1NAHA

Udp-galactose 4-epimerase from escherichia coli, reduced
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE 4-EPIMERASE
publication title Crystal structures of the oxidized and reduced forms of UDP-galactose 4-epimerase isolated from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 131
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1995-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nahA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1nahA01
3NX4A 4OIMA 4D0RA 4IBOA 3PK0A 5BNIA 5TF4A 1RPNA 2W8ZA 1G1AA 1NR7A 2JKVA 1YONA 1V6AA 3JQFC 4II2A 2ZJ0A 1PSDA 4URFA 2Y99A 4LGVA 1VKOA 4KOAA 1KEPA 2DTEA 3H5RA 3V5NA 4J9VA 1K2WA 3AUTA 3PHGA 4BO2A 3QRWA 2C0CA 3BMQA 4GQAA 4B4WA 1W4ZA 3GPIA 3ZV3A 4J0FA 4HADA 4OM8A 3WYBA 2VHVA 3LK7A 1OC2A 5JDCC 3U4DA 3D3EA 4E5KA 1E3EA 1P1KA 4ITUA 3H3FA 2Z5LA 3FPLA 3FN4A 4J4TA 4FC7A 4TSKA 2J5RA 1HDOA 4I8XA 3GUCA 2O2SA 3QLJA 1A72A 3H7AA 1UDAA 3QW2A 5JCJA 1ONPA 1WDLA 2WE8A 3OECA 2HJSA 4B8WA 2PZMA 2XPCA 1U5AA 5IXSA 3M1AA 1P1HA 4PVDA 2V6GA 4UUOA 4DIBA 4IDGA 1GFSA 1BDBA 1FK8A 3BA1A 5C37A 1EK6A 4HFJA 1BMDA 1JQBA 2Q49A 5HWSA 1DOHA 1ZKMA 3JQFA 5BSHA 3UXYA 4ND1A 4CM7A 3FI9A 1H6AA 5A5EA 1QR6A 3D4PA 1HE5A 4MVJH 1FF9A 2D8AA 3WGQA 4RVFA 2G5CA 3LC2O 3UH1A 1I2BA 2P9GA 2C07A 1NQAO 2GYYA 1BTOA 1R0KA 2XXJA 4FFMA 4O1MA 3WLEA 4DPLA 3LF1A 1I2CA 5HTOA 2DU8A 1ZMOA 1JKJA 3OEYA 4FR5A 5JDIC 3ZWOA 1EDOA 2I65A 1E1MA 3E03A 2EP7A 4DYVA 5JDCA 4N5LA 2VZ9A 3VKVA 1SNYA 3LZ6A 2VWQA 5K9ZA 3ITDA 1LSSA 4DLAA 4BS9A 2EWMA 4NIMA 1PR3A 5CG2A 1EVYA 3PPIA 4WLNA 2J3JA 3RUCA 5L3ZA 4BQRA 2I99A 2VRBA 3GPDG 4YJGA 4ZU3A 4O59O 2HK8A 3ROPA 1C0IA 1HLPA 1HSZA 4IDFA 2IYPA 2NVUB 5CFZA 4GH5A 3ASVA 3UCFA 1I10A 4CM8A 4K28A 3RROA 2PV7A 4BO9A 3GK3A 3PJDA 4DIOA 2P5UA 4UULA 2AMFA 1JA9A 2G0TA 3HFGA 3M6IA 3VKUA 3MTJA 3BHIA 2PK3A 1RM0A 4TZTA 4EGFA 2GPTA 2DT5A 4G5HA 4YACA 5DBGA 5IN5A 1S7CA 3GMSA 5U1PA 1EEHA 1RJWA 3JQ7A 1OBFO 4H16A 1T2CA 3DOOA 3FPCA 4OH1A 1DAOA 3WDSA 4FB5A 3BHMA 3QIVA 3E9QA 5JPIA 3UCEA 1KEWA 5JDIA 1Q7GA 3U09A 3ANMA 3S2GA 2OP1A 3PQFA 2W90A 3UUWA 1NHWA 1KVSA 4R3NA 4AJPA 5BQFA 2PGJA 5AXDA 1LC0A 4IINA 4BGIA 3CINA 3IKVA 2OL4A 3HADA 3P5SA 5TLSA 2NTVA 1D8AA 2PY6A 4BV9A 1H0KA 2C7GA 2O3UA 3BMCB 4Z3DA 1N7GA 1MX3A 3I6IA 3P7MA 3ANLA 4DPKA 1EUCA 1ISIA 3C85A 2OHXA 5DBIA 4Z0PA 3LYLA 4BKUA 1I5RA 3ZHYA 4YJDA 5L4SA 1NM5A 1YL5A 1IULA 1CF2O 4K6CA 1HDRA 1NFQA 1R4MA 2HMTA 1VJTA 1HDXA 1BW9B 2J3KA 2EGHA 4Q9NA 3RQSA 1PS8A 1LRKA 2VUTA 4NR0A 4BO1A 4MVJF 4XDYA 4A2CA 4RF5A 3CMMA 4BGVA 1J6UA 2JFFA 3HWRA 5U4QA 1M66A 3NT2A 3LU1A 4RQTA 1R0LA 2F1KA 1ZK1A 4IXTA 4ZICA 3GQVA 4OHUA 4R41A 4LCEA 3MJCA 1VE9A 4YJFB 4YQYA 3FCOA 4XZ3A 2QYSA 3BYZA 4CJXA 3AWDA 3ITKA 2J3IA 4J9UE 1DJQA 3DOJA 2HUNA 3C1TA 3F5QA 4NNJA 4XQEA 5CDTA 3FTPA 3WWZA 5H83A 2CDCA 2Y0DA 1EBFA 3EZYA 3JD1A 5T57A 5ICSA 1GYRA 3ZU3A 4ND4A 2DBZA 4E33A 1A4UA 1K5HA 1W73A 1Z74A 4PG5A 1NP3A 1DJNA 2D59A 3DHEA 4GLLA 3PZBA 2FSVA 5JY1A 2CY0A 2A35A 5L4NA 1XQ6A 4JLWA 3ZHXA 3H65A 2Y0CA 4FIZA 4DUPA 3V1UA 4YPOA 1IE3A 4MVJD 1B2LA 5FF9A 3WFIA 3WSVA 5KJCA 1KC1A 3O8QB 4NDNE 4CQMB 1TT5A 2DBRA 1WW8A 5DT9A 4GX2A 3C7DB 2PZKA 4E5NA 5FI3A 3RD5A 2ZJ1A 5JBIA 2GGSA 2DFDA 2HJRA 4IDCA 1P44A 3L07A 1DC5A 1YS4A 3QWIA 4R5MA 4E6PA 1XCBA 4KZPA 3T7CA 2VUUA 4OGWA 4RVGA 4FJ1A 1NTOA 1EBUA 2NU7A 2YQ5A 4TQGA 4XRRA 1RM4A 5JAZA 4OKNA 4TZKA 2GSDA 1HEUA 3OJLA 1DPGA 4ONEA 3JQGB 1E92A 2UUOA 1N7HA 1U7HA 1XU7A 2BGMA 2VYVD 1L7EA 3EUWA 3RBXA 4PN3A 3T7EA 1LLCA 3E9MA 4GSLA 4JX8A 3INTA 1T4DA 1C14A 3OJEA 4BNMA 3JQ6A 2O50A 3JQAD 2A92A 2BH9A 4YBZA 4CLEA 5B4VA 4N5NA 2C20A 3M1LA 2QRKA 1NASA 1A5ZA 1LQTA 1MB4A 3IOYA 4L74A 4UUPA 3PQEA 2QHXA 5THQA 3FNGA 4BNUA 3KSDO 2CVQA 3L6DA 5EQFA 2XF8A 4KQXA 1B7GO 4KP7A 4PLYA 4IJVA 4C7KA 3ZV6A 4IM7A 2VYNA 4DVJA 1LNQA 4GKVA 4GLOA 4R54A 2YV3A 3I9JA 1V3UA 1LBEA 1QORA 3CUKA 1X15A 3KUXA 1EVJA 4OYRA 4RORA 4XWYA 4ALLA 1PL6A 2OUIA 2UUPA 1PEDA 4L4RA 2VZ8A 3PYXA 1MP0A 3K96A 4JNKA 5G0UA 3ZW8A 1EK5A 1HYEA 1XELA 4WPGA 1CRWG 3G49A 1P3DA 4U7WA 3QVXA 4PG6A 2V6MA 1LLDA 1JLLA 3F47A 1KVUA 2ZTUA 5DOVA 3EC7A 5GY7A 2JFGA 5JYDA 4XKJA 1I8TA 4O63O 1U4SA 3HUDA 1HSOA 2I67A 2G1UA 5JYEA 1NAHA 2V6BA 4I1IA 4DIFA 3VHRA 5ADHA 3VZPA 1WP4A 5HS4A 1B15A 5T6BA 2EEZA 4U8GA 1WNTA 3MJEA 1G6KA 2DTXA 3WQRA 3FWZA 2VHYA 3EHEA 2FR8A 4GKBA 2FR0A 3A4VA 2C5AA 3U5TA 3QWBA 3K2EA 4Q3DA 4O5OA 4MIEA 3ZV4A 1PS0A 1YRLA 4TRMA 5L9AA 3OP4A 1ULSA 1B8UA 4UEJA 5CDSA 1QLJA 3I5MA 5JMPA 3PWKA 3VPGA 4FFOA 3ZWXA 4QEDA 2HCTA 2EERA 2LDXA 3LT2A 4JBHA 3CIFA 1X1TA 3INGA 3SC6A 3ZNQA 4BNJA 1ISHA 5DCWA 4E5MA 5L45A 5EPOA 1Q1NA 1H93A 3QWHA 1DO8A 3JYNA 4PIVA 5I8ZA 1LDMA 1U5CA 3DONA 2C2YA 1MG0A 5IDQA 3DZKA 2CVOA 3L4SO 5L40A 3R6DA 2CD9A 1R4NB 2C29D 5JCJD 5KKCA 2JHGA 1MUUA 3DWFA 3ZU4A 2DVMA 3GT0A 1IPFA 3AUAA 2Q50A 3A1NA 1NVTA 3DAPA 4QSMA 4LVUA 2PZLA 1NYTA 4NFSA 3ZWPA 4M8SA 1SPXA 3I52A 4Y9DA 2J6IA 3KHUA 4HFRA 5I9LA 2IXBA 1AE1A 1JAYA 1V35A 5EQDA 4BO0A 4OJNA 3IUPA 3BZUA 1V3VA 2I6TA 4II3A 3Q2IA 1LQUA 1NX6A 1CDOA 3KYDB 2DUWA 1ZXBA 3MOGA 3RUEA 4NBTA 3TZHA 3WGOA 4KUEA 3NT5A 3VVBA 1UR5A 2GERA 1BVUA 1XDWA 3LT4A 1GD1O 