1NAHA

Udp-galactose 4-epimerase from escherichia coli, reduced
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the oxidized and reduced forms of UDP-galactose 4-epimerase isolated from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-GALACTOSE 4-EPIMERASE
total genus 131
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1995-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nahA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1nahA01
1WZEA 5I7VA 1LDGA 4QECA 4FC7A 1I01A 1N1EA 2Q1UA 2GN6A 1CIVA 3C8MA 3I52A 2WE7A 4XX0A 2VNSA 3E82A 4OXKA 3GZ4A 1Y1PA 2DPGA 5AXDA 4EUEA 3ONEA 3UW3A 3HG7A 3ZWPA 3DL2A 4OKNA 1ZK0A 2YZ7A 3M1LA 2P9GA 4BNKA 5A9SA 3AI1A 2A94A 2CVZA 3PJFA 3ZV3A 4DIFA 5IG2A 2VUSA 5G4LA 1DJQA 5A05A 3FTNA 1IHXA 1PIWA 3W8EA 2P5UA 1VKNA 4DTIA 4A03A 1NPDA 4HY3A 2GERA 5L40A 1KVQA 2YY7A 4N18A 5DCUA 3ZU4A 2NTNA 1C0PA 3HQ4O 3O26A 1N7HA 3HJAA 1ZXBA 1PL7A 2X7HA 2VUUA 3ROPA 3E1KA 1Y8QA 3IS3A 3AUUA 4XYEA 1PJ2A 2I6TA 3DQPA 3GVPA 5DULA 3ULKA 3WIDA 1PL6A 4N5LA 3ZW9A 2FP4A 2Z95A 4WOJA 3VH3A 4BO8A 3DTTA 5KVVA 2EJWA 4ND5A 5FWNA 2PD6A 2OP0A 1VPDA 2AXQA 5I8ZA 3S2EA 3OA0A 4AJPA 3V2GA 3MJSA 4PG4A 2W98A 4U6QA 2D3TA 4GVLA 1BXGA 2JAPA 5T6BA 3WGTA 2JFFA 4D46A 3BMNB 1ZXLA 1PJ3A 3PYMA 4WNCA 4Q3DA 2PA3A 2YDXA 3WDSA 4Y98A 2I5PO 4CQMB 1GEEA 2UUPA 1MFPA 1ZJYA 3NV9A 1XR3A 4DC1A 4E2ZA 3GVXA 3ONFA 4FQ8A 4BNLA 4BNJA 4W7IA 2AMFA 4CMHA 2GR9A 4F3YA 5CG2A 3PWSA 1NPYA 1I30A 3EGOA 1RYEA 3JQCA 1UH5A 4TZKA 5BNTA 3OQBA 4B3IA 2HKIA 2PZLA 1OFGA 1XGKA 3PJDA 1MA0A 2AEJA 5CAEA 1MC5A 3UKOA 4IJKA 2BELA 3JQGA 3V8BA 3WQSB 2HK9A 1E6WA 3MJEA 2J3IA 1LC3A 5KVSA 2B4TO 1DDOA 1YL7A 3NT2A 4BGIA 4L73A 4QO7A 5DCYA 4WEOA 3RSHA 4H3VA 1WMBA 2C82A 3PIDA 3SLGA 1I24A 4DQVA 1YBVA 5AOVA 4KTVE 4LCEA 5JMWA 1W6UA 2AG8A 1ZBQA 1XWFA 1ENPA 2BKAA 4P38A 1ENZA 3GT0A 1H5QA 1C14A 4BVAA 1N1GA 4ONEA 4CM7A 4NU6A 3TL2A 3DO5A 1EDOA 3DZKA 3OQ1A 4HBGA 3ZWYA 2G1UA 3LSYA 3KYDA 2X5KO 3VVBA 5G0UA 3UICA 3P19A 5DBIA 2PH3A 1YJQA 5DBFA 4BUCA 2PZMA 3HE3A 1FK8A 4CMCA 1O9BA 3PZRA 4MVJA 1JWAB 1E0DA 1I3MA 1I5RA 1QSGA 3LT1A 3NUGA 4YJGB 3SLKA 3WGQA 1PTJA 4UAGA 3AU8A 1E77A 4MDHA 1R0SA 3F1KA 4GX1A 3WJ7A 4I9HA 2VWGA 3FWNA 4BHTA 2BGLA 5H81A 1B3RA 2Y1EA 1FXSA 1EVYA 3DBLB 4FGWA 5U4QA 1QXSA 1E5LA 2ZTVA 2POQX 5EQFA 2YQ4A 3ETDA 4WGGA 1PZEA 1Z75A 1Y8RB 1C1DB 3WFJA 5T67A 4BB5A 5IDXA 3Q9UA 3K2EA 1HL3A 5ENDA 1WWKA 4EDFA 4INAA 4CR8A 4LRSB 3AY3A 2GGSA 1BDMA 4U8GA 4GI2A 4RL6A 1ZK1A 4MVJP 3RQSA 3NDRA 4RDIA 4DIBA 4J16A 2EKLA 3R6DA 4BO1A 4H7PA 4ESOA 4ZQEA 1DHRA 2P9EA 4F6LA 3I4CA 5ER6A 3DAFA 1NAIA 1R0KA 3KSDO 3VZPA 4XQCA 1R4MB 1XA0A 3U4DA 4QXMA 1SC6A 4E5NA 5A4DA 5AQ1A 5HWSA 1U8XX 3GDOA 2ET6A 2Y1OA 4FN4A 1GQYA 1IHYA 4W9NA 3R0IA 4ZD6A 3S1LA 2ZCVA 2DKNA 1U5AA 4PN3A 1YRLA 1E7MA 1IZ0A 4K1LA 1YVEI 4YRDA 2GZ3A 2X5OA 3LQFA 1T4DA 1U5CA 4R41A 1JTVA 2PD4A 3L9XA 4XJTA 4BKUA 1ZMTA 3ST7A 1YDWA 1PQWA 1DC4A 4XR9A 3RFTA 2VQ3A 1UXHA 3TDKA 1LTHR 4IDCA 5JSFA 5KKAA 1HYHA 1DIHA 1PS8A 2Q2VA 1O6ZA 3KUXA 1SAYA 1G0NA 5B1YA 2Y93A 5IXSA 1PSDA 1CRWG 1EDZA 3L9WA 3VPXA 1YQXA 2A4KA 3WFIA 1HDZA 2FN7A 4OQZA 1M67A 2V6BA 3RBXA 4OL9A 4KTTE 1XLTA 1A4IA 2JAHA 4IDFA 3KVOA 2DQ4A 2XOXA 3R1IA 4CMBA 4RJTA 3H9QA 3RUIA 1A4UA 2WYWA 4YVFA 4R1TA 4NK5A 2CDBA 3GZNA 1NHWA 5KVQA 4R1SA 5T5QA 3ZWXA 1J49A 3NX4A 1I33A 1LA2A 2JHFA 3V1UA 2H63A 8ADHA 4CV2A 1WNTA 2F00A 1ZO8A 3SJ7A 2ZTUA 4FDAA 3GY0A 1LDNA 4NQZA 5C5IA 2ZB7A 4EGFA 1E5QA 1HZJA 4IMRA 3KYDB 4RVDA 3P2OA 1E3IA 3NDJA 4FOOA 3AOEC 5HM8A 1LDMA 1XELA 1B8UA 4JCOA 2EXXA 3ZDFA 1CJCA 3RCBA 3JYNA 2W90A 4J4BA 3LF2A 3GUCA 1ISJA 4JP3A 1EEHA 4I5EA 1V3TA 2VRCD 1DAPA 3H8VA 3DWFA 2V6GA 4LSMA 2D8AA 2F1KA 3K31A 1CWUA 1ZSVA 3PWZA 2Y0CA 1YL5A 4LRTB 4AJHA 2GZ1A 4WCDA 2NVBA 1XQ1A 1SB8A 4BQRA 4LMPA 1GADO 4BNUA 3DZJA 3HFSA 4R4JA 