1NAAA

Cellobiose dehydrogenase flavoprotein fragment in complex with cellobionolactam
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
541
structure length
541
Chain Sequence
TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose dehydrogenase
publication title Mechanism of the reductive half-reaction in cellobiose dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 185
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2002-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1naaA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1naaA01
1JNZA 1H7WA 2XFUA 2GR3A 2YWLA 3GD4A 1LQUA 4BV6A 4WCTA 1FEAA 2XYOA 2TMDA 1RYIA 2YG3A 3V3OA 4A6NB 3JSKA 1VQWA 1K0LA 4C3XA 4DSGA 3P4QA 1GTHA 4K5SA 4B1BA 2WOWA 4NEVA 2I0ZA 2WPCA 3GDNA 1CC6A 1BKWA 3ITJA 1B8SA 1EL9A 2V60A 4C77A 3ALMA 3GD3A 4ECHA 5KWFA 3DGZA 3AYLA 4X9MA 1P2HA 1CJ4A 1NPXA 4EIQA 4XWZA 3PVCA 1CHUA 3LXDA 3AE3A 3PS9A 3M0OA 2XFQA 4JY2A 4APNA 4YSHA 3BHFA 2ACZA 2QA1A 4EIPA 2VRMA 2H88A 1B37A 3D8XA 3AXBA 4Z26A 2XFOA 2YLTA 3CNTA 4U8JA 3AB1A 4GCMA 2JB2A 2ZZCA 1K4QA 3GRSA 1ELIA 2GF3A 3QJ4A 4OPLA 2WPFA 4H2QA 3UTEA 4A9WA 4H4RA 2WESA 3P4SA 1PXBA 3BNUA 5GSNA 1V59A 3CIRA 1F8SA 2GR2A 3SQPA 3UKQA 4Z2UA 1BZLA 1PBFA 4CBQA 2NVKX 2C7GA 3GWFA 2DKHA 5FS6A 1KSSA 2RGJA 1E1NA 2CFYA 3DK8A 3G5QA 3NRNA 3OZ2A 1TDKA 2WOIA 4JN9A 2VVLA 2ZZ0A 5DBJA 4UDQA 2XVFA 4AT2A 1PN0A 2EQ9A 1IUWA 4B68A 1TDEA 1GSNA 2EQ6A 3ICTA 3NT6A 1LV0A 2VZ2A 2X8GA 1ZP0A 2GH5A 3EAOA 4J33A 3UP5A 4AT0A 3NK0X 4CCQA 3AEDA 1S3EA 3NTAA 5M10A 1ZY8A 5CQFA 1D4DA 4O5UA 1H7XA 2WBAA 3V3NA 3CPIG 2BS3A 3G5RA 2FJDA 1KNPA 2C72A 1FEBA 1F3PA 3UKHA 5JCMA 3UKFA 2YM2A 1PS9A 3UKAA 2C70A 5BRTA 4H2PA 2V6OA 3DK4A 3KVEA 2BS4A 3NGCX 5EB4A 4EMJA 3KA7A 2XLPA 3ALLA 1H86A 1NG3A 1YQ4A 3DJGX 4IV9A 1GRAA 1Q1WA 3PO7A 5C3JA 1ZOVA 1D5TA 4TLZA 4A7AA 3DMEA 3NHOX 4B64A 4C5OA 1O94A 3GYIA 2TPRA 2YVGA 3K30A 4UDPA 5KRQA 3AE6A 1BGJA 2WEUA 2B9WA 3SGLA 3BI4A 1TYTA 4X9NA 1O5WA 4U8IA 3NN0X 1FCDA 3QVPA 2GQFA 3P4RA 3AD9B 4XWRA 2C3CA 1RP0A 4YT0A 3LZXA 4OPGA 2WU2A 4PAAA 3VRAA 1EL8A 2BYBA 1UKVG 1NEKA 1ZMDA 2BA9A 3ZYXA 1L9CA 2VVLG 4OPCA 2YM1A 4U8MA 1YY5A 3NYFA 4GUVA 1DOCA 1JOAA 2YVJA 3GMCA 2RABA 1VG9A 5TR3A 4BJZA 2FJEA 1PJ5A 3AE8A 1NHQA 3QFAA 3DK9A 5LV9A 3FPZA 4U2TA 2YLXA 2WDVA 2APGA 3IC9A 3IWAA 4H2RA 2BK3A 1K0JA 2R0GA 2YG6A 3CNDA 3KKJA 2BCGG 4FX9A 2UZZA 4NTDA 4NZHA 4C74A 1TDNA 2C65A 2Q0LA 2JB1A 1EL7A 4ZCDA 2QA2A 2XFNA 3COXA 1RSGA 2A89A 3BI5A 3FMWA 5U1OA 1GXFA 4A5LA 4CNKA 5HY5A 4HA6A 4K7ZA 2DKIA 2H89A 1CJ3A 4GF7A 5M0ZA 2X3NA 2VOUA 3F8DA 1GEUA 2C67A 3C4NA 3F8RA 2GMHA 1B4VA 2X8HA 3UOVA 2BABA 3RNMA 4YSZA 4LA1A 3K7TA 3Q6JA 3QSSA 1GPEA 2GVCA 1N4UA 1AOGA 3C4AA 2BXRA 3CGBA 1TRBA 2YLRA 4OVIA 1DODA 1L0VA 1QLBA 1OJ9A 4RG3A 4C3YA 2GAHB 3DJEA 2O9ZA 4A79A 1P2EA 3P9UA 4Y4LA 4YTPA 2WOVA 5FS9A 3CGEA 3FBSA 2XVHA 1GRGA 1KSUA 1GNDA 1JEHA 2CVJA 2VQ7A 1L9DA 4OPIA 3UTFA 1OJDA 4B69A 4IVMB 3B6DA 2YR6A 1H83A 1M64A 2VQBA 2XLTA 4KPRA 1PXAA 2R0CA 3LADA 2HQMA 1E1MA 1COYA 1EL5A 3E1TA 5EOWA 3B3RA 1B5QA 3KLJA 5ER0A 1PBCA 3CTYA 3UKPA 2GMJA 1HYUA 3DJDA 1IUTA 1JRZA 2BK5A 2XVEA 3CPJG 3CGCA 1IJHA 1PJ6A 2YG7A 2R0PA 4YKFA 1E7PA 1JRXA 2B76A 2R4EA 3URHA 4EQSA 2OALA 3CNSA 2V3BA 1ZX9A 2AAQA 2GR0A 2IVDA 2VRLA 3R9UA 3GWDA 2C75A 4FK1A 4H50A 2BACA 1ZOYA 3AEFA 1PBDA 4GRTA 4K2XA 2WDRA 4AP3A 2XLUA 3GRTA 2B7SA 2WP9A 1JU2A 3AWIA 2JB3A 4BK3A 1PJ7A 5IQ4A 2BS2A 4Z44A 2YQUA 2B9YA 1OJTA 4ICYA 3VR9A 2C73A 4DGKA 1JNRA 2OLNA 4H4PA 4U8KA 4WX1A 4ADWA 3H4KA 1N4VA 4E0VA 4EMIA 2WQYA 1NG4A 3GSIA 2PHHA 3QSEA 2V61A 4U8NA 2WDQA 1XHCA 3ADAB 3RP6A 2GR1A 1GREA 3AYJA 3IHGA 4YWOA 4CY8A 2WP6A 3UOYA 4HB9A 2VVMA 2GB0A 3UTGA 4BK1A 1Z6LA 1H81A 4J36A 4B63A 1TDOA 3AE7A 3SM8A 5L46A 4I59A 4Z24A 1IUVA 3LJPA 4IA5A 4YSXA 2YR5A 3M12A 3AD7B 4A65A 2JK6A 2YLZA 3GMBA 3NYCA 5C2TA 1GV4A 3NK2X 1NAAA 4FDCB 4OPUA 2Q7VA 5FMHA 1S3BA 1PHHA 3VQRA 1D7YA 3T37A 1BGNA 4JNAA 4GDEA 4ZN0A 2RGOA 4JNQA 3V76A 3DJJA 1KDGA 5FS8A 2J3NA 2PYXA 1Q1RA 5FS7A 1KFYA 4YTNA 4AOXA 3EPTA 2GQWA 4O5QA 3AE2A 3FG2P 3ICSA 4YXDA 1E1LA 1VDCA 2BC0A 4H4XA 3SFEA 2XCGA 3CGDA 3DH9A 2YG4A 3AE1A 1GRHA 2YLWA 5KOWA 3QVRA 1L9EA 3BHKA 4J34A 2WS3A 1H6VA 4EQXA 3AE5A 5IQ1A 2C64A 2OLOA 4EM4A 4MJWA 4H4ZA 2C76A 3Q9TA 4BURA 4K8DA 3G5SA 3IF9A 1F8WA 4Z2RA 2BK4A 1KNRA 2E1MA 1D7LA 3H8LA 1QJDA 4N9XA 4J56A 4REKA 1IUSA 2W0HA 2YVFA 1JRYA 1TYPA 2FBWA 3HZLA 2WETA 1W4XA 1IUXA 1GETA 1YQ3A 2Y6RA 2YAUA 4JQ9A 2Q6UA 1XDIA 1VG0A 3VRDB 3OC4A 2X99A 1GESA 2Z5YA 1XANA 4D03A 1E1KA 4J31A 4H4TA 3H8IA 3BNMA 3EANA 5KXJA 1OJAA 2X50A 3AD8B 1Y56A 1EBDA 1FOHA 3EF6A 3C96A 3I6DA 4LU6A 2FJAA 5JCKA 4EQWA 5BULA 1NDAA 3VRBA 1ZMCA 1H84A 2XDOA 3AEGA 3ZDNA 3S61A 4OCGA 2WU5A 3K7QX 3VR8A 4A99A 1S2QA 2A8XA 3L8KA 3ICRA 3AECA 1GT8A 2ARDA 2XLRA 2ZBWA 4IA6A 3RP7A 4CCRA 1ZK7A 3KU9A 4U8OA 4X4JA 1ZKQA 5EBKA 1X31B 1ZDLA 1KF6A 3NK1X 2AQJA 4YKGA 2C66A 4XXGA 1NHRA 2IVEA 2V3AA 4EMWA 1Q9IA 5EB5A 5KVHA 4TM0A 2X8CA 3ATRA 3RHAA 4JY3A 4JDRA 2WHDA 3P1WA 1O95A 2B9XA 1GERA 3NNEA 1DOEA 3CPHG 4K22A 1FL2A 4BJYA 3ISHA 1M6IA 1GRTA 4UP3A 3DA1A 3CNJA 4Y4NA 4AP1A 3KD9A 1TDFA 5HYMA 2CDUA 1FECA 2QAEA 4FK1C 2V5ZA 3REDA 5HXIA 2BXSA 3L1RA 2F5ZA 3NN6X 1XPQA 2C3DA 3AYIA 5J7XA 4BK2A 1CC4A 5GRTA 2R45A 2NPXA 4NEWA 3AE9A 4UDRA 4U8LA 4DSHA 3QSMA 4TM1A 2A87A 3ATQA 2Z5XA 4USQA 4Z2TA 1S2YA 3NKSA 4TLXA 2B7RA 3NH3X 4B66A 4Y4MA 3LB8A 1CJCA 4TM3A 5KVIA 3NYEA 2WP5A 2GEWA 2EQ7A 4H4WA 4I58A 4Z43A 1BWCA 4H4VA 3P4PA 1GRFA 3BI2A 4LIIA 4M52A 1E6EA 2OAMA 2RGHA 5HHFA 1SEZA 2WPEA 2YLSA 4H4SA 4CRTA 4P9SA 4D04A 3NLCA 3GYJA 3D1CA 3IHMA 3CNPA 5IPYA 5BVAA 1MO9A 3ALJA 3ABVA 4A6NA 4U2SA 2IIDA 3AEBA 2JAEA 2JBVA 3F8PA 1LPFA 1CC2A 1GALA 2Q0KA 3UKLA 2GAGB 3KPFA 4AOSA 3M13A 3K7MX 3NIXA 3QFBA 4NTCA 4GR1A 3WE0A 4H4QA 1Y56B 4CNJA 1NHPA 2BCPA 4U8PA 2OA1A 2JKCA 4IVOB 1YQZA 4Z25A 1PXCA 3AEEA 5JCLA 2FJBA 5CKUA 3RP8A 1F8RA 1H82A 2EQ8A 4J57A 2XFPA 1LTXR 3UOXA 1Y0PA 4EQRA 1LJ1A 4YSYA 1K0IA 4KX6A 1PBBA 1DJQA 5JCIA 4H7UA 2R46A 1DXLA 2AR8A 3LZWA 3S5WA 2CULA 4YTMA 3UCLA 4RSLA 4H4UA 1E39A 5KOXA 1NENA 2GV8A 3UKKA 5JCNA 1IUUA 2QCUA 1PBEA 4J2WA 1DNCA 1REOA 4USRA 2ZZBA 3DGHA 3GDPA 4ZCCA 4PABA 4B65A 3UP4A 4B67A 2E5VA 2R4JA 4OPDA 4H4YA 2GRTA 1QO8A 3AE4A 1DOBA 4CY6A 3I3LA 1F6MA 5U25A 2E4GA 1CJ2A 2R9ZA 1NHSA 4GDPA 4DNAA 4U2LA 1MOKA 3O0HA 3UTHA 4RG4A 1BF3A 1CBOA 1MXTA 2BC1A 2XLSA 1D4CA 2XVJA 1LVLA 2YG5A 3FIMB 2Y6QA 3NG7X 1CF3A 4H2NA 4OPTA 1ONFA 1DJNA 1GRBA 3NTDA 4TM4A 3CN8A 4NTEA 3II4A 1D4EA 3UOZA 3SFDA 3LOVA 1OJCA 1N4WA 5J60A 4K5RA 1GOSA 2XVIA 3AEAA 1GTEA 1PDHA 1CL0A 1LQTA 1VRQB 1YKJA 1N1PA 4EM3A 5U63A 2YR4A 5BUKA