3AY7A 1E1KA 5L7WA 1D7OA 4XGIA 1GV0A 2JHFA 2VWPA 2O3TA 1WAMA 2ZKLA 3U49A 4B7XA 2PFGA 2D4AA 4NHEA 3TWOA 1LDYA 5GZ6A 3WBFA 4DC1A 1PIWA 1OFGA 3H9JA 3NGXA 3W4JA 4BB5A 1QV7A 1LX6A 3UHAA 4CMIB 4YRBA 2OOSA 2Q46A 4NBUA 3WJ7A 5B37A 5A1TA 5CDUA 2RBEA 4U6SA 1HL3A 1P9LA 3UFXA 1GUYA 3ZWCA 4ZJUA 1LSJA 1F06A 1DDOA 1GU7A 4E2YA 3GY0A 1BG6A 3PFWO 3W6ZA 3PRJA 3DFUA 4XQ9A 2EKPA 3H5NA 3RKRA 1K0UA 3DHYA 4FPXA 1NVGA 2FR1A 2HMWA 2PZJA 4LISA 3RIHA 5ENVA 4AJ1A 3R3SA 3IC5A 4BNHA 4AJKA 3JYOA 3PWZA 5EJ2A 1KS9A 2CVZA 1XWFA 1Y81A 2HK7A 2VRCD 4J7CA 4MVJE 4N7RA 4F46A 4F6LA 1U3VA 4CLRA 2AG8A 1GTMA 5KJ1A 4BO7A 3RFVA 1FXSA 1DIAA 1E7QA 3ICPA 1AUPA 2CF5A 1XLTA 1H5QA 2BHLA 4CUJA 2HMUA 5DBFA 5A3VA 3UGKA 3QVTA 4K1LA 3DZHA 3NEPX 4FJ0A 1I33A 4L8VA 4WOJA 3SJ7A 3NDIA 4YT5A 4BNVA 1U3TA 3PJEA 3PDJA 1BXGB 1NAIA 4CR6A 2AE1A 3V1TC 1Z45A 3ASUA 4PG4A 4A03A 1K3TA 1EE9A 5BR7A 5T8KC 4MKXA 4OOEA 4ALIA 3H5AA 2NU6A 1YGYA 3GRKA 3K92A 3M2PA 3K73O 2AEFA 2J8ZA 4IPTA 4IJWA 4R1SA 2GCGA 1C1DB 1PR9A 4BGEA 1KVRA 2WYWA 2YFQA 2BD0A 2B5VA 4HWKA 1U4OA 2E49A 3AFMA 2Y1CA 4XQGA 4W7IA 2BMAA 1A7AA 1TLTA 2AQIA 4R69A 5ILGA 1GAEO 2QG4A 3ON5A 1SMKA 5A02A 2DFVA 4RPGA 3KYCA 5FFFA 1H2HA 4RJTA 1E3JA 1QP8A 2EJWA 2FRDA 4CM3A 2CDBA 4PLGA 3F4BA 4IMRA 4CLDA 4CR8A 1TT7A 4NU6A 4AL4A 4MVJA 5KTKA 4FOOA 2Y1DA 4MPDA 5J23A 1ONOA 1E1NA 3RBVA 5CAEA 4HFMA 3GNQA 1RYDA 4LRTB 1U3UA 1ZIDA 3HB4X 5B12A 3KV3O 1V3TA 2AW5A 1RKXA 4XJTA 2IXAA 4J4HA 2B37A 2GZ1A 3AOEC 5A9RA 4QECA 1N9GA 2RH8A 4R9RA 3HE3A 3EAGA 5IN4A 1PZHA 5T8KA 4BB6A 2PLAA 3AI1A 3PXXA 3FHLA 2I9PA 4LCJA 2YV2A 5DZSA 1XYGA 5COAA 1B26A 2OMEA 3GDOA 1R0SA 3FTNA 3LF2A 3OH8A 1WMAA 3OQ6A 4YYZA 5JO0A 2VYVA 4OXYA 3F6YA 3QE3A 5KJFA 4IY1A 1DLIA 1Z73A 2IYOA 2YZ7A 1LLUA 3TFOA 3JQAA 2OXIA 4E2WA 1DIHA 2GRAA 3B1JA 4OXKA 2UDPA 4P38A 5JAQA 4GBJA 4XGKA 4YRAA 4LSMA 1UXHA 3NUGA 3OQ1A 5F5NA 5F21A 3FWNA 5IF3A 4Z3KA 1PWZA 2NTNA 4MDHA 4TROA 4ZRNA 3ZN2A 3L9XA 4RVHA 2DKNA 3DMYA 4FDAA 3DDNA 1WWKA 2H9IA 4M55A 1M2WA 1NFFA 1VKNA 3PLRA 2O2YA 3IL2A 1DFIA 4PZDA 3WWYA 1X0XA 1ENYA 2HMVA 2Q4EA 3GGPA 1ZW1A 5BSGA 1A4IA 5CEFA 3QQPA 3PLNA 3ST7A 4HNHA 4CLOA 4YCAA 4N54A 3AOEA 3BTSA 1DFGA 3WGZA 4DLLA 3WGHA 5EERA 4RLHA 4WOKA 4BNZA 1EQ2A 1CQJA 2A4KA 4MKZA 1ZMTA 1CYDA 1D4FA 1CQIA 4PCVA 8ADHA 1YBAA 2EF1A 3MWDB 2DTDA 3JD2A 4D79A 1HDYA 4W7HA 2X22A 3C1AA 2YQ4A 3FRJA 4RZIA 4IZIA 3JYLA 3RUIA 5KJEA 3DBLA 5CHEA 4D41A 4E13A 2Q2VA 4AVYA 3TZQA 2WE7A 5JCXA 1E7WA 5KJ6A 4J1SA 1V8BA 3D3WA 3SXPA 4KMSA 1Y5RA 3AFNA 1C1XB 4E2XA 1UUFA 1MA0A 1YOVB 4FQ8A 2HU2A 1DC3A 1N2SA 2CZCA 3DTYA 1DAPA 4ND5A 1LDNA 3GVXA 2VWHA 4AJLA 4YT8A 1NWCA 3MJTA 3MJ4A 2R00A 4IQGA 5L7TA 4IJUA 4ZQHA 4IQ0A 4TKLA 2BFAA 1EFLA 1M76A 1Y8RB 2A9FA 1H94A 3DBRB 1ONNA 1ZK3A 3EK2A 4W4TA 4ZQFA 5F1PA 3VAZA 4DBZA 4WE3A 1QV6A 1XEAA 1VJ1A 1G0OA 1Y8QA 3KZVA 2DPGA 5CP8A 1XKQA 3GLQA 1KVQA 5THKA 4CMHA 4CLHA 2NQ8A 1CIVA 1NPDA 3GH3A 1PGNA 4J49A 4J6FA 1T2DA 3LLSA 4BMVA 1W6UA 1H6DA 1YKFA 3K30A 1I3KA 1TXGA 4PLFA 2AXQA 2Y1GA 2X9NA 4L9RA 1IYZA 3MWEB 4JXKA 4GVLA 3IP1A 3RC1A 5IG2A 3QVSA 3BTVA 3VZSA 5T64A 2WSBA 1GCUA 4WLVA 4OMUA 1C3VA 4Q3CA 1UP7A 3GHYA 3GVCA 1ZEMA 3F4LA 2O3RA 3GG9A 3AI2A 2FZEA 1K89A 3C7AA 3KEQA 1XA0A 2OORA 2HMSA 4CL8A 3K5PA 3CMCO 4IDDA 3JQDA 4CMEC 1E5QA 1DRVA 1ORRA 5I8WA 4GL4A 1JU9A 1HZJA 1ZSNA 3OQBA 1A7KA 1I3MA 1IL0A 1OZAA 3AK4A 4NU5A 4CMCA 2GN8A 1KY4A 2P4QA 2YHIA 2FN7A 3H8VA 3TQHA 4U5QA 4NQZA 2YFHA 4PG8A 3DZJA 4YJHA 4IZHA 4CMJA 1DIGA 3SEFA 4YA6A 1KIFA 2W2KA 4A7PA 1E3WB 3QY9A 3L6EA 4UAGA 1ZH8A 2GN6A 2VCYA 4L75A 4B3JA 1MFZA 3RSHA 2EW8A 4E5PA 5IAAA 5BT9A 4IS3A 3PIIA 2ZK7A 5MGBA 4NFHA 5LDHA 1R6DA 5KOIA 2D5AA 4WCFB 4GX5A 2FY8A 4IXWA 4B3IA 1YVEI 2O4CA 3INRA 1E6EA 4ND2A 4OSOA 5TQVA 1QG6A 1VL0A 4NBRA 2XAAA 1QYWA 1WPQA 3EDMA 3F46A 1XIVA 2YDXA 3WNVA 3RU7A 5A3JA 1HE3A 1NBOA 5L51A 3PHJA 4NK5A 1J5PA 1K6XA 3TSCA 1A9YA 4TVOA 2PH5A 1KC3A 1NWHA 5AYVA 1BVRA 1VC2A 2VRCA 3DHNA 4GI2A 1QXSA 4R5HA 3OHSX 3WNQA 7ADHA 2RH4A 3RBZA 2P68A 2BF7A 1SAYA 1VSUA 4G65A 3GEMA 3VC7A 3VPFA 2P4HX 4Y6RA 3EW7A 1P77A 1CERA 2X58A 3RKUA 2V65A 3WYEA 4NZ9A 1E3IA 2ZQZA 4JP3A 1NR1A 3LT0A 2C59A 3CSDA 5G4LA 2H1SA 3OSUA 1T25A 3E1KA 3KOUA 2DBVO 1ZXLA 1WDKA 3P19A 2VNSA 4IS2A 2WD7A 1HLDA 4Q3NA 5A9SA 4CV3A 4CQLB 4L4XA 4I9UA 1ZFNA 1I0ZA 3ZWMA 1PJCA 1UAYA 5KKAA 4UVIA 4JGBA 1JWBB 2DAPA 3JQ8A 2VOEA 1ISFA 1PJBA 1YBVA 3EGOA 4WJZA 3L9WA 3BMNA 3I9OA 5I7VA 3AW9A 3FR7A 3UAGA 3WQSB 1PZEA 5L95A 5U9CA 2PD4A 4GVXA 1LDEA 3UVEA 2X9VA 3BAZA 4RO0A 4WLEA 4EZBA 4YWJA 1EMDA 2FMUA 3WS7A 4B4VA 4EJ6A 3PHIA 3EVTA 5MDHA 6ADHA 3ZV5A 4Z9FA 4BNIA 4IMPA 2ZCUA 3I9MA 4YVFA 1JKFA 5G4KB 2X86A 3SBOA 5L4LA 1T1RA 3KVOA 2VNAA 5COQA 4C7JA 3CZRA 3GDFA 5TNXA 1NPTO 4WCDA 5DDIP 4GWKA 3GVHA 4XJSA 5IZCC 1LA2A 2DM6A 2Z95A 3OJFA 1UJMA 3AUSA 3NTOA 2EGGA 4BUCA 1E7MA 4IQ8A 3GAZA 4UVEA 3OJOA 3GG2A 1GZ6A 1Z7EA 3DFZA 4DMLA 1PJ4A 1H9BA 5FI5A 4EUHA 4I9HA 3TL2A 4S1VA 5HM8A 2JFHA 2PTGA 4NH4A 1LSUA 3FF4A 2DPHA 5JSFA 1Y6JA 1TI7A 5CPFA 4A0SA 1I32A 3GEDA 3R0IA 3DZGA 4YRDA 1T24A 5IDWA 3ZWWA 3GR6A 4Q3BA 1LTHR 4WUVA 5HRUA 1CJCA 3GN2A 3C1OA 4B4OA 2IZ1A 4DBVO 4RVDA 1FDTA 5AXBA 1DBVO 1AN9A 4XA8A 