A 3CNTA 3CTYA 4U8IA 1EL7A 2ARDA 3GSIA 1GEUA 2BC0A 3UKAA 3GYJA 1JRXA 2UZZA 2WP5A 3ATQA 2GB0A 2V60A 3AXBA 3F8PA 3NHOX 4GR1A 2RGJA 3CPHG 4TLZA 3QSMA 3UP5A 2XVHA 2GR2A 4H4YA 1OJAA 1PJ7A 3GYXA 3ZDNA 4G6HA 2XYOA 3NYEA 4FK1C 3UTGA 4CY8A 3DMEA 1O5WA 4D04A 4DSHA 4TLXA 2ACZA 3H4KA 2GMJA 2CULA 4APNA 3AYIA 1Q1RA 2Q6UA 3FMWA 4OVIA 1YY5A 3RP6A 3G5RA 2BRYA 1IUVA 3CNSA 3ZYXA 2NVKX 1F8WA 2YLRA 2WESA 4A7AA 4ADWA 5JCNA 1NG4A 3SQPA 4YSXA 4XXGA 2YG5A 4K5SA 1F8RA 4YSHA 1E1MA 1RSGA 4BK1A 1FEBA 3ISHA 1GT8A 5BUKA 1L9CA 2YLXA 1OJDA 3V3NA 2JAEA 1S2YA 4JN9A 1GTEA 4U8NA 2XLSA 4TM4A 2RGOA 2BC1A 3T31A 1H7WA 1PJ6A 3EPTA 4A65A 1PDHA 4U8KA 4H4QA 4A9WA 3AEEA 3AB1A 2YWLA 1LQUA 3HYVA 2Y6QA 2VRLA 1ZKQA 1LV0A 4C5OA 2WEUA 3ALMA 4K8DA 3S61A 1GOSA 1OJCA 1JU2A 2BCGG 2BA9A 2RABA 3G5QA 5M10A 4USRA 1LVLA 2YM1A 1GRTA 2OA1A 1OJ9A 3SYIA 1P2EA 3NYCA 4X4JA 1PS9A 4X9MA 4J33A 1COYA 4WX1A 4OPTA 3T0KA 4EIQA 3NYFA 1DODA 3GDPA 1M64A 4K2XA 3B6DA 3UKLA 4G9KA 3DJDA 1TDKA 4EQWA 3SZCA 4XWRA 2WOWA 1CF3A 4H4UA 4G73A 2VVLA 4GUVA 1VG0A 2ZZ0A 2VZ2A 4K22A 1DNCA 4KX6A 2IIDA 4FK1A 2XFNA 4UDPA 4EM3A 3PO7A 2B76A 3ATRA 4H4TA 1DOBA 4NTCA 2WHDA 1H7XA 2R45A 3V3OA 1D4DA 4NEVA 2OAMA 1BKWA 3EAOA 3O0HA 3UCLA 3AEAA 3KKJA 1CJ4A 4BJYA 1NEKA 2Q0KA 2FJBA 3DA1A 2FJDA 1PJ5A 3ICTA 4A99A 4U8PA 2E4GA 4DNAA 4Z44A 2R4EA 1QLBA 4NNJA 3T2YA 2W0HA 3LJPA 3DJGX 5EB4A 1S3BA 3C4AA 4CCQA 2GV8A 1O94A 2YLTA 4EQXA 2YVGA 4H4ZA 3ICSA 5KMQA 2A87A 3NK1X 4AP3A 1N4UA 2CFYA 4PABA 5EOWA 4I58A 2R0GA 4IA5A 1YQ3A 4C3XA 1PBBA 3AEDA 3AEGA 3AD9B 4JDRA 1CL0A 5HXIA 5KXJA 1PHHA 4AOSA 5HY5A 1ZK7A 2PYXA 2GEWA 5C2TA 3GRSA 2YLZA 1EL8A 1GPEA 4D03A 4O5QA 2WETA 1YQ4A 3SZ0A 3UTFA 2C65A 1ZMDA 3BNUA 3CNJA 3T14A 3CGCA 4U2SA 2AR8A 1D7LA 3GD4A 4C77A 4FDCB 2Z5XA 5J7XA 2GR3A 4J31A 3L8KA 4P9SA 4IVOB 4RG4A 1XANA 2BS4A 3HZLA 1FOHA 1K0LA 3KA7A 1UKVG 2QA2A 4Z2TA 3D1CA 2C4CA 2YG7A 2BCPA 2WDVA 2B9XA 2VRMA 4Y4LA 2O9ZA 1KDGA 2C3DA 5FS6A 1NDAA 2E1MA 5KMRA 2WDQA 3T2KA 2X8HA 1CC2A 3CNDA 1X31B 5KVIA 1NENA 1GRAA 1W4XA 3URHA 2NPXA 4RG3A 1PBFA 1H81A 5U1OA 4YKFA 3ADAB 3SGLA 4YTNA 3ALJA 3DH9A 2WP6A 3QFAA 4Y4MA 4YSZA 1Q1WA 2DKIA 1BGNA 4J56A 1M6IA 4Z43A 5KWFA 3DK9A 4II3A 5JCMA 3SXIA 4TM3A 4WCTA 1D5TA 2B9WA 1TYPA 2WU2A 4TM1A 2YVFA 3P4RA 4G74A 1JNRA 3KPKA 3GDNA 1P2HA 1K4QA 4H4SA 1LPFA 4IV9A 3QSEA 2FBWA 2BABA 5IPYA 2B9YA 3QVRA 4EMJA 3F8DA 5FS9A 5IQ4A 4U8OA 2WPCA 5C3JA 3P1WA 4U2LA 2ZZBA 3ABVA 2WOIA 4HA6A 2XFUA 3NH3X 4ZCDA 2A8XA 2C3CA 2BK4A 2R46A 3IHMA 3LZWA 3UTHA 4M52A 1KNPA 1ELIA 3BHFA 5FS8A 2TPRA 4AT0A 4C74A 4ECHA 2BS2A 3AWIA 3P4QA 4YTMA 4CBQA 5EB5A 1IUUA 1F8SA 2X8CA 3T37A 3K30A 5HHFA 4BJZA 1LTXR 2QAEA 3AEFA 1DOEA 1IJHA 3AD8B 3Q6JA 2V61A 3CN8A 3K7MX 1XDIA 2AAQA 3QJ4A 1VRQB 5J60A 3NN0X 4OPIA 5KOXA 1DXLA 3AEBA 2BK5A 2DKHA 3CIRA 4CRTA 3Q9TA 2GF3A 1Y56B 3UKFA 2GR0A 1SEZA 1EBDA 4E0VA 1KSUA 1CJ2A 1GV4A 2I0ZA 4YXDA 1RP0A 1H83A 2F5ZA 3DK8A 2C75A 1JEHA 2APGA 2YAUA 2YR5A 2BYBA 3BNMA 4LIIA 3LZXA 4BK2A 4EQSA 2XVJA 1L0VA 4H2RA 4J57A 3UKHA 2BK3A 3NKSA 1MOKA 3HYXA 3AE3A 1KSSA 1GXFA 3GRTA 4B64A 1N1PA 2V3BA 2WBAA 3DJJA 1B37A 4U8LA 4OPGA 4USQA 1F6MA 1FECA 1XHCA 4AOXA 3IWAA 1RYIA 4GDPA 4NWZA 2EQ6A 3VRDB 2BS3A 2WPFA 3CGEA 1E39A 1IUWA 4JNQA 3RP8A 5JCIA 3AE5A 3F8RA 1JRYA 3QVPA 4II2A 2R0PA 3UKQA 2GR1A 2EQ9A 4J36A 3COXA 1XPQA 1NHSA 2C76A 3AE1A 1K0IA 1NHRA 4IVMB 3KVEA 4UP3A 2YR4A 1TDFA 3BI5A 1HYUA 2CDUA 4ZCCA 3LB8A 2X50A 3CNPA 2X99A 1H84A 1IUXA 3NGCX 2JB1A 2V5ZA 4EM4A 2B7RA 2BXSA 5KMSA 3AECA 2R4JA 2XLPA 1V59A 2VOUA 4GRTA 4H4RA 1TDNA 5KMPA 1IUTA 3T2ZA 1B5QA 3LOVA 4B69A 5BULA 1JOAA 2XLRA 1GSNA 3G5SA 1TRBA 2XLTA 4A6NB 4HB9A 2TMDA 2OALA 4B67A 2AQJA 3SZWA 2PHHA 4JY3A 2J3NA 2C66A 3I3LA 1S3EA 3S5WA 5L46A 1CBOA 4CY6A 1PBDA 3AE8A 2VQBA 3KLJA 3RP7A 1KNRA 1ZDLA 1GRFA 2V3AA 1CC6A 2WS3A 4LA1A 3L1RA 3FPZA 2EQ8A 2A89A 2B7SA 3BHKA 3NK2X 2JBVA 3II4A 4NZHA 2R9ZA 4JY2A 3SY4A 2X8GA 2IVEA 4REKA 1ONFA 3NLCA 2OLOA 5FMHA 4CNKA 4GDEA 3B3RA 4U2TA 3SFEA 1JRZA 2YG3A 1L9EA 1D7YA 4OPDA 4RSLA 4Y4NA 3CGDA 3CMMA 1EL5A 5EBKA 1PBCA 5HYMA 1AOGA 4H2PA 4N9XA 3LXDA 1ZY8A 4JQ9A 4EMIA 1GETA 3ALLA 1MO9A 2YG6A 4Z24A 4AP1A 5U63A 3DK4A 2GVCA 2C72A 1GTHA 1LJ1A 3FBSA 