2W2KB 3GPIA 1JVBA 1ZUD1 4GGPA 1XIVA 3D3WA 1ZKMA 1X14A 2GZ2A 3JQ6A 2AG5A 2EIHA 2HCTA 1GYRA 4BKRA 1Q7GA 4F6CA 4BNGA 1P1IA 2HK8A 4BL5A 3ADOA 3FCOA 4RF4A 2NU6A 2X9NA 2P68A 4FPXA 1JKIA 4OO3A 4ZU3A 4YYZA 5JAMA 1RYDA 4BMSA 1EBUA 4BO2A 3GVCA 3OIGA 2QRKA 4JNKA 4OXNA 3ICPA 3ON5A 4NK4A 1P1KA 2Y66A 1F12A 3HN2A 4B8ZA 2PGLA 4Q9NA 4E33A 2EJVA 1ISMA 3PHJA 3O38A 4J6FA 4L0QA 3W6ZA 4YEDA 4FOSA 1UR5A 5ER9A 1EK5A 4M89A 5ES3A 4IDEA 1WZIA 3V2HA 2A35A 3I9OA 5ITWA 2VYVA 3D0OA 4TSKA 1KIFA 4DPMA 1U3TA 1ISHA 2J5QA 5T57A 1GUYA 1EQ2A 1HRDA 3WLFA 4ALNA 3OH8A 3GG9A 4DRYA 4YR9A 5JDIC 1P33A 4ZGWA 5A02A 5CG1A 1TXGA 4M54A 4CQMA 4B4OA 3KB6A 9LDBA 1UDAA 3I83A 4BO0A 1KEUA 4IDBA 4JJFA 4MINA 4E2WA 1R15A 2IEDA 1T2EA 5H83A 4ZQFA 2DU8A 4EJMA 3ANMA 3GRKA 3QJ5A 1AUPA 1NFQA 2FPIA 1X0VA 3JQFC 2HMUA 4FB5A 3C1TA 3N74A 5HBRA 4BIIA 3HN7A 4AJNA 1HE2A 1LSUA 2YW9A 4OYRA 1EK6A 4PLYA 4DUPA 2X1HA 3TN7A 1BSVA 4J7XA 1O5IA 4YJFA 3DBHB 1QLHA 2G17A 2C20A 5IZCC 4DREA 3VKVA 4CR7A 3GFBA 1Q0LA 2EGHA 4YT5A 4YAIA 3B20A 4TROA 5BSGA 2IRWA 2ZJ1A 4IS2A 5A06A 1I0ZA 1JWBB 3HB4X 1HDOA 2Q2QA 5ICMA 2YDYA 2PNFA 3DZFA 5EQDA 3OHSX 2IYOA 4BQPA 2BGMA 3U9LA 1HTBA 3GHHA 4IGFA 1EMDA 2D5AA 1A7KA 4D42A 4NFHA 5DDIP 1YH3A 4NFYA 4Q3BA 1LDYA 4WCFB 5JFOA 4JLWA 3UF0A 1GPJA 1WMAA 2C0CA 1IYZA 3DB2A 4RGBA 4B4UA 1W8DA 4YACA 1C0KA 2DVMA 4GLOA 2OBNA 4YAGA 3VOSA 4G2NA 3DOJA 4CODB 1VJ0A 2FHSA 3CMCO 2WEKA 4MVJM 2B36A 4UVDA 4CM4A 4I9UA 4GVXA 4S3MA 2ZK7A 3K96A 3DR3A 2WMDA 3LT4A 4BNZA 3D64A 3KO8A 4AJ2A 4QX6A 4AJ1A 1K6JA 1D4FA 4NJOA 3EVTA 4Z0TA 1KC3A 1U4OA 1UP6A 4KP7A 3VPHA 3JD0A 1UDBA 3UVEA 2O7SA 3V5NA 3LLVA 1LBEA 1J5PA 2EGGA 4ALJA 5CP8A 1J4AA 1YBAA 2IZZA 1KOLA 3WYEA 1ADBA 1HSOA 3C7CB 3K30A 3QY9A 1NM5A 1W73A 3ZHBA 2DTEA 3S2GA 2ZTLA 4OM8A 3ZV5A 1A5ZA 4YQYA 1PQPA 3QWFA 3DFUA 1HDGO 3D1LA 3OQ6A 2FMUA 4WCFC 1B8VA 4DPKA 2YFHA 3MOGA 5DP1A 1EZ4A 1WDLA 5DBGA 2VHXA 4O5OA 1PGOA 3ROKA 4Y6PA 1G0OA 1R4NA 3FBGA 3B1JA 4W9NC 4D43A 2C29D 3QP9A 4CMKA 1CQJA 5G0TA 4C7KA 3A9WA 1DBVO 3KXDA 3IP1A 1GUZA 4XB2A 3WBFA 1U2DA 3BMOA 4PG6A 2O4CA 3JD3A 2FR1A 5A5EA 2GD1O 3WGHA 3KV3O 4NIMA 3SX2A 2EWMA 4NI5A 3ORFA 4IQGA 3TF5A 3CEAA 3FWZA 3SBOA 4GMGA 1B2LA 1OMOA 1SPXA 1GYPA 4U6SA 1I32A 5C37A 2VZ8A 3JQAA 3OJOA 1NFFA 4P22A 4TQGA 1DIRA 4QUKA 3H6KA 5ITVA 3EZYA 4MIOA 1V3UA 1IL0A 4MKZA 3GRPA 1H6CA 1PR9A 2UUOA 3PJEA 3QLJA 4G65A 4ZQHA 3OSUA 5FYDA 2X86A 3E8XA 3ZCXA 5DP2A 5IXYA 4H16A 3IL2A 2YHIB 1B8PA 3MOIA 1QR6A 3Q6IA 3K8ZA 1TEHA 2BRUA 2GSDA 1U4SA 3PQEA 4PLFA 2G0TA 4CLHA 1A7AA 2Q2WA 3NJ4A 2UVDA 1BVUA 1VE9A 3CZMA 3FNHA 1ONNA 4JK3A 3RJ5A 3D4OA 4GSKA 4JP2A 2P91A 4Z9YA 3AU9A 4RVHA 4WOKA 3OBBA 4FIZA 5JPIA 2NV6A 3KBOA 2GO1A 5L3ZA 1V3VA 1YB4A 2P2SA 1GV0A 3C85A 4O63O 3U4HA 5BNIA 4FFRA 1DC5A 2HRBA 1O0SA 2PFGA 2PKQO 3AOEA 4R51A 4FFOA 2WDZA 4QFCA 3LC1O 1QV6A 2PWZA 5FEUA 4XWYA 1VL0A 4Y6SA 3WLEA 1TVEA 1TT7A 4UVHA 3C3XA 4II2A 2C2YA 1T25A 3GEGA 3NGLA 1BW9B 1VJTA 2AA3A 2CDCA 5HS6A 1I36A 2EW2A 1QG6A 3ROQA 5CDTA 4Y6RA 3NT4A 5G0SA 1K6IA 3RAJA 3RVDA 2EERA 2B5WA 2BLLA 2IXBA 2I65A 4BNMA 4YPOA 3PRJA 5A5FA 2WYUA 3DHYA 4TZTA 4TRJA 4GQAA 4J2OA 5AXAA 4Y9DA 3ZHYA 3CINA 2WJPA 3DZBA 2ZB3A 5JMPA 1A9YA 5IZ4A 2ZYAA 2E49A 4RPLA 3G1UA 1IUKA 2DT5A 3DZIA 4CLOB 3LVFO 4R9RA 4YJHB 3Q0EA 2OFPA 3C24A 3KEOA 3NRCA 5THQA 4E5MA 3B70A 3QVWA 4PFJA 1E1MA 3QWIA 1K0UA 5B12A 4PLWA 3H9UA 4RPJA 5HRUA 1U3VA 3B1KA 2YYYA 4KDEA 3T7EA 4EI2A 5CEJA 4YTEA 3AY6A 2NU9A 4MKXA 3TRIA 4PZCA 2TMDA 4DPLA 3VZRA 3F4LA 4DXHA 3JV7A 5JY1A 2HMWA 5LC1A 4BO7A 1Y5RA 1L7EA 2R6JA 3HUDA 3IUPA 1GU7A 1PJLA 4EZBA 1HEUA 1Y6JA 4OMUA 4MP6A 2FSVA 3RFVA 1R6DA 5JDIA 3SC4A 3AUAA 2Y1CA 2J5RA 1DOHA 4WLNA 4LMRA 3PHGA 4TVBA 1PS9A 2O3UA 1F0YA 1TLTA 2YV3A 3PIIA 1LXCA 3S55A 3OP4A 4HWKA 4UEKA 1H6BA 3FR8A 4W82A 4GMFA 1MUUA 4FW8A 5K6AA 1UAGA 1LSJA 3CPSA 