3NYWA 3Q2KA 4EW6A 4RPKA 3OBBA 3GFBA 2PA3A 4JCOA 5JC8A 2E37A 4XD2A 3PWSA 4HX5A 3IDSA 4IDAA 2G76A 3GZNA 4NJMB 4UVGA 4AFNA 4QFCA 3DOCA 4JROA 3IUSA 3H6KA 4QTZA 2Q2WA 4BNYA 1PGJA 2JCXA 2P2SA 3OETA 2Y05A 4FJ2A 3U9LA 3RFXA 1GZ3A 2NQTA 1YL6A 4IIVA 3JYPA 4CM4A 1GPDG 1PJTA 1WMBA 4WEQA 3HN2A 3RUDA 3VH3A 4RCVA 3TOXA 5I7EA 3IKTA 2HDHA 2RCYA 3PGXA 2Y67A 3VH4A 3KTDA 1IY8A 3GGOA 1PQWA 2Q1UA 3GF4A 5COBA 3A06A 2X5JO 1UZMA 2GZ2A 3D1LA 3FBGA 1PGOA 3BMQB 2I66A 4J16A 4M86A 2RHCA 3I4CA 4CL3A 2Q45A 1IZ0A 2QIOA 5GZ3A 4R1UA 3QHAA 1QRRA 3ULKA 2EG9A 1FDWA 1KYQA 4LMPA 4Q39A 1B16A 3D0OA 3HB5X 2GR9A 3ZU2A 2Y66A 3KM0A 1AGNA 4AJNA 2EKLA 1GQ2A 3K8ZA 1WVGA 3RJ5A 4UEOA 2WYUA 4YAIA 2Y93A 1SEPA 2P91A 2IZ0A 3BMOA 3PP8A 3R3JA 2VOJA 5HBRA 4GPD1 3NV9A 4R1NA 3DBHA 5JY6A 2I5PO 5DNAA 1KY5A 5TJ9A 3ADPA 4XR4A 4JP2A 1GQYA 4ALMA 4RDIA 4XYBA 4YTEA 4RL6A 5DP1A 2X5KO 1HTBA 3VPSA 4Y6SA 4D3SA 1JWAB 3RC2A 1EQUA 2B35A 3B6ZA 1QYVA 1GL3A 3HZZA 3TDKA 1HKUA 3S2FA 4CQMD 1ZSVA 2PD6A 1KBZA 5B4TA 3HNPA 3H2ZA 3KLPX 1SB8A 1TEHA 3D5QA 4ROSA 3FR8A 1L7DA 3FSRA 2VTDA 1T2FA 3GC6A 5I7FA 2X0RA 2FHSA 3C24A 1WDMA 3MJSA 2YUTA 3TZKA 4CLXA 4HKTA 4OL9A 4YT2A 3PTZA 4MJLA 3U4CA 4GMFA 5BSEA 2C5EA 1ZSYA 2AQHA 4Z9YA 2FPPA 4MIOA 5AQ1A 1JDJA 3FD8A 3GGGA 2NNLD 4IJKA 3ZZNA 1HETA 2O7SA 4IDBA 1I3LA 3WYCA 3WBBA 2GASA 4A5OA 4JK3A 3JQ9C 2QX7A 3IIEA 1RWBA 3PJGA 4H7PA 1P45A 1ADCA 3VTFA 4YJGB 4W6ZA 4BNFA 3RASA 5DP2A 3ZHBA 1P74A 1CWUA 4YAJA 3AJRA 4CM8B 6LDHA 3B1KA 8LDHA 1WXDA 1WZEA 1RM3A 1P31A 1ISGA 2JAPA 4DLBA 3PGJA 3WXBA 4CM9D 3NDRA 4DWVA 3GEGA 2J5KA 4RLSA 4BV8A 3O03A 1PJ3A 4CM6A 4D7AA 4BQPA 1Y9AA 4MVJG 5F1KA 3AUUA 1LEHA 1GYQA 1MG5A 3RC9A 3JQ7B 5JMWA 4GGOA 1E77A 5BNTA 3G1TA 4AJOA 2R6JA 3EZLA 1PL8A 2ZYDA 3QWFA 2Q1WA 2DC1A 3V8BA 4D43A 1IHXA 1NNUA 4MVJI 5A9TA 5IDXA 5G2OA 2X6TA 2QYTA 1YE3A 2YDYA 3LC1O 3OICA 4ZD6A 4EUEA 1YB4A 1GYPA 2BLLA 4FW8A 4RF4A 3RC7A 3W4IA 1LC3A 1VM6A 3WTBA 1F17A 1PJSA 1YDWA 3SLGA 5EMHA 4B79A 4BNTA 3AM3A 1SOVA 1MGOA 3KSZO 3Q1LA 4CV2A 2OBYA 3OIFA 5IFLA 3WJAA 1O6ZA 2JAHA 4J43A 2JJYA 3SVTA 4QXMA 2PH3A 3LVFO 1NPYA 3P2OA 2HSDA 2NU9A 2VUSA 1R4MB 2NV6A 3IMFA 4PRKA 2ZB8A 3ROKA 2ILTA 1XSEA 2VWGA 4R3WA 5CDYA 1JW9B 1HRDA 3TN7A 4R51A 4CUZA 2RAFA 4MP3A 2V6FA 2FOIA 4WCFC 3U4HA 4CMAA 3HDJA 3G0OA 3U3XA 4RF3A 3RI3A 1SO8A 3F1LA 5FWNA 1EDZA 3LQFA 3QVWA 2C82A 2W2LD 1TVEA 5G0WA 3WMWA 4FFLA 2QRLA 3ONEA 2AEJA 5DULA 4ND3A 4LMRA 5TC4A 1H2BA 3IP3A 4A73A 3LC7O 1F8FA 1W8DA 4JIGA 4LK3A 5AVOA 2QW8A 2X9GA 1JN0A 2GN4A 1ARZA 3NT4A 3OJ0A 5CEJA 4ZN6A 2ZATA 1GZ4A 1IPEA 4U0KA 4XEHA 2Q3EA 4ZQBA 4R9SA 4EDFA 3JSAA 5JAMA 2GNAA 3GAFA 4RVUA 2PGDA 5G0VA 3WGGA 4JQCA 4BKQA 3U4IA 2TMGA 1FDSA 3V2HA 4OO3A 4EI2A 2O4UX 4J2HA 3H9EO 3RWBA 2O23A 2NUAA 3AU9A 1Y9EA 3T4EA 3RJ9A 7MDHA 2BI7A 3EYWA 4TRJA 1A71A 4HV4A 1TT5B 2EIHA 3H9UA 4PFJA 5F3RA 3W6UA 4G81A 3RVDA 2NVUA 4LRSB 4UUMA 1NXQA 2Q2QA 2YW9A 3SX2A 3O38A 2W98A 3PHHA 4FGSA 1C0PA 4YAEA 4AJ4A 2NVWA 3UW3A 2NTJA 1XG5A 4JBGA 3OA2A 5HA5A 3ZWVA 3DZBA 3PYLA 1Y5MA 3CKYA 2HO5A 1J49A 3S1LA 9LDTA 2GDZA 2I3GA 1VSVA 4G2NA 4GGPA 1O0SA 3OMLA 2DQ4A 3ENKA 4R68A 3VZRA 1VRWA 4W99A 1I36A 1LRJA 4AG3A 4YAGA 1NQ5A 5KNLA 2HAEA 2CDAA 4GSKA 4YQZA 3IJPA 3BTUA 5LCXA 3ANNA 1VPDA 1Q2XA 2DUUA 1E7YA 1O94A 4Y8VA 2FZWA 2ZYAA 3DO5A 3NAQA 1HWYA 2OBNA 4BNNA 5CG1A 2CUKA 2AQKA 1XGKA 2B69A 5G0TA 3O4RA 1YQXA 1NFRA 2CF6A 4LW8A 1P0CA 4BL5A 3BMCA 4K26A 3S55A 3RFTA 1ENOA 4JN6B 5A05A 5GMOA 4O6VA 5GZ1A 1U2GA 1F0YA 1ZNQO 3VH1A 4BNLA 1Q7CA 3Q6IA 2VTEA 4L73A 1M6WA 5EIOA 1YO6A 4WLFA 4ZQGA 1BW9A 4I9NA 4R4JA 1UZLA 5I7SA 3AY3A 3VDRA 1E7RA 3ONDA 2DBQA 1P0FA 5JLAA 3I3OA 1DLJA 4E21A 3IQDB 2BFOA 3STHA 4QUKA 3E6AA 4YXFA 4J1TA 3CE6A 3RUHA 3TRIA 3HG7A 4YJFA 1Z82A 1U2DA 2DLDA 5CDGA 1YDEA 1PZGA 3RUAA 3CZMA 5EL0A 1UP6A 4E2ZA 2ZB7A 3NDJA 3JCZA 4OAQA 4NK4A 3QSGA 1O89A 1MV8A 4JJGA 3PEFA 1LLQA 4DPMA 2CSUA 3PJFA 4AJEA 3ABIA 3L6OO 1PQUA 4A10A 2NACA 5IDYA 1UXIA 1PTJA 2C54A 1PU2A 2BELA 2JD0A 3HDQA 3RUFA 5JAIA 2PNFA 4D3FA 3TNLA 4IGEA 3MEQA 1R16A 4PLCA 3GDGA 4D45A 3E5MA 2AEMA 4E3ZA 3JQEA 1Y1PA 4ALKA 2HLPA 3KXDA 2D0IA 3O8QA 4K9DA 4CQMA 1ADGA 4DQXA 4NBVA 3HQ4O 2BFPA 4R1TA 1DFHA 2EHDA 4ID9A 2IE0A 2EKQA 2Y1OA 3DB2A 1X7GA 2CMDA 4INAA 2WMDA 4J1NA 2PD3A 3DC2A 1B8VA 4LN1A 5ILOA 1DSSG 4TWRA 2IODA 3H2SA 1I3NA 1YJQA 4PZCA 4QO7A 3WSWA 1E5LA 1DHTA 3JQGA 4E31A 1P1FA 2UYYA 5I9MA 4WECA 1K6JA 1DHRA 4NJOA 1C0LA 5AXAA 3TFQA 2E48A 3KSUA 5DCYA 4FGWA 4TRNA 4A27A 3L4BC 5BNFA 4D3DA 1GY8A 2Y68A 3Q11A 3KRTA 3MTGA 4NMHA 4ZRMA 9LDBA 4MVJM 3TPCA 3NJ8A 5JNLA 3BHJA 4ESOA 2J5QA 3TOZA 2B4QA 2HKIA 3FBTA 1B3RA 3B20A 4UVDA 5TIIA 4CM9A 3ETDA 4RQUA 4EYEA 2J3HA 1ENPA 1U7TA 4FFRA 4MVJP 1IHYA 3K9QO 2X0IA 2C7VA 4EEZA 4XYGA 3DBVO 1OC4A 4I08A 4Y6PA 3DAFA 1MXFA 1HDCA 4F3YA 2V7PA 1GPJA 5IXYA 2UVDA 3E5RA 3WFJA 3DMTC 3SJUA 3G79A 1EVZA 3GMDA 4P22A 1T26A 2GF2A 1R12A 4ZA2A 3QP9A 2A94A 3JQBC 3B70A 3OF2A 4ZVVA 3MOIA 4D42A 1E7SA 4R01A 3DEYX 1QSGA 4XYLA 1M67A 3GOHA 2GN9A 2ZIZA 2OZPA 4TVBA 3C8MA 4CLRB 1NHGA 1O9BA 2FP4A 3L4BA 1MXHA 3MZ0A 4Z0TA 5CPBA 4XIJA 4XQCA 4XRGA 4RPHA 2W4QA 3E8XA 1QKIA 1HXHA 2Q1SA 5ICMA 2OFPA 2YJZA 3VPHA 