chains in the Genus database with same CATH superfamily
1JNZA 1H7WA 2XFUA 2GR3A 2YWLA 3GD4A 1LQUA 4BV6A 4WCTA 1FEAA 2XYOA 2TMDA 1RYIA 2YG3A 3V3OA 4A6NB 5KMRA 3JSKA 1VQWA 1K0LA 4C3XA 4DSGA 3P4QA 1GTHA 4K5SA 4B1BA 2WOWA 4NEVA 2I0ZA 4NWZA 2WPCA 3GDNA 1CC6A 1BKWA 3ITJA 1B8SA 1EL9A 2V60A 4C77A 3ALMA 3GD3A 4ECHA 5KWFA 3DGZA 3AYLA 4X9MA 1P2HA 1CJ4A 1NPXA 4EIQA 4XWZA 3PVCA 1CHUA 3LXDA 3AE3A 3PS9A 3M0OA 2XFQA 4JY2A 4APNA 4YSHA 3BHFA 2ACZA 2QA1A 4EIPA 2VRMA 2H88A 1B37A 3D8XA 3AXBA 4Z26A 2XFOA 2YLTA 3CNTA 4U8JA 3AB1A 4GCMA 2JB2A 4G73A 2ZZCA 1K4QA 3GRSA 1ELIA 2GF3A 3QJ4A 4OPLA 2WPFA 4H2QA 3UTEA 4A9WA 4H4RA 2WESA 3KPKA 3P4SA 1PXBA 3BNUA 5GSNA 3GYXA 1V59A 3CIRA 1F8SA 2GR2A 3SQPA 3UKQA 4Z2UA 1BZLA 1PBFA 4CBQA 2NVKX 2C7GA 3GWFA 2DKHA 5FS6A 1KSSA 2RGJA 1E1NA 2CFYA 3DK8A 3G5QA 3NRNA 3OZ2A 1TDKA 2WOIA 3HYWA 2VVLA 2ZZ0A 4JN9A 5DBJA 3SYIA 4CCRA 4UDQA 2XVFA 4AT2A 1PN0A 2EQ9A 1IUWA 4B68A 1TDEA 1GSNA 2EQ6A 3ICTA 3NT6A 1LV0A 2VZ2A 2X8GA 1ZP0A 2GH5A 3EAOA 4J33A 3UP5A 4AT0A 3NK0X 4CCQA 3AEDA 1S3EA 3NTAA 5M10A 1ZY8A 5CQFA 1D4DA 4O5UA 1H7XA 2WBAA 3V3NA 3CPIG 2BS3A 4G9KA 3G5RA 2FJDA 1KNPA 2C72A 1FEBA 1F3PA 3UKHA 5JCMA 3UKFA 2YM2A 1PS9A 3UKAA 2C70A 5BRTA 4H2PA 2V6OA 3DK4A 3KVEA 2BS4A 3NGCX 5EB4A 4EMJA 3KA7A 2XLPA 3ALLA 1H86A 1NG3A 1YQ4A 3DJGX 4IV9A 1GRAA 1Q1WA 3PO7A 3T0KA 5C3JA 1ZOVA 1D5TA 4TLZA 4A7AA 3DMEA 3NHOX 4B64A 4C5OA 1O94A 3GYIA 2TPRA 4UDPA 2YVGA 3K30A 5KRQA 3AE6A 1BGJA 2WEUA 2B9WA 3SGLA 4G6HA 3BI4A 1TYTA 4X9NA 1O5WA 4U8IA 3NN0X 1FCDA 3QVPA 2GQFA 3P4RA 3AD9B 4XWRA 2C3CA 1RP0A 4YT0A 3LZXA 4OPGA 2WU2A 4PAAA 3VRAA 1EL8A 2BYBA 1UKVG 1NEKA 1ZMDA 2BA9A 3ZYXA 1L9CA 2VVLG 2BRYA 4OPCA 2YM1A 4U8MA 1YY5A 3NYFA 4GUVA 1DOCA 1JOAA 2YVJA 3GMCA 2RABA 1VG9A 5TR3A 4BJZA 2FJEA 1PJ5A 3AE8A 5KMSA 1NHQA 3QFAA 3DK9A 5LV9A 3FPZA 4U2TA 2YLXA 2WDVA 2APGA 3IC9A 3IWAA 4H2RA 3T14A 2BK3A 1K0JA 2R0GA 2YG6A 3CNDA 3KKJA 2BCGG 4FX9A 2UZZA 4NTDA 4NZHA 4C74A 1TDNA 2C65A 2Q0LA 2JB1A 1EL7A 4ZCDA 2QA2A 2XFNA 3COXA 1RSGA 2A89A 3BI5A 3FMWA 5U1OA 1GXFA 4A5LA 4CNKA 5HY5A 4HA6A 4K7ZA 2DKIA 2H89A 1CJ3A 4GF7A 5M0ZA 2X3NA 2VOUA 3F8DA 1GEUA 2C67A 3C4NA 3F8RA 2GMHA 1B4VA 2X8HA 3UOVA 3SY4A 2BABA 3RNMA 4YSZA 3T2KA 4LA1A 3K7TA 3Q6JA 3QSSA 1GPEA 2GVCA 1N4UA 1AOGA 3C4AA 2BXRA 3CGBA 1TRBA 2YLRA 4OVIA 1DODA 1L0VA 1QLBA 1OJ9A 4RG3A 4C3YA 2GAHB 3DJEA 2O9ZA 4A79A 1P2EA 3P9UA 4Y4LA 4YTPA 2WOVA 5FS9A 3CGEA 3FBSA 2XVHA 1GRGA 1KSUA 1GNDA 1JEHA 2CVJA 2VQ7A 1L9DA 4OPIA 3UTFA 1OJDA 4II2A 4B69A 4IVMB 3B6DA 2YR6A 1H83A 1M64A 2VQBA 2XLTA 4KPRA 1PXAA 2R0CA 3LADA 2HQMA 1E1MA 1COYA 1EL5A 3E1TA 5EOWA 3SZWA 3B3RA 1B5QA 3KLJA 5ER0A 1PBCA 3CTYA 3UKPA 2GMJA 1HYUA 3DJDA 1IUTA 1JRZA 3SXIA 2BK5A 2XVEA 3CPJG 3CGCA 1IJHA 1PJ6A 2YG7A 2R0PA 4YKFA 1E7PA 1JRXA 2B76A 2R4EA 3URHA 4EQSA 2OALA 3CNSA 2V3BA 1ZX9A 2AAQA 2GR0A 3CMMA 2IVDA 2VRLA 3T31A 3R9UA 3GWDA 2C75A 4FK1A 4H50A 2BACA 1ZOYA 3AEFA 1PBDA 4GRTA 4K2XA 2WDRA 4AP3A 2XLUA 3GRTA 2B7SA 2WP9A 1JU2A 3AWIA 4II3A 2JB3A 4BK3A 1PJ7A 5IQ4A 5KMPA 2BS2A 4Z44A 2YQUA 2B9YA 1OJTA 4ICYA 3VR9A 2C73A 4DGKA 1JNRA 2OLNA 4G6GA 4H4PA 4U8KA 4WX1A 4ADWA 3H4KA 1N4VA 4E0VA 4EMIA 2WQYA 1NG4A 3GSIA 2PHHA 3QSEA 2V61A 4U8NA 2WDQA 1XHCA 3ADAB 3RP6A 2GR1A 1GREA 3AYJA 3IHGA 4YWOA 3T2ZA 4CY8A 2WP6A 3UOYA 4HB9A 2VVMA 2GB0A 3UTGA 3SX6A 1Z6LA 4BK1A 1H81A 4J36A 3SZFA 4B63A 1TDOA 3AE7A 3SM8A 5L46A 4I59A 4Z24A 3LJPA 1IUVA 4IA5A 4YSXA 2YR5A 3M12A 3AD7B 4A65A 2JK6A 2YLZA 3GMBA 3NYCA 5C2TA 1GV4A 2BRAA 1NAAA 3NK2X 4FDCB 2Q7VA 4OPUA 1S3BA 5FMHA 1PHHA 3VQRA 1D7YA 3T37A 1BGNA 4JNAA 4GDEA 4ZN0A 2RGOA 4JNQA 3V76A 3DJJA 1KDGA 5FS8A 2J3NA 2PYXA 1Q1RA 3SZCA 5FS7A 1KFYA 4YTNA 4AOXA 3EPTA 2GQWA 4O5QA 3AE2A 3FG2P 3ICSA 4YXDA 1E1LA 1VDCA 2BC0A 4H4XA 3SFEA 2XCGA 3CGDA 3DH9A 2YG4A 3AE1A 1GRHA 2YLWA 5KOWA 3QVRA 1L9EA 3BHKA 4J34A 2WS3A 1H6VA 4EQXA 3AE5A 5IQ1A 2C64A 2OLOA 4EM4A 4MJWA 4H4ZA 2C76A 3Q9TA 4BURA 4K8DA 3G5SA 3IF9A 1F8WA 4Z2RA 2BK4A 1KNRA 2E1MA 1D7LA 3H8LA 1QJDA 4N9XA 4J56A 4REKA 1IUSA 2W0HA 2C4CA 2YVFA 1JRYA 4NNJA 1TYPA 2FBWA 3HZLA 2WETA 1W4XA 1IUXA 1GETA 1YQ3A 2Y6RA 2YAUA 4JQ9A 2Q6UA 1XDIA 1VG0A 3VRDB 3T2YA 3OC4A 5KNLA 2X99A 1GESA 2Z5YA 1XANA 4D03A 1E1KA 4J31A 4H4TA 3H8IA 3BNMA 3EANA 5KXJA 1OJAA 2X50A 3AD8B 1Y56A 1EBDA 1FOHA 3EF6A 3C96A 3I6DA 4LU6A 2FJAA 5JCKA 4EQWA 5BULA 1NDAA 3VRBA 1ZMCA 1H84A 2XDOA 3AEGA 3ZDNA 3S61A 4OCGA 2WU5A 3K7QX 3VR8A 4A99A 1S2QA 2A8XA 3L8KA 3ICRA 3AECA 1GT8A 2ARDA 2XLRA 2ZBWA 4IA6A 4G74A 3RP7A 1ZK7A 3KU9A 4U8OA 4X4JA 1ZKQA 5EBKA 1X31B 1ZDLA 1KF6A 3NK1X 2AQJA 4YKGA 2C66A 4XXGA 1NHRA 2IVEA 2V3AA 4EMWA 1Q9IA 5EB5A 5KVHA 4TM0A 2X8CA 3ATRA 3RHAA 4JY3A 4JDRA 2WHDA 3P1WA 1O95A 2B9XA 1GERA 3NNEA 1DOEA 3CPHG 4K22A 1FL2A 4BJYA 3ISHA 1M6IA 1GRTA 4UP3A 3DA1A 3CNJA 4Y4NA 4AP1A 3KD9A 1TDFA 5HYMA 2CDUA 1FECA 2QAEA 4FK1C 2V5ZA 3HYXA 3REDA 5HXIA 2BXSA 3L1RA 2F5ZA 3NN6X 1XPQA 2C3DA 3AYIA 5J7XA 4BK2A 1CC4A 5GRTA 2R45A 2NPXA 4UDRA 3AE9A 4NEWA 4U8LA 4DSHA 3QSMA 4TM1A 2A87A 3ATQA 2Z5XA 4USQA 3SZ0A 4Z2TA 1S2YA 3NKSA 4TLXA 2B7RA 3NH3X 4B66A 4Y4MA 3LB8A 1CJCA 4TM3A 5KVIA 3NYEA 2WP5A 2GEWA 2EQ7A 4H4WA 4I58A 4Z43A 1BWCA 4H4VA 3P4PA 1GRFA 3BI2A 4LIIA 4M52A 1E6EA 2OAMA 2RGHA 5HHFA 1SEZA 2WPEA 