2RCYA 3D5TA 1S7CA 2D4AA 4EJ6A 4U0JA 3AFMA 4KOAA 5ICSA 1DB3A 3FTPA 3Q2KA 1P9LA 4AJLA 4CQLB 4DIOA 1X7DA 2XXBA 4CMGA 1N8KA 1QYVA 4NBRA 5DZSA 1B15A 1F14A 4WLVA 2D59A 4IXTA 5EN4A 2QZ9A 4CUKA 2GUGA 3W8DA 3HDYA 3T7CA 3P5SA 1JLLA 2W4QA 4L4RA 4YRBA 1NQOA 1V6AA 1QYXA 5C7LO 1Q7CA 1ZW1A 2NACA 3C7AA 2GCGA 2P4HX 3OF2A 2HMVA 2CF6A 2PZKA 4ND1A 1FJHA 5EERA 1E7WA 1SOWA 5IJZA 1XG5A 3LK7A 1XKQA 3PJGA 2X6TA 2QQ5A 3F46A 1T1SA 4Q3NA 3IJPA 3RU7A 4ZHSA 3SVTA 2DM6A 3ZI0A 2GPTA 1NVTA 2I99A 4CV0A 3OEYA 2CFCA 4HXYA 1YQDA 3IKTA 2ZCUA 3TSCA 3MZ0A 3EAGA 2YUTA 1R16A 2B35A 2B4RO 3DXFA 3GN1A 4FD3A 3TZCA 4XGKA 3OJEA 1ZK4A 1ZSYA 1IE3A 2O48X 3KOUA 3PYLA 3Q2IA 3X2EA 2OORA 3K73O 3H65A 4DMMA 4CLOA 1KEVA 3S8MA 1T26A 1BMDA 2D1YA 2YQ5A 1QRRA 3PDJA 2VHYA 2PGDA 1NHGA 4BNIA 4YWJA 1MX3A 1JKJA 3LC2O 1NQAO 4NHEA 5ILOA 1BRMA 1T2DA 3RFXA 1XU9A 2OBYA 1Z74A 4CV1A 1X7HA 4HFJA 3FD8A 4L74A 2OO5A 4S1VA 4B8WA 4IPTA 3WWZA 5TF4A 2JCVA 1AHIA 4BGEA 4W99A 2WD7B 4R5HA 4DBZA 4KDFA 3SXPA 3X2FA 4XRGA 1H94A 1Y9AA 4GWGA 5AVOA 3JCZA 3OJFA 4W4TA 2X23A 4IJWA 1FMCA 2PLAA 4NZ9A 3ZWOA 4CJXA 2C59A 4E6PA 5I8WA 1O94A 3I9KA 2X4GA 2QYSA 3NKLA 1QV7A 4KUEA 3UN1A 4CMEA 1KC1A 5DT9A 2D0IA 1YONA 4UUMA 4BKOA 4BB6A 1TA4A 4NNJA 3RIHA 2Q1WA 6LDHA 2FOIA 3DBHA 4O0LA 1ZEJA 3WGYA 1PGNA 3CSDA 5JDCC 5JS6A 1UUFA 4CM5A 3RJ9A 1XHLA 3K9QO 1NP3A 4I1IA 4JROA 4NJMB 5F5NA 1ORRA 5JC1A 1GUFA 3GH3A 3WGGA 2CMDA 3OETA 3KLMX 4ZVVA 4J2HA 1SBYA 2P9CA 5JCJD 2J3HA 4FC6A 3FPCA 4JBHA 4HADA 4PG7A 2FR8A 3H9GA 1A27A 4W6ZA 5EMHA 5EL0A 3AUTA 1QYWA 4W7HA 2I3AA 3FI9A 5JXWA 1HT0A 1NASA 2Q3EA 1C1DA 2Z1MA 4P4LA 4DYDA 2HMSA 3L4SO 3TOXA 2DBQA 1E3EA 4K6FA 4TMFA 3BHIA 4AG3A 2Q4BA 2IYPA 4DBVO 4MPDA 1P3DA 4N54A 1LLUA 1H2HA 5L7YA 1DHTA 4ALIA 1WDMA 2LDXA 2NADA 4WLOA 3WQQA 3JQAD 4E13A 4XYLA 3WYBA 1N2SA 3KYBA 4DYVA 1UXGA 4IDAA 1AN9A 1F8GA 3EDMA 4KQWA 3F5SA 4URFA 1VL6A 5TNXA 3ZN2A 1P1HA 5KTKA 3KTDA 4JJGA 1AHHA 1BWSA 5LCXA 3PWKA 3ZV6A 4CLRA 2DBRA 1H6DA 1PGJA 3GNQA 4IJVA 2NWQA 1TT5B 1ZK3A 3DZGA 4J7UA 5CHEA 3LDHA 5F1PA 3S2FA 5IDWA 4PLHA 3FN4A 4UUOA 1N9GB 1ADGA 4DLBA 4BNNA 4FBGA 3NT5A 3SC6A 3WGOA 3QWHA 4E0BA 2EEZA 1DSSG 5F1KA 2JCYA 4Q3CA 3G1TA 1B26A 4IJUA 2E82A 1B7GO 3TFQA 3O03A 3IOYA 3VH2A 3K92A 1R4NB 4U0KA 3ZNQA 2WTBA 4RLHA 2V7PA 3CZRA 4L9RA 3MJCA 3JQBA 4KWHA 2J3KA 4AJIA 1I3NA 1U2GA 3H5NA 2JFGA 3RUAA 3QSGA 4GX0A 1BXKA 3ZWCA 3U4CA 3INRA 5CDUA 1PJ4A 2YHUA 3VPGA 5I7EA 1RWBA 4BS9A 3RU9A 1U1IA 4JGBA 3CIFA 2WSBA 2Y0EA 2VCYA 3OM9A 3RC7A 4MO2A 3Q9NA 4DL9A 1U9JA 4RZHA 2YV1A 1N7GA 3GNTA 3PQFA 5HS4A 4PGFA 5GZ6A 4B7UA 2VHZA 4GKBA 3UUWA 3PHIA 4ND2A 3IKVA 1DFHA 4OSOA 5K9ZA 1Z73A 1CERA 1HF3A 1OAAA 3JQ9A 5IN4A 5L95A 3OA2A 1GYQA 3KHUA 1NWHA 2NLOA 3DBRB 1ID1A 3FBTA 3MWDB 4PLGA 3AI2A 4GX5A 4IY1A 3C7DB 4UREA 1KVSA 3PYXA 3U62A 3PLNA 5TIIA 2Z5LA 3HFGA 4I08A 2P5YA 5DN9A 8LDHA 2AQ8A 3DOCA 4OKIA 4F46A 3ZWAA 5JBIA 1LI4A 3H2ZA 4RCVA 1GPDG 1ISIA 5CEEA 6ADHA 3GDGA 3ANNA 1ZCJA 2WYVA 1VC2A 2SCUA 2HK7A 2FRDA 4B4WA 5A9TA 3WNVA 4OAQA 2GN4A 4L76A 1YWGO 1WW8A 3AUSA 4LCJA 4MIYA 1CQIA 1KETA 3QVXA 1AXGA 4E12A 2P4QA 4M86A 3PFWO 1VRWA 2ZIZA 4IXWA 1X7GA 5K6AC 5KCZA 2R00A 2RHRA 4ID9A 4TWRA 3UH1A 3ENKA 2ZYGA 3TQHA 4K26A 3LF1A 4AJEA 2DPHA 3HWRA 4N5NA 4PLVA 1PZGA 5JC8A 5EIOA 3G0OA 1NPTO 2NVUB 1BG6A 4XA8A 3OJLA 3IP3A 2OUIA 3LT2A 3ZHXA 1W0CA 2H9IA 4O59O 3WX0A 5IDQA 4JJIA 3H5RA 4OHUA 3PHLA 2ZYDA 3TOZA 2IODA 3HADA 3K2BA 5HA5A 3ETEA 2FZWA 1B3BA 4Z9FA 1N9GA 3CMMA 1PJTA 3AI3A 2DAPA 3TPCA 4A10A 4PLPA 4OOEA 3GHYA 4RQUA 4UVGA 4ZRNA 4P4NA 2VNAA 4LVUA 1J0XO 3LYLA 3QVTA 4RVSA 2O3TA 5A9SB 5B4UA 4DLLA 1YQGA 1ADCA 1T1RA 3VTZA 4GL4A 2EKQA 3TFOA 2CD9A 5KJ6A 1ZNQO 1PQUA 4MP8A 4ZJUA 1YXMA 3D4NA 2Y68A 1I2BA 3A06A 1YE3A 3VZQA 2X8LA 3LZ6A 1VI2A 2HSDA 4I9NA 5BQFA 3WICA 4JXKA 2JHGA 4J43A 1C0IA 4D7AA 3L4BC 