5H82A 3GZ4A 3OA0A 1P1IA 3PYMA 4RPLA 5EINA 4Z6KA 1VL8A 1PJQA 3AM5A 3Q0EA 3NTQA 2W2LA 3EY4A 5FEUA 1M6HA 4NI5A 1JVBA 4ZGWA 4KDEA 2PR2A 1UZNA 1ZVMA 4CMEA 1QYXA 1WZIA 2OO5A 4NG5A 3PDUA 3DMTA 4M54A 5TX7A 2FWMX 3JYQA 5EN4A 1LU9A 3W8EA 3B1FA 3C3XA 3JQBA 4OQZA 2ZTMA 4IDEA 1LRLA 2EV9A 2HRBA 1R4NA 3ZDFA 1T2EA 5JO9A 3NTRA 1PZFA 1FJHA 1GV1A 3UF0A 3X2EA 2QZZA 4XIYA 3JD3A 1V0JA 2BGKA 3I9KA 5FYDA 4PLHA 3KYCB 3ZWYA 3KBOA 4R16A 5B4UA 1UDCA 4RDHA 2C2XA 5TRTA 3NRCA 2ZB3A 1Q7BA 3EVNA 1TA4A 4LSWA 3K31A 5KIAA 2X5OA 2Q4BA 2FPIA 4J7XA 1B3BA 2WM3A 3QJ5A 4M89A 2NSDA 1DIBA 1QYCA 1MFPA 3KYDA 3OFSA 1XQ1A 4YEDA 1N92A 4B4UA 4CMKA 2B83A 2CNBA 2H5LA 1N9GB 2XOXA 1ISJA 2H6EA 1Z6ZA 4FD3A 3KEOA 2GZ3A 3GUYA 1S6YA 1D3AA 4CODB 3KLMX 1OI7A 4U6QA 1EFKA 3WIDA 2X0NA 4N18A 4RVSA 4TKMA 3ZNPA 3WOHA 1HF3A 4Y98A 2BGLA 4PRLA 3RCBA 1VL6A 4OOFA 2EW2A 4CMIA 3G3EA 3ONFA 4XCVA 5A4DA 2PGLA 1ADFA 2B5WA 2G82A 3IAHA 2VHWA 3JQAB 4L0QA 3UCXA 4BNGA 3Q9NA 4ALNA 2PKQP 4O0LA 1PL7A 1UAGA 3Q3CA 1R15A 4DGSA 5A06A 1VJ0A 3DL2A 2POQX 3DTTA 3KYBA 4KWHA 1SZJG 3AOGA 1T1SA 2P9EA 3CTMA 4CUKA 3N58A 2R2GA 2WEKA 1YJ8A 3PHLA 3ORFA 4WEOA 3AY6A 3DR3A 2NVBA 1Y7TA 4XB2A 2TMDA 3LT1A 2AE2A 5H81A 1DC4A 4CR7A 3MJVA 4BKOA 4J91A 3I1JA 3LDHA 2WYVA 1PX0A 3PIDA 4CLOB 5JC1A 1DEHA 4BO4A 1DRWA 4GX0A 3TZCA 4A26A 3V2UA 4WK6A 5A03A 3W1VA 1N5DA 1YQGA 3GNSA 5IJZA 4BHTA 2RHRA 1HYHA 2UAGA 3L77A 4HFNA 4XR9A 4CMGA 1LDGA 4BMSA 1DRUA 4BNXA 3E48A 3ADOA 4RGBA 4J1QA 3E18A 2O3JA 2E4AA 5F5LA 3O26A 4QO8A 3AI3A 1UP4A 1BSVA 3HDHA 4JJIA 2O48X 3WMXA 1BXGA 4FC6A 2ZB4A 3DBLB 4JJFA 5L53A 3WQQA 2UV8A 3ETGA 1ML3A 2ET6A 1NQTA 4U0JA 2ZCVA 3D3WB 5L7YA 3GN1A 2WTBA 3HN7A 2E82A 3ROMA 1C1DA 4AJJA 4BMNA 4Y67A 4X54A 1EUZA 4HP8A 2YYYA 3NKLA 5IZCA 3IJRA 3HFSA 4AJIA 4MP6A 4Z0HO 1VI2A 3A14A 4RZHA 2BKAA 3DZIA 4KTTE 4WNIA 3JV7A 1RM5A 2IEBA 1UXGA 1CEQA 5ITVA 3VOSA 1M75A 3PZRA 2IZZA 1N1GA 3JQCA 4I5EA 1Z75A 4L4SA 4PLZA 1DC6A 2ZTVA 2ZYGA 3AU8A 3TF5A 3F5SA 5KWEA 4XYMA 2CFCA 4BVAA 4YAKA 2BRUA 1YL7A 4WLUA 5ITWA 1Y8QB 4HUJA 2F00A 5DCUA 2VT3A 4GMGA 1EVIA 1HYGA 4FSHA 1DXYA 3DQPA 4FCCA 4PGFA 3EMKA 3F9IA 3Q9UA 5TGDA 1IUKA 1Q0HA 4PLPA 3HHPA 4F6CA 1RYEA 2X23A 4WASA 3L0DA 5A04A 4BO5A 3JD0A 1F14A 1U1IA 1BGVA 2VHXA 1H6BA 1KOLA 2JD1A 2NU8A 2JD2A 2X7HA 4PLWA 4DL9A 5LDGA 4KTVE 3I6QA 3PVZA 3ZCXA 3COSA 4NPCA 4DTIA 3OM9A 4WKGA 1AHHA 3UOGA 4HBGA 2OGUA 2AQ8A 4D0SA 1ZJZA 1SOWA 4DXHA 5C7OO 1NVMB 1P1JA 1SC6A 1F8GA 3N74A 3I4FA 1P1RA 4FFNA 2YHIB 3MCVA 2VZ0A 3TJRA 2X4GA 5JXWA 4DQUA 3DXFA 4YJHB 4FFPA 4P4LA 2D2IA 4CMBA 3U0BA 3ZI0A 2P5YA 1Q0LA 1GR0A 2W2KB 4RV9A 5JW6A 1SB9A 3TZ6A 1LJ8A 4XGNA 3F1KA 2OP0A 4BNWA 4E30A 5DN9A 4Z9XA 3A28A 4Q3EA 3PFFA 5TT0A 1PGQA 1JTVA 1UH5A 1JVSA 1O95A 1UXKA 5EESA 1DB3A 1BHSA 4IGFA 4MP8A 1E3LA 2Y1EA 1AXEA 3ZNNA 1T4BA 2NADA 1U9JA 4FS3A 4HXYA 5C7IO 4M49A 3W4KA 3U62A 1ULUA 3OEWA 1B14A 1DIRA 3K6JA 1ZEJA 4BO6A 4JBIA 2JCYA 1HDGO 1W0CA 4ZQEA 4W82A 4FOSA 3ZWBA 1ENZA 4GX1A 1ZK0A 3FNFA 3E82A 2ZQYA 1XR3A 5JFOA 2I76A 1G0NA 3E9NA 3PI7A 3BXXA 1H9AA 4E0BA 2IDZA 1ADBA 3VH2A 3W8DA 5T67A 1QYDA 2YV1A 2D1YA 1C1XA 4F45A 3WLFA 1ZO8A 2WWRA 5KVVA 1YOVA 2D5CA 3QVOA 3FNHA 3WGTA 1XHLA 2AA3A 4QT0A 2P9CA 5TT1A 1ZK2A 1UDBA 3RAJA 2X0JA 1PWXA 3R1IA 4E5YA 5C7LO 2BFMA 5C3MA 4QX6A 3VVCA 3JQ9A 4N5MA 1Y8RA 1X0VA 2JL1A 2WJPA 4BOYA 3DBRA 3S2EA 1SCUA 1X7HA 3F3SA 3ZWAA 4PZEA 2IEDA 4YB8A 4D44A 1YH3A 1PGPA 4M87A 1E3SA 3GA0A 1R37A 3OIDA 3WGIA 2WD7B 1X1EA 2QZ9A 3WX0A 5A9SB 4I5FA 1GADO 4BKRA 3S8MA 4EEXA 3GHHA 3UKOA 4E4YA 3I9LA 4OQYA 4DYDA 1I01A 1FMCA 1ID1A 3JQ8B 1B8PA 1IZ9A 4IIUA 2XXBA 3WTCA 4W9NC 1ZCJA 3BMNB 4FN4A 5K6AC 5KVQA 3PQDA 1HT0A 3ZNOA 1YXMA 4UREA 2ZTLA 2O3QA 2RIRA 3P2YA 3OIGA 3UN1A 4DRYA 3I23A 1O5IA 3CH6A 1U28A 1D1SA 2GUGA 2VN8A 4J4BA 2PWZA 2Q99A 3WB9A 3ZH2A 2FPGA 4CM5A 1N8KA 3KO8A 4PG7A 2HQ1A 3H3JA 3BTOA 1YBMA 2Y0EA 1FDUA 2QRJA 1JKIA 3LLVA 4B8ZA 1PQPA 1VLLA 3D4NA 2EP5A 3ZW9A 1FDVA 2IRWA 4BO3A 1HDZA 1KEVA 4NFYA 2BI8A 5CEEA 2HRZA 4WGGA 3SC4A 4RPJA 4EJMA 4GAEA 4YR9A 4P8RA 3X2FA 5T5QA 5C5IA 1E3WA 2QQ5A 4J3FA 4CV0A 2LDBA 3GNTA 4PLTA 4J2OA 3VDQA 1WLYA 4D46A 1OOEA 3RU9A 3G1UA 1MLDA 3UICA 4ZHSA 4E12A 4CV1A 5JE8A 5HS6A 5K0ZA 1KEUA 1HE4A 1A9ZA 1YWGO 3CEAA 4W9NA 5K6AA 4WCFA 4DA9A 4EUFA 1I2ZA 3JTMA 3ICCA 2FSSA 2NLOA 3A9WA 3SLKA 4XYEA 1GEGA 1U3WA 2VT2A 4HY3A 1TB4A 1HZZA 4L76A 1C0KA 2VQ3A 4S3MA 2Q1TA 1EZ4A 3T4XA 4DREA 3AM4A 4WNCA 1X14A 4P4NA 1YQDA 3S2IA 3H4VA 4KUHA 1V9LA 1E1LA 5G0SA 3GZNB 3D4OA 4P4GA 3GVPA 3GVIA 5KVSA 3C7CB 4MOWA 3ZGYA 1P33A 3ZHZA 1J0XO 1Q0QA 1PJ2A 3V1YA 1LXCA 2O7QA 3VTZA 5F1OA 1ZJYA 5LC1A 4CM4B 5IZ4A 1JAXA 3BIOA 1LSOA 1I30A 1E0DA 3I9NA 4UUNA 4C4OA 2AHRA 2X8LA 4PVCA 1ZUD1 2JCVA 1N1EA 2VHZA 1ZK4A 4MO2A 3NGLA 1ZZEA 1YB5A 1KETA 5ES3A 5DOZA 3WIEA 1K6IA 3WG9A 4ILKA 4KDFA 3K2BA 3O9ZA 4J0EA 4DMMA 1UXJA 3H9GA 4BO8A 4XB1A 4KWIA 3CXRA 2WDZA 1Z7BA 1AXGA 5A5FA 1PS9A 5ENDA 1A27A 4AICA 2NWQA 1QLHA 4HNGA 1I24A 3N7UA 1OAAA 3DZFA 1EUDA 1MC4A 3QWAA 3M2TA 4BGUA 3ETEA 1QMGA 4XX0A 2NM0A 4EITA 5I9NA 1X13A 2B36A 2B4TO 3I83A 3WR5A 4CQLA 3BMOB 3ROQA 1BRMA 2B0JA 3ZU5A 4QFDA 1ISMA 4ALJA 2WD8A 1E6WA 1L1FA 1LUAA 1BDMA 