4H2QA 4OPUA 3SM8A 2QCUA 1YQZA 2OLNA 2QA1A 1DJNA 3K7TA 1ZX9A 2JB3A 1GESA 2YM2A 2XVFA 3AE2A 4H7UA 1FL2A 1E1KA 4A6NA 4UDRA 1Q9IA 4BURA 1H6VA 5FS7A 3DGHA 4OPCA 4PAAA 3AD7B 4GF7A 1IUSA 4EMWA 1L9DA 5U25A 2GAHB 3EANA 5GRTA 4YSYA 1PXCA 1D4EA 3AYJA 3RHAA 5BRTA 3FIMB 1MXTA 4DGKA 2GMHA 3DJEA 3EF6A 1BGJA 1H82A 4B65A 4FX9A 2GRTA 2Q0LA 2Q7VA 3M0OA 2FJEA 4A5LA 5KRQA 2ZZCA 3NK0X 4XWZA 2XDOA 4IA6A 4B63A 1B8SA 3KPFA 1PXBA 4ICYA 2YG4A 4TM0A 3AE6A 3H8LA 1E7PA 3IF9A 3GWFA 3VRAA 1TDEA 1ZP0A 1ZOVA 2XLUA 1GNDA 4H2NA 5BVAA 5LV9A 2XCGA 3NTDA 3M13A 5IQ1A 4X9NA 4ZN0A 2RGHA 4NEWA 4KPRA 3IC9A 4CCRA 4YTPA 1E1NA 4MJWA 1O95A 4GAPA 4Z2RA 1GALA 1KFYA 4B66A 3GWDA 4LU6A 2WP9A 4K7ZA 4NTDA 1ZMCA 2C7GA 2CVJA 1DOCA 3UKKA 1YKJA 3GMCA 2X3NA 3NG7X 3P9UA 4J2WA 3UOXA 2YLSA 4JNAA 4B68A 3UOVA 1CJCA 1GERA 1E1LA 1S2QA 3QSSA 1PBEA 3HYWA 1CHUA 4H4XA 3SX6A 2VVLG 2XVIA 4AT2A 2IVDA 3SFDA 4OCGA 3H8IA 3UKPA 3NNEA 1GREA 2XVEA 2YVJA 3JSKA 4O5UA 5GSNA 3UOZA 2H88A 4H4WA 3UP4A 1TDOA 2JK6A 4GCMA 2VQ7A 3I6DA 2BACA 1VG9A 2WQYA 1CC4A 1NHQA 1Z6LA 4GAVA 4EIPA 3E1TA 3PVCA 1N4VA 1Y0PA 3FG2P 3D8XA 1GRGA 3VR8A 3REDA 2C70A 4UDQA 3QFBA 1NAAA 2R0CA 5CQFA 2VVMA 1PXAA 4CNJA 3ITJA 3C96A 2GQFA 1REOA 4K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7Q X;  3NRN A;  5DBJ A;  1K0J A;  4U8M A;  1B4V A;  1QJD A;  1VQW A;  2YQU A;  2ZBW A;  1FEA A;  3OC4 A;  4OPL A;  2GH5 A;  3RNM A;  5KVH A;  2GQW A;  5CKU A;  1NPX A;  5JCL A;  3AE4 A;  1QO8 A;  2GAG B;  4YT0 A;  4Z26 A;  1N4W A;  3WE0 A;  4BK3 A;  4NTE A;  1TYT A;  1NHP A;  5JCK A;  3PS9 A;  3GMB A;  3C4N A;  3CGB A;  2YR6 A;  4H4P A;  4I59 A;  1Y56 A;  2YLW A;  3AE9 A;  2HQM A;  4BV6 A;  5TR3 A;  3VR9 A;  2Y6R A;  2H89 A;  4EQR A;  1OJT A;  2WDR A;  2XFQ A;  2WPE A;  3BI4 A;  3UTE A;  1CJ3 A;  1PN0 A;  3CPI G;  4H4V A;  2FJA A;  2JKC A;  4C3Y A;  1JNZ A;  1E6E A;  3VRB A;  2XFP A;  3NIX A;  3V76 A;  1VDC A;  4B1B A;  2V6O A;  2XFO A;  3NN6 X;  3AE7 A;  4Z25 A;  4DSG A;  5M0Z A;  2E5V A;  2JB2 A;  3IHG A;  2Z5Y A;  1BF3 A;  1GRB A;  1GRH A;  1BZL A;  4YKG A;  3P4S A;  3DGZ A;  3ICR A;  2C67 A;  5ER0 A;  4A79 A;  3UOY A;  3GYI A;  3LAD A;  3OZ2 A;  4U8J A;  2WOV A;  5KOW A;  1KF6 A;  2WU5 A;  3AYL A;  1ZOY A;  3NT6 A;  1LQT A;  4H50 A;  3CPJ G;  4J34 A;  2C64 A;  1DJQ A;  4Z2U A;  3NTA A;  3P4P A;  2BXR A;  4YWO A;  1EL9 A;  3BI2 A;  3VQR A;  1H86 A;  2C73 A;  3GD3 A;  1FCD A;  1F3P A;  3KU9 A;  1D4C A;  3M12 A;  1BWC A;  3R9U A;  3KD9 A;  2EQ7 A;  1NG3 A;  3CNT A;  3CTY A;  4U8I A;  1EL7 A;  2ARD A;  3GSI A;  1GEU A;  2BC0 A;  3UKA A;  3GYJ A;  1JRX A;  2UZZ A;  2WP5 A;  3ATQ A;  2GB0 A;  2V60 A;  3AXB A;  3F8P A;  3NHO X;  4GR1 A;  2RGJ A;  3CPH G;  4TLZ A;  3QSM A;  3UP5 A;  2XVH A;  2GR2 A;  4H4Y A;  1OJA A;  1PJ7 A;  3ZDN A;  4DSH A;  2XYO A;  3NYE A;  4FK1 C;  3UTG A;  4CY8 A;  3DME A;  1O5W A;  4D04 A;  4TLX A;  2ACZ A;  3H4K A;  2GMJ A;  2CUL A;  4APN A;  3AYI A;  1Q1R A;  2Q6U A;  3FMW A;  4OVI A;  1YY5 A;  3RP6 A;  3G5R A;  1IUV A;  3CNS A;  3ZYX A;  2NVK X;  1F8W A;  2YLR A;  2WES A;  4A7A A;  4ADW A;  5JCN A;  1NG4 A;  3SQP A;  4YSX A;  4XXG A;  2YG5 A;  4K5S A;  1F8R A;  4YSH A;  1E1M A;  1RSG A;  4BK1 A;  1FEB A;  3ISH A;  1GT8 A;  5BUK A;  1L9C A;  2YLX A;  1OJD A;  3V3N A;  2JAE A;  1S2Y A;  4JN9 A;  1GTE A;  4U8N A;  2XLS A;  4TM4 A;  2RGO A;  2BC1 A;  1H7W A;  1PJ6 A;  3EPT A;  4A65 A;  1PDH A;  4U8K A;  4H4Q A;  4A9W A;  3AEE A;  3AB1 A;  2YWL A;  1LQU A;  2Y6Q A;  2VRL A;  1ZKQ A;  1LV0 A;  4C5O A;  2WEU A;  3ALM A;  4K8D A;  3S61 A;  1GOS A;  1OJC A;  1JU2 A;  2BCG G;  2BA9 A;  2RAB A;  3G5Q A;  5M10 A;  4USR A;  1LVL A;  2YM1 A;  1GRT A;  2OA1 A;  1OJ9 A;  1P2E A;  3NYC A;  4X4J A;  1PS9 A;  4X9M A;  4J33 A;  1COY A;  4WX1 A;  4OPT A;  4EIQ A;  3NYF A;  1DOD A;  1M64 A;  3GDP A;  4K2X A;  3B6D A;  3UKL A;  3DJD A;  1TDK A;  4EQW A;  4XWR A;  2WOW A;  1CF3 A;  4H4U A;  4GUV A;  2VVL A;  1VG0 A;  2ZZ0 A;  2VZ2 A;  4K22 A;  1DNC A;  4KX6 A;  2IID A;  4FK1 A;  2XFN A;  4UDP A;  4EM3 A;  3PO7 A;  2B76 A;  3ATR A;  4H4T A;  1DOB A;  4NTC A;  2WHD A;  1H7X