5A03A 3BA1A 2VTEA 4CM9D 2B5VA 1IZ9A 4CLDA 2J5KA 4YJGA 5B4TA 2AE2A 4RLSA 3D4PA 2O3QA 4BO6A 4IZHA 1LC0A 1GZ4A 2PR2A 1LUAA 2OZPA 3JQ7B 4Z0HO 1KBZA 4NDNE 2YV2A 4FFPA 1QYCA 3MWEB 3BTUA 3EK2A 3JD4A 4BO3A 1NNUA 1UZLA 3GN2A 5G0WA 2XAAA 2D5CA 5JCXA 2XF8A 5CDYA 4M1QA 3I6QA 4YDRA 1LDBA 1FDSA 3FNFA 1RM0A 5G4KA 4ZICA 5KNLA 4IMPA 3E5RA 3U0BA 4A5OA 1U3UA 4R1NA 2BH9A 1H0KA 5F5LA 5FI3A 2VRBA 1N92A 2VT2A 4BOYA 1IB6A 1P74A 3CUKA 2HQ1A 4RPGA 1LSSA 1RM5A 3VHRA 4E32A 1DC3A 4ND4A 1LLQA 3BHMA 4QTZA 3KM0A 4Y8VA 4CM3A 5IZCA 1ENYA 1VL8A 3OICA 1C3VA 3OIFA 4MVJG 4YJHA 3GR6A 3H9EO 4TRRA 1Z45A 4LVCA 4DGSA 1LQUA 4FSHA 3IQDB 4OJNA 4ZA2A 5KIAA 2V6FA 3TJRA 3QA9A 5EINA 4NBWA 1SO8A 4J1SA 3GUYA 4AJKA 4LK3A 3WB9A 2C5EA 3ASVA 3FPLA 2GASA 1R12A 1SB9A 2ZB4A 2VZ9A 4NU5A 3L77A 4MIEA 4BMNA 4JIGA 4OH1A 3STHA 4DWVA 1NR1A 4FFMA 3U09A 5CDGA 5TJHA 1RM4A 2V6MA 4JBGA 1EUZA 4FR5A 1GZ3A 3NJ8A 1JKFA 5L4SA 1P77A 4R1UA 3VPSA 3WMWA 4AFNA 4AL4A 4RV9A 4WLEA 3PTZA 2DUUA 3E9NA 1PZHA 2J3JA 3ZNPA 1Q2XA 5I9MA 1I8TA 3JYQA 5L4LA 1UXKA 3FRJA 1GZ6A 3JD2A 2PH5A 5MGBA 1U28A 1X15A 1EQUA 3ABIA 4GGOA 3HDHA 5GMOA 3FNGA 3M6IA 3MEQA 4JQCA 5L7WA 1MXFA 3SJUA 1GEGA 1TI7A 3FNEA 4PRLA 3K6JA 1X1EA 3INGA 4KMSA 3WJAA 4IIUA 4PLCA 5JAZA 3I4FA 5COQA 1LLDA 2VN8A 4CM9A 3UCFA 2VRCA 3ZU5A 4WECA 3PVZA 3I9NA 1HE3A 4D3SA 2H5LA 2HDHA 3RUEA 3F1LA 5G4KB 1MFZA 4CMIB 1OC4A 1NTOA 4ALMA 1YGYA 3INTA 1G1AA 3ITDA 1VLLA 2HMTA 2YHIA 3M2PA 3VDQA 3PLRA 3T4XA 4NFSA 4HFNA 2E4AA 3A28A 1DJNA 5GY7A 2H6EA 3P2YA 3D3WB 3WMXA 2FPPA 1ML3A 1UP7A 2IDZA 3JQ9C 5FI5A 1UXJA 4OQYA 3Q3CA 4IS3A 3RUCA 4BV9A 1E6UA 4MKRA 3WR5A 1GFSA 2O3SA 3W8FA 4CPDA 4BGVA 4HUJA 4XD2A 3QVSA 3HDQA 4A2CA 1B14A 1K5HA 4CMIA 1P31A 3AK4A 3ICCA 4WNIA 1EUCA 3WQRA 1UJMA 4FGSA 3EZLA 4BV8A 1DLJA 1B0AA 1HETA 4WK6A 3ZV4A 3E5MA 1ONOA 2VZ0A 2C2XA 2I67A 4G5HA 5F1OA 4R01A 1S6YA 3I6IA 3UHAA 4BO5A 5J23A 4PVDA 4E3ZA 1V8BA 4E5KA 1V35A 5FFFA 1M75A 4KWIA 2FWMX 2VYVD 2CNBA 1I10A 1M76A 4JBIA 1R0LA 4QFDA 4WLUA 1OBFO 3RC9A 3TZQA 3BMQB 1ISFA 3HNPA 4FFLA 3AWDA 2Q46A 2X58A 2A92A 3EVNA 3HHPA 5I7SA 5MDHA 2HUNA 2JD0A 3JQFA 2VOJA 4RDHA 3W4KA 4OXYA 3B1FA 3H4VA 4HFRA 4WJZA 4B4VA 5KOIA 4AJOA 2DTXA 1NQ5A 1H2BA 1MB4A 1HLPA 4LSWA 1JVSA 1E1LA 1D1TA 4O6VA 4PG5A 1UZMA 1JAXA 3G3EA 3O8QA 4I5FA 3R3SA 3VH1A 1XSEA 3P7MA 4U7WA 4E31A 4CUZA 2WE8A 1LLCA 4DA9A 4DQUA 3GC6A 2BMAA 2QRLA 3AM4A 3BMCA 3BMQA 4PCVA 4MVJE 1I3KA 1BGVA 2UDPA 3JTMA 2G82A 1WPQA 3AM3A 3BIOA 1BHSA 5KWEA 4J9VA 4B7XA 3C1AA 1V0JA 2FSSA 3JSAA 3KLPX 1IY8A 1JQBA 2CY0A 2QIOA 4J4HA 4GSLA 7MDHA 4B79A 1WP4A 1PEDA 1U7TA 3FHLA 5HTOA 2X0JA 3JYPA 4RO0A 4OIMA 1GCUA 3AW9A 4WASA 3QW2A 3DHEA 3PGJA 1MXHA 1OZAA 1CEQA 3I23A 2C7VA 5GZ1A 3IIEA 1QORA 5DOZA 5BSHA 2D2IA 3U3XA 2PGJA 3EW7A 2Q1SA 2HJSA 4ROSA 3D3EA 1LRKA 2QW8A 3DMTA 2CF5A 2AW5A 3IAHA 4GKVA 4RVGA 1HDCA 3RKRA 2OHXA 1H6AA 4O1MA 2GDZA 1A72A 4L8VA 4M87A 4F45A 3Q1LA 3JQ8B 2AQHA 3COSA 1K89A 4YAJA 2AEMA 3OMLA 1NXQA 4LN1A 2X0RA 4MVJH 1EFLA 2W2LD 3WTBA 1Y81A 4RF2A 1HZZA 4FCCA 4RQTA 3U5TA 3KRTA 4UEJA 1JW9B 4TVOA 4D3FA 5KKCA 2VOEA 3NAQA 4P8RA 1PJBA 2NQ8A 4UVEA 3WTCA 3DBVO 3MJTA 1P45A 2IZ1A 2NVUA 2GRAA 1F17A 3I1JA 3RI3A 1DRVA 2Y0DA 1MG0A 3C1OA 3L0DA 4BGUA 1HLDA 5JAIA 5A9RA 1M66A 2HO5A 3GOHA 2Q4EA 1HXHA 4PLZA 3WOHA 1D1SA 1DRWA 1GCOA 3UGKA 5LDHA 1Q0QA 2C07A 4YAEA 1MGOA 1UXIA 1EE9A 1GD1O 2VT3A 3HSKA 3ITKA 3JQ8A 4ZQGA 5KJ1A 3VDRA 2C54A 3GA0A 4QEDA 2TMGA 3NTQA 2CVOA 5AXCA 3F9IA 5CEFA 1ARZA 2BFPA 1VSVA 3GK3A 4J1QA 2BFMA 4NMHA 4CMJA 4TRNA 4IDDA 3VVCA 3IMFA 1AE1A 2B69A 3ZWNA 3RUDA 2IXAA 2O3JA 3DFZA 4GLLA 1P0FA 1FF9A 2BD0A 3KETA 4FJ2A 4GAEA 3VH4A 1HDYA 1KS9A 2NTJA 4YT4A 4ITUA 3H2SA 3PI7A 1YBMA 2UAGA 3RBVA 4MOWA 1JU9A 2FPGA 2QX7A 3EYWA 5AXBA 1CYDA 3JD1A 1EVIA 2PTGA 3DMTC 3BHJA 2BFOA 3GQVA 3JQ7A 2LDBA 3TNLA 1DIGA 2RHCA 