4Q3AA 3ZWNA 3KB6A 4UEKA 3DBHB 5BSFA 1LI4A 1NQOA 1IB6A 3D7LA 3GFGA 4MIYA 3CPSA 1GEEA 5ER6A 5ER9A 4EJ0A 3H9QA 1GQQA 3ENNA 4GWGA 1BXKA 2PKQO 4B3HA 3QV1A 4OXNA 1F12A 2GLXA 3DAGA 3NJ4A 4CPDA 3WICA 3G17A 4QQRA 3V2GA 4XDZA 4NBWA 1GCOA 1E6UA 1XU9A 4H15A 3QA9A 2EXXA 5TSDA 1O8CA 1GUFA 4M1QA 3LSYA 4H3VA 2G17A 4IUYA 4E32A 4MKRA 4FBGA 5G4KA 1LDBA 5KCZA 4KQWA 2YHUA 1SBYA 1U8XX 3TL3A 4K6FA 1AHIA 1H6CA 1J4AA 2GO1A 5TS3A 2D3TA 4B7CA 2EJVA 2AG5A 1KERA 2H63A 3D5TA 4TRRA 4CM1A 1D1TA 4PLVA 4RF2A 3HSKA 2HK9A 4BKPA 1T2AA 1B0AA 4WLOA 5JS6A 1OMOA 2YY7A 4YDRA 3VPXA 4LVCA 1BWSA 2R00C 3WGYA 2Z1NA 1MC5A 3D64A 1GUZA 3JD4A 4DC0A 5AOVA 4KUGA 1SEVA 1PJLA 3IS3A 2I3AA 2O3SA 2SCUA 1X7DA 2Z1MA 4I5GA 4AJ2A 4I5DA 2GD1O 1GDHA 5B1YA 1HE2A 4TMFA 4UVHA 3VZQA 5KVCA 2B4RO 5TJHA 4J7UA 1EE2A 4J90A 3HDYA 4BIIA 2E6UX 4AJHA 4BNKA 3GRPA 1IOLA 3W8FA 2VYND 3FNEA 1CETA 5AXCA 1R66A 2X1HA 1BXZA 4DQVA 4YT4A 4MINA 4OSPA 3KETA 2Y1FA 4NJMA 4EBFA 4B7UA 2PKRA 5DF1A 4OKIA 3HJAA 1KVTA 1ZBQA 1U8FO 1YB1A
chains in the Genus database with same CATH superfamily
3N2LA 4YRNA 2VDMB 4IBOA 3PK0A 1O03A 1RPNA 4XD7D 1C9DB 4MEAA 1DBIA 3JQFC 1PL0A 4F9GA 4II2A 4P82A 1PSDA 4K87A 3IBYA 5LP6B 2XCUA 4CFZA 4JNGA 2IQ5A 3KR2A 4R7ZA 1BJTA 1F5NA 3H5RA 3LCCA 2QSUA 3U26A 3V5NA 1K2WA 1L5HB 1EGVB 1OXBB 4BDSA 3EZXA 2C0CA 1ZOOA 1ORWA 1QF7A 4IXDA 1TA0A 3HKCA 3RSOA 1W4ZA 3NNDA 4J0FA 1UC5B 3GMIA 1W25A 2OPHA 1CR1A 4PRZA 4ZO6A 5IKEA 1C7QA 2GJ8A 4DLNA 1M2VA 1BCRB 4L27A 5DHRA 1OC2A 5JDCC 2DHDA 2NAFA 3D3EA 4E5KA 3U6KA 2NU9B 4N0EA 1TLFA 5KEIA 2Z5LA 5JLJA 1NXOA 1W581 1YZLA 3HVRA 3STVA 3FN4A 1RI4A 2HIHA 4J4TA 1G41A 1JU3A 1NNI1 4I8XA 2W6IA 3GUCA 2XUZA 5G3ZA 4XH9B 1W1WA 2V9CA 2J3QA 1UDAA 4WNAB 3GJ6A 4NU8X 1ONPA 4H7FA 4IIGA 5DTRA 1B6SA 1QJCA 2A14A 4AY5A 1GKLA 2Q3DA 5IWCA 1PKXA 2NAPA 4TT3A 1P1HA 3TTXA 1W93A 1EHYA 2BM0A 4I4TB 4K46A 4IDGA 1TA9A 3I05A 1FK8A 5KX5F 2ZJ3A 1NLFA 1PE0A 1UPBA 1GHTA 1EK6A 2O57A 3D8UA 4UCFA 3U7FB 1KP9A 4TXLA 1JQBA 3EXHB 3WMEA 3ZVLA 1WQ4A 4IDUA 1DOHA 1ZKMA 4AYTA 1F2VA 1FUYB 3F7MA 4B75A 4ME6A 1EXWA 1H3EA 3HDGA 1FBTA 1SU4A 3G89A 1CJUC 1QCZA 4MVJH 1KKMA 1GA4A 2EYQA 4INZA 4RVFA 1I2BA 5ELMA 2GYYA 3O94A 3IALA 3TS1A 3WIBA 4B45A 1AJEA 1LBHA 3GQBA 5AK4A 1E0KA 2XXJA 4FFMA 4G37A 2GKGA 1VCNA 3A58B 1HURA 4QUBA 3GX1A 2DU8A 4N7JA 1TZCA 1LCIA 2H3HA 3A4NA 1JKJA 1Z15A 3L5KA 2OBLA 3LAWA 3G82C 1CUWA 1IN4A 5AKZA 2PX6A 5K8VA 1X38A 3JZAA 3ZWKA 5THXA 4EO4A 2DB3A 5LLTA 3FDJA 5LA6B 5BW8A 2VZ9A 2ZULA 3VKVA 4GDFA 1H2AS 3QYJA 1SNYA 1WSDA 3OZAA 1S4MA 3P2IA 3T3OA 1RYBA 2J45A 1EEXB 4MUJA 2J5BA 2JLUA 2AWNA 1ZGGA 2FWNA 5KAPA 2QUJA 5JZ9A 1FTYA 1DTWA 4F4HA 3L01A 1FDIA 5KMGA 1W52X 1XNGA 1IOZA 1C0IA 1HSZA 5EHQA 5KDLA 2IYPA 1COWD 1C41A 1G5TA 1NC3A 1OFIA 1U2TA 4GH5A 4KPUA 5EJ8A 2JB9A 2XF2A 2BTQB 3A27A 3SU8A 3DGEC 1WNFA 1UFQA 3RROA 4HYTA 1EA7A 4UTXA 4DMFA 2R6R1 1IEQA 3HL4A 3N2IA 3AVUA 1N2HA 2ORED 2VCEA 3M6MD 2BKEA 2CLCX 4IF6A 4UULA 3LOUA 2BMFA 1AO0A 4CCYB 1EG7A 1NT2A 1U8ZA 4WMLA 3CXUA 4YRFA 3V4SA 4R0VA 1T4CB 2IEZA 4G5HA 4YACA 1O7JA 2XUGA 1S7CA 3AH8A 1Z68A 2C77A 1EEHA 2M6SA 2QMQA 5U1PA 1DJMA 4GQBA 1T2CA 4H16A 3NWPA 5CB8A 3MGGA 3PNPA 1DAOA 2IH2A 3WDSA 1ESZA 2C4UA 1NBME 1VMDA 2YXPX 3UCEA 3IQWA 3V4LA 5JDIA 4HDRA 4N0PA 3S2GA 2OP1A 3UUWA 2I7TA 1XN4A 2EL9A 3CM0A 1V39A 3H1EA 1PAUA 4R3NA 3HK2A 4GLBA 4DHWA 4HAUA 4BGIA 1MJGA 2OL4A 1XRRA 3HADA 3P5SA 2R4TA 3WWEA 4HMPA 4JH0A 1CJVC 5FPPA 5TLSA 2WVJA 1D8AA 1XZBA 3RTAA 1H0KA 4BV9A 2XRYA 3C8DA 1I51A 3ANLA 1F4LA 3EASA 1EUCA 1TCUA 3KQWA 1GGEA 1KFKB 1WB9A 4TTQA 1APBA 1M34A 1ODIA 4X61A 4ZARA 3TM4A 4NZYA 1T9KA 3LYLA 1I5RA 1G20B 1J56A 1BX0A 4LXTA 1L7XA 2BMWA 3UMRA 5FL7A 3HCBA 5EXTA 2XTNA 3BRWD 3WL3A 1F1BA 4G07A 1BW9B 5K03A 1SVMA 2CMHA 5CDFE 4HS4A 3ZIAD 1HEIA 1PS8A 1Q12A 1XA4A 1NIJA 4AG6A 4ZCMA 1UBSB 2Y0PA 4P7JA 4BO1A 4XDYA 3L7MA 3W5VA 3WYAA 1O4VA 4AMZA 4M0DA 4BGVA 3HWRA 1C29B 4MWGA 1SC4A 3ASZA 3L6RA 4RQTA 2O8FB 1R0LA 1RWPA 4GYJA 3PEUA 1CY0A 1ZK1A 1T8RA 4IXTA 4QQNA 5ARCA 1OF1A 4C2BA 1X8KA 3KVVA 2R7NA 4O08A 2JDIA 1TW2A 4LCEA 1T9HA 4C7VA 3CT4A 4YJFB 3ZDZB 4YQYA 3FCOA 4XZ3A 2QYSA 2CHEA 3BYZA 1ZRMA 4CJXA 2NPOA 2J3IA 1X7YB 4I6EA 4J9UE 2GEUA 3AZQA 2HUNA 2ZZKA 3FTPA 3DVSX 3E3OA 4HDSA 2Y0DA 5IH7A 1EFAA 2D2FA 2QT0A 4D4HA 3D6VA 1MABA 2FSFA 1TC1A 4OLAA 1GYRA 2AN9A 5M04A 5I7AA 5K0LA 3ZU3A 4BNDA 4ND4A 4RTLA 1A8QA 2G9VA 4QARA 1A4UA 1K5HA 1W73A 3ND9A 1SOUA 4IH4A 4O1IA 4UXJA 3RH0A 3TLJA 3ZI7A 4D1YA 5LZ5A 1N7IA 2X6RA 1L5FA 1ZJ5A 3DHEA 4M9CA 4DGQA 4UZFA 4RPIA 5CA0F 2WIKA 1NVVR 2A35A 2XRMA 1A8HA 1T3SA 1REQA 4PXYA 5EVCA 1FVXA 1J33A 1IE3A 5JAPA 1N5OX 2A78A 1CP3A 3SR4A 1HUQA 2DPYA 3BGSA 3WFIA 5BXYA 3RM3A 2EZ4A 1FYWA 2RG7A 2QMEA 2XRFA 4IKEA 2BFCB 2QB5A 3B78A 1ZD4A 2WFLB 2H2HA 3FBWA 2NG1A 2XLCA 4GX2A 1KYXA 3LECA 4E5NA 1F6BA 1FP4A 1S96A 1QX4A 1UK6A 2O2JA 3EZGA 3RD5A 2ZJ1A 4X63A 2HJRA 3AVOA 2UUAB 1YIDA 4IDCA 4U7HA 5IJAA 3H2KA 3LD9A 3QWIA 2PM8A 1U3DA 1XCBA 1FFHA 4JNCA 3WLHA 1TQDA 5DM70 2VUUA 5F12A 2RGNA 4FJ1A 4G6ZA 4QJ3A 2H5EA 5LB4A 2YQ5A 3WGNA 4R8RA 4XRRA 1ZESA 1CU1A 3WMFA 5SZHB 4LF9B 4N5IX 4HXEB 1EB8A 5DNWA 1P3JA 4FDLA 2GSDA 1DPGA 2C4TA 2W2OA 