2YLSA 4H4SA 4CRTA 4P9SA 4D04A 3NLCA 3GYJA 3D1CA 3IHMA 3CNPA 5IPYA 5BVAA 1MO9A 3ALJA 3ABVA 4A6NA 4U2SA 2IIDA 3AEBA 2JAEA 2JBVA 3F8PA 1LPFA 1CC2A 1GALA 2Q0KA 4GAPA 3UKLA 2GAGB 3KPFA 4AOSA 3M13A 3K7MX 3NIXA 3QFBA 4NTCA 4GR1A 3WE0A 4H4QA 1Y56B 4CNJA 1NHPA 2BCPA 4U8PA 2OA1A 2JKCA 4IVOB 1YQZA 4Z25A 1PXCA 3AEEA 5JCLA 2FJBA 5CKUA 3RP8A 1F8RA 1H82A 2EQ8A 4J57A 2XFPA 1LTXR 3UOXA 1Y0PA 4EQRA 1LJ1A 4YSYA 1K0IA 4KX6A 1PBBA 1DJQA 5JCIA 4H7UA 2R46A 1DXLA 2AR8A 3LZWA 3S5WA 2CULA 4YTMA 3UCLA 4RSLA 4H4UA 1E39A 5KOXA 1NENA 2GV8A 3UKKA 5JCNA 1IUUA 2QCUA 1PBEA 4J2WA 1DNCA 1REOA 4USRA 2ZZBA 3DGHA 3GDPA 4ZCCA 4PABA 4B65A 3UP4A 3HYVA 4B67A 2E5VA 2R4JA 4OPDA 4H4YA 2GRTA 1QO8A 3AE4A 1DOBA 4CY6A 3I3LA 4GAVA 1F6MA 5U25A 2E4GA 1CJ2A 2R9ZA 1NHSA 4GDPA 4DNAA 4U2LA 1MOKA 3O0HA 3UTHA 5KMQA 4RG4A 1BF3A 1CBOA 1MXTA 2BC1A 2XLSA 1D4CA 2XVJA 1LVLA 2YG5A 3FIMB 2Y6QA 3NG7X 1CF3A 4H2NA 4OPTA 1ONFA 1DJNA 1GRBA 3NTDA 4TM4A 3CN8A 4NTEA 3II4A 1D4EA 3UOZA 3SFDA 3LOVA 1OJCA 1N4WA 5J60A 4K5RA 1GOSA 2XVIA 3AEAA 1GTEA 1PDHA 1CL0A 1LQTA 1VRQB 1YKJA 1N1PA 4EM3A 5U63A 2YR4A 5BUKA
chains in the Genus database with same CATH topology
1JNZA 1H7WA 2XFUA 2GR3A 2YWLA 3GD4A 1LQUA 4BV6A 4WCTA 1FEAA 2XYOA 2TMDA 1RYIA 2YG3A 3V3OA 4A6NB 5KMRA 3JSKA 1VQWA 1K0LA 4C3XA 4DSGA 3P4QA 1GTHA 4K5SA 4B1BA 2WOWA 4NEVA 2I0ZA 4NWZA 2WPCA 3GDNA 1CC6A 1BKWA 3ITJA 1B8SA 1EL9A 2V60A 4C77A 3ALMA 3GD3A 4ECHA 5KWFA 3DGZA 3AYLA 4X9MA 1P2HA 1CJ4A 1NPXA 4EIQA 4XWZA 3PVCA 1CHUA 3LXDA 3AE3A 3PS9A 3M0OA 2XFQA 4JY2A 4APNA 4YSHA 3BHFA 2ACZA 2QA1A 4EIPA 2VRMA 2H88A 1B37A 3D8XA 3AXBA 4Z26A 2XFOA 2YLTA 3CNTA 4U8JA 3AB1A 4GCMA 2JB2A 4G73A 2ZZCA 1K4QA 3GRSA 1ELIA 2GF3A 3QJ4A 4OPLA 2WPFA 4H2QA 3UTEA 4A9WA 4H4RA 2WESA 3KPKA 3P4SA 1PXBA 3BNUA 5GSNA 3GYXA 1V59A 3CIRA 1F8SA 2GR2A 3SQPA 3UKQA 4Z2UA 1BZLA 1PBFA 4CBQA 2NVKX 2C7GA 3GWFA 2DKHA 5FS6A 1KSSA 2RGJA 1E1NA 2CFYA 3DK8A 3G5QA 3NRNA 3OZ2A 1TDKA 2WOIA 3HYWA 2VVLA 2ZZ0A 4JN9A 5DBJA 3SYIA 4CCRA 4UDQA 2XVFA 4AT2A 1PN0A 2EQ9A 1IUWA 4B68A 1TDEA 1GSNA 2EQ6A 3ICTA 3NT6A 1LV0A 2VZ2A 2X8GA 1ZP0A 2GH5A 3EAOA 4J33A 3UP5A 4AT0A 3NK0X 4CCQA 3AEDA 1S3EA 3NTAA 5M10A 1ZY8A 5CQFA 1D4DA 4O5UA 1H7XA 2WBAA 3V3NA 3CPIG 2BS3A 4G9KA 3G5RA 2FJDA 1KNPA 2C72A 1FEBA 1F3PA 3UKHA 5JCMA 3UKFA 2YM2A 1PS9A 3UKAA 2C70A 5BRTA 4H2PA 2V6OA 3DK4A 3KVEA 2BS4A 3NGCX 5EB4A 4EMJA 3KA7A 2XLPA 3ALLA 1H86A 1NG3A 1YQ4A 3DJGX 4IV9A 1GRAA 1Q1WA 3PO7A 3T0KA 5C3JA 1ZOVA 1D5TA 4TLZA 4A7AA 3DMEA 3NHOX 4B64A 4C5OA 1O94A 3GYIA 2TPRA 4UDPA 2YVGA 3K30A 5KRQA 3AE6A 1BGJA 2WEUA 2B9WA 3SGLA 4G6HA 3BI4A 1TYTA 4X9NA 1O5WA 4U8IA 3NN0X 1FCDA 3QVPA 2GQFA 3P4RA 3AD9B 4XWRA 2C3CA 1RP0A 4YT0A 3LZXA 4OPGA 2WU2A 4PAAA 3VRAA 1EL8A 2BYBA 1UKVG 1NEKA 1ZMDA 2BA9A 3ZYXA 1L9CA 2VVLG 2BRYA 4OPCA 2YM1A 4U8MA 1YY5A 3NYFA 4GUVA 1DOCA 1JOAA 2YVJA 3GMCA 2RABA 1VG9A 5TR3A 4BJZA 2FJEA 1PJ5A 3AE8A 5KMSA 1NHQA 3QFAA 3DK9A 5LV9A 3FPZA 4U2TA 2YLXA 2WDVA 2APGA 3IC9A 3IWAA 4H2RA 3T14A 2BK3A 1K0JA 2R0GA 2YG6A 3CNDA 3KKJA 2BCGG 4FX9A 2UZZA 4NTDA 4NZHA 4C74A 1TDNA 2C65A 2Q0LA 2JB1A 1EL7A 4ZCDA 2QA2A 2XFNA 3COXA 1RSGA 2A89A 3BI5A 3FMWA 5U1OA 1GXFA 4A5LA 4CNKA 5HY5A 4HA6A 4K7ZA 2DKIA 2H89A 1CJ3A 4GF7A 5M0ZA 2X3NA 2VOUA 3F8DA 1GEUA 2C67A 3C4NA 3F8RA 2GMHA 1B4VA 2X8HA 3UOVA 3SY4A 2BABA 3RNMA 4YSZA 3T2KA 4LA1A 3K7TA 3Q6JA 3QSSA 1GPEA 2GVCA 1N4UA 1AOGA 3C4AA 2BXRA 3CGBA 1TRBA 2YLRA 4OVIA 1DODA 1L0VA 1QLBA 1OJ9A 4RG3A 4C3YA 2GAHB 3DJEA 2O9ZA 4A79A 1P2EA 3P9UA 4Y4LA 4YTPA 2WOVA 5FS9A 3CGEA 3FBSA 2XVHA 1GRGA 1KSUA 1GNDA 1JEHA 2CVJA 2VQ7A 1L9DA 4OPIA 3UTFA 1OJDA 4II2A 4B69A 4IVMB 3B6DA 2YR6A 1H83A 1M64A 2VQBA 2XLTA 4KPRA 1PXAA 2R0CA 3LADA 2HQMA 1E1MA 1COYA 1EL5A 3E1TA 5EOWA 3SZWA 3B3RA 1B5QA 3KLJA 5ER0A 1PBCA 3CTYA 3UKPA 2GMJA 1HYUA 3DJDA 1IUTA 1JRZA 3SXIA 2BK5A 2XVEA 3CPJG 3CGCA 1IJHA 1PJ6A 2YG7A 2R0PA 4YKFA 1E7PA 1JRXA 2B76A 2R4EA 3URHA 4EQSA 2OALA 3CNSA 2V3BA 1ZX9A 2AAQA 2GR0A 3CMMA 2IVDA 2VRLA 3T31A 3R9UA 3GWDA 2C75A 4FK1A 4H50A 2BACA 1ZOYA 3AEFA 1PBDA 4GRTA 4K2XA 2WDRA 4AP3A 2XLUA 3GRTA 2B7SA 2WP9A 1JU2A 3AWIA 4II3A 2JB3A 4BK3A 1PJ7A 5IQ4A 5KMPA 2BS2A 4Z44A 2YQUA 2B9YA 1OJTA 4ICYA 3VR9A 2C73A 4DGKA 1JNRA 2OLNA 4G6GA 4H4PA 4U8KA 4WX1A 4ADWA 3H4KA 1N4VA 4E0VA 4EMIA 2WQYA 1NG4A 3GSIA 2PHHA 3QSEA 2V61A 4U8NA 2WDQA 1XHCA 3ADAB 3RP6A 2GR1A 1GREA 3AYJA 3IHGA 4YWOA 3T2ZA 4CY8A 2WP6A 3UOYA 4HB9A 2VVMA 2GB0A 3UTGA 3SX6A 1Z6LA 4BK1A 1H81A 4J36A 3SZFA 4B63A 1TDOA 3AE7A 3SM8A 5L46A 4I59A 4Z24A 3LJPA 1IUVA 4IA5A 4YSXA 2YR5A 3M12A 3AD7B 4A65A 2JK6A 2YLZA 3GMBA 3NYCA 5C2TA 1GV4A 2BRAA 1NAAA 3NK2X 4FDCB 2Q7VA 4OPUA 1S3BA 5FMHA 1PHHA 3VQRA 1D7YA 3T37A 1BGNA 4JNAA 4GDEA 4ZN0A 2RGOA 4JNQA 3V76A 3DJJA 1KDGA 5FS8A 2J3NA 2PYXA 1Q1RA 3SZCA 5FS7A 1KFYA 4YTNA 4AOXA 3EPTA 2GQWA 4O5QA 3AE2A 3FG2P 3ICSA 4YXDA 1E1LA 1VDCA 2BC0A 4H4XA 3SFEA 2XCGA 3CGDA 3DH9A 2YG4A 3AE1A 1GRHA 2YLWA 5KOWA 3QVRA 1L9EA 3BHKA 4J34A 2WS3A 1H6VA 4EQXA 3AE5A 5IQ1A 2C64A 2OLOA 4EM4A 4MJWA 4H4ZA 2C76A 3Q9TA 4BURA 4K8DA 3G5SA 3IF9A 1F8WA 4Z2RA 2BK4A 1KNRA 2E1MA 1D7LA 3H8LA 1QJDA 4N9XA 4J56A 4REKA 1IUSA 2W0HA 2C4CA 2YVFA 1JRYA 4NNJA 1TYPA 2FBWA 3HZLA 2WETA 1W4XA 1IUXA 1GETA 1YQ3A 2Y6RA 2YAUA 4JQ9A 2Q6UA 1XDIA 1VG0A 3VRDB 3T2YA 3OC4A 5KNLA 2X99A 1GESA 2Z5YA 1XANA 4D03A 1E1KA 4J31A 4H4TA 3H8IA 3BNMA 3EANA 5KXJA 1OJAA 2X50A 3AD8B 1Y56A 1EBDA 1FOHA 3EF6A 3C96A 3I6DA 4LU6A 2FJAA 5JCKA 4EQWA 5BULA 1NDAA 3VRBA 1ZMCA 1H84A 2XDOA 3AEGA 3ZDNA 3S61A 4OCGA 2WU5A 3K7QX 3VR8A 4A99A 1S2QA 2A8XA 3L8KA 3ICRA 3AECA 1GT8A 2ARDA 2XLRA 2ZBWA 4IA6A 4G74A 3RP7A 1ZK7A 3KU9A 4U8OA 4X4JA 1ZKQA 5EBKA 1X31B 1ZDLA 1KF6A 3NK1X 2AQJA 4YKGA 2C66A 4XXGA 1NHRA 2IVEA 2V3AA 4EMWA 1Q9IA 5EB5A 5KVHA 4TM0A 2X8CA 3ATRA 3RHAA 4JY3A 4JDRA 2WHDA 3P1WA 1O95A 2B9XA 1GERA 3NNEA 1DOEA 3CPHG 4K22A 1FL2A 4BJYA 3ISHA 1M6IA 1GRTA 4UP3A 3DA1A 3CNJA 4Y4NA 4AP1A 3KD9A 1TDFA 5HYMA 2CDUA 