A;  2R45 A;  3V3O A;  1D4D A;  4NEV A;  2OAM A;  1BKW A;  3EAO A;  3O0H A;  3UCL A;  3AEA A;  3KKJ A;  1CJ4 A;  4BJY A;  1NEK A;  2Q0K A;  2FJB A;  3DA1 A;  2FJD A;  1PJ5 A;  3ICT A;  4A99 A;  4U8P A;  2E4G A;  4DNA A;  4Z44 A;  2R4E A;  1QLB A;  2W0H A;  3LJP A;  3DJG X;  3C4A A;  1S3B A;  5EB4 A;  4CCQ A;  2GV8 A;  1O94 A;  2YLT A;  4EQX A;  2YVG A;  4H4Z A;  3ICS A;  2A87 A;  3NK1 X;  4AP3 A;  1N4U A;  2CFY A;  4PAB A;  5EOW A;  4I58 A;  2R0G A;  4IA5 A;  1YQ3 A;  4C3X A;  1PBB A;  3AED A;  3AEG A;  3AD9 B;  4JDR A;  1CL0 A;  5HXI A;  5KXJ A;  1PHH A;  4AOS A;  5HY5 A;  1ZK7 A;  2PYX A;  2GEW A;  5C2T A;  3GRS A;  2YLZ A;  1EL8 A;  1GPE A;  4D03 A;  4O5Q A;  2WET A;  1YQ4 A;  3UTF A;  2C65 A;  1ZMD A;  3BNU A;  3CNJ A;  3CGC A;  4U2S A;  2AR8 A;  1D7L A;  3GD4 A;  4C77 A;  4FDC B;  2Z5X A;  5J7X A;  2GR3 A;  4J31 A;  3L8K A;  4P9S A;  4IVO B;  4RG4 A;  1XAN A;  2BS4 A;  3HZL A;  1FOH A;  1K0L A;  3KA7 A;  1UKV G;  2QA2 A;  4Z2T A;  3D1C A;  4Y4L A;  2YG7 A;  2BCP A;  2WDV A;  2B9X A;  2VRM A;  2O9Z A;  1KDG A;  2C3D A;  5FS6 A;  1NDA A;  2E1M A;  2WDQ A;  2X8H A;  1CC2 A;  3CND A;  1X31 B;  5KVI A;  1NEN A;  1GRA A;  1W4X A;  3URH A;  2NPX A;  4RG3 A;  1PBF A;  1H81 A;  5U1O A;  4YKF A;  3ADA B;  3SGL A;  4YTN A;  3ALJ A;  3DH9 A;  2WP6 A;  3QFA A;  4Y4M A;  4YSZ A;  1Q1W A;  2DKI A;  1BGN A;  4J56 A;  1M6I A;  4Z43 A;  5KWF A;  3DK9 A;  5JCM A;  4TM3 A;  4WCT A;  1D5T A;  2B9W A;  1TYP A;  2WU2 A;  4TM1 A;  2YVF A;  3P4R A;  1JNR A;  3GDN A;  1P2H A;  1K4Q A;  4H4S A;  1LPF A;  4IV9 A;  3QSE A;  2FBW A;  2BAB A;  5IPY A;  2B9Y A;  3QVR A;  4EMJ A;  3F8D A;  5FS9 A;  5IQ4 A;  4U8O A;  2WPC A;  5C3J A;  3P1W A;  4U2L A;  2ZZB A;  3ABV A;  2WOI A;  4HA6 A;  2XFU A;  3NH3 X;  4ZCD A;  2A8X A;  2C3C A;  2BK4 A;  2R46 A;  3IHM A;  3LZW A;  3UTH A;  4M52 A;  1KNP A;  1ELI A;  3BHF A;  5FS8 A;  2TPR A;  4AT0 A;  4C74 A;  4ECH A;  2BS2 A;  3AWI A;  3P4Q A;  4YTM A;  4CBQ A;  1F8S A;  1IUU A;  5EB5 A;  2X8C A;  3T37 A;  3K30 A;  5HHF A;  4BJZ A;  1LTX R;  2QAE A;  3AEF A;  1DOE A;  1IJH A;  3AD8 B;  3Q6J A;  2V61 A;  3CN8 A;  3K7M X;  1XDI A;  2AAQ A;  3QJ4 A;  1VRQ B;  5J60 A;  3NN0 X;  4OPI A;  5KOX A;  1DXL A;  3AEB A;  2BK5 A;  2DKH A;  3CIR A;  4CRT A;  3Q9T A;  2GF3 A;  1Y56 B;  3UKF A;  2GR0 A;  1SEZ A;  1EBD A;  4E0V A;  1KSU A;  1CJ2 A;  1GV4 A;  2I0Z A;  4YXD A;  1RP0 A;  1H83 A;  2F5Z A;  3DK8 A;  2C75 A;  1JEH A;  2APG A;  2YAU A;  2YR5 A;  2BYB A;  3BNM A;  4LII A;  3LZX A;  4BK2 A;  4EQS A;  2XVJ A;  1L0V A;  4H2R A;  4J57 A;  3UKH A;  2BK3 A;  3NKS A;  1MOK A;  3AE3 A;  1KSS A;  1GXF A;  3GRT A;  4B64 A;  1N1P A;  2V3B A;  2WBA A;  3DJJ A;  1B37 A;  4U8L A;  4OPG A;  4USQ A;  1F6M A;  1FEC A;  1XHC A;  4AOX A;  3IWA A;  1RYI A;  4GDP A;  2EQ6 A;  3VRD B;  2BS3 A;  2WPF A;  3CGE A;  1E39 A;  1IUW A;  4JNQ A;  3RP8 A;  5JCI A;  3AE5 A;  3F8R A;  1JRY A;  3QVP A;  2R0P A;  3UKQ A;  2GR1 A;  2EQ9 A;  4J36 A;  3COX A;  1XPQ A;  1NHS A;  2C76 A;  3AE1 A;  1K0I A;  1NHR A;  4IVM B;  3KVE A;  4UP3 A;  2YR4 A;  1TDF A;  3BI5 A;  1HYU A;  2CDU A;  4ZCC A;  3LB8 A;  2X50 A;  3CNP A;  2X99 A;  1H84 A;  1IUX A;  3NGC X;  2JB1 A;  2V5Z A;  4EM4 A;  2B7R A;  2BXS A;  3AEC A;  2R4J A;  2XLP A;  1V59 A;  2VOU A;  4GRT A;  4H4R A;  1TDN A;  1IUT A;  1B5Q A;  3LOV A;  4B69 A;  5BUL A;  1JOA A;  2XLR A;  1GSN A;  3G5S A;  1TRB A;  2XLT A;  4A6N B;  4HB9 A;  2TMD A;  2OAL A;  4B67 A;  2AQJ A;  2PHH A;  4JY3 A;  2J3N A;  2C66 A;  3I3L A;  1S3E A;  3S5W A;  5L46 A;  1CBO A;  4CY6 A;  1PBD A;  3AE8 A;  2VQB A;  3KLJ A;  3RP7 A;  1KNR A;  1ZDL A;  1GRF A;  2V3A A;  1CC6 A;  2WS3 A;  4LA1 A;  3L1R A;  3FPZ A;  2EQ8 A;  2A89 A;  2B7S A;  3BHK A;  3NK2 X;  2JBV A;  3II4 A;  4NZH A;  2R9Z A;  4JY2 A;  2X8G A;  2IVE A;  4REK A;  1ONF A;  3NLC A;  2OLO A;  5FMH A;  4CNK A;  4GDE A;  3B3R A;  4U2T A;  3SFE A;  1JRZ A;  2YG3 A;  1L9E A;  1D7Y A;  4OPD A;  4RSL A;  4Y4N A;  3CGD A;  1EL5 A;  5EBK A;  1PBC A;  5HYM A;  1AOG A;  4H2P A;  4N9X A;  3LXD A;  1ZY8 A;  4JQ9 