1CNEA 3G9TA 2C58A 3LPAA 3BE6A 4HTFB 4O2LA 5D85A 3ZY5A 1U7HA 2BGMA 4PN3A 5KQGA 4MQMA 4DC9A 3FE2A 4X6XA 1U02A 1LLCA 4GSLA 2QUZA 4KBGA 4JX8A 5CX1A 3M3PA 3OJEA 1STOA 1E1RD 4BNMA 1MW8X 1P4JA 4HR7A 4A8TA 3VU0A 2EIXA 5K6RA 4N5NA 1DV1A 1B4DA 2C20A 3QK7A 3TJZA 4FK8A 2NNWB 2QT1A 5I8PA 1ZOSA 4H7IA 3I42A 1A5ZA 4C05A 1N0IA 3X44A 2VT6A 4PY2A 4UUPA 4CTNA 2GN2A 2QHXA 4YXWD 4QBHA 1H8HD 1QS0B 5F23A 3CF6R 2C5BA 2HMAA 3KSDO 2CVQA 1RRGA 2FR8C 3ODPA 1EP2B 4B82A 4DA6A 4KP7A 3G0GA 2MIIA 2ZYWX 5ADWA 2ODEA 3ZV6A 3T5AA 5JJCA 3PXCX 1LNQA 1JFLA 1M1NB 1EXMA 2P5SA 2VJOA 3I9JA 4KIFA 4LOLA 4GPEA 1H1LA 3HJTA 1LBEA 4PTYA 2PBLA 3CUKA 4XWYA 3WLRA 1EVJA 4RORA 2RHHA 2EFCB 3BXOA 3KHTA 4MPJA 5IVIA 4I55A 1DCFA 1G18A 3T5DA 1OCEA 5K3BA 3WB1A 4UMVA 4KR7A 3RVQA 3ZZTA 2VQFB 5ECWA 2VZ8A 1XD8A 1MP0A 4MB0A 5IDVA 4QVIA 3UXHA 3SZGA 1EK5A 1XELA 4LKRA 4RKWA 5DI3A 4PG6A 3PR2B 2HBQA 5GJVC 2V6MA 4RJ2A 3COYA 5TV2A 3F47A 1C3OB 1T9BA 5ALKA 5IW8A 1NU6A 3TZBA 3UT6A 2IOFK 3U40A 1M6VB 3WK8A 2ZTUA 4ZIRB 1NP7A 3HFRA 4H9GA 4Q4JA 2CHUA 2IU6A 2RHLA 4P5EA 3ZJYA 1FA9A 2YVUA 2CVFA 2CKMA 1Y1QA 4XKJA 4OJYA 5A71A 5JYDA 5DNEA 4HNAA 4G0ZA 4QYIB 1R1DA 3FHJA 1BHO1 1J8QA 2X4IA 3H4TA 2P78A 3RSGA 3WDKA 3EG5A 1DCTA 2R3SA 3EISA 3KT0A 4TMWA 3UOWA 1PYDA 2LPMA 3ILHA 5TARA 1WP4A 3I72A 5T6BA 1U8TA 3A3PA 2EJBA 3AR5A 1M2EA 1WNTA 1G6KA 1HM5A 2DTXA 4HQKA 3W7BA 3H5WA 3EVCA 4FWIB 4BUJA 4YV1A 5GINE 2AMVA 1ZIPA 4FYMA 2IS2A 4WACA 1IH8A 2C5AA 3X0DA 3K2EA 1SXGA 4V2IA 1FFAA 1OBHA 4M8IA 1BS1A 1R9MA 1P3Y1 1MH9A 1Z29A 2Y3IA 4G4GA 4MIEA 4UU0A 4E7OA 1KZ9A 1POXA 1NSFA 3RBAA 4REQA 3VJMA 4YRGA 1U1EA 4UEJA 3E9ZA 4W63A 1TEVA 5CDSA 3I5MA 4H1VA 2OM2A 5JVDA 4KPGA 2H00A 3TLAA 3VPGA 5K0GA 3K1JA 3OP1A 4GVPA 3I53A 5DPMA 3DOHA 3ZWXA 5I4IA 2HCTA 2BZGA 4IIYA 1U65A 4FYIA 1C2YA 3BGWA 3LT2A 5AVTA 2NT4A 3B6KA 3ZDYB 5IAEA 3SC6A 3K20A 3ZNQA 2JC3A 4B3DA 1YMQA 1E2GA 2EJTA 2VF2A 2J67A 2VJDA 3M4JA 3QWHA 4MUXA 1TO6A 4GM4A 4WERA 2OCKA 3DONA 4UBMA 5CITA 2C2YA 5IDQA 2GAFA 3AG5A 2IVZA 3DZKA 3F6BX 4KH1A 1FJXA 1DL5A 3A7DA 3R6DA 4R05A 1Y9JA 4PZ9A 3F6EX 3SYTA 4M1TA 1MUUA 1BWPA 4ETMA 3AUAA 4KDRA 3WZLA 5DB4A 2ZVQX 2PZLA 2YNMA 3GD7A 4NFSA 3DH0A 3CEPB 3DVRX 4JJZA 3CRZA 5C8XA 1R7RA 3G2NA 1JEQB 1SPXA 1T13A 2ZAOA 4P5DA 1TKBA 4MUGA 1KZHA 3SJAA 3WK7A 2R1TA 1U81A 3GRYA 3H3XA 5EE0A 1T3LA 1ZD5A 4DKJA 3DEFA 4ZYXA 3IP6A 4AC9A 5I9LA 2IXBA 3MINA 4JOQA 2Y27A 3L2OB 3ONNA 1T4MA 3IHLA 3HI6A 3RGWS 1UKAA 3ZU6A 4B6FA 5HQ3B 2OGWA 2I6TA 4II3A 3HFJA 1NX6A 1OSNA 1DPFA 2ZRAA 5JH7B 3NBAA 2I91A 2DUWA 2OWEA 4BLWA 3CS3A 3JALA 4HEHA 1ZI8A 4NBTA 4KSBA 4UBIA 3T7AA 1XPOA 4KUEA 2FLVA 1QRTA 3EHDA 1UR5A 3DE3X 4TN5A 5A7FA 2GERA 3F4KA 2RJ3A 2ZXEA 3ONVA 4QQFA 1SKBA 3LT4A 1NBEA 4K86A 2IYXA 1V2GA 1GV0A 2MMGA 4UHCA 2O3TA 3T1OA 2PFGA 4NHEA 3TWOA 2Q0QA 2GRJA 1O97C 3CTPA 3M1YA 2AFHB 2Z2IA 2WIBA 4EAAA 1Y33E 4MWOA 3RVPA 2B78A 3NGXA 3PR3A 1C50A 2R84A 1KHHA 5KC8A 3W4JA 4BB5A 4EQ6A 3GLFE 3CLUC 4B3CA 1LX6A 1QONA 2A0FA 3AHJA 4TMXA 4CMIB 3HTXA 2COEA 4LX8A 2F9MA 2PBRA 4OHRA 4PX2A 2CW5A 4C0AC 5JROA 2BDUA 1Q57A 5IKMA 3KXLA 5SYAA 1VJCA 1JQJC 1LPPA 1KMMA 4N49A 3ZWCA 1F06A 1JT9A 3TR0A 1J00A 2CXPA 2HO4A 4R7TA 3FDZB 3C4QA 1G291 3AWIA 3VJKA 5AI5A 4E2YA 2JZCA 4RJLA 4ZDIA 3PFWO 2O8BB 3PF9A 3PRJA 3O2SB 2EKPA 3EGDA 1X1CA 3H5NA 3O8OA 2WIAA 4TPKA 3DFIA 5P8WA 1J8VA 3PXDA 3GGJA 4N0DA 5JG7A 3TRHA 4B33A 5HZHA 1E2UA 1U0HC 2HMWA 4TTVA 1VHQA 2PZJA 4LISA 1R5OA 1V5WA 2FZGA 4NZOA 4RHEA 3RIHA 4DRXB 5A4AA 2HU8A 5HZKA 2JA1A 2ZIAA 2OBXA 5KMGB 3UG6A 3NCTA 2CFRA 3PWZA 1KS9A 1SIBE 3X1MA 4F6LA 1Y81A 2VRCD 4CLRA 3WFZA 2W2TA 2Q0XA 1Z33A 4KXWA 1KEZA 4X97A 2GA9A 2WU1A 3P0RA 1N6KA 5KJ1A 4H60A 4FVTA 2XUIA 2VP6A 1IZ8A 1H22A 1Y3FE 4BO7A 4UU7A 4GC9A 5DSZA 1DKPA 3TCXB 2ZBVA 1E7QA 1JHRA 4AP9A 4NAUA 3L8CA 5DBFA 4LDPA 3WKDA 3W2HA 5JCOC 3DZHA 2WF6A 4FJ0A 4KXFB 5HKOA 1I33A 4ER7A 1JPNA 1Q7RA 3EMBA 4EIWA 2MYNA 3AUFA 4MW2A 4G25A 1D1QA 4GS5A 3KYIB 1ESMA 4RTRA 4CR6A 1FUUA 3V1TC 5DJ5A 3WGMA 1QOPB 5EP1A 1BE8A 2GXAA 3ETLA 3GRKA 3M2PA 4Q00A 3E1GA 4IJWA 2HDOA 4GP7A 4NMLA 2QQEA 4IIJA 3WKBA 1C1DB 3HXOA 1KVRA 2QTFA 2WYWA 4JEHA 3H4MA 1QGUA 1N75A 2P9FA 4FFVA 2ZJ7A 3KSMA 4CEJB 1TLTA 2AQIA 2B0CA 2V5UA 4R69A 5ILGA 3OOJA 2X41A 1EZ1A 3REQA 1PD0A 3L8DA 4BATA 3AEKA 1E0AA 4Z99A 2GBPA 1GAEO 1C5KA 2QG4A 1SMKA 3L43A 4OHCA 3UAZA 3OPYA 4RPGA 3RSLA 4M0PA 5FFFA 2YOGA 4YIKA 3YASA 1H2HA 4B80A 1FRQA 1K8XB 1TKRA 2EJWA 2JJ2A 3IDFA 3EZ6A 4PLGA 4TXNA 3W78A 4CLDA 4IMRA 4AL4A 1GR1A 2BGGA 3I9V6 4HEJA 1TEZA 3KEFA 2FPWA 4FOOA 4MPDA 4IJ6A 3RRXA 1ONOA 5J23A 3OE7A 3PTAA 3AMVA 4UPDA 3RBVA 1RYDA 5CLJA 1U3UA 1ZIDA 2CCJA 4I50F 1E4OA 5E6UB 2I8CA 2RK4A 3P94A 3Q7PA 2PGOA 3HYNA 4XJTA 4GPBA 4D4IA 2WIDA 4QBGB 4L78A 1ACJA 4G23A 1RAFA 2GZ1A 5A9RA 2BUBA 1N9GA 5AICA 4WBNB 4N3CA 1U9IA 2QY9A 3EAGA 3S3TA 1Y6ZA 5T8KA 3I6MA 4FSXA 4BB6A 4KE7A 2Q5IA 2P9ZA 4LCJA 4YR7A 2AN1A 1ZHOA 1P91A 4YMTA 3EPLA 1CQWA 1XYGA 3H0CA 3SKVA 4I2NA 1B26A 3ZX4A 1W88A 3GDOA 3FTNA 3OH8A 1GGJA 2QJRA 5JO0A 1ZH2A 1PNOA 1GRQA 2ZRHA 4IG9A 5J4HA 3F6YA 3QE3A 2UVPA 4FDTA 5EJMA 4CIXA 4B47A 1PW5A 1ZINA 1E9VA 1XK7A 4OHXA 2C3OA 2X5XA 2YZ7A 2CHQA 3JQAA 4F93B 