1FECA 2QAEA 4FK1C 2V5ZA 3HYXA 3REDA 5HXIA 2BXSA 3L1RA 2F5ZA 3NN6X 1XPQA 2C3DA 3AYIA 5J7XA 4BK2A 1CC4A 5GRTA 2R45A 2NPXA 4UDRA 3AE9A 4NEWA 4U8LA 4DSHA 3QSMA 4TM1A 2A87A 3ATQA 2Z5XA 4USQA 3SZ0A 4Z2TA 1S2YA 3NKSA 4TLXA 2B7RA 3NH3X 4B66A 4Y4MA 3LB8A 1CJCA 4TM3A 5KVIA 3NYEA 2WP5A 2GEWA 2EQ7A 4H4WA 4I58A 4Z43A 1BWCA 4H4VA 3P4PA 1GRFA 3BI2A 4LIIA 4M52A 1E6EA 2OAMA 2RGHA 5HHFA 1SEZA 2WPEA 2YLSA 4H4SA 4CRTA 4P9SA 4D04A 3NLCA 3GYJA 3D1CA 3IHMA 3CNPA 5IPYA 5BVAA 1MO9A 3ALJA 3ABVA 4A6NA 4U2SA 2IIDA 3AEBA 2JAEA 2JBVA 3F8PA 1LPFA 1CC2A 1GALA 2Q0KA 4GAPA 3UKLA 2GAGB 3KPFA 4AOSA 3M13A 3K7MX 3NIXA 3QFBA 4NTCA 4GR1A 3WE0A 4H4QA 1Y56B 4CNJA 1NHPA 2BCPA 4U8PA 2OA1A 2JKCA 4IVOB 1YQZA 4Z25A 1PXCA 3AEEA 5JCLA 2FJBA 5CKUA 3RP8A 1F8RA 1H82A 2EQ8A 4J57A 2XFPA 1LTXR 3UOXA 1Y0PA 4EQRA 1LJ1A 4YSYA 1K0IA 4KX6A 1PBBA 1DJQA 5JCIA 4H7UA 2R46A 1DXLA 2AR8A 3LZWA 3S5WA 2CULA 4YTMA 3UCLA 4RSLA 4H4UA 1E39A 5KOXA 1NENA 2GV8A 3UKKA 5JCNA 1IUUA 2QCUA 1PBEA 4J2WA 1DNCA 1REOA 4USRA 2ZZBA 3DGHA 3GDPA 4ZCCA 4PABA 4B65A 3UP4A 3HYVA 4B67A 2E5VA 2R4JA 4OPDA 4H4YA 2GRTA 1QO8A 3AE4A 1DOBA 4CY6A 3I3LA 4GAVA 1F6MA 5U25A 2E4GA 1CJ2A 2R9ZA 1NHSA 4GDPA 4DNAA 4U2LA 1MOKA 3O0HA 3UTHA 5KMQA 4RG4A 1BF3A 1CBOA 1MXTA 2BC1A 2XLSA 1D4CA 2XVJA 1LVLA 2YG5A 3FIMB 2Y6QA 3NG7X 1CF3A 4H2NA 4OPTA 1ONFA 1DJNA 1GRBA 3NTDA 4TM4A 3CN8A 4NTEA 3II4A 1D4EA 3UOZA 3SFDA 3LOVA 1OJCA 1N4WA 5J60A 4K5RA 1GOSA 2XVIA 3AEAA 1GTEA 1PDHA 1CL0A 1LQTA 1VRQB 1YKJA 1N1PA 4EM3A 5U63A 2YR4A 5BUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNZ A;  1H7W A;  2XFU A;  2GR3 A;  2YWL A;  3GD4 A;  1LQU A;  4BV6 A;  4WCT A;  1FEA A;  2XYO A;  2TMD A;  1RYI A;  2YG3 A;  3V3O A;  4A6N B;  3JSK A;  1VQW A;  1K0L A;  4C3X A;  4DSG A;  3P4Q A;  1GTH A;  4K5S A;  4B1B A;  2WOW A;  4NEV A;  2I0Z A;  2WPC A;  3GDN A;  1CC6 A;  1BKW A;  3ITJ A;  1B8S A;  1EL9 A;  2V60 A;  4C77 A;  3ALM A;  3GD3 A;  4ECH A;  5KWF A;  3DGZ A;  3AYL A;  4X9M A;  1P2H A;  1CJ4 A;  1NPX A;  4EIQ A;  4XWZ A;  3PVC A;  1CHU A;  3LXD A;  3AE3 A;  3PS9 A;  3M0O A;  2XFQ A;  4JY2 A;  4APN A;  4YSH A;  3BHF A;  2ACZ A;  2QA1 A;  4EIP A;  2VRM A;  2H88 A;  1B37 A;  3D8X A;  3AXB A;  4Z26 A;  2XFO A;  2YLT A;  3CNT A;  4U8J A;  3AB1 A;  4GCM A;  2JB2 A;  2ZZC A;  1K4Q A;  3GRS A;  1ELI A;  2GF3 A;  3QJ4 A;  4OPL A;  2WPF A;  4H2Q A;  3UTE A;  4A9W A;  4H4R A;  2WES A;  3P4S A;  1PXB A;  3BNU A;  5GSN A;  1V59 A;  3CIR A;  1F8S A;  2GR2 A;  3SQP A;  3UKQ A;  4Z2U A;  1BZL A;  1PBF A;  4CBQ A;  2NVK X;  2C7G A;  3GWF A;  2DKH A;  5FS6 A;  1KSS A;  2RGJ A;  1E1N A;  2CFY A;  3DK8 A;  3G5Q A;  3NRN A;  3OZ2 A;  1TDK A;  2WOI A;  4JN9 A;  2VVL A;  2ZZ0 A;  5DBJ A;  4UDQ A;  2XVF A;  4AT2 A;  1PN0 A;  2EQ9 A;  1IUW A;  4B68 A;  1TDE A;  1GSN A;  2EQ6 A;  3ICT A;  3NT6 A;  1LV0 A;  2VZ2 A;  2X8G A;  1ZP0 A;  2GH5 A;  3EAO A;  4J33 A;  3UP5 A;  4AT0 A;  3NK0 X;  4CCQ A;  3AED A;  1S3E A;  3NTA A;  5M10 A;  1ZY8 A;  5CQF A;  1D4D A;  4O5U A;  1H7X A;  2WBA A;  3V3N A;  3CPI G;  2BS3 A;  3G5R A;  2FJD A;  1KNP A;  2C72 A;  1FEB A;  1F3P A;  3UKH A;  5JCM A;  3UKF A;  2YM2 A;  1PS9 A;  3UKA A;  2C70 A;  5BRT A;  4H2P A;  2V6O A;  3DK4 A;  3KVE A;  2BS4 A;  3NGC X;  5EB4 A;  4EMJ A;  3KA7 A;  2XLP A;  3ALL A;  1H86 A;  1NG3 A;  1YQ4 A;  3DJG X;  4IV9 A;  1GRA A;  1Q1W A;  3PO7 A;  5C3J A;  1ZOV A;  1D5T A;  4TLZ A;  4A7A A;  3DME A;  3NHO X;  4B64 A;  4C5O A;  1O94 A;  3GYI A;  2TPR A;  2YVG A;  3K30 A;  4UDP A;  5KRQ A;  3AE6 A;  1BGJ A;  2WEU A;  2B9W A;  3SGL A;  3BI4 A;  1TYT A;  4X9N A;  1O5W A;  4U8I A;  3NN0 X;  1FCD A;  3QVP A;  2GQF A;  3P4R A;  3AD9 B;  4XWR A;  2C3C A;  1RP0 A;  4YT0 A;  3LZX A;  4OPG A;  2WU2 A;  4PAA A;  3VRA A;  1EL8 A;  2BYB A;  1UKV G;  1NEK A;  1ZMD A;  2BA9 A;  3ZYX A;  1L9C A;  2VVL G;  4OPC A;  2YM1 A;  4U8M A;  1YY5 A;  3NYF A;  4GUV A;  1DOC A;  1JOA A;  2YVJ A;  3GMC A;  2RAB A;  1VG9 A;  5TR3 A;  4BJZ A;  2FJE A;  1PJ5 A;  3AE8 A;  1NHQ A;  3QFA A;  3DK9 A;  5LV9 A;  3FPZ A;  4U2T A;  2YLX A;  2WDV A;  2APG A;  3IC9 A;  3IWA A;  4H2R A;  2BK3 A;  1K0J A;  2R0G A;  2YG6 A;  3CND A;  3KKJ A;  2BCG G;  4FX9 A;  2UZZ A;  4NTD A;  4NZH A;  4C74 A;  1TDN A;  2C65 A;  2Q0L A;  2JB1 A;  1EL7 A;  4ZCD A;  2QA2 A;  2XFN A;  3COX A;  1RSG A;  2A89 A;  3BI5 A;  3FMW A;  5U1O A;  1GXF A;  4A5L A;  4CNK A;  5HY5 A;  4HA6 A;  4K7Z A;  2DKI A;  2H89 A;  1CJ3 A;  4GF7 A;  5M0Z A;  2X3N A;  2VOU A;  3F8D A;  1GEU A;  2C67 A;  3C4N A;  3F8R A;  2GMH A;  1B4V A;  2X8H A;  3UOV A;  2BAB A;  3RNM A;  4YSZ A;  4LA1 A;  3K7T A;  3Q6J A;  3QSS A;  1GPE A;  2GVC A;  1N4U A;  1AOG A;  3C4A A;  2BXR A;  3CGB A;  1TRB A;  2YLR A;  4OVI A;  1DOD A;  1L0V A;  1QLB A;  1OJ9 A;  4RG3 A;  4C3Y A;  2GAH B;  3DJE A;  2O9Z A;  4A79 A;  1P2E A;  3P9U A;  4Y4L A;  4YTP A;  2WOV A;  5FS9 A;  3CGE A;  3FBS A;  2XVH A;  1GRG A;  1KSU A;  1GND A;  1JEH A;  2CVJ A;  2VQ7 A;  1L9D A;  4OPI A;  3UTF A;  1OJD A;  4B69 A;  4IVM B;  3B6D A;  2YR6 A;  1H83 A;  1M64 A;  2VQB A;  2XLT A;  4KPR A;  1PXA A;  2R0C A;  3LAD A;  2HQM A;  1E1M A;  1COY A;  1EL5 A;  3E1T A;  5EOW A;  3B3R A;  1B5Q A;  3KLJ A;  5ER0 A;  1PBC A;  3CTY A;  3UKP A;  2GMJ A;  1HYU A;  3DJD A;  1IUT A;  1JRZ A;  2BK5 A;  2XVE A;  3CPJ G;  3CGC A;  1IJH A;  1PJ6 A;  2YG7 A;  2R0P A;  4YKF A;  1E7P A;  1JRX A;  2B76 A;  2R4E A;  3URH A;  4EQS A;  2OAL A;  3CNS A;  2V3B A;  1ZX9 A;  2AAQ A;  2GR0 A;  2IVD A;  2VRL A;  3R9U A;  3GWD A;  2C75 A;  4FK1 A;  4H50 A;  2BAC A;  1ZOY A;  3AEF A;  1PBD A;  4GRT A;  4K2X A;  2WDR A;  4AP3 A;  2XLU A;  3GRT A;  2B7S A;  2WP9 A;  1JU2 A;  3AWI A;  2JB3 A;  4BK3 A;  1PJ7 A;  5IQ4 A;  2BS2 A;  4Z44 A;  2YQU A;  2B9Y A;  1OJT A;  4ICY A;  3VR9 A;  2C73 A;  4DGK A;  1JNR A;  2OLN A;  4H4P