A;  4EMI A;  1GET A;  3ALL A;  1MO9 A;  2YG6 A;  4Z24 A;  4AP1 A;  5U63 A;  3DK4 A;  2GVC A;  2C72 A;  1GTH A;  1LJ1 A;  3FBS A;  4H2Q A;  4OPU A;  3SM8 A;  2QCU A;  1YQZ A;  2OLN A;  2QA1 A;  1DJN A;  3K7T A;  1ZX9 A;  2JB3 A;  1GES A;  2YM2 A;  2XVF A;  3AE2 A;  4H7U A;  1FL2 A;  1E1K A;  4A6N A;  4UDR A;  1Q9I A;  4BUR A;  1H6V A;  5FS7 A;  3DGH A;  4OPC A;  4PAA A;  3AD7 B;  4GF7 A;  1IUS A;  4EMW A;  1L9D A;  5U25 A;  2GAH B;  3EAN A;  5GRT A;  4YSY A;  1PXC A;  1D4E A;  3AYJ A;  3RHA A;  5BRT A;  3FIM B;  1MXT A;  4DGK A;  2GMH A;  3DJE A;  3EF6 A;  1BGJ A;  1H82 A;  4B65 A;  4FX9 A;  2GRT A;  2Q0L A;  2Q7V A;  3M0O A;  2FJE A;  4A5L A;  5KRQ A;  2ZZC A;  3NK0 X;  4XWZ A;  2XDO A;  4IA6 A;  4B63 A;  1B8S A;  3KPF A;  1PXB A;  4ICY A;  2YG4 A;  4TM0 A;  3AE6 A;  3H8L A;  1E7P A;  3IF9 A;  3GWF A;  3VRA A;  1TDE A;  1ZP0 A;  1ZOV A;  2XLU A;  1GND A;  4H2N A;  5BVA A;  5LV9 A;  2XCG A;  3NTD A;  3M13 A;  5IQ1 A;  4X9N A;  4ZN0 A;  2RGH A;  4NEW A;  4KPR A;  3IC9 A;  4CCR A;  4YTP A;  1E1N A;  1O95 A;  4MJW A;  4Z2R A;  1GAL A;  1KFY A;  4B66 A;  3GWD A;  4LU6 A;  2WP9 A;  4K7Z A;  4NTD A;  1ZMC A;  2C7G A;  2CVJ A;  1DOC A;  3UKK A;  1YKJ A;  3GMC A;  2X3N A;  3NG7 X;  3P9U A;  4J2W A;  3UOX A;  2YLS A;  4JNA A;  4B68 A;  3UOV A;  1CJC A;  1GER A;  1E1L A;  1S2Q A;  3QSS A;  1PBE A;  1CHU A;  4H4X A;  2VVL G;  2XVI A;  4AT2 A;  2IVD A;  3SFD A;  4OCG A;  3H8I A;  3UKP A;  3NNE A;  1GRE A;  2XVE A;  2YVJ A;  3JSK A;  4O5U A;  5GSN A;  3UOZ A;  2H88 A;  4H4W A;  3UP4 A;  1TDO A;  2JK6 A;  4GCM A;  2VQ7 A;  3I6D A;  2BAC A;  1VG9 A;  2WQY A;  1CC4 A;  1NHQ A;  1Z6L A;  4EIP A;  3E1T A;  3PVC A;  1N4V A;  1Y0P A;  3FG2 P;  3D8X A;  1GRG A;  3VR8 A;  3RED A;  2C70 A;  4UDQ A;  3QFB A;  1NAA A;  2R0C A;  5CQF A;  2VVM A;  1PXA A;  4CNJ A;  3ITJ A;  3C96 A;  2GQF A;  1REO A;  4K5R A; 
#chains in the Genus database with same CATH topology
 3K7Q X;  3NRN A;  5DBJ A;  1K0J A;  4U8M A;  1B4V A;  1QJD A;  1VQW A;  2YQU A;  2ZBW A;  1FEA A;  3OC4 A;  4OPL A;  2GH5 A;  3RNM A;  5KVH A;  2GQW A;  5CKU A;  1NPX A;  5JCL A;  3AE4 A;  3SZF A;  1QO8 A;  2GAG B;  4YT0 A;  4Z26 A;  1N4W A;  3WE0 A;  4BK3 A;  4NTE A;  1TYT A;  1NHP A;  5JCK A;  3PS9 A;  3GMB A;  3C4N A;  3CGB A;  2YR6 A;  4H4P A;  4I59 A;  1Y56 A;  2YLW A;  3AE9 A;  2HQM A;  4BV6 A;  5TR3 A;  3VR9 A;  2BRA A;  2Y6R A;  2H89 A;  4EQR A;  1OJT A;  2WDR A;  2XFQ A;  2WPE A;  3BI4 A;  3UTE A;  1CJ3 A;  1PN0 A;  3CPI G;  4H4V A;  2FJA A;  2JKC A;  5KNL A;  4C3Y A;  1JNZ A;  1E6E A;  3VRB A;  2XFP A;  3NIX A;  3V76 A;  1VDC A;  4B1B A;  2V6O A;  2XFO A;  3NN6 X;  3AE7 A;  4Z25 A;  4DSG A;  5M0Z A;  2E5V A;  2JB2 A;  3IHG A;  2Z5Y A;  1BF3 A;  1GRB A;  1GRH A;  1BZL A;  4YKG A;  3P4S A;  3DGZ A;  3ICR A;  2C67 A;  5ER0 A;  4A79 A;  3UOY A;  4G6G A;  3GYI A;  3LAD A;  3OZ2 A;  4U8J A;  2WOV A;  5KOW A;  1KF6 A;  2WU5 A;  3AYL A;  1ZOY A;  3NT6 A;  1LQT A;  4H50 A;  3CPJ G;  4J34 A;  2C64 A;  1DJQ A;  4Z2U A;  3NTA A;  3P4P A;  2BXR A;  4YWO A;  1EL9 A;  3BI2 A;  3VQR A;  1H86 A;  2C73 A;  3GD3 A;  1FCD A;  1F3P A;  3KU9 A;  1D4C A;  3M12 A;  1BWC A;  3R9U A;  3KD9 A;  2EQ7 A;  1NG3 A;  3CNT A;  3CTY A;  4U8I A;  1EL7 A;  2ARD A;  3GSI A;  1GEU A;  2BC0 A;  3UKA A;  3GYJ A;  1JRX A;  2UZZ A;  2WP5 A;  3ATQ A;  2GB0 A;  2V60 A;  3AXB A;  3F8P A;  3NHO X;  4GR1 A;  2RGJ A;  3CPH G;  4TLZ A;  3QSM A;  3UP5 A;  2XVH A;  2GR2 A;  4H4Y A;  1OJA A;  1PJ7 A;  3GYX A;  3ZDN A;  4G6H A;  2XYO A;  3NYE A;  4FK1 C;  3UTG A;  4CY8 A;  3DME A;  1O5W A;  4D04 A;  4DSH A;  4TLX A;  2ACZ A;  3H4K A;  2GMJ A;  2CUL A;  4APN A;  3AYI A;  1Q1R A;  2Q6U A;  3FMW A;  4OVI A;  1YY5 A;  3RP6 A;  3G5R A;  2BRY A;  1IUV A;  3CNS A;  3ZYX A;  2NVK X;  1F8W A;  2YLR A;  2WES A;  4A7A A;  4ADW A;  5JCN A;  1NG4 A;  3SQP A;  4YSX A;  4XXG A;  2YG5 A;  4K5S A;  1F8R A;  4YSH A;  1E1M A;  1RSG A;  4BK1 A;  1FEB A;  3ISH A;  1GT8 A;  5BUK A;  1L9C A;  2YLX A;  1OJD A;  3V3N A;  2JAE A;  1S2Y A;  4JN9 A;  1GTE A;  4U8N A;  2XLS A;  4TM4 