4UQLA 1DQPA 2UDPA 4YRAA 1OB5A 4XGKA 4GU5A 3DKVA 3NH6A 1JSCA 4LSMA 3OQ1A 1PBTA 2HSJA 4ZI3A 5KDDA 5IF3A 4MLDA 4ZRNA 1CY6A 3WLTA 3WLNA 4QUJA 3IUMA 4HNQA 2IPAB 4JUFA 4UEQA 2YZGA 3QF4A 2DKNA 3O3NB 5A0TA 1QPBA 3A3NA 3DMYA 4NYMR 2CL6X 4FDAA 1WWKA 1ZX1A 1YS6A 5E1MA 4EJSB 3IL2A 4GL2A 2WB2A 1QF9A 1XCJA 4CHGA 4PR0A 4JMPA 2OQRA 1E59A 1QOQB 2XVXA 4PCLA 4PZDA 4BLVA 2YN4A 2Q4EA 3GGPA 4E4TA 1ZW1A 3GCXA 3QQPA 1PR1A 3K0CC 4DSTA 3PLNA 4CLOA 1CQXA 1T0JB 2H2IA 2ZIWB 4AKIA 4UMEA 2VP5A 3R5JA 4O4LB 1ECFA 2XB2A 1K06A 2FV8A 4AWBA 3I76A 1DFGA 3K0AB 4DLLA 3SE7A 5GOZA 3AZOA 2R6AA 2PSFA 2VDWA 4IQ4A 3G2HA 1Z9BA 5EERA 1XDGA 3VR3D 2A4KA 1CQJA 3BWYA 3HJUA 3HU1A 3O4HA 1D4FA 1K8ZB 1RZRA 3ZQKA 1YBAA 1ZUIA 4MKHA 2EF1A 3I09A 1ZH4A 5BR4A 3U7GA 3THYA 1L2TA 4MUYA 4D79A 5CFMA 5JPCA 3EEFA 3C1AA 2Z4SA 1A96A 2NP6A 3OMXA 4IZIA 2EL7A 1IG3A 3UM9A 3BEOA 1U8UA 4O8CA 2C4VA 1NBHA 2WF8A 5JD6A 5EKUA 3K9HA 3TSYA 4E13A 2WW8A 2IH4A 2Z09A 2O2EA 1XV5A 1KY3A 1L8LA 2QUHA 1NKVA 2ZS9A 3ELYA 4BQEA 4IJSA 4B4KA 5HKBA 4B3GA 5JVDF 1ZBDA 4G85A 1Z2DA 2RI0A 5HM6A 1LQ2A 4OYYA 3AJEA 5JXGA 4US2R 3MT0A 4MRAA 3KTAB 3MLBA 5C51B 1N2SA 1YSCA 4EDHA 1DAPA 5BWBA 3GVXA 1LVGA 1VCHA 2VWHA 4GD3Q 1DXQA 4ASUA 3MJTA 4KAXA 4S0ZA 2R00A 4IQGA 1YFLA 3HPRA 1QM5A 1T5TA 3ESXA 4ZQHA 4C6HA 4EVQA 5CCDA 1DJLA 2BFAA 2X2PA 2XB9A 3JR7A 4PICA 4C7BA 1Y8RB 2BF4A 4IGIA 2ZRCA 1U2RA 1V43A 3EK2A 5F1PA 3HHEA 2HL6A 2P4EA 3B6MA 3E5HA 1AGPA 1J70A 1QV6A 1XEAA 2B2NA 5LBUA 4OG2A 1G0OA 5CP8A 1JBEA 3UG7A 3GLQA 3HCAA 4Q21A 1ACLA 5THKA 2J7KA 1BGWA 2NQ8A 2JK1A 3TR5A 1SBZA 2RC5A 4J49A 5J4KA 5KX5B 3LLSA 5FKJA 1QH9A 1X9IA 1YKFA 3K16A 3K30A 1DZIA 5E4FA 1I3KA 1QOZA 3AIOA 3Q2OA 4DCCA 1A97A 4EYGA 1RQLA 4XASA 3OO1A 1C8LA 4X6UA 2O54A 4L9RA 1Z26A 2Y9MB 5C9ZA 1B8NA 3NTUA 4NE7A 1U6KA 4W8HA 5HW0A 4JC4A 2WG1A 3FZNA 3RC1A 2NZ2A 4B09A 1PR5A 3IEIA 1N2OA 2XJ9A 1C3VA 2OHFA 3M49A 2P6RA 1N4DA 1UP7A 5EJIA 3C39A 3FFXA 3F4LA 3GG9A 1WCIB 2ECQA 3DR5A 3UC9A 2WU0A 3EXIB 3W5DA 3NAZA 4W5TA 2JLVA 2XT6A 2COKA 1XA0A 3PPVA 4ZAYA 4ETNA 4MCJA 2QX4A 1DS6A 4NWIA 4BMPB 1U0FA 4CL8A 1P2FA 2CYCA 2GKOA 1H05A 1ORRA 4F3TA 4GL4A 3AYZB 4EQZA 1ZSNA 1W4LA 3E27A 1X8LA 3SS9X 1N9ZA 3I73A 4NU5A 1KQ3A 2KQUA 1H5UA 4P92A 5EPUA 3TQHA 5HCUA 4GBGA 4JUAA 5E1DA 2VJMB 4YJHA 2ODPA 3DPUA 2VP2A 3L0PA 3SEFA 1KIFA 1BXRB 1Y6QA 2GK7A 5IM5A 3C8HA 1T8WA 1GRRA 4AUEA 4EG1A 1A1SA 2H5IA 1PFUA 3T3IA 1A5AB 1KORA 1ZH8A 4KQFA 3SXUA 2EW8A 4Y2PA 3OQOA 3H2GA 2FZCA 3PNSA 3DE7X 5BT9A 4IS3A 1SD2A 2F90A 3JU3A 3AFGA 4JJ7A 1N3BA 3D0RA 3AUYA 1R6DA 2ZTSA 2HT1A 5KOIA 2IKQA 4Z4EA 2D5AA 3PXBA 5KYWA 5KSYA 3RRJA 2KX7A 2QMOA 2QTZA 3MILA 3TOSA 4B3IA 1V41E 1A8UA 1XYYA 1Z6TA 2JIDA 2KS6A 2O4CA 1KJWA 2F17A 2FLWA 3R6GA 1VL0A 3I39X 4NBRA 2O0HA 2BFEB 2XAAA 3QKRA 5K05A 4G09A 3X1KA 2A1TR 3F46A 5K3CA 4EKDA 3A04A 3HJRA 4N5HX 1HE3A 2J31A 4D6YA 4WJLA 2ONKA 1GSIA 4OHVA 4EG4A 1K7YA 2WT9A 2NO0A 3L0BA 5IABA 2DLCX 2QE7D 2H5JA 1ORVA 3G6WA 4UEWA 2XZDA 4CEIB 1QAQA 5KYTA 4GI2A 2IZ5A 3RTGA 2XE7A 3CN9A 4MEBA 2YVKA 3LBHA 3BGIA 3BQMB 1L5OA 1EG2A 2RH4A 1SVWA 4D96A 1R88A 2AUNA 3PUIA 4K6OA 4QNMA 4DQDA 1CLEA 3A37A 5D3MA 3C45A 2C4KA 1E2KA 1KK1A 3GEMA 5J4VA 1NR5A 1ZWKA 4Y6RA 3EW7A 1P77A 1CERA 1O5OA 2AIRA 2A57A 2V65A 4WOCA 1XHFA 2O8CA 1CUGA 4NZ9A 3IEUA 3TNFA 5ARBA 3VNUA 1CHNA 4FE3A 3E7PA 4IIJF 2C9YA 1NR1A 3RK0A 4U6NA 1QIFA 4DLPA 5BV1A 3P97A 2FHPA 3KEGA 3GDHA 4TYYA 4BX3A 1ZVVA 1GQSA 3N5CA 1EUDB 5DM4A 3KKNA 1NXXA 1DMSA 1U04A 2I7CA 5HJ7A 1U4NA 4RV4A 5DEIA 1WDKA 4XX0B 5DGTA 3P19A 1XZ8A 4IS2A 3CPJB 3IESA 1CSEE 7YASA 5A9SA 1UZUA 3ZVKA 1DTEA 4CQLB 3V2IA 3L1JA 1L7OA 4F4CA 4HX2A 4UPEA 4JZKA 1PJCA 3OESA 3RJMA 5JNUA 3MMSA 4CKEB 2DAPA 1JFVA 5T6MA 1RC8A 3JQ8A 2VOEA 3U7JA 4DLSA 1SVNA 1DAEA 3BJZA 3FAZA 4WJZA 4JT2A 5FCDA 1O97D 1EVLA 3I9OA 1RC1A 4PAQA 4V24A 5I7VA 1KYIA 2GZRA 3FR7A 1E9RA 4RK4A 3VTAA 1PZEA 3A6HA 1YS9A 3OQJA 3ZCSA 3CLUD 4Q48A 1OREA 2PD4A 4PX3A 1LDEA 4O4IB 5LFAA 5JJIA 2DHQA 4AF7A 4P7GA 5HRAA 1EMDA 3DT8A 4G01B 4LPKA 2FMUA 2R1VA 1J21A 1E98A 3IVAA 3K5WA 1U0SY 4XFJA 3EVTA 1E1QA 1H3FA 3RYHA 1WW3A 2G9QA 1BCSB 2AI1A 1JPVA 3LSTA 4KNYA 3DVAB 1A77A 2ZCUA 3I04M 4QUEA 3QLVC 4XVQA 1E2EA 1DKLA 1KBQA 3AKZA 2ZSDA 4YVFA 2YYSA 4N9WA 1MVNA 4J1JA 3B12A 2P30A 3RTEA 2O5EA 1A9SA 2VNAA 3R7AA 1OBVA 3DP9A 2BIFA 4OATA 3O0TA 4YP5A 2QM0A 1GNTA 3IAS1 3Q72A 2FSHA 4JSYA 5AKYA 3V4VB 4C89A 4EB0A 1Q92A 5DDIP 5AVKA 1IBRA 5AT1A 1QC5B 3N0RA 1BA2A 1GG8A 3P4YA 3BPSA 4P81A 4XJSA 2DM6A 1OZ0A 3OJFA 3GELA 3NTOA 4GR4A 5JZSA 2C78A 2GBCA 4PWYA 2RG1A 3CH5A 3QOXA 4Y6QA 2AG0A 2BTEA 4RKQA 4M22A 2WKSA 4OLFA 4I9HA 3TL2A 1NVKA 2JFHA 2PTGA 4J16C 2X5NA 3K8QA 5CFQA 1LSUA 4QXOA 3T3HA 4I1PA 1Y6JA 4PC3A 5FHQA 5TPZD 4A0SA 1I32A 4Q7QA 5E1BA 4QLBA 4YUXA 3P9YA 1KDTA 2SCUB 4PZ0A 1K3UB 3HKBA 4WUVA 1XQXA 1IOVA 1OXSC 3GN2A 4O5AA 5C80A 5A7HA 5DCUA 3FCEA 4D6PA 2IZ1A 2YTZA 4UAJA 2F3RA 5GM2A 3V4FA 3PEEA 3U4QA 2A0UA 2JH3A 2QL7A 4GR9A 1RT9A 2C4WA 3LPDA 1MORA 4OB6A 1RU3A 3OFND 5GGXA 2ISSD 1E9DA 3GA5A 4ERXA 4TV8A 3Q2KA 5AK3A 2ZXFA 3R0XA 3OBBA 3ZDEA 4EW6A 2I33A 4RZ2A 5CVUA 5IUNC 4MAFA 1ECPA 1IEVA 3DAOA 3O5AA 4CKBA 1G9TA 4BJHB 3IDSA 2G76A 1L5YA 4UVGA 1YVPA 1X92A 3JVUA 1FNNA 1E2LA 1OIXA 4YP9A 2Q2WA 4GRDA 1YHNA 4Z2AA 3DT9A 1EPUA 4JC5A 1AZLA 1YL6A 2YZ2A 4IIVA 4ECAA 2DFTA 4WEQA 4EPWA 2GBLC 3RUDA 4RCVA 3PFHA 3TOXA 5GJBA 4JI3B 3IKTA 1TYBE 3C4VA 5CT4A 3AW8A 2IEIA 5HK8A 2VPPA 5DTEA 1BEZA 2Y67A 5G3YA 3IVGA 3B6IA 2HSEA 3KTDA 1KI6A 1NKTA 3QI7A 4J0IA 3V8QA 4FEEA 1KRHA 3OLXA 3A06A 3ZJ4A 4PAGA 2VXOA 3MD9A 1UZMA 5IARA 1TJ5A 3D1LA 1PGOA 2I66A 1JMYA 3HKCB 3I4CA 1Q15A 2WF9A 1IZ0A 2P90A 3ZZUA 3BFKA 4W1SA 4HPXB 2JIPA 1ZVKA 1FDWA 1KO5A 1M2VB 1LPSA 1HLGA 3HB5X 2Q9UA 3ZU2A 1VP3A 2ZANA 4MUAA 5CRIA 1IQPA 4MAAA 3FFTA 1GQ2A 1PLLA 2Q5EA 4UEOA 4YAIA 1VB5A 1O95C 4Q9LA 2FW9A 4CG1A 2ALJA 5K4GA 1FLAA 3D7SA 1S5PA 4C87A 1I3OA 3AJDA 2GAAA 2IXDA 2P0YA 3ELDA 3NV9A 3Q7IA 4KJXA 4Q05A 4R1NA 3DBHA 4U2CA 1KY5A 5JWHA 4CT5A 4XR4A 1YR7A 3BWBA 1OROA 4NMXB 1DBQA 3CIOA 3D8RA 3DLPX 5JFGA 2MHCA 4Q4AA 5DP1A 3RSCA 3U19A 1ORIA 3S4YA 2XMDA 3WGJA 2XADA 1HTBA 4XSHA 4IDUB 1RHUA 1L5SA 3KLBA 2B35A 4DCJA 1AMUA 1GL3A 4BX9A 4D9BA 4G1VA 3TDKA 1QF6A 1E9BA 2R8XA 4QUAA 4UE2A 4FYYA 3MRVA 3U4AA 4FW9A 1SB8A 4UUQA 3D5QA 3FR8A 3FSRA 3GQBB 3VHQA 3PUVA 5AKLA 4ZAWA 3R7FA 5EP3A 1O4WA 1T2FA 1ZUHA 3GC6A 1NDHA 4OQLA 5FJIA 4YUZA 3C24A 1JKJB 4N3GA 1SQSA 1U1DA 5FWYA 2NYUA 1CZUA 1QUFA 1CD5A 2C5EA 1QJ4A 1M74A 3WGLA 4LTDA 4DCUA 2HXYA 3S44A 3DKIA 1SU7A 1FDRA 2B4AA 2D4HA 2YOHA 1JDJA 3NEYA 3LIIA 5LP6C 2QX9A 3ZQUA 3VOTA 3PKZA 1Y6RA 5DFAA 1I3LA 1SXJC 3ME5A 1EFDN 2IITA 2R7LA 3WBBA 3R6LA 2ZWOA 4A5OA 1EFRD 1F3LA 1W9HA 1P2DA 3JQ9C 3ZDCA 3IIEA 2ZR7A 1ADCA 3KKQA 2J33A 1MU0A 1DTWB 1XAHA 2D8MA 3VTFA 1N6RA 1FP7A 1S0UA 1VLMA 3IPXA 3MRSA 4QE3A 1XAIA 5CVVA 4OHKA 5HFJA 2QJFA 3K4HA 4HVCA 5KTYA 4KPUB 3AVYA 4ZCQA 4HWGA 4EF5A 2YASA 1CWUA 1DAIA 2VAMA 3OIWA 1CVIA 3TPFA 2W0MA 3KHSA 3ZY6A 6LDHA 8LDHA 4F6RA 4O8ZA 2R87A 3AHEA 1OIVA 1WXDA 1WZEA 1GRVA 4TM8A 2VAPA 4ZMBA 2D0OB 4MGKR 1P31A 4DLBA 2GF9A 1M0TA 1DINA 3EFHA 4MV3A 5D6NA 4H6WA 1I1HA 1VJDA 2JZOA 2C00A 3GGSA 4CM9D 2J5KA 2L42A 1NONA 3O03A 1F3OA 2XD4A 2Q6TA 3U7RA 4F11A 3PE3A 1GYQA 2BFFA 3ZIDA 5JXJA 3RC9A 1G4UR 3AY0A 3L7BA 4JI6B 5BNTA 2FX5A 4LXHA 4X71A 1EDBA 3L0OA 4AJOA 2OO3A 3EZ2A 1PL8A 3OKCA 4IOKA 3EXHC 4HDRB 5A4IS 3B3AA 1OI4A 2EZ9A 4DAOA 5G2OA 1ORHA 4KRGA 4GMKA 1VDZA 1YE3A 2YDYA 2P6UA 1P6UA 5A7GA 4ARVA 4R8MA 2BHTA 2NTYC 1XVVA 1YRBA 5EIEA 3LKDA 3DWGA 4OGLA 1PJSA 4PV7A 3E23A 1GRCA 2ZIVB 3AM3A 4HDMA 5EMHA 3UJCA 4B79A 4BNTA 8ABPA 1L5NA 1EUCB 2A5DA 1Z0DA 2OBYA 2IOQA 5IFLA 1M34B 4DA0A 4J43A 3OX4A 1Y1KE 4RZQA 4HPJB 2GX6A 521PA 3WQHA 1LBTA 2PH3A 3N2EA 4LJ5A 2JCSA 3SVTA 3LVFO 1NPYA 3P2OA 2QR2A 2GD6A 2VUSA 4PBTA 1OZGA 1DWOA 4KW7A 1OAOA 4TTSA 3MGKA 1A5SB 2ILTA 3WBJA 1N8TA 1LNSA 1Z6GA 2VWGA 3FCSB 1JW9B 1GT6A 2GPAA 3BWDD 1QPGA 5C7YA 2HFJA 5CTJA 1YI1A 2B8NA 4HK4A 4CCSA 4UE6A 3M81A 2XDWA 4IIFA 4MLCA 2BCEA 1RAAA 3OD1A 4PYOA 3WLOA 1PDVA 2OENG 3VDMA 3T7KA 1AMNA 1EDZA 1VKRA 4C3OB 2YJ5A 2E89A 2R8RA 5FUMA 3KFLA 1NVDA 3LBYA 3NM4A 1GZ7A 1NN3A 1N2XA 2ZAGA 1FFSA 2FW6A 4URXR 1PYGA 1TVEA 1ZWLA 5DLYA 3WMWA 4DM3A 4Y6OA 2IUEA 4ZKEA 2QSJA 5DULA 1Z5GA 4LSZA 3QOFA 4ILEA 3ICQB 2I3BA 2CK3A 2HRQA 3OCWA 4MRSA 5FP0A 5AVOA 2JLAA 2AFIA 2OV1A 5KUTA 2UUBB 2LCFA 3RFFA 2C31A 2GN4A 1KYVA 3GGCA 3MMXA 1HQYE 3BS4A 4HDSB 4L8LA 3L7AA 3TD9A 1QFMA 1MABB 1GZ4A 1P17A 2F62A 3EF0A 1JA0A 1JJIA 1Z39A 2WI8A 4BNDB 4ZQBA 1NTRA 3OM8A 2PH1A 1O94C 2GNAA 1TNDA 3GAFA 1MEJA 3NFYA 1E62A 1I0LA 4GM0A 2PGDA 4RVUA 3RVOA 3WGGA 4CFYA 4AF8A 5LSAA 4L1KA 3QEBZ 3W3AD 3AUKA 1T3GA 3UO8B 4Q1AA 4BKQA 5ES4B 4TKUA 4MI3A 2PUJA 2TMGA 3K0BA 1L3IA 2X76A 3QBTA 4RCZA 1REQB 1Y48E 4OO3A 4HXFB 1JR6A 2O4UX 4CKWA 2VKQA 3DE6X 2NUAA 1KOFA 1XKLA 1IK4A 1GO2A 2QG9A 4RHFA 2GLUA 1PK7A 2HIGA 7MDHA 4TL9A 1QHNA 2BI7A 4KH0A 4TRJA 4TLLB 4P83A 3PQ8A 3IEXA 4PFJA 3H9UA 3CLSC 2QV7A 3T61A 1A9XA 4KXNA 3VNBA 3W6UA 3RVDA 4OXRA 1FP4B 4UUMA 4IJQA 2Q2QA 2YW9A 2AJ8A 2ODAA 3O38A 5JECA 4FX2A 3CRRA 1NXSA 1U8YA 3OUTA 2IPLA 1K08A 1XG5A 2CFOA 4I5IA 4BIMA 3UMSA 4JBGA 2IWHA 2WQZA 3A9UA 4GOKA 1FFYA 1XCPA 3ZWVA 3DZBA 3PYLA 1Y5MA 3BRSA 1QYRA 2IUTA 2WJYA 3Q5GA 5GGYA 4ZXFA 5BY2A 9LDTA 1J5EB 2QU8A 4OU4A 4AKGA 4C1BA 4H7DA 5EOVA 2H7VA 3VZRA 5F7JA 4ZAZA 1UDRA 3ZHCA 3RC2A 4E14A 5CX1B 5LJLA 1QNLA 4YQZA 2PMWB 2EGUA 3TLZA 1VPDA 4J1TC 1L4LA 2BHRA 1S3IA 1QVWA 1U2DC 3E9EA 2ZYAA 3NAQA 3EJ6A 4HNSA 2IW1A 3AHFA 2CUKA 3QE4A 2Q3FA 1CZRA 3E2MA 3O4RA 3DS8A 1YCDA 4C3ZA 3DL0A 1G7RA 2B6HA 2FG7C 1M54A 3ZQJA 4NV0A 4EFMA 1MH1A 4PE5B 3LY5A 3RFTA 2H4HA 1L4MA 3QFCA 1H1LB 2FLKA 3KQVA 1IB0A 4JITA 3O90A 1AB6A 1EWKA 5GMOA 3HR7A 1GL7A 1M8GA 1XDZA 5ELLA 4I55B 1J0AA 4IDOA 1GARA 5P21A 1YGPA 5E38A 3VH1A 4F04A 2ADMA 1NJGA 2VTEA 1M1YA 4RHCA 1GAQA 3GAAA 4WLFA 3RVJA 4ZTZB 4N8DA 4PZAA 1L4EA 1BGXT 2V98A 1JV2B 2Z04A 2GM3A 4G1EB 4GC5A 5DI3B 3KDSE 4ZQGA 5FADA 2FMFA 3CRQA 4IOJA 4KAFA 3SFTA 4LI3X 5AI4A 2X3UA 5I7SA 3NEJA 3VDRA 1IUPA 1WPRA 3UT0A 4D98A 2APJA 3T3EA 1ZM2A 1J2UA 4Q4JB 4QBIA 4ZYUA 2DBQA 1P0FA 2QMZA 3FNRA 1HMYA 2SBTA 4IIEA 4MLPA 4X3CA 4HNAB 3CGWA 1DLJA 3RSSA 1QIDA 4WN9A 1N77A 2DECA 3IQDB 2BFOA 4Y2GA 3R3YA 1OPRA 3B6EA 3CB2A 4L50A 3HG7A 1U63A 3ND6A 5K0JA 4FZJA 3CZMA 2BE9A 1T0BA 4UTZA