2O2SA 2BI8A 5A3VA 4XQ9A 4CM6A 5COAA 1GDHA 2VYND 1TB4A 4ALLA 1QYDA 2QG4A 3LLSA 4CM8B 4A7PA 4M49A 4QO8A 5JAQA 1KEPA 1PJQA 3QWAA 2ZB8A 5JCJA 4CMEC 3W4JA 2H1SA 4R3WA 1L1FA 4E2XA 1DRUA 2DFVA 1T4BA 3F47A 4YJFB 4J91A 4XKJA 1CETA 3QV1A 4WKGA 2ZTMA 1ZFNA 2IEBA 5JYDA 2NVWA 2OGUA 1QP8A 4NG5A 3K5PA 2O2YA 4Q3EA 3DBRA 4J49A 4M55A 2Q99A 3PPIA 5DNAA 4FJ0A 1LU9A 1BXGB 2O4UX 3WGZA 1DPGA 2JD1A 4N7RA 4Z3KA 4N5MA 5JW6A 3I9JA 2WD7A 2X9GA 5T8KC 4B7CA 4CLXA 2EP7A 2HJRA 4YXFA 1RM3A 1YJ8A 5A1TA 3GPDG 3BTOA 5COBA 4E30A 3JYLA 4MVJD 2Y67A 4WLFA 3RD5A 4IGEA 3E18A 1GR0A 3L07A 1ADFA 4BNTA 1Z6ZA 4YCAA 2ILTA 1E3SA 3GF4A 5T64A 3GFGA 4CQMD 5ILGA 3QVOA 2GF2A 2R2GA 3QHAA 5L7TA 2PZJA 2VWQA 4Y67A 3NTRA 1KY5A 1DEHA 3RUHA 1QLJA 1SZJG 1E7YA 1EBFA 3UOGA 1X13A 3A4VA 3JQGB 3DZHA 4KZPA 3RROA 4A26A 2ZKLA 3ENNA 3PGXA 4HNGA 3RBZA 3V2UA 1B16A 5IAAA 1SNYA 1BTOA 3MCVA 2OXIA 4ZQBA 4YT2A 3ONDA 1LDEA 1ZK2A 3WIEA 3DOOA 1K3TA 1LRLA 2E6UX 3PEFA 3PDUA 1ZEMA 1ULUA 2Y1FA 1E3WB 2GN9A 2OL4A 2OP1A 1O8CA 4GWKA 3DDNA 4R69A 1E7QA 4TRMA 5TQVA 3V1YA 5JYEA 1Y8QB 5CDSA 1XU7A 1NYTA 3IDSA 1P0CA 2W2KA 3JQEA 4HX5A 1LJ8A 2O3RA 2Z1NA 3ROMA 1W4ZA 4R68A 1P1JA 2EHDA 2AEFA 4XYMA 3EY4A 1BXZA 1PWXA 4WEQA 1GAEO 4A27A 1NBOA 3AJRA 4NBUA 2CVQA 4HFMA 3HB5X 3WBBA 4ZN6A 2ZJ0A 3W1VA 1ONPA 1R37A 1EUDA 1YKFA 5TGDA 3LU1A 1E3JA 1Z7EA 1HE5A 4UULA 4OOFA 5JNLA 1ZSNA 1UP4A 4DVJA 4UUNA 3CH6A 3GMDA 2ZQZA 1Y8RA 1NWCA 4WPGA 3MTGA 1E3LA 1YL6A 3DONA 2Y05A 1E3WA 2A9FA 1H93A 4EUFA 1IPFA 2Q1TA 1CF2O 4YA6A 3PQDA 3T4EA 4BNFA 2HRZA 3O8QB 5C7IO 2GYYA 4EEXA 1GQ2A 3DAPA 3DHNA 4IQ8A 5F3RA 1PS0A 4UUPA 1ZIDA 2BHLA 1U7HA 3F4BA 5I7FA 1PR3A 4MJLA 2PKRA 5TLSA 1WVGA 3JQAB 4AVYA 1SOVA 4YT8A 5TT0A 5JO9A 1HYGA 3G17A 3E9MA 3H7AA 1PU2A 5THKA 2OMEA 3BXXA 3LC7O 3QQPA 2C5AA 3NDIA 4D3DA 4EJ0A 4J4TA 3H5AA 5U9CA 1Y7TA 2Q50A 3PK0A 5TC4A 1UDCA 4D0SA 1VJ1A 2DBVO 2VWPA 2W8ZA 4CLEA 3RKUA 1QKIA 4X54A 3IJRA 4RPKA 1DIAA 4WUVA 3KYCA 3Q11A 4A73A 4Q3AA 4XZ3A 3TL3A 5DOVA 2O50A 4IM7A 4YQZA 3BAZA 2B0JA 3L6DA 1K2WA 1JDJA 5U1PA 5KJFA 3H3FA 5BSEA 3E48A 5L4NA 5JO0A 1XYGA 4XDZA 3ZU2A 1HWYA 3UFXA 2NM0A 1I2ZA 2X22A 3IUSA 3BMNA 3G49A 1LNQA 4IBOA 2X9VA 3OIDA 3F3SA 3WNQA 3PHHA 3ZWWA 3ZWMA 4DMLA 4E5YA 4E2YA 2XPCA 4XGNA 2B83A 1M2WA 4I5GA 3GGOA 1CDOA 2E48A 5FF9A 4BKPA 1BW9A 1N5DA 2NSDA 3WWYA 4PG8A 1PWZA 4CM1A 1FDUA 2Y99A 1DIBA 3BMOB 1HDRA 2FZEA 4EUHA 2IE0A 4PRKA 2Y1GA 3FF4A 3GVHA 5JY6A 1XDWA 5BNFA 1F8FA 1PJSA 2BGKA 1LQTA 4IIVA 4BMVA 1YOVA 3GNSA 2DC1A 4FFNA 5TX7A 4TKMA 5KVCA 1L7DA 1ULSA 2BI7A 1GTMA 1DLIA 3GZNB 4QT0A 4HV4A 2RBEA 2DBZA 3ZGYA 3CXRA 1T2AA 5L53A 3AY7A 4J0FA 2NU8A 4YAKA 1WLYA 4J1NA 3W4IA 4NJMA 4K28A 1RPNA 4ILKA 4Q39A 2DLDA 1WDKA 1KERA 4H15A 3ADPA 3VPFA 4CL8A 3GG2A 4IINA 3DTYA 2AQIA 4XB1A 4CM4B 5B4VA 5BSFA 3NGXA 2EF1A 4DLAA 1K6XA 1KY4A 2DTDA 2DUWA 2I3GA 4CL3A 1XCBA 1E7RA 2E37A 4LW8A 3ZW8A 5A04A 4NBTA 3MJVA 1DC6A 4GH5A 4RVFA 3EMKA 1M6WA 4JX8A 1KVTA 3ANLA 3N7UA 5F21A 1JA9A 2X0NA 1E7SA 3WS7A 1EVJA 3JYOA 4RORA 3AFNA 4XIJA 2C7GA 1SEVA 5C7OO 1BVRA 1H9BA 2G5CA 5BR7A 1QMGA 4NBVA 3BTSA 5KJEA 4BKQA 1YO6A 2X5JO 5G0VA 2Y1DA 2JL1A 4PZEA 1PZFA 4D41A 3NEPX 1PGQA 1ENOA 3GAZA 2PD3A 4HNHA 2OOSA 3MJ4A 1HSZA 4R16A 4II3A 4XCVA 2AHRA 5L45A 2IZ0A 2Q45A 3UCEA 1LRJA 3CTMA 3DBLA 3TZ6A 1YB5A 2RH4A 1NVMB 1PL8A 2HLPA 4B3HA 3PP8A 1P1RA 4R5MA 4J90A 3GDFA 4CM8A 4CUJA 5C3MA 4J9UE 1KVUA 4E21A 1Z7BA 4B3JA 1HYEA 2JD2A 2JCXA 3DMYA 3PZBA 1E1NA 1A9ZA 4FJ1A 2QRJA 3GLQA 4XEHA 3TZHA 3W6UA 5KJCA 1NVGA 9LDTA 4NH4A 2NQTA 2UYYA 1YS4A 4UVIA 4KUHA 4FS3A 1Q7BA 1V9LA 3I9LA 5CPFA 3MTJA 1IULA 5TJ9A 5I9LA 1DFGA 5T8KA 5H82A 1IOLA 1RKXA 3LT0A 3O4RA 4HP8A 4PIVA 3QWBA 1JAYA 1G6KA 2EW8A 3KZVA 4I8XA 4MP3A 4P4GA 5TRTA 3UXYA 3ZNOA 1EE2A 1H9AA 3M2TA 1D3AA 2QZZA 3BYZA 1KEWA 4YRAA 4XQGA 3L6EA 1M6HA 1T2FA 1VM6A 