A;  4U8K A;  4WX1 A;  4ADW A;  3H4K A;  1N4V A;  4E0V A;  4EMI A;  2WQY A;  1NG4 A;  3GSI A;  2PHH A;  3QSE A;  2V61 A;  4U8N A;  2WDQ A;  1XHC A;  3ADA B;  3RP6 A;  2GR1 A;  1GRE A;  3AYJ A;  3IHG A;  4YWO A;  4CY8 A;  2WP6 A;  3UOY A;  4HB9 A;  2VVM A;  2GB0 A;  3UTG A;  4BK1 A;  1Z6L A;  1H81 A;  4J36 A;  4B63 A;  1TDO A;  3AE7 A;  3SM8 A;  5L46 A;  4I59 A;  4Z24 A;  1IUV A;  3LJP A;  4IA5 A;  4YSX A;  2YR5 A;  3M12 A;  3AD7 B;  4A65 A;  2JK6 A;  2YLZ A;  3GMB A;  3NYC A;  5C2T A;  1GV4 A;  3NK2 X;  1NAA A;  4FDC B;  4OPU A;  2Q7V A;  5FMH A;  1S3B A;  1PHH A;  3VQR A;  1D7Y A;  3T37 A;  1BGN A;  4JNA A;  4GDE A;  4ZN0 A;  2RGO A;  4JNQ A;  3V76 A;  3DJJ A;  1KDG A;  5FS8 A;  2J3N A;  2PYX A;  1Q1R A;  5FS7 A;  1KFY A;  4YTN A;  4AOX A;  3EPT A;  2GQW A;  4O5Q A;  3AE2 A;  3FG2 P;  3ICS A;  4YXD A;  1E1L A;  1VDC A;  2BC0 A;  4H4X A;  3SFE A;  2XCG A;  3CGD A;  3DH9 A;  2YG4 A;  3AE1 A;  1GRH A;  2YLW A;  5KOW A;  3QVR A;  1L9E A;  3BHK A;  4J34 A;  2WS3 A;  1H6V A;  4EQX A;  3AE5 A;  5IQ1 A;  2C64 A;  2OLO A;  4EM4 A;  4MJW A;  4H4Z A;  2C76 A;  3Q9T A;  4BUR A;  4K8D A;  3G5S A;  3IF9 A;  1F8W A;  4Z2R A;  2BK4 A;  1KNR A;  2E1M A;  1D7L A;  3H8L A;  1QJD A;  4N9X A;  4J56 A;  4REK A;  1IUS A;  2W0H A;  2YVF A;  1JRY A;  1TYP A;  2FBW A;  3HZL A;  2WET A;  1W4X A;  1IUX A;  1GET A;  1YQ3 A;  2Y6R A;  2YAU A;  4JQ9 A;  2Q6U A;  1XDI A;  1VG0 A;  3VRD B;  3OC4 A;  2X99 A;  1GES A;  2Z5Y A;  1XAN A;  4D03 A;  1E1K A;  4J31 A;  4H4T A;  3H8I A;  3BNM A;  3EAN A;  5KXJ A;  1OJA A;  2X50 A;  3AD8 B;  1Y56 A;  1EBD A;  1FOH A;  3EF6 A;  3C96 A;  3I6D A;  4LU6 A;  2FJA A;  5JCK A;  4EQW A;  5BUL A;  1NDA A;  3VRB A;  1ZMC A;  1H84 A;  2XDO A;  3AEG A;  3ZDN A;  3S61 A;  4OCG A;  2WU5 A;  3K7Q X;  3VR8 A;  4A99 A;  1S2Q A;  2A8X A;  3L8K A;  3ICR A;  3AEC A;  1GT8 A;  2ARD A;  2XLR A;  2ZBW A;  4IA6 A;  3RP7 A;  4CCR A;  1ZK7 A;  3KU9 A;  4U8O A;  4X4J A;  1ZKQ A;  5EBK A;  1X31 B;  1ZDL A;  1KF6 A;  3NK1 X;  2AQJ A;  4YKG A;  2C66 A;  4XXG A;  1NHR A;  2IVE A;  2V3A A;  4EMW A;  1Q9I A;  5EB5 A;  5KVH A;  4TM0 A;  2X8C A;  3ATR A;  3RHA A;  4JY3 A;  4JDR A;  2WHD A;  3P1W A;  1O95 A;  2B9X A;  1GER A;  3NNE A;  1DOE A;  3CPH G;  4K22 A;  1FL2 A;  4BJY A;  3ISH A;  1M6I A;  1GRT A;  4UP3 A;  3DA1 A;  3CNJ A;  4Y4N A;  4AP1 A;  3KD9 A;  1TDF A;  5HYM A;  2CDU A;  1FEC A;  2QAE A;  4FK1 C;  2V5Z A;  3RED A;  5HXI A;  2BXS A;  3L1R A;  2F5Z A;  3NN6 X;  1XPQ A;  2C3D A;  3AYI A;  5J7X A;  4BK2 A;  1CC4 A;  5GRT A;  2R45 A;  2NPX A;  4NEW A;  3AE9 A;  4UDR A;  4U8L A;  4DSH A;  3QSM A;  4TM1 A;  2A87 A;  3ATQ A;  2Z5X A;  4USQ A;  4Z2T A;  1S2Y A;  3NKS A;  4TLX A;  2B7R A;  3NH3 X;  4B66 A;  4Y4M A;  3LB8 A;  1CJC A;  4TM3 A;  5KVI A;  3NYE A;  2WP5 A;  2GEW A;  2EQ7 A;  4H4W A;  4I58 A;  4Z43 A;  1BWC A;  4H4V A;  3P4P A;  1GRF A;  3BI2 A;  4LII A;  4M52 A;  1E6E A;  2OAM A;  2RGH A;  5HHF A;  1SEZ A;  2WPE A;  2YLS A;  4H4S A;  4CRT A;  4P9S A;  4D04 A;  3NLC A;  3GYJ A;  3D1C A;  3IHM A;  3CNP A;  5IPY A;  5BVA A;  1MO9 A;  3ALJ A;  3ABV A;  4A6N A;  4U2S A;  2IID A;  3AEB A;  2JAE A;  2JBV A;  3F8P A;  1LPF A;  1CC2 A;  1GAL A;  2Q0K A;  3UKL A;  2GAG B;  3KPF A;  4AOS A;  3M13 A;  3K7M X;  3NIX A;  3QFB A;  4NTC A;  4GR1 A;  3WE0 A;  4H4Q A;  1Y56 B;  4CNJ A;  1NHP A;  2BCP A;  4U8P A;  2OA1 A;  2JKC A;  4IVO B;  1YQZ A;  4Z25 A;  1PXC A;  3AEE A;  5JCL A;  2FJB A;  5CKU A;  3RP8 A;  1F8R A;  1H82 A;  2EQ8 A;  4J57 A;  2XFP A;  1LTX R;  3UOX A;  1Y0P A;  4EQR A;  1LJ1 A;  4YSY A;  1K0I A;  4KX6 A;  1PBB A;  1DJQ A;  5JCI A;  4H7U A;  2R46 A;  1DXL A;  2AR8 A;  3LZW A;  3S5W A;  2CUL A;  4YTM A;  3UCL A;  4RSL A;  4H4U A;  1E39 A;  5KOX A;  1NEN A;  2GV8 A;  3UKK A;  5JCN A;  1IUU A;  2QCU A;  1PBE A;  4J2W A;  1DNC A;  1REO A;  4USR A;  2ZZB A;  3DGH A;  3GDP A;  4ZCC A;  4PAB A;  4B65 A;  3UP4 A;  4B67 A;  2E5V A;  2R4J A;  4OPD A;  4H4Y A;  2GRT A;  1QO8 A;  3AE4 A;  1DOB A;  4CY6 A;  3I3L A;  1F6M A;  5U25 A;  2E4G A;  1CJ2 A;  2R9Z A;  1NHS A;  4GDP A;  4DNA A;  4U2L A;  1MOK A;  3O0H A;  3UTH A;  4RG4 A;  1BF3 A;  1CBO A;  1MXT A;  2BC1 A;  2XLS A;  1D4C A;  2XVJ A;  1LVL A;  2YG5 A;  3FIM B;  2Y6Q A;  3NG7 X;  1CF3 A;  4H2N A;  4OPT A;  1ONF A;  1DJN A;  1GRB A;  3NTD A;  4TM4 A;  3CN8 A;  4NTE A;  3II4 A;  1D4E A;  3UOZ A;  3SFD A;  3LOV A;  1OJC A;  1N4W A;  5J60 A;  4K5R A;  1GOS A;  2XVI A;  3AEA A;  1GTE A;  1PDH A;  1CL0 A;  1LQT A;  1VRQ B;  1YKJ A;  1N1P A;  4EM3 A;  5U63 A;  2YR4 A;  5BUK A; 
#chains in the Genus database with same CATH topology
 1JNZ A;  1H7W A;  2XFU A;  2GR3 A;  2YWL A;  3GD4 A;  1LQU A;  4BV6 A;  4WCT A;  1FEA A;  2XYO A;  2TMD A;  1RYI A;  2YG3 A;  3V3O A;  4A6N B;  5KMR A;  3JSK A;  1VQW A;  1K0L A;  4C3X A;  4DSG A;  3P4Q A;  1GTH A;  4K5S A;  4B1B A;  2WOW A;  4NEV A;  2I0Z A;  4NWZ A;  2WPC A;  3GDN A;  1CC6 A;  1BKW A;  3ITJ A;  1B8S A;  1EL9 A;  2V60 A;  4C77 A;  3ALM A;  3GD3 A;  4ECH A;  5KWF A;  3DGZ A;  3AYL A;  4X9M A;  1P2H A;  1CJ4 A;  1NPX A;  4EIQ A;  4XWZ A;  3PVC A;  1CHU A;  3LXD A;  3AE3 A;  3PS9 A;  3M0O A;  2XFQ A;  4JY2 A;  4APN A;  4YSH A;  3BHF A;  2ACZ A;  2QA1 A;  4EIP A;  2VRM A;  2H88 A;  1B37 A;  3D8X A;  3AXB A;  4Z26 A;  2XFO A;  2YLT A;  3CNT A;  4U8J A;  3AB1 A;  4GCM A;  2JB2 A;  4G73 A;  2ZZC A;  1K4Q A;  3GRS A;  1ELI A;  2GF3 A;  3QJ4 A;  4OPL A;  2WPF A;  4H2Q A;  3UTE A;  4A9W A;  4H4R A;  2WES A;  3KPK A;  3P4S A;  1PXB A;  3BNU A;  5GSN A;  3GYX A;  1V59 A;  3CIR A;  1F8S A;  2GR2 A;  3SQP A;  3UKQ A;  4Z2U A;  1BZL A;  1PBF A;  4CBQ A;  2NVK X;  2C7G A;  3GWF A;  2DKH A;  5FS6 A;  1KSS A;  2RGJ A;  1E1N A;  2CFY A;  3DK8 A;  3G5Q A;  3NRN A;  3OZ2 A;  1TDK