A;  2RGO A;  2BC1 A;  3T31 A;  1H7W A;  1PJ6 A;  3EPT A;  4A65 A;  1PDH A;  4U8K A;  4H4Q A;  4A9W A;  3AEE A;  3AB1 A;  2YWL A;  1LQU A;  3HYV A;  2Y6Q A;  2VRL A;  1ZKQ A;  1LV0 A;  4C5O A;  2WEU A;  3ALM A;  4K8D A;  3S61 A;  1GOS A;  1OJC A;  1JU2 A;  2BCG G;  2BA9 A;  2RAB A;  3G5Q A;  5M10 A;  4USR A;  1LVL A;  2YM1 A;  1GRT A;  2OA1 A;  1OJ9 A;  3SYI A;  1P2E A;  3NYC A;  4X4J A;  1PS9 A;  4X9M A;  4J33 A;  1COY A;  4WX1 A;  4OPT A;  3T0K A;  4EIQ A;  3NYF A;  1DOD A;  3GDP A;  1M64 A;  4K2X A;  3B6D A;  3UKL A;  4G9K A;  3DJD A;  1TDK A;  4EQW A;  3SZC A;  4XWR A;  2WOW A;  1CF3 A;  4H4U A;  4G73 A;  2VVL A;  4GUV A;  1VG0 A;  2ZZ0 A;  2VZ2 A;  4K22 A;  1DNC A;  4KX6 A;  2IID A;  4FK1 A;  2XFN A;  4UDP A;  4EM3 A;  3PO7 A;  2B76 A;  3ATR A;  4H4T A;  1DOB A;  4NTC A;  2WHD A;  1H7X A;  2R45 A;  3V3O A;  1D4D A;  4NEV A;  2OAM A;  1BKW A;  3EAO A;  3O0H A;  3UCL A;  3AEA A;  3KKJ A;  1CJ4 A;  4BJY A;  1NEK A;  2Q0K A;  2FJB A;  3DA1 A;  2FJD A;  1PJ5 A;  3ICT A;  4A99 A;  4U8P A;  2E4G A;  4DNA A;  4Z44 A;  2R4E A;  1QLB A;  4NNJ A;  3T2Y A;  2W0H A;  3LJP A;  3DJG X;  5EB4 A;  1S3B A;  3C4A A;  4CCQ A;  2GV8 A;  1O94 A;  2YLT A;  4EQX A;  2YVG A;  4H4Z A;  3ICS A;  5KMQ A;  2A87 A;  3NK1 X;  4AP3 A;  1N4U A;  2CFY A;  4PAB A;  5EOW A;  4I58 A;  2R0G A;  4IA5 A;  1YQ3 A;  4C3X A;  1PBB A;  3AED A;  3AEG A;  3AD9 B;  4JDR A;  1CL0 A;  5HXI A;  5KXJ A;  1PHH A;  4AOS A;  5HY5 A;  1ZK7 A;  2PYX A;  2GEW A;  5C2T A;  3GRS A;  2YLZ A;  1EL8 A;  1GPE A;  4D03 A;  4O5Q A;  2WET A;  1YQ4 A;  3SZ0 A;  3UTF A;  2C65 A;  1ZMD A;  3BNU A;  3CNJ A;  3T14 A;  3CGC A;  4U2S A;  2AR8 A;  1D7L A;  3GD4 A;  4C77 A;  4FDC B;  2Z5X A;  5J7X A;  2GR3 A;  4J31 A;  3L8K A;  4P9S A;  4IVO B;  4RG4 A;  1XAN A;  2BS4 A;  3HZL A;  1FOH A;  1K0L A;  3KA7 A;  1UKV G;  2QA2 A;  4Z2T A;  3D1C A;  2C4C A;  2YG7 A;  2BCP A;  2WDV A;  2B9X A;  2VRM A;  4Y4L A;  2O9Z A;  1KDG A;  2C3D A;  5FS6 A;  1NDA A;  2E1M A;  5KMR A;  2WDQ A;  3T2K A;  2X8H A;  1CC2 A;  3CND A;  1X31 B;  5KVI A;  1NEN A;  1GRA A;  1W4X A;  3URH A;  2NPX A;  4RG3 A;  1PBF A;  1H81 A;  5U1O A;  4YKF A;  3ADA B;  3SGL A;  4YTN A;  3ALJ A;  3DH9 A;  2WP6 A;  3QFA A;  4Y4M A;  4YSZ A;  1Q1W A;  2DKI A;  1BGN A;  4J56 A;  1M6I A;  4Z43 A;  5KWF A;  3DK9 A;  4II3 A;  5JCM A;  3SXI A;  4TM3 A;  4WCT A;  1D5T A;  2B9W A;  1TYP A;  2WU2 A;  4TM1 A;  2YVF A;  3P4R A;  4G74 A;  1JNR A;  3KPK A;  3GDN A;  1P2H A;  1K4Q A;  4H4S A;  1LPF A;  4IV9 A;  3QSE A;  2FBW A;  2BAB A;  5IPY A;  2B9Y A;  3QVR A;  4EMJ A;  3F8D A;  5FS9 A;  5IQ4 A;  4U8O A;  2WPC A;  5C3J A;  3P1W A;  4U2L A;  2ZZB A;  3ABV A;  2WOI A;  4HA6 A;  2XFU A;  3NH3 X;  4ZCD A;  2A8X A;  2C3C A;  2BK4 A;  2R46 A;  3IHM A;  3LZW A;  3UTH A;  4M52 A;  1KNP A;  1ELI A;  3BHF A;  5FS8 A;  2TPR A;  4AT0 A;  4C74 A;  4ECH A;  2BS2 A;  3AWI A;  3P4Q A;  4YTM A;  4CBQ A;  5EB5 A;  1IUU A;  1F8S A;  2X8C A;  3T37 A;  3K30 A;  5HHF A;  4BJZ A;  1LTX R;  2QAE A;  3AEF A;  1DOE A;  1IJH A;  3AD8 B;  3Q6J A;  2V61 A;  3CN8 A;  3K7M X;  1XDI A;  2AAQ A;  3QJ4 A;  1VRQ B;  5J60 A;  3NN0 X;  4OPI A;  5KOX A;  1DXL A;  3AEB A;  2BK5 A;  2DKH A;  3CIR A;  4CRT A;  3Q9T A;  2GF3 A;  1Y56 B;  3UKF A;  2GR0 A;  1SEZ A;  1EBD A;  4E0V A;  1KSU A;  1CJ2 A;  1GV4 A;  2I0Z A;  4YXD A;  1RP0 A;  1H83 A;  2F5Z A;  3DK8 A;  2C75 A;  1JEH A;  2APG A;  2YAU A;  2YR5 A;  2BYB A;  3BNM A;  4LII A;  3LZX A;  4BK2 A;  4EQS A;  2XVJ A;  1L0V A;  4H2R A;  4J57 A;  3UKH A;  2BK3 A;  3NKS A;  1MOK A;  3HYX A;  3AE3 A;  1KSS A;  1GXF A;  3GRT A;  4B64 A;  1N1P A;  2V3B A;  2WBA A;  3DJJ A;  1B37 A;  4U8L A;  4OPG A;  4USQ A;  1F6M A;  1FEC A;  1XHC A;  4AOX A;  3IWA A;  1RYI A;  4GDP A;  4NWZ A;  2EQ6 A;  3VRD B;  2BS3 A;  2WPF A;  3CGE A;  1E39 A;  1IUW A;  4JNQ A;  3RP8 A;  5JCI A;  3AE5 A;  3F8R A;  1JRY A;  3QVP A;  4II2 A;  2R0P A;  3UKQ A;  2GR1 A;  2EQ9 A;  4J36 A;  3COX A;  1XPQ A;  1NHS A;  2C76 A;  3AE1 A;  1K0I A;  1NHR A;  4IVM B;  3KVE A;  4UP3 A;  2YR4 A;  1TDF A;  3BI5 