2VYNA 5TS3A 5DCWA 3ZWBA 2FY8A 1O95A 4YB8A 1C1XB 3ASUA 4E4YA 4EEZA 4GX2A 4PVCA 5BT9A 2CSUA 3H3JA 4OSPA 2VTDA 4EW6A 1SCUA 1R66A 1HDXA 3KSUA 1OC2A 1NFRA 4XJSA 2J6IA 1NAHA 2EP5A 5CPBA 1FDVA 2QHXA 2AQKA 4PLTA 1X1TA 2NNLD 4XRRA 4L4SA 2PK3A 3DC2A 1ZH8A 3E6AA 4EYEA 1GL3A 4KUGA 4J3FA 2JFHA 4J1TA 3FR7A 2VWHA 7ADHA 3ZHZA 1AXEA 1NR7A 1O89A 4XIYA 1DAOA 1T2CA 3RC1A 5CFZA 2FR0A 1C1XA 3U4IA 2JKVA 4QSMA 5TSDA 3ZZNA 2RH8A 1TT5A 2B37A 3IC5A 2O23A 1ISGA 4PZDA 3D7LA 1J6UA 3RWBA 2X0IA 5JLAA 4RZIA 1MP0A 1P44A 1GY8A 1U8FO 4RVUA 1R4MA 3E03A 3F6YA 4WCFA 4D45A 2EV9A 3BZUA 3G79A 1XEAA 5L9AA 2O7QA 4Z0PA 3OECA 2J8ZA 3GMSA 1P1FA 1I2CA 5LDGA 4J7CA 1VKOA 1LEHA 1HE4A 1OI7A 3ZH2A 3PXXA 2EG9A 3I9MA 2HAEA 5TT1A 5EPOA 3GEDA 1D7OA 3H9JA 3N58A 1MG5A 2AE1A 1MC4A 5GZ3A 4M8SA 3FSRA 1E1KA 1NQTA 2EKPA 4CR6A 3VC7A 1SEPA 4D44A 1DO8A 1UZNA 3HZZA 1E6EA 1YDEA 1Z82A 4D0RA 5IDYA 5DF1A 3I5MA 4IZIA 3ZWVA 4BO4A 4XGIA 4BNVA 3KSZO 1HKUA 2RAFA 1EVZA 1MLDA 3DAGA 1UAYA 1Y5MA 1JN0A 2WM3A 3WSVA 2ZATA 4CMAA 1EFKA 4E5PA 2RIRA 5IN5A 4R9SA 4WE3A 3D5QA 5EESA 4ALKA 3OJ0A 1SMKA 2VUTA 2GN8A 3SEFA 3WYCA 3L4BA 3A1NA 4L4XA 3L6OO 3JQDA 3VKUA 4CLRB 4XQEA 1GV1A 3V1TC 3ZNNA 3R3JA 4DC0A 1ZVMA 4ND3A 3GAFA 2VHVA 2R00C 4KQXA 2NUAA 5IFLA 2I66A 3NYWA 4XYBA 3GGPA 1T24A 1YB1A 5ENVA 1A71A 1BDBA 1RJWA 3AM5A 3UCXA 3ZU3A 3WSWA 5A3JA 1NX6A 2YJZA 3EC7A 4GBJA 2I9PA 4J0EA 1Q0HA 3PFFA 2WWRA 4BNHA 2BFAA 1D8AA 3BMCB 4QQRA 4TKLA 1FDTA 1KVRA 3F5QA 3GVIA 1I3LA 4EITA 1MV8A 1PX0A 5JDCA 1OOEA 3KEQA 3QE3A 4K9DA 4MVJI 4L75A 2GNAA 4K6CA 3B6ZA 1YOVB 3RC2A 3U49A 2V65A 4YBZA 4IUYA 4DQXA 3TZKA 2WD8A 4XR4A 3TWOA 3JQBC 2B4QA 2G76A 3CKYA 3OFSA 4RF3A 4AJJA 3VTFA 3WXBA 3AOGA 3S2IA 4BO9A 1Q1NA 3VZSA 4XDYA 5IF3A 4YJDA 2NU7A 1ZJZA 2CZCA 2Q49A 2BF7A 4U5QA 4Z6KA 1ZMOA 2DFDA 2QYTA 3BTVA 3A14A 1WAMA 5B37A 4BNXA 3M1AA 1WXDA 1F06A 3DEYX 1DXYA 5G2OA 1X0XA 3RUFA 2PV7A 1VSUA 5AYVA 4Z3DA 1PJCA 3HDJA 4IQ0A 4LGVA 2PY6A 4C7JA 2NTVA 3O9ZA 5EJ2A 1IPEA 2I76A 4I5DA 4MVJF 4HKTA 4CQLA 4D79A 4OGWA 4C4OA 1PGPA 2CUKA 1LX6A 3VAZA 4G81A 2ZQYA 1GQQA 1C0LA 3E9QA 2W2LA 3EUWA 3QIVA 5L51A 3WGIA 5ADHA 3KYCB 3GGGA 4CV3A 3EHEA 1E92A 1LSOA 3NTOA 3QRWA 4NR0A 4ZRMA 4EBFA 2CDAA 2YFQA 3CE6A 3GEMA 4JN6B 4NPCA 2UV8A 3I3OA 4A0SA 3ETGA 4IDGA 2VHWA 3OEWA 3UAGA 5JE8A 3WG9A 5K0ZA 4RF5A 1ZZEA 4R54A 3RASA 4BNWA 1U3WA 5I9NA 2XXJA 1AGNA 4LISA 1FDWA 4XYGA 2GLXA 4AICA 1XQ6A 1Y9EA 4RPHA 4Z9XA 1DFIA 4GPD1 4UEOA 4R3NA 4AJ4A 2JJYA 4BNYA 2HU2A 1KYQA 2PKQP
chains in the Genus database with same CATH superfamily
1WZEA 3KL2A 3ZI4A 2CHFA 1G98A 2XCUA 3GGDA 4FC7A 3V7YA 5LP1A 4YCLA 1I01A 2AFIE 3VC1A 4EATA 4ZK6A 2WWHA 1VXRA 4HXEB 1M2OB 2Q27A 4IOJA 4EJSA 4IUBS 4HJXA 2WWGA 5FTMA 1Y1PA 2BDUA 2NVOA 4M36A 3AO0B 3N59A 5JCOA 1U5BA 1T9KA 2NX2A 3KJHA 2IHUA 3LXUX 3W2GA 2M2IA 3UW3A 4QLOA 2JEOA 2CNDA 4OKNA 4F1KA 1DKQA 3BD6A 1OR8A 1WS6A 1EFDN 2Y77A 1GNPA 1S8NA 3M1LA 1L9KA 1RRPA 2LGJA 2P9GA 2ZUWA 3DMRA 2V7VA 1NV9A 3FE2A 3NHBA 3O2NA 4RLQA 4H1WA 3AR2A 1P61B 4XYGA 2DWQA 4Z86A 1RAGA 2E21A 2R47A 2A9OA 1ZGGA 3FTNA 1IHXA 1PIWA 4N47A 1NRWA 3PQ7A 4M8IA 4HY3A 1XZDA 2GERA 2QEQA 3ZZMA 2YY7A 3G2MA 3B6JA 1ZXBA 2FVYA 2X7HA 3DCJA 4S05A 2EGUA 4U9IS 4CKEB 1UPBA 4XYEA 5TF0A 4O33A 3JX9A 3WIDA 2HRCA 2FP4A 1Z8FA 3T7RA 6NULA 3F8WA 4JFRA 2FZGA 2OP0A 4V0KA 2AXQA 4PSAA 4I2NA 4GMKA 4YV0A 1X8LA 4PPYA 3EIWA 4OTZA 2XNHA 4GVLA 4GYYA 1BXGA 4XPIB 4G37A 2JFFA 2CWWA 1KEZA 4OHPA 3TYXA 2FRVA 4ETIA 1M6YA 1OLOA 4EKYA 5KINB 1ZXLA 3UMJA 2FRDC 4CQNA 2PA3A 4LWOA 3WDSA 1RAEA 2O0KA 2DT8A 2PE5A 1CTQA 2G88A 4PGGA 3AIMA 4QFBA 4CQMB 4GMHA 1E8MA 5AVQA 3SDBA 4S1WA 4E2ZA 1H1LA 1XR3A 4EMTA 4QYIB 2VH1A 4U2FA 1CUZA 1CZHA 1JXQA 1KAEA 1QZ3A 3I6YA 4Q6BA 5SY4A 4DZRA 3TECE 1IY1A 1SRQA 3G8CA 2AMFA 5AT1A 4UHJA 2AZTA 5AM0A 4K7JA 4CMHA 1GG5A 3OX3A 3VHLB 