A;  2WOI A;  3HYW A;  2VVL A;  2ZZ0 A;  4JN9 A;  5DBJ A;  3SYI A;  4CCR A;  4UDQ A;  2XVF A;  4AT2 A;  1PN0 A;  2EQ9 A;  1IUW A;  4B68 A;  1TDE A;  1GSN A;  2EQ6 A;  3ICT A;  3NT6 A;  1LV0 A;  2VZ2 A;  2X8G A;  1ZP0 A;  2GH5 A;  3EAO A;  4J33 A;  3UP5 A;  4AT0 A;  3NK0 X;  4CCQ A;  3AED A;  1S3E A;  3NTA A;  5M10 A;  1ZY8 A;  5CQF A;  1D4D A;  4O5U A;  1H7X A;  2WBA A;  3V3N A;  3CPI G;  2BS3 A;  4G9K A;  3G5R A;  2FJD A;  1KNP A;  2C72 A;  1FEB A;  1F3P A;  3UKH A;  5JCM A;  3UKF A;  2YM2 A;  1PS9 A;  3UKA A;  2C70 A;  5BRT A;  4H2P A;  2V6O A;  3DK4 A;  3KVE A;  2BS4 A;  3NGC X;  5EB4 A;  4EMJ A;  3KA7 A;  2XLP A;  3ALL A;  1H86 A;  1NG3 A;  1YQ4 A;  3DJG X;  4IV9 A;  1GRA A;  1Q1W A;  3PO7 A;  3T0K A;  5C3J A;  1ZOV A;  1D5T A;  4TLZ A;  4A7A A;  3DME A;  3NHO X;  4B64 A;  4C5O A;  1O94 A;  3GYI A;  2TPR A;  4UDP A;  2YVG A;  3K30 A;  5KRQ A;  3AE6 A;  1BGJ A;  2WEU A;  2B9W A;  3SGL A;  4G6H A;  3BI4 A;  1TYT A;  4X9N A;  1O5W A;  4U8I A;  3NN0 X;  1FCD A;  3QVP A;  2GQF A;  3P4R A;  3AD9 B;  4XWR A;  2C3C A;  1RP0 A;  4YT0 A;  3LZX A;  4OPG A;  2WU2 A;  4PAA A;  3VRA A;  1EL8 A;  2BYB A;  1UKV G;  1NEK A;  1ZMD A;  2BA9 A;  3ZYX A;  1L9C A;  2VVL G;  2BRY A;  4OPC A;  2YM1 A;  4U8M A;  1YY5 A;  3NYF A;  4GUV A;  1DOC A;  1JOA A;  2YVJ A;  3GMC A;  2RAB A;  1VG9 A;  5TR3 A;  4BJZ A;  2FJE A;  1PJ5 A;  3AE8 A;  5KMS A;  1NHQ A;  3QFA A;  3DK9 A;  5LV9 A;  3FPZ A;  4U2T A;  2YLX A;  2WDV A;  2APG A;  3IC9 A;  3IWA A;  4H2R A;  3T14 A;  2BK3 A;  1K0J A;  2R0G A;  2YG6 A;  3CND A;  3KKJ A;  2BCG G;  4FX9 A;  2UZZ A;  4NTD A;  4NZH A;  4C74 A;  1TDN A;  2C65 A;  2Q0L A;  2JB1 A;  1EL7 A;  4ZCD A;  2QA2 A;  2XFN A;  3COX A;  1RSG A;  2A89 A;  3BI5 A;  3FMW A;  5U1O A;  1GXF A;  4A5L A;  4CNK A;  5HY5 A;  4HA6 A;  4K7Z A;  2DKI A;  2H89 A;  1CJ3 A;  4GF7 A;  5M0Z A;  2X3N A;  2VOU A;  3F8D A;  1GEU A;  2C67 A;  3C4N A;  3F8R A;  2GMH A;  1B4V A;  2X8H A;  3UOV A;  3SY4 A;  2BAB A;  3RNM A;  4YSZ A;  3T2K A;  4LA1 A;  3K7T A;  3Q6J A;  3QSS A;  1GPE A;  2GVC A;  1N4U A;  1AOG A;  3C4A A;  2BXR A;  3CGB A;  1TRB A;  2YLR A;  4OVI A;  1DOD A;  1L0V A;  1QLB A;  1OJ9 A;  4RG3 A;  4C3Y A;  2GAH B;  3DJE A;  2O9Z A;  4A79 A;  1P2E A;  3P9U A;  4Y4L A;  4YTP A;  2WOV A;  5FS9 A;  3CGE A;  3FBS A;  2XVH A;  1GRG A;  1KSU A;  1GND A;  1JEH A;  2CVJ A;  2VQ7 A;  1L9D A;  4OPI A;  3UTF A;  1OJD A;  4II2 A;  4B69 A;  4IVM B;  3B6D A;  2YR6 A;  1H83 A;  1M64 A;  2VQB A;  2XLT A;  4KPR A;  1PXA A;  2R0C A;  3LAD A;  2HQM A;  1E1M A;  1COY A;  1EL5 A;  3E1T A;  5EOW A;  3SZW A;  3B3R A;  1B5Q A;  3KLJ A;  5ER0 A;  1PBC A;  3CTY A;  3UKP A;  2GMJ A;  1HYU A;  3DJD A;  1IUT A;  1JRZ A;  3SXI A;  2BK5 A;  2XVE A;  3CPJ G;  3CGC A;  1IJH A;  1PJ6 A;  2YG7 A;  2R0P A;  4YKF A;  1E7P A;  1JRX A;  2B76 A;  2R4E A;  3URH A;  4EQS A;  2OAL A;  3CNS A;  2V3B A;  1ZX9 A;  2AAQ A;  2GR0 A;  3CMM A;  2IVD A;  2VRL A;  3T31 A;  3R9U A;  3GWD A;  2C75 A;  4FK1 A;  4H50 A;  2BAC A;  1ZOY A;  3AEF A;  1PBD A;  4GRT A;  4K2X A;  2WDR A;  4AP3 A;  2XLU A;  3GRT A;  2B7S A;  2WP9 A;  1JU2 A;  3AWI A;  4II3 A;  2JB3 A;  4BK3 A;  1PJ7 A;  5IQ4 A;  5KMP A;  2BS2 A;  4Z44 A;  2YQU A;  2B9Y A;  1OJT A;  4ICY A;  3VR9 A;  2C73 A;  4DGK A;  1JNR A;  2OLN A;  4G6G A;  4H4P A;  4U8K A;  4WX1 A;  4ADW A;  3H4K A;  1N4V A;  4E0V A;  4EMI A;  2WQY A;  1NG4 A;  3GSI A;  2PHH A;  3QSE A;  2V61 A;  4U8N A;  2WDQ A;  1XHC A;  3ADA B;  3RP6 A;  2GR1 A;  1GRE A;  3AYJ A;  3IHG A;  4YWO A;  3T2Z A;  4CY8 A;  2WP6 A;  3UOY A;  4HB9 A;  2VVM A;  2GB0 A;  3UTG A;  3SX6 A;  1Z6L A;  4BK1 A;  1H81 A;  4J36 A;  3SZF A;  4B63 A;  1TDO A;  3AE7 A;  3SM8 A;  5L46 A;  4I59 A;  4Z24 A;  3LJP A;  1IUV A;  4IA5 A;  4YSX A;  2YR5 A;  3M12 A;  3AD7 B;  4A65 A;  2JK6 A;  2YLZ A;  3GMB A;  3NYC A;  5C2T A;  1GV4 A;  2BRA A;  1NAA A;  3NK2 X;  4FDC B;  2Q7V A;  4OPU A;  1S3B A;  5FMH A;  1PHH A;  3VQR A;  1D7Y A;  3T37 A;  1BGN A;  4JNA A;  4GDE A;  4ZN0 A;  2RGO A;  4JNQ A;  3V76 A;  3DJJ A;  1KDG A;  5FS8 A;  2J3N A;  2PYX A;  1Q1R A;  3SZC A;  5FS7 A;  1KFY A;  4YTN A;  4AOX A;  3EPT A;  2GQW A;  4O5Q A;  3AE2 A;  3FG2 P;  3ICS A;  4YXD A;  1E1L A;  1VDC A;  2BC0 A;  4H4X A;  3SFE A;  2XCG A;  3CGD A;  3DH9 A;  2YG4 A;  3AE1 A;  1GRH A;  2YLW A;  5KOW A;  3QVR A;  1L9E A;  3BHK A;  4J34 A;  2WS3 A;  1H6V A;  4EQX A;  3AE5 A;  5IQ1 A;  2C64 A;  2OLO A;  4EM4 A;  4MJW A;  4H4Z A;  2C76 A;  3Q9T A;  4BUR A;  4K8D A;  3G5S A;  3IF9 A;  1F8W A;  4Z2R A;  2BK4 A;  1KNR A;  2E1M A;  1D7L A;  3H8L A;  1QJD A;  4N9X A;  4J56 A;  4REK A;  1IUS A;  2W0H A;  2C4C A;  2YVF A;  1JRY A;  4NNJ A;  1TYP A;  2FBW A;  3HZL A;  2WET A;  1W4X A;  1IUX A;  1GET A;  1YQ3 A;  2Y6R A;  2YAU A;  4JQ9 A;  2Q6U A;  1XDI A;  1VG0 A;  3VRD B;  3T2Y A;  3OC4 A;  5KNL A;  2X99 A;  1GES A;  2Z5Y A;  1XAN A;  4D03 A;  1E1K A;  4J31 A;  4H4T A;  3H8I A;  3BNM A;  3EAN A;  5KXJ A;  1OJA A;  2X50 A;  3AD8 B;  1Y56 A;  1EBD A;  1FOH A;  3EF6 A;  3C96 A;  3I6D A;  4LU6 A;  2FJA A;  5JCK A;  4EQW A;  5BUL A;  1NDA A;  3VRB A;  1ZMC A;  1H84 A;  2XDO A;  3AEG A;  3ZDN A;  3S61 A;  4OCG A;  2WU5 A;  3K7Q X;  3VR8 A;  4A99 A;  1S2Q A;  2A8X A;  3L8K A;  3ICR A;  3AEC A;  1GT8 A;  2ARD A;  2XLR A;  2ZBW A;  4IA6 A;  4G74 A;  3RP7 A;  1ZK7 A;  3KU9 A;  4U8O A;  4X4J A;  1ZKQ A;  5EBK A;  1X31 B;  1ZDL A;  1KF6 A;  3NK1 X;  2AQJ A;  4YKG A;  2C66 A;  4XXG A;  1NHR A;  2IVE A;  2V3A A;  4EMW A;  1Q9I A;  5EB5 A;  5KVH A;  4TM0 A;  2X8C A;  3ATR A;  3RHA A;  4JY3 A;  4JDR A;  2WHD A;  3P1W A;  1O95 A;  2B9X A;  1GER A;  3NNE A;  1DOE A;  3CPH G;  4K22 A;  1FL2 A;  4BJY A;  3ISH A;  1M6I A;  1GRT A;  4UP3 A;  3DA1 A;  3CNJ A;  4Y4N A;  4AP1 A;  3KD9 A;  