A;  1HYU A;  2CDU A;  4ZCC A;  3LB8 A;  2X50 A;  3CNP A;  2X99 A;  1H84 A;  1IUX A;  3NGC X;  2JB1 A;  2V5Z A;  4EM4 A;  2B7R A;  2BXS A;  5KMS A;  3AEC A;  2R4J A;  2XLP A;  1V59 A;  2VOU A;  4GRT A;  4H4R A;  1TDN A;  5KMP A;  1IUT A;  3T2Z A;  1B5Q A;  3LOV A;  4B69 A;  5BUL A;  1JOA A;  2XLR A;  1GSN A;  3G5S A;  1TRB A;  2XLT A;  4A6N B;  4HB9 A;  2TMD A;  2OAL A;  4B67 A;  2AQJ A;  3SZW A;  2PHH A;  4JY3 A;  2J3N A;  2C66 A;  3I3L A;  1S3E A;  3S5W A;  5L46 A;  1CBO A;  4CY6 A;  1PBD A;  3AE8 A;  2VQB A;  3KLJ A;  3RP7 A;  1KNR A;  1ZDL A;  1GRF A;  2V3A A;  1CC6 A;  2WS3 A;  4LA1 A;  3L1R A;  3FPZ A;  2EQ8 A;  2A89 A;  2B7S A;  3BHK A;  3NK2 X;  2JBV A;  3II4 A;  4NZH A;  2R9Z A;  4JY2 A;  3SY4 A;  2X8G A;  2IVE A;  4REK A;  1ONF A;  3NLC A;  2OLO A;  5FMH A;  4CNK A;  4GDE A;  3B3R A;  4U2T A;  3SFE A;  1JRZ A;  2YG3 A;  1L9E A;  1D7Y A;  4OPD A;  4RSL A;  4Y4N A;  3CGD A;  3CMM A;  1EL5 A;  5EBK A;  1PBC A;  5HYM A;  1AOG A;  4H2P A;  4N9X A;  3LXD A;  1ZY8 A;  4JQ9 A;  4EMI A;  1GET A;  3ALL A;  1MO9 A;  2YG6 A;  4Z24 A;  4AP1 A;  5U63 A;  3DK4 A;  2GVC A;  2C72 A;  1GTH A;  1LJ1 A;  3FBS A;  4H2Q A;  4OPU A;  3SM8 A;  2QCU A;  1YQZ A;  2OLN A;  2QA1 A;  1DJN A;  3K7T A;  1ZX9 A;  2JB3 A;  1GES A;  2YM2 A;  2XVF A;  3AE2 A;  4H7U A;  1FL2 A;  1E1K A;  4A6N A;  4UDR A;  1Q9I A;  4BUR A;  1H6V A;  5FS7 A;  3DGH A;  4OPC A;  4PAA A;  3AD7 B;  4GF7 A;  1IUS A;  4EMW A;  1L9D A;  5U25 A;  2GAH B;  3EAN A;  5GRT A;  4YSY A;  1PXC A;  1D4E A;  3AYJ A;  3RHA A;  5BRT A;  3FIM B;  1MXT A;  4DGK A;  2GMH A;  3DJE A;  3EF6 A;  1BGJ A;  1H82 A;  4B65 A;  4FX9 A;  2GRT A;  2Q0L A;  2Q7V A;  3M0O A;  2FJE A;  4A5L A;  5KRQ A;  2ZZC A;  3NK0 X;  4XWZ A;  2XDO A;  4IA6 A;  4B63 A;  1B8S A;  3KPF A;  1PXB A;  4ICY A;  2YG4 A;  4TM0 A;  3AE6 A;  3H8L A;  1E7P A;  3IF9 A;  3GWF A;  3VRA A;  1TDE A;  1ZP0 A;  1ZOV A;  2XLU A;  1GND A;  4H2N A;  5BVA A;  5LV9 A;  2XCG A;  3NTD A;  3M13 A;  5IQ1 A;  4X9N A;  4ZN0 A;  2RGH A;  4NEW A;  4KPR A;  3IC9 A;  4CCR A;  4YTP A;  1E1N A;  4MJW A;  1O95 A;  4GAP A;  4Z2R A;  1GAL A;  1KFY A;  4B66 A;  3GWD A;  4LU6 A;  2WP9 A;  4K7Z A;  4NTD A;  1ZMC A;  2C7G A;  2CVJ A;  1DOC A;  3UKK A;  1YKJ A;  3GMC A;  2X3N A;  3NG7 X;  3P9U A;  4J2W A;  3UOX A;  2YLS A;  4JNA A;  4B68 A;  3UOV A;  1CJC A;  1GER A;  1E1L A;  1S2Q A;  3QSS A;  1PBE A;  3HYW A;  1CHU A;  4H4X A;  3SX6 A;  2VVL G;  2XVI A;  4AT2 A;  2IVD A;  3SFD A;  4OCG A;  3H8I A;  3UKP A;  3NNE A;  1GRE A;  2XVE A;  2YVJ A;  3JSK A;  4O5U A;  5GSN A;  3UOZ A;  2H88 A;  4H4W A;  3UP4 A;  1TDO A;  2JK6 A;  4GCM A;  2VQ7 A;  3I6D A;  2BAC A;  1VG9 A;  2WQY A;  1CC4 A;  1NHQ A;  1Z6L A;  4GAV A;  4EIP A;  3E1T A;  3PVC A;  1N4V A;  1Y0P A;  3FG2 P;  3D8X A;  1GRG A;  3VR8 A;  3RED A;  2C70 A;  4UDQ A;  3QFB A;  1NAA A;  2R0C A;  5CQF A;  2VVM A;  1PXA A;  4CNJ A;  3ITJ A;  3C96 A;  2GQF A;  1REO A;  4K5R A; 
#chains in the Genus database with same CATH homology
 3K7Q X;  3NRN A;  5DBJ A;  1K0J A;  4U8M A;  1B4V A;  1QJD A;  1VQW A;  2YQU A;  2ZBW A;  1FEA A;  3OC4 A;  4OPL A;  2GH5 A;  3RNM A;  5KVH A;  2GQW A;  5CKU A;  1NPX A;  5JCL A;  3AE4 A;  3SZF A;  1QO8 A;  2GAG B;  4YT0 A;  4Z26 A;  1N4W A;  3WE0 A;  4BK3 A;  4NTE A;  1TYT A;  1NHP A;  5JCK A;  3PS9 A;  3GMB A;  3C4N A;  3CGB A;  2YR6 A;  4H4P A;  4I59 A;  1Y56 A;  2YLW A;  3AE9 A;  2HQM A;  4BV6 A;  5TR3 A;  3VR9 A;  2BRA A;  2Y6R A;  2H89 A;  4EQR A;  1OJT A;  2WDR A;  2XFQ A;  2WPE A;  3BI4 A;  3UTE A;  1CJ3 A;  1PN0 A;  3CPI G;  4H4V A;  2FJA A;  2JKC A;  5KNL A;  4C3Y A;  1JNZ A;  1E6E A;  3VRB A;  2XFP A;  3NIX A;  3V76 A;  1VDC A;  4B1B A;  2V6O A;  2XFO A;  3NN6 X;  3AE7 A;  4Z25 A;  4DSG A;  5M0Z A;  2E5V A;  2JB2 A;  3IHG A;  2Z5Y A;  1BF3 A;  1GRB A;  1GRH A;  1BZL A;  4YKG A;  3P4S A;  3DGZ A;  3ICR A;  2C67 A;  5ER0 A;  4A79 A;  3UOY A;  4G6G A;  3GYI A;  3LAD A;  3OZ2 A;  4U8J A;  2WOV A;  5KOW A;  1KF6 A;  2WU5 A;  3AYL A;  1ZOY A;  3NT6 A;  1LQT A;  4H50 A;  3CPJ G;  4J34 A;  2C64 A;  1DJQ A;  4Z2U A;  3NTA A;  3P4P A;  2BXR A;  4YWO A;  1EL9 A;  3BI2 A;  3VQR A;  1H86 A;  2C73 A;  3GD3 A;  1FCD A;  1F3P A;  3KU9 A;  1D4C A;  3M12 A;  1BWC A;  3R9U A;  3KD9 A;  2EQ7 A;  1NG3 A;  3CNT A;  3CTY A;  4U8I A;  1EL7 A;  2ARD A;  3GSI A;  1GEU A;  2BC0 A;  3UKA A;  3GYJ A;  1JRX A;  2UZZ A;  2WP5 A;  3ATQ A;  2GB0 A;  2V60 A;  3AXB A;  3F8P A;  3NHO X;  4GR1 A;  2RGJ A;  3CPH G;  4TLZ A;  3QSM A;  3UP5 A;  2XVH A;  2GR2 A;  4H4Y A;  1OJA A;  1PJ7 A;  3GYX A;  3ZDN A;  4G6H A;  2XYO A;  3NYE A;  4FK1 C;  3UTG A;  4CY8 A;  3DME A;  1O5W A;  4D04 A;  4DSH A;  4TLX A;  2ACZ A;  3H4K A;  2GMJ A;  2CUL A;  4APN A;  3AYI A;  1Q1R A;  2Q6U A;  3FMW A;  4OVI A;  1YY5 A;  3RP6 A;  3G5R A;  2BRY A;  1IUV A;  3CNS A;  3ZYX A;  2NVK X;  1F8W A;  2YLR A;  2WES A;  4A7A A;  4ADW A;  5JCN A;  1NG4 A;  3SQP A;  4YSX A;  4XXG A;  2YG5 A;  4K5S A;  1F8R A;  4YSH A;  1E1M A;  1RSG A;  4BK1 A;  1FEB A;  3ISH A;  1GT8 A;  5BUK A;  1L9C A;  2YLX A;  1OJD A;  3V3N A;  2JAE A;  1S2Y A;  4JN9 A;  1GTE A;  4U8N A;  2XLS A;  4TM4 A;  2RGO A;  2BC1 A;  3T31 A;  1H7W A;  1PJ6 A;  3EPT A;  4A65 A;  1PDH A;  4U8K A;  4H4Q A;  4A9W A;  3AEE A;  3AB1 A;  2YWL A;  1LQU A;  3HYV A;  2Y6Q A;  2VRL A;  1ZKQ A;  1LV0 A;  4C5O A;  2WEU A;  3ALM A;  4K8D A;  3S61 A;  1GOS A;  1OJC A;  1JU2 A;  2BCG G;  2BA9 A;  2RAB A;  3G5Q A;  5M10 A;  4USR A;  1LVL A;  2YM1 A;  1GRT A;  2OA1 A;  1OJ9 A;  3SYI A;  1P2E A;  3NYC A;  4X4J A;  1PS9 A;  4X9M A;  4J33 A;  1COY A;  4WX1 A;  4OPT A;  3T0K A;  4EIQ A;  3NYF A;  1DOD A;  3GDP A;  1M64 A;  4K2X A;  3B6D A;  3UKL A;  4G9K A;  3DJD A;  1TDK A;  4EQW A;  3SZC A;  4XWR A;  2WOW A;  1CF3 A;  4H4U A;  4G73 A;  2VVL A;  4GUV A;  1VG0 A;  2ZZ0 A;  2VZ2 A;  4K22 A;  1DNC A;  4KX6 A;  2IID A;  4FK1 A;  2XFN A;  4UDP A;  4EM3 A;  3PO7 A;  2B76 A;  3ATR A;  4H4T A;  1DOB A;  4NTC A;  2WHD A;  1H7X A;  2R45 A;  3V3O A;  1D4D A;  4NEV A;  2OAM A;  1BKW A;  3EAO A;  3O0H A;  3UCL A;  3AEA A;  3KKJ A;  1CJ4 A;  4BJY A;  1NEK A;  2Q0K A;  2FJB A;  3DA1 A;  2FJD A;  1PJ5 A;  3ICT A;  4A99 A;  4U8P A;  2E4G A;  4DNA A;  4Z44 A;  2R4E A;  1QLB A;  4NNJ A;  3T2Y A;  2W0H A;  3LJP A;  3DJG X;  5EB4 A;  1S3B A;  3C4A A;  4CCQ A;  2GV8 A;  1O94 A;  2YLT A;  4EQX A;  2YVG A;  4H4Z A;  3ICS A;  5KMQ A;  2A87 A;  3NK1 X;  4AP3 A;  1N4U A;  2CFY A;  4PAB A;  5EOW A;  4I58 A;  2R0G A;  4IA5 A;  1YQ3 A;  4C3X A;  1PBB A;  3AED A;  3AEG A;  3AD9 B;  4JDR A;  1CL0 A;  5HXI A;  5KXJ A;  1PHH A;  4AOS A;  5HY5 A;  1ZK7 A;  2PYX A;  2GEW A;  5C2T A;  3GRS A;  2YLZ A;  1EL8 A;  1GPE A;  4D03 A;  4O5Q A;  2WET A;  1YQ4 A;  3SZ0 A;  3UTF A;  2C65 A;  1ZMD A;  3BNU A;  3CNJ A;  3T14 A;  3CGC A;  4U2S A;  2AR8 A;  1D7L A;  3GD4 A;  4C77 A;  4FDC B;  2Z5X A;  5J7X A;  2GR3 A;  4J31 A;  3L8K A;  4P9S A;  4IVO B;  4RG4 A;  1XAN A;  2BS4 A;  3HZL A;  1FOH A;  1K0L A;  3KA7 A;  1UKV G;  2QA2 A;  4Z2T A;  3D1C A;  2C4C A;  2YG7 A;  2BCP A;  2WDV A;  2B9X A;  2VRM A;  4Y4L A;  2O9Z A;  1KDG A;  2C3D A;  5FS6 A;  1NDA A;  2E1M A;  5KMR A;  2WDQ A;  3T2K A;  2X8H A;  1CC2 A;  3CND A;  1X31 B;  5KVI A;  1NEN A;  1GRA A;  1W4X A;  3URH A;  2NPX A;  4RG3 A;  1PBF A;  1H81 A;  5U1O A;  4YKF A;  3ADA B;  3SGL A;  4YTN A;  3ALJ A;  3DH9 A;  2WP6 A;  3QFA A;  4Y4M A;  4YSZ A;  1Q1W A;  2DKI A;  1BGN A;  4J56 A;  1M6I A;  4Z43 A;  5KWF A;  3DK9 A;  4II3 A;  5JCM A;  3SXI A;  4TM3 A;  4WCT A;  1D5T A;  2B9W A;  1TYP A;  2WU2 A;  4TM1 A;  2YVF A;  3P4R A;  4G74 A;  1JNR A;  3KPK A;  3GDN A;  1P2H A;  1K4Q A;  4H4S A;  1LPF A;  4IV9 A;  3QSE A;  2FBW A;  2BAB A;  5IPY A;  2B9Y A;  3QVR A;  4EMJ A;  3F8D A;  5FS9 A;  5IQ4 A;  4U8O A;  2WPC A;  5C3J A;  3P1W A;  4U2L A;  2ZZB A;  3ABV A;  2WOI A;  4HA6 A;  2XFU A;  3NH3 X;  4ZCD A;  2A8X A;  2C3C A;  2BK4 A;  2R46 A;  3IHM A;  3LZW A;  3UTH A;  4M52 A;  1KNP A;  1ELI A;  3BHF A;  5FS8 A;  2TPR A;  4AT0 A;  4C74 A;  4ECH A;  2BS2 A;  3AWI A;  3P4Q A;  4YTM A;  4CBQ A;  5EB5 A;  1IUU A;  1F8S A;  2X8C A;  3T37 A;  3K30 A;  5HHF A;  4BJZ A;  1LTX