1EG7A 4TT3A 4MLPA 1TQ2A 3BK7A 1L7XA 1RYEA 3ILSA 3JQCA 4TZKA 2AUTA 5HRCA 3OQBA 1NVFA 2H1LA 1UPAA 3DDSA 4ZVKA 6Q21A 4C0QC 3AVPA 2CL7X 3PJDA 4A16A 2AEJA 2JA2A 2OHOA 4PZYA 4F2HA 1PEYA 5CAEA 3IOCA 2BELA 2GWHA 4OYYA 3TB4A 1D4ZA 2E4VA 2GLTA 2PAAA 2VSOA 2E4UA 4J3NA 4BHHB 3A70A 4FCTA 1JHDA 3A58B 4IEFB 1J99A 2G8LA 1LC3A 2QRZA 1FSGA 2W43A 3A1DA 5EKDA 3ICQB 4G23A 1YL7A 1EE1A 3ESDA 1K8ZB 3T0GA 1IXSB 1SM4A 1YA8A 4L73A 1TNDA 1Z2CA 5DCYA 3RSHA 2W6JD 2ZBFA 1UK8A 3H1AA 4NOLA 3SS8A 1GTSA 5ALKA 1EFVB 2PKWA 1C9EA 2JI8A 1HO3A 1AF4A 5AOVA 3KJFA 3KK0A 1XCJA 1ZR2A 3H2KA 3G2QA 1W6UA 2AG8A 2BKAA 3T9AA 4DY4A 1QF6A 2R87A 2GOYA 7GPBA 3IBSA 3X0DA 1DWPA 3L7DA 3CH4B 5F7JA 1IFXA 4K03A 2DFTA 4NU6A 3HI6A 2Y1KA 3U7QA 4FUTA 2QPOA 4HS4A 2RBKA 4KLNA 3ZWYA 4RTKA 3K1ZA 3QX8A 3VTAA 2DUNA 4DAEA 2NTYC 2G0NA 4ROTA 4BTEA 3VKGA 3T3GA 5DBIA 3DP7A 2I4IA 1Y7PA 1U0FA 3HGTA 3I92A 3IE0A 3S8YA 3PR2B 1VHJA 5AJTA 1QSGA 1I5RA 3C7KA 3KD2A 2PYDA 3LT1A 1MJGA 3PBKA 4YJGB 4CNBA 4F97A 1PTJA 2HA2A 3NFRA 1E77A 5KTNA 4A5SA 1X7YB 1R0SA 2IIQA 1XJCA 4TOIA 3IAUA 8ATCA 2GEDA 4FKZA 2HYDA 5H81A 4DMHA 5HGXA 5JFTA 3QM1A 4RJJA 1FQWA 1UM9A 5U4QA 2W6QA 1E5LA 3IEKA 4EPTA 2XVZA 2ZTVA 3NZEA 4UFOA 2XWJI 1YTUA 4LZPA 1DDGA 1VJGA 4WGGA 1Z75A 4FSXA 1Y8RB 3WFJA 1OWLA 2W2TA 5I7AA 4BB5A 3I04M 3K15A 3K2EA 1NURA 4L28A 5TXGA 3L6CA 1CD5A 1W4BA 4Y2TA 2WJHA 4ERXA 5I45A 4GOOD 1ESEA 1M8PA 1BDMA 4EMSA 3PPXA 2PRJA 5ECWA 1SUAA 2VBCA 3F67A 5I9IA 4PM4A 3EEBA 3OY2A 3RQSA 3NDRA 1J00A 4R0NA 4LDNA 1T1IA 4RDIA 4WD3A 4WUTA 1UJNA 4J16A 3IGFA 2EKLA 3MJFA 2AFIB 4H1HA 4BFLA 1A8QA 1M2HA 5DYWA 1JXAA 4HLUA 4LGYA 4C4PA 3KSDO 1Q84A 1R4MB 1TECE 5GIPE 3U4DA 1YMVA 3U7GA 1Q0PA 4B2PA 5AQ1A 2H5IA 2B30A 4CHTA 1Z26A 1FFHA 3VR2D 4FU0A 3U3OA 2PAFA 8GPBA 3BG5A 2BKLA 4PSCA 4WN9A 3WL4A 4F7DA 5LM3A 2JKYA 4HPWA 2IX3A 1O03A 4BMPB 2DKNA 2QD1A 4R9NA 4PN3A 4IWNA 1UKBA 4YRDA 1WB6A 5KTRA 2NPIA 1UJ4A 1M1YB 3H0EA 4KLCA 3B51X 1MQ8B 1VE7A 1WR8A 4QPJC 1JTVA 3JZAA 4XJTA 1ZMTA 3EUAA 5EUMA 2OFXA 4DRZA 2F43A 2NGRA 2QTBA 2VQ3A 4LBWA 4P08A 5KKAA 1VMIA 1PS8A 2EATA 1SVMA 3ISVA 4FDVA 5F52A 4JJ6A 4BBZA 1PQ4A 5KNDD 4KN9S 1JI3A 1G0NA 2R5FA 1PSDA 1DNPA 1CRWG 3QMMA 4KXXA 3KHKA 3O95A 5H68A 3FYSA 3WFIA 4IXMA 3W1EA 2AUNA 3W05A 4OQZA 1M67A 2QMYA 2Z56A 3NRBA 3OX2A 4ZO6A 2J0QA 4OL9A 3ZVMA 4MRMB 5JH7B 4K3UA 5ALSA 4L8WB 1PBTA 3UTDA 1VLZA 3J81A 5KAPA 2XOXA 1C7ZA 3R1IA 4QPPA 2Q0HA 4GI3A 2YY6A 4UUQA 5DNVA 4TV8A 2WYWA 2DF8A 2XUFA 1X1AA 5A5DA 3KU4A 1JFTA 3OY7A 1H2WA 3RTAA 2YQZA 4RH0A 4R1TA 2XUIA 5JJ5A 4HDSB 3NYRA 2W48A 2CDBA 3GZNA 4R1SA 1FNCA 1SXJD 5T5QA 1C50A 4IQFA 4KE9A 3ZDRA 1LA2A 2YJ4A 2H63A 1W48A 2QTWB 3IT0A 4CV2A 3CY6A 3SJ7A 5BSKA 4CL2A 2ZJ3A 3LFUA 3O4JA 1LDNA 4NQZA 4CKZA 2WU3A 1P2GA 1NF2A 1V43A 2ZB7A 2HM7A 4IDUA 4EGFA 1M83A 4W9RA 4MV5A 5JH7F 4M0EA 4XPIA 3SQLA 5CD1A 4I4CA 4NZYA 3AKDA 3EOAI 4MQBA 4DGQA 3FDZA 4AN0A 1MO3A 3EGXA 4HN9A 1FBTA 3AOEC 5JALA 1KSJA 2XGJA 1NUSA 4O4JB 4HLUC 4E7OA 1B8UA 1Z5OA 2QT0A 2YWEA 4Y2SA 3LRXA 1IHDA 5H4HA 3GUCA 3WL7A 1K98A 1V3TA 2AYYA 1GTVA 1TLFA 2MIIA 3EJ6A 1XZMA 4JT9A 2AC7A 3R8CA 3K0KA 1YVDA 2Y0CA 1YL5A 4AJHA 1IPHA 3HP1A 2GZ1A 1P4SA 3UB3A 2GVDC 1TKCA 2VO1A 4FYJA 1SB8A 2HHLA 4WZBB 5JBQA 5JZBA 2WYIA 2DBYA 3R6LA 4QASA 3DO8A 4BQRA 1NUTA 1SQSA 1RP7A 1T9DA 1YI0A 3HFSA 4CQJA 1G63A 3P2EA 3A6GA 2GCPA 4Z2AA 5JXJA 1XZFA 1XIVA 4LHWA 3E2IA 1TJNA 5K0BA 1QFXA 4ZAVA 2JGMA 2XCIA 1GQFA 2O2XA 4OATA 4X91A 4BZPA 1NA5A 4MUGA 5FB3A 1YA4A 2VSFA 2GZ2A 4CIWA 2RG7A 2AG5A 5CVVA 1GYRA 1OQAA 1AOXA 3BCRA 3B5IA 4F6CA 1WZCA 1M8KA 2ODQA 5E7IA 2GM9A 4L5CA 3L7LA 1DT5A 1K7XB 1RWXA 4YH1A 3VMFA 3KLBA 4TTSA 3U2QA 1Y8AA 1P1CA 2WJ6A 3A9TA 4LHXA 5JXHA 4WXMA 2XRZA 4JNKA 3QF7A 3ON5A 2XGGA 1P1KA 1F12A 4NK4A 4C08A 3SZ3A 3OZUA 1G20B 3BWYA 1Q7EA 3G0CA 2QD2A 4FD2A 3A9CA 4N8EA 4FOSA 4RZSA 