1TDF A;  5HYM A;  2CDU A;  1FEC A;  2QAE A;  4FK1 C;  2V5Z A;  3HYX A;  3RED A;  5HXI A;  2BXS A;  3L1R A;  2F5Z A;  3NN6 X;  1XPQ A;  2C3D A;  3AYI A;  5J7X A;  4BK2 A;  1CC4 A;  5GRT A;  2R45 A;  2NPX A;  4UDR A;  3AE9 A;  4NEW A;  4U8L A;  4DSH A;  3QSM A;  4TM1 A;  2A87 A;  3ATQ A;  2Z5X A;  4USQ A;  3SZ0 A;  4Z2T A;  1S2Y A;  3NKS A;  4TLX A;  2B7R A;  3NH3 X;  4B66 A;  4Y4M A;  3LB8 A;  1CJC A;  4TM3 A;  5KVI A;  3NYE A;  2WP5 A;  2GEW A;  2EQ7 A;  4H4W A;  4I58 A;  4Z43 A;  1BWC A;  4H4V A;  3P4P A;  1GRF A;  3BI2 A;  4LII A;  4M52 A;  1E6E A;  2OAM A;  2RGH A;  5HHF A;  1SEZ A;  2WPE A;  2YLS A;  4H4S A;  4CRT A;  4P9S A;  4D04 A;  3NLC A;  3GYJ A;  3D1C A;  3IHM A;  3CNP A;  5IPY A;  5BVA A;  1MO9 A;  3ALJ A;  3ABV A;  4A6N A;  4U2S A;  2IID A;  3AEB A;  2JAE A;  2JBV A;  3F8P A;  1LPF A;  1CC2 A;  1GAL A;  2Q0K A;  4GAP A;  3UKL A;  2GAG B;  3KPF A;  4AOS A;  3M13 A;  3K7M X;  3NIX A;  3QFB A;  4NTC A;  4GR1 A;  3WE0 A;  4H4Q A;  1Y56 B;  4CNJ A;  1NHP A;  2BCP A;  4U8P A;  2OA1 A;  2JKC A;  4IVO B;  1YQZ A;  4Z25 A;  1PXC A;  3AEE A;  5JCL A;  2FJB A;  5CKU A;  3RP8 A;  1F8R A;  1H82 A;  2EQ8 A;  4J57 A;  2XFP A;  1LTX R;  3UOX A;  1Y0P A;  4EQR A;  1LJ1 A;  4YSY A;  1K0I A;  4KX6 A;  1PBB A;  1DJQ A;  5JCI A;  4H7U A;  2R46 A;  1DXL A;  2AR8 A;  3LZW A;  3S5W A;  2CUL A;  4YTM A;  3UCL A;  4RSL A;  4H4U A;  1E39 A;  5KOX A;  1NEN A;  2GV8 A;  3UKK A;  5JCN A;  1IUU A;  2QCU A;  1PBE A;  4J2W A;  1DNC A;  1REO A;  4USR A;  2ZZB A;  3DGH A;  3GDP A;  4ZCC A;  4PAB A;  4B65 A;  3UP4 A;  3HYV A;  4B67 A;  2E5V A;  2R4J A;  4OPD A;  4H4Y A;  2GRT A;  1QO8 A;  3AE4 A;  1DOB A;  4CY6 A;  3I3L A;  4GAV A;  1F6M A;  5U25 A;  2E4G A;  1CJ2 A;  2R9Z A;  1NHS A;  4GDP A;  4DNA A;  4U2L A;  1MOK A;  3O0H A;  3UTH A;  5KMQ A;  4RG4 A;  1BF3 A;  1CBO A;  1MXT A;  2BC1 A;  2XLS A;  1D4C A;  2XVJ A;  1LVL A;  2YG5 A;  3FIM B;  2Y6Q A;  3NG7 X;  1CF3 A;  4H2N A;  4OPT A;  1ONF A;  1DJN A;  1GRB A;  3NTD A;  4TM4 A;  3CN8 A;  4NTE A;  3II4 A;  1D4E A;  3UOZ A;  3SFD A;  3LOV A;  1OJC A;  1N4W A;  5J60 A;  4K5R A;  1GOS A;  2XVI A;  3AEA A;  1GTE A;  1PDH A;  1CL0 A;  1LQT A;  1VRQ B;  1YKJ A;  1N1P A;  4EM3 A;  5U63 A;  2YR4 A;  5BUK A; 
#chains in the Genus database with same CATH homology
 1JNZ A;  1H7W A;  2XFU A;  2GR3 A;  2YWL A;  3GD4 A;  1LQU A;  4BV6 A;  4WCT A;  1FEA A;  2XYO A;  2TMD A;  1RYI A;  2YG3 A;  3V3O A;  4A6N B;  5KMR A;  3JSK A;  1VQW A;  1K0L A;  4C3X A;  4DSG A;  3P4Q A;  1GTH A;  4K5S A;  4B1B A;  2WOW A;  4NEV A;  2I0Z A;  4NWZ A;  2WPC A;  3GDN A;  1CC6 A;  1BKW A;  3ITJ A;  1B8S A;  1EL9 A;  2V60 A;  4C77 A;  3ALM A;  3GD3 A;  4ECH A;  5KWF A;  3DGZ A;  3AYL A;  4X9M A;  1P2H A;  1CJ4 A;  1NPX A;  4EIQ A;  4XWZ A;  3PVC A;  1CHU A;  3LXD A;  3AE3 A;  3PS9 A;  3M0O A;  2XFQ A;  4JY2 A;  4APN A;  4YSH A;  3BHF A;  2ACZ A;  2QA1 A;  4EIP A;  2VRM A;  2H88 A;  1B37 A;  3D8X A;  3AXB A;  4Z26 A;  2XFO A;  2YLT A;  3CNT A;  4U8J A;  3AB1 A;  4GCM A;  2JB2 A;  4G73 A;  2ZZC A;  1K4Q A;  3GRS A;  1ELI A;  2GF3 A;  3QJ4 A;  4OPL A;  2WPF A;  4H2Q A;  3UTE A;  4A9W A;  4H4R A;  2WES A;  3KPK A;  3P4S A;  1PXB A;  3BNU A;  5GSN A;  3GYX A;  1V59 A;  3CIR A;  1F8S A;  2GR2 A;  3SQP A;  3UKQ A;  4Z2U A;  1BZL A;  1PBF A;  4CBQ A;  2NVK X;  2C7G A;  3GWF A;  2DKH A;  5FS6 A;  1KSS A;  2RGJ A;  1E1N A;  2CFY A;  3DK8 A;  3G5Q A;  3NRN A;  3OZ2 A;  1TDK A;  2WOI A;  3HYW A;  2VVL A;  2ZZ0 A;  4JN9 A;  5DBJ A;  3SYI A;  4CCR A;  4UDQ A;  2XVF A;  4AT2 A;  1PN0 A;  2EQ9 A;  1IUW A;  4B68 A;  1TDE A;  1GSN A;  2EQ6 A;  3ICT A;  3NT6 A;  1LV0 A;  2VZ2 A;  2X8G A;  1ZP0 A;  2GH5 A;  3EAO A;  4J33 A;  3UP5 A;  4AT0 A;  3NK0 X;  4CCQ A;  3AED A;  1S3E A;  3NTA A;  5M10 A;  1ZY8 A;  5CQF A;  1D4D A;  4O5U A;  1H7X A;  2WBA A;  3V3N A;  3CPI G;  2BS3 A;  4G9K A;  3G5R A;  2FJD A;  1KNP A;  2C72 A;  1FEB A;  1F3P A;  3UKH A;  5JCM A;  3UKF A;  2YM2 A;  1PS9 A;  3UKA A;  2C70 A;  5BRT A;  4H2P A;  2V6O A;  3DK4 A;  3KVE A;  2BS4 A;  3NGC X;  5EB4 A;  4EMJ A;  3KA7 A;  2XLP A;  3ALL A;  1H86 A;  1NG3 A;  1YQ4 A;  3DJG X;  4IV9 A;  1GRA A;  1Q1W A;  3PO7 A;  3T0K A;  5C3J A;  1ZOV A;  1D5T A;  4TLZ A;  4A7A A;  3DME A;  3NHO X;  4B64 A;  4C5O A;  1O94 A;  3GYI A;  2TPR A;  4UDP A;  2YVG A;  3K30 A;  5KRQ A;  3AE6 A;  1BGJ A;  2WEU A;  2B9W A;  3SGL A;  4G6H A;  3BI4 A;  1TYT A;  4X9N A;  1O5W A;  4U8I A;  3NN0 X;  1FCD A;  3QVP A;  2GQF A;  3P4R A;  3AD9 B;  4XWR A;  2C3C A;  1RP0 A;  4YT0 A;  3LZX A;  4OPG A;  2WU2 A;  4PAA A;  3VRA A;  1EL8 A;  2BYB A;  1UKV G;  1NEK A;  1ZMD A;  2BA9 A;  3ZYX A;  1L9C A;  2VVL G;  2BRY A;  4OPC A;  2YM1 A;  4U8M A;  1YY5 A;  3NYF A;  4GUV A;  1DOC A;  1JOA A;  2YVJ A;  3GMC A;  2RAB A;  1VG9 A;  5TR3 A;  4BJZ A;  2FJE A;  1PJ5 A;  3AE8 A;  5KMS A;  1NHQ A;  3QFA A;  3DK9 A;  5LV9 A;  3FPZ A;  4U2T A;  2YLX A;  2WDV A;  2APG A;  3IC9 A;  3IWA A;  4H2R A;  3T14 A;  2BK3 A;  1K0J A;  2R0G A;  2YG6 A;  3CND A;  3KKJ A;  2BCG G;  4FX9 A;  2UZZ A;  4NTD A;  4NZH A;  4C74 A;  1TDN A;  2C65 A;  2Q0L A;  2JB1 A;  1EL7 A;  4ZCD A;  2QA2 A;  2XFN A;  3COX A;  1RSG A;  2A89 A;  3BI5 A;  3FMW A;  5U1O A;  1GXF A;  4A5L A;  4CNK A;  5HY5 A;  4HA6 A;  4K7Z A;  2DKI A;  2H89 A;  1CJ3 A;  4GF7 A;  5M0Z A;  2X3N A;  2VOU A;  3F8D A;  1GEU A;  2C67 A;  3C4N A;  3F8R A;  2GMH A;  1B4V A;  2X8H A;  3UOV A;  3SY4 A;  2BAB A;  3RNM A;  4YSZ A;  3T2K A;  4LA1 A;  3K7T A;  3Q6J A;  3QSS A;  1GPE A;  2GVC A;  1N4U A;  1AOG A;  3C4A A;  2BXR A;  3CGB A;  1TRB A;  2YLR A;  4OVI A;  1DOD A;  1L0V A;  1QLB A;  1OJ9 A;  4RG3 A;  4C3Y A;  2GAH B;  3DJE A;  2O9Z A;  4A79 A;  1P2E A;  3P9U A;  4Y4L A;  4YTP A;  2WOV A;  5FS9 A;  3CGE A;  