R;  2QAE A;  3AEF A;  1DOE A;  1IJH A;  3AD8 B;  3Q6J A;  2V61 A;  3CN8 A;  3K7M X;  1XDI A;  2AAQ A;  3QJ4 A;  1VRQ B;  5J60 A;  3NN0 X;  4OPI A;  5KOX A;  1DXL A;  3AEB A;  2BK5 A;  2DKH A;  3CIR A;  4CRT A;  3Q9T A;  2GF3 A;  1Y56 B;  3UKF A;  2GR0 A;  1SEZ A;  1EBD A;  4E0V A;  1KSU A;  1CJ2 A;  1GV4 A;  2I0Z A;  4YXD A;  1RP0 A;  1H83 A;  2F5Z A;  3DK8 A;  2C75 A;  1JEH A;  2APG A;  2YAU A;  2YR5 A;  2BYB A;  3BNM A;  4LII A;  3LZX A;  4BK2 A;  4EQS A;  2XVJ A;  1L0V A;  4H2R A;  4J57 A;  3UKH A;  2BK3 A;  3NKS A;  1MOK A;  3HYX A;  3AE3 A;  1KSS A;  1GXF A;  3GRT A;  4B64 A;  1N1P A;  2V3B A;  2WBA A;  3DJJ A;  1B37 A;  4U8L A;  4OPG A;  4USQ A;  1F6M A;  1FEC A;  1XHC A;  4AOX A;  3IWA A;  1RYI A;  4GDP A;  4NWZ A;  2EQ6 A;  3VRD B;  2BS3 A;  2WPF A;  3CGE A;  1E39 A;  1IUW A;  4JNQ A;  3RP8 A;  5JCI A;  3AE5 A;  3F8R A;  1JRY A;  3QVP A;  4II2 A;  2R0P A;  3UKQ A;  2GR1 A;  2EQ9 A;  4J36 A;  3COX A;  1XPQ A;  1NHS A;  2C76 A;  3AE1 A;  1K0I A;  1NHR A;  4IVM B;  3KVE A;  4UP3 A;  2YR4 A;  1TDF A;  3BI5 A;  1HYU A;  2CDU A;  4ZCC A;  3LB8 A;  2X50 A;  3CNP A;  2X99 A;  1H84 A;  1IUX A;  3NGC X;  2JB1 A;  2V5Z A;  4EM4 A;  2B7R A;  2BXS A;  5KMS A;  3AEC A;  2R4J A;  2XLP A;  1V59 A;  2VOU A;  4GRT A;  4H4R A;  1TDN A;  5KMP A;  1IUT A;  3T2Z A;  1B5Q A;  3LOV A;  4B69 A;  5BUL A;  1JOA A;  2XLR A;  1GSN A;  3G5S A;  1TRB A;  2XLT A;  4A6N B;  4HB9 A;  2TMD A;  2OAL A;  4B67 A;  2AQJ A;  3SZW A;  2PHH A;  4JY3 A;  2J3N A;  2C66 A;  3I3L A;  1S3E A;  3S5W A;  5L46 A;  1CBO A;  4CY6 A;  1PBD A;  3AE8 A;  2VQB A;  3KLJ A;  3RP7 A;  1KNR A;  1ZDL A;  1GRF A;  2V3A A;  1CC6 A;  2WS3 A;  4LA1 A;  3L1R A;  3FPZ A;  2EQ8 A;  2A89 A;  2B7S A;  3BHK A;  3NK2 X;  2JBV A;  3II4 A;  4NZH A;  2R9Z A;  4JY2 A;  3SY4 A;  2X8G A;  2IVE A;  4REK A;  1ONF A;  3NLC A;  2OLO A;  5FMH A;  4CNK A;  4GDE A;  3B3R A;  4U2T A;  3SFE A;  1JRZ A;  2YG3 A;  1L9E A;  1D7Y A;  4OPD A;  4RSL A;  4Y4N A;  3CGD A;  3CMM A;  1EL5 A;  5EBK A;  1PBC A;  5HYM A;  1AOG A;  4H2P A;  4N9X A;  3LXD A;  1ZY8 A;  4JQ9 A;  4EMI A;  1GET A;  3ALL A;  1MO9 A;  2YG6 A;  4Z24 A;  4AP1 A;  5U63 A;  3DK4 A;  2GVC A;  2C72 A;  1GTH A;  1LJ1 A;  3FBS A;  4H2Q A;  4OPU A;  3SM8 A;  2QCU A;  1YQZ A;  2OLN A;  2QA1 A;  1DJN A;  3K7T A;  1ZX9 A;  2JB3 A;  1GES A;  2YM2 A;  2XVF A;  3AE2 A;  4H7U A;  1FL2 A;  1E1K A;  4A6N A;  4UDR A;  1Q9I A;  4BUR A;  1H6V A;  5FS7 A;  3DGH A;  4OPC A;  4PAA A;  3AD7 B;  4GF7 A;  1IUS A;  4EMW A;  1L9D A;  5U25 A;  2GAH B;  3EAN A;  5GRT A;  4YSY A;  1PXC A;  1D4E A;  3AYJ A;  3RHA A;  5BRT A;  3FIM B;  1MXT A;  4DGK A;  2GMH A;  3DJE A;  3EF6 A;  1BGJ A;  1H82 A;  4B65 A;  4FX9 A;  2GRT A;  2Q0L A;  2Q7V A;  3M0O A;  2FJE A;  4A5L A;  5KRQ A;  2ZZC A;  3NK0 X;  4XWZ A;  2XDO A;  4IA6 A;  4B63 A;  1B8S A;  3KPF A;  1PXB A;  4ICY A;  2YG4 A;  4TM0 A;  3AE6 A;  3H8L A;  1E7P A;  3IF9 A;  3GWF A;  3VRA A;  1TDE A;  1ZP0 A;  1ZOV A;  2XLU A;  1GND A;  4H2N A;  5BVA A;  5LV9 A;  2XCG A;  3NTD A;  3M13 A;  5IQ1 A;  4X9N A;  4ZN0 A;  2RGH A;  4NEW A;  4KPR A;  3IC9 A;  4CCR A;  4YTP A;  1E1N A;  4MJW A;  1O95 A;  4GAP A;  4Z2R A;  1GAL A;  1KFY A;  4B66 A;  3GWD A;  4LU6 A;  2WP9 A;  4K7Z A;  4NTD A;  1ZMC A;  2C7G A;  2CVJ A;  1DOC A;  3UKK A;  1YKJ A;  3GMC A;  2X3N A;  3NG7 X;  3P9U A;  4J2W A;  3UOX A;  2YLS A;  4JNA A;  4B68 A;  3UOV A;  1CJC A;  1GER A;  1E1L A;  1S2Q A;  3QSS A;  1PBE A;  3HYW A;  1CHU A;  4H4X A;  3SX6 A;  2VVL G;  2XVI A;  4AT2 A;  2IVD A;  3SFD A;  4OCG A;  3H8I A;  3UKP A;  3NNE A;  1GRE A;  2XVE A;  2YVJ A;  3JSK A;  4O5U A;  5GSN A;  3UOZ A;  2H88 A;  4H4W A;  3UP4 A;  1TDO A;  2JK6 A;  4GCM A;  2VQ7 A;  3I6D A;  2BAC A;  1VG9 A;  2WQY A;  1CC4 A;  1NHQ A;  1Z6L A;  4GAV A;  4EIP A;  3E1T A;  3PVC A;  1N4V A;  1Y0P A;  3FG2 P;  3D8X A;  1GRG A;  3VR8 A;  3RED A;  2C70 A;  4UDQ A;  3QFB A;  1NAA A;  2R0C A;  5CQF A;  2VVM A;  1PXA A;  4CNJ A;  3ITJ A;  3C96 A;  2GQF A;  1REO A;  4K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...