3FBS A;  2XVH A;  1GRG A;  1KSU A;  1GND A;  1JEH A;  2CVJ A;  2VQ7 A;  1L9D A;  4OPI A;  3UTF A;  1OJD A;  4II2 A;  4B69 A;  4IVM B;  3B6D A;  2YR6 A;  1H83 A;  1M64 A;  2VQB A;  2XLT A;  4KPR A;  1PXA A;  2R0C A;  3LAD A;  2HQM A;  1E1M A;  1COY A;  1EL5 A;  3E1T A;  5EOW A;  3SZW A;  3B3R A;  1B5Q A;  3KLJ A;  5ER0 A;  1PBC A;  3CTY A;  3UKP A;  2GMJ A;  1HYU A;  3DJD A;  1IUT A;  1JRZ A;  3SXI A;  2BK5 A;  2XVE A;  3CPJ G;  3CGC A;  1IJH A;  1PJ6 A;  2YG7 A;  2R0P A;  4YKF A;  1E7P A;  1JRX A;  2B76 A;  2R4E A;  3URH A;  4EQS A;  2OAL A;  3CNS A;  2V3B A;  1ZX9 A;  2AAQ A;  2GR0 A;  3CMM A;  2IVD A;  2VRL A;  3T31 A;  3R9U A;  3GWD A;  2C75 A;  4FK1 A;  4H50 A;  2BAC A;  1ZOY A;  3AEF A;  1PBD A;  4GRT A;  4K2X A;  2WDR A;  4AP3 A;  2XLU A;  3GRT A;  2B7S A;  2WP9 A;  1JU2 A;  3AWI A;  4II3 A;  2JB3 A;  4BK3 A;  1PJ7 A;  5IQ4 A;  5KMP A;  2BS2 A;  4Z44 A;  2YQU A;  2B9Y A;  1OJT A;  4ICY A;  3VR9 A;  2C73 A;  4DGK A;  1JNR A;  2OLN A;  4G6G A;  4H4P A;  4U8K A;  4WX1 A;  4ADW A;  3H4K A;  1N4V A;  4E0V A;  4EMI A;  2WQY A;  1NG4 A;  3GSI A;  2PHH A;  3QSE A;  2V61 A;  4U8N A;  2WDQ A;  1XHC A;  3ADA B;  3RP6 A;  2GR1 A;  1GRE A;  3AYJ A;  3IHG A;  4YWO A;  3T2Z A;  4CY8 A;  2WP6 A;  3UOY A;  4HB9 A;  2VVM A;  2GB0 A;  3UTG A;  3SX6 A;  1Z6L A;  4BK1 A;  1H81 A;  4J36 A;  3SZF A;  4B63 A;  1TDO A;  3AE7 A;  3SM8 A;  5L46 A;  4I59 A;  4Z24 A;  3LJP A;  1IUV A;  4IA5 A;  4YSX A;  2YR5 A;  3M12 A;  3AD7 B;  4A65 A;  2JK6 A;  2YLZ A;  3GMB A;  3NYC A;  5C2T A;  1GV4 A;  2BRA A;  1NAA A;  3NK2 X;  4FDC B;  2Q7V A;  4OPU A;  1S3B A;  5FMH A;  1PHH A;  3VQR A;  1D7Y A;  3T37 A;  1BGN A;  4JNA A;  4GDE A;  4ZN0 A;  2RGO A;  4JNQ A;  3V76 A;  3DJJ A;  1KDG A;  5FS8 A;  2J3N A;  2PYX A;  1Q1R A;  3SZC A;  5FS7 A;  1KFY A;  4YTN A;  4AOX A;  3EPT A;  2GQW A;  4O5Q A;  3AE2 A;  3FG2 P;  3ICS A;  4YXD A;  1E1L A;  1VDC A;  2BC0 A;  4H4X A;  3SFE A;  2XCG A;  3CGD A;  3DH9 A;  2YG4 A;  3AE1 A;  1GRH A;  2YLW A;  5KOW A;  3QVR A;  1L9E A;  3BHK A;  4J34 A;  2WS3 A;  1H6V A;  4EQX A;  3AE5 A;  5IQ1 A;  2C64 A;  2OLO A;  4EM4 A;  4MJW A;  4H4Z A;  2C76 A;  3Q9T A;  4BUR A;  4K8D A;  3G5S A;  3IF9 A;  1F8W A;  4Z2R A;  2BK4 A;  1KNR A;  2E1M A;  1D7L A;  3H8L A;  1QJD A;  4N9X A;  4J56 A;  4REK A;  1IUS A;  2W0H A;  2C4C A;  2YVF A;  1JRY A;  4NNJ A;  1TYP A;  2FBW A;  3HZL A;  2WET A;  1W4X A;  1IUX A;  1GET A;  1YQ3 A;  2Y6R A;  2YAU A;  4JQ9 A;  2Q6U A;  1XDI A;  1VG0 A;  3VRD B;  3T2Y A;  3OC4 A;  5KNL A;  2X99 A;  1GES A;  2Z5Y A;  1XAN A;  4D03 A;  1E1K A;  4J31 A;  4H4T A;  3H8I A;  3BNM A;  3EAN A;  5KXJ A;  1OJA A;  2X50 A;  3AD8 B;  1Y56 A;  1EBD A;  1FOH A;  3EF6 A;  3C96 A;  3I6D A;  4LU6 A;  2FJA A;  5JCK A;  4EQW A;  5BUL A;  1NDA A;  3VRB A;  1ZMC A;  1H84 A;  2XDO A;  3AEG A;  3ZDN A;  3S61 A;  4OCG A;  2WU5 A;  3K7Q X;  3VR8 A;  4A99 A;  1S2Q A;  2A8X A;  3L8K A;  3ICR A;  3AEC A;  1GT8 A;  2ARD A;  2XLR A;  2ZBW A;  4IA6 A;  4G74 A;  3RP7 A;  1ZK7 A;  3KU9 A;  4U8O A;  4X4J A;  1ZKQ A;  5EBK A;  1X31 B;  1ZDL A;  1KF6 A;  3NK1 X;  2AQJ A;  4YKG A;  2C66 A;  4XXG A;  1NHR A;  2IVE A;  2V3A A;  4EMW A;  1Q9I A;  5EB5 A;  5KVH A;  4TM0 A;  2X8C A;  3ATR A;  3RHA A;  4JY3 A;  4JDR A;  2WHD A;  3P1W A;  1O95 A;  2B9X A;  1GER A;  3NNE A;  1DOE A;  3CPH G;  4K22 A;  1FL2 A;  4BJY A;  3ISH A;  1M6I A;  1GRT A;  4UP3 A;  3DA1 A;  3CNJ A;  4Y4N A;  4AP1 A;  3KD9 A;  1TDF A;  5HYM A;  2CDU A;  1FEC A;  2QAE A;  4FK1 C;  2V5Z A;  3HYX A;  3RED A;  5HXI A;  2BXS A;  3L1R A;  2F5Z A;  3NN6 X;  1XPQ A;  2C3D A;  3AYI A;  5J7X A;  4BK2 A;  1CC4 A;  5GRT A;  2R45 A;  2NPX A;  4UDR A;  3AE9 A;  4NEW A;  4U8L A;  4DSH A;  3QSM A;  4TM1 A;  2A87 A;  3ATQ A;  2Z5X A;  4USQ A;  3SZ0 A;  4Z2T A;  1S2Y A;  3NKS A;  4TLX A;  2B7R A;  3NH3 X;  4B66 A;  4Y4M A;  3LB8 A;  1CJC A;  4TM3 A;  5KVI A;  3NYE A;  2WP5 A;  2GEW A;  2EQ7 A;  4H4W A;  4I58 A;  4Z43 A;  1BWC A;  4H4V A;  3P4P A;  1GRF A;  3BI2 A;  4LII A;  4M52 A;  1E6E A;  2OAM A;  2RGH A;  5HHF A;  1SEZ A;  2WPE A;  2YLS A;  4H4S A;  4CRT A;  4P9S A;  4D04 A;  3NLC A;  3GYJ A;  3D1C A;  3IHM A;  3CNP A;  5IPY A;  5BVA A;  1MO9 A;  3ALJ A;  3ABV A;  4A6N A;  4U2S A;  2IID A;  3AEB A;  2JAE A;  2JBV A;  3F8P A;  1LPF A;  1CC2 A;  1GAL A;  2Q0K A;  4GAP A;  3UKL A;  2GAG B;  3KPF A;  4AOS A;  3M13 A;  3K7M X;  3NIX A;  3QFB A;  4NTC A;  4GR1 A;  3WE0 A;  4H4Q A;  1Y56 B;  4CNJ A;  1NHP A;  2BCP A;  4U8P A;  2OA1 A;  2JKC A;  4IVO B;  1YQZ A;  4Z25 A;  1PXC A;  3AEE A;  5JCL A;  2FJB A;  5CKU A;  3RP8 A;  1F8R A;  1H82 A;  2EQ8 A;  4J57 A;  2XFP A;  1LTX R;  3UOX A;  1Y0P A;  4EQR A;  1LJ1 A;  4YSY A;  1K0I A;  4KX6 A;  1PBB A;  1DJQ A;  5JCI A;  4H7U A;  2R46 A;  1DXL A;  2AR8 A;  3LZW A;  3S5W A;  2CUL A;  4YTM A;  3UCL A;  4RSL A;  4H4U A;  1E39 A;  5KOX A;  1NEN A;  2GV8 A;  3UKK A;  5JCN A;  1IUU A;  2QCU A;  1PBE A;  4J2W A;  1DNC A;  1REO A;  4USR A;  2ZZB A;  3DGH A;  3GDP A;  4ZCC A;  4PAB A;  4B65 A;  3UP4 A;  3HYV A;  4B67 A;  2E5V A;  2R4J A;  4OPD A;  4H4Y A;  2GRT A;  1QO8 A;  3AE4 A;  1DOB A;  4CY6 A;  3I3L A;  4GAV A;  1F6M A;  5U25 A;  2E4G A;  1CJ2 A;  2R9Z A;  1NHS A;  4GDP A;  4DNA A;  4U2L A;  1MOK A;  3O0H A;  3UTH A;  5KMQ A;  4RG4 A;  1BF3 A;  1CBO A;  1MXT A;  2BC1 A;  2XLS A;  1D4C A;  2XVJ A;  1LVL A;  2YG5 A;  3FIM B;  2Y6Q A;  3NG7 X;  1CF3 A;  4H2N A;  4OPT A;  1ONF A;  1DJN A;  1GRB A;  3NTD A;  4TM4 A;  3CN8 A;  4NTE A;  3II4 A;  1D4E A;  3UOZ A;  3SFD A;  3LOV A;  1OJC A;  1N4W A;  5J60 A;  4K5R A;  1GOS A;  2XVI A;  3AEA A;  1GTE A;  1PDH A;  1CL0 A;  1LQT A;  1VRQ B;  1YKJ A;  1N1P A;  4EM3 A;  5U63 A;  2YR4 A;  5BUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...