5G40A 1G291 2JIZA 3WMFA 2P6OA 4M89A 2CEKA 5ES3A 1EUCB 2CLEB 2WBLC 2R7MA 4IDEA 1SG6A 5ITWA 3EZXA 3BH0A 4ZOLF 3DTVA 4TSKA 4EH1A 4BQIA 4IFBA 2IHBA 3O0DA 2Y2UA 5DX0A 5T57A 5DPMA 3WLFA 1QDLB 4JI6B 4D26A 2A14A 1K3UB 2CLSA 4LRWA 3GYBA 3ZHCA 1P33A 3JATA 3VQTA 4CL0A 4LHVA 1OGYA 4I4NA 4LWPA 4C07A 4ZHQB 3SQNA 3P32A 1JMKC 1AS3A 4A91A 2NXNA 1XZJA 1O8BA 5I9BA 5C1OA 1NLYA 3I83A 4BO0A 4AO6A 4UNPA 1R15A 1T2EA 3CVWA 2YXPX 5H83A 2DR0A 5CW1A 1LPPA 5EE0A 3GJRA 3VOBA 1KDRA 1AA9A 2J9FA 3GRKA 4UU1A 4KMMA 1Z0DA 1RXYA 2HA4A 4PAWA 3TXYA 3PTAA 4FB5A 3SBEA 3AESB 2VPYA 3WLRA 1FJGB 1UFKA 1X7ZA 1LSUA 1RI5A 1V6CA 1Z4OA 1C8VB 4PLYA 1K8XB 3GLRA 3WXMA 4RD4A 3TN7A 3O8CA 4OQNA 2BEVB 1YCDA 3AMVA 4WRRA 3EX7C 4E4RA 1RRKA 3HNRA 3MWKA 1QTQA 1SXHA 2GH1A 3DB1A 1ZOPA 3MWEA 1KJZA 4IV8A 2RKWA 1DP4A 1B6SA 1RHMA 2OHHA 3E05A 4OFXA 4QOJA 4M9XA 5TY0A 4N6GA 1A1VA 4M88A 4CNQA 2FN9A 1SURA 2B7BA 3ODPA 2QR3A 4F9GA 3UOAB 4OLBA 4YAIA 3RU3A 4K9MA 5EHZA 2NG1A 2IRWA 5JI2E 2O0LA 5TARA 5A06A 4EYSA 3IE1A 2QMEA 2R6DA 2SECE 3JPYA 1I0LA 3K20A 4J0QA 4CU2A 4YCSA 4FFVA 2Q3DA 3BK2A 3DZFA 1N8TA 3IRVA 4NYJR 2IYOA 1E3MA 2CL6X 2C5FA 3Q72A 3SAJA 1NG9A 2BGMA 4H18A 1SXJC 1ITZA 4HGYA 3SC2B 2H1WA 3KQHA 4LZAA 4GUAA 1EMDA 3ZDQA 1EFRA 1JF8A 1F2DA 4MLZA 5B36A 4B4DA 2PVSA 2O6LA 5B6PA 2F67A 3I37X 1J7KA 4NFYA 4Q3BA 3X1JA 4YJ3A 2ZJ4A 5AESA 4FI3F 1RIFA 4JLWA 3DB2A 3GJQA 4Y1GA 1IYZA 3Q0TA 3VSDA 4DS3A 1RXUA 2BP7A 3FX2A 5AJVB 1N6NA 2OBNA 4U2KA 4ESHA 4B45A 5JSUA 3VOSA 1CDZA 1T4CB 1W88A 3DOJA 4LE2A 1W36D 4PPGA 5AKJA 2NYUA 3N6VA 2WEKA 3FKSA 1RYHA 4XFJA 2WK1A 3SHTA 2OAP1 1NLMA 3AF0A 3DR3A 2WMDA 4JELA 4TXNA 1CNMA 2WFLA 2LKCA 3I09A 3KO8A 2ZDGA 4BNZA 1ZRNA 2H1VA 2WHRA 4KAFA 1ZVVA 4QX6A 3DTVD 4HUQB 3QITA 5F4BA 4NJOA 3HC7A 4Z0TA 4AN4A 1MO2A 5EQJB 5H3LA 5LMCA 5LXTA 1U4OA 1JHMA 2E7ZA 4ZT2A 4KP7A 4LDQA 3VPHA 3ZXYA 3JD0A 5CTAA 1SVKA 1Z7YA 2CXNA 1XHEA 2VZEA 3QU7A 4JL8A 2O7SA 3UVEA 3VMMA 3LLVA 5DNYB 1VLHA 1UK7A 1ZISA 2EGGA 2OZVA 4UBKA 1XMQB 2KMLA 2YC2C 2PX6A 4X97A 4ALJA 4C4XA 4NZNA 1J4AA 2O5CA 1KOLA 1F5SA 2HHJA 2QLNA 3DMPA 4LRUA 2KB0A 4PO3X 1FNNA 5IJ0A 3LXMA 4KGZA 1X9GA 1BN7A 3NBQA 4TTPA 4UC0A 5CLHA 2DTEA 2R60A 4AY5A 1KNQA 1OROA 4I1RA 3T3PB 4QPCA 1A5ZA 3ZV5A 4L2IA 1O0BA 1XNGA 1WV0A 3HHEA 1QYIA 3QWFA 1HDGO 1Y98A 2YWJA 4U02A 3E9CA 3RF6A 4LYEA 4B81A 1B8VA 1QQAA 1PK7A 3HLYA 4HB3A 4ZOBA 5DP1A 2VBFA 1QCYA 3QBVA 4K6GA 2IPMA 1WUTA 1DO2A 1JMVA 2Q41A 4XPZA 1WMFA 3CW8X 5DBGA 4YRJA 4UDYX 4Y6PA 3ZTYA 5AW9A 3CURA 4L0MA 2NP7A 3DYVA 1ISSA 2F1HA 2NO4A 3LHDA 4RIHA 4EMBA 1Q77A 4WOCA 2YKGA 3QP9A 1CQJA 3HCEA 5G0TA 1BS2A 1KI4A 3KXDA 1E9BA 4RDCA 3B7PA 3TM5A 1GUZA 1V7CA 5FBHA 3FSGA 1PWEA 1U2DA 2D3WA 3K8QA 2VF2A 1S96A 5A5EA 1T5DX 3MF4A 2GD1O 2D1SA 1XTUA 2YMLA 3KV3O 3IAAA 4NIMA 1GAXA 3SX2A 1VKZA 4NI5A 3ORFA 3VC2A 3CEAA 5CB4A 2UKDA 2B1GA 1XVLA 4GMGA 4MTCA 4QGSA 1BXRA 1OMOA 3T7AA 2DECA 3IVGA 2R7AA 2WMOB 4DRXA 1Y1KE 1L3BA 1GM5A 3MD0A 3SHVA 4YAWA 4QUKA 2CV0A 2PT5A 3ABOB 1THTA 1W1WA 4I9GA 4PU0A 5FCDA 2QN9A 4AKIA 4RSGA 4QJ3A 1H3FA 4G65A 3H8SA 1EP1B 4OL0A 2JFVA 4Q02A 5DP2A 4H16A 3MVEA 3Q98A 3RGGA 1NZJA 4MR7B 3KZMA 1Q1AA 3EB9A 3K9HA 5FUWA 3AB8A 1B00A 5FADA 3UK7A 2GSDA 3VBEA 4ZAXA 1XCOA 4PLFA 1PK9A 4UU7A 4HGZA 4L7QA 3TIXB 2QTGA 2VK4A 4OP3A 1A7AA 1E5XA 4L07A 2ZAMA 1UM8A 2AOTB 2ODTX 4P7KA 3W3AH 5JANA 4XWWA 3FNHA 4FWTA 1IATA 4JK3A 4OM7A 2V7TA 4Z5XA 3PXDA 2P91A 1QJ4A 2H85A 3LKDA 4ZEOA 1FS5A 1E5TA 3ZXIA 1M6NA 2QWXA 4V2UA 4WOKA 3UATA 1F48A 3WRYC 1VZ2A 3H97A 3KBOA 5JASA 4YJ2B 5LZ2A 3CNBA 3U4HA 2ZZNA 4IZ6A 4O4IB 2N1BA 1DC5A 3T5TA 2VYQA 4M76B 2K7ZA 2OGZA 4FFOA 2W93A 5I5EA 4DCVA 1KEKA 3EEOA 1UJ6A 4YRZA 4XWYA 2FZ4A 4OMFG 1RWKA 2Q07A 3RRNA 3W2HA 1AZLA 1TVEA 4OA8A 3X1XA 5CB8A 4UVHA 2D5BA 4CU5A 1JQJC 3OPYI 2AI2A 5AK4A 4HDMB 1O54A 1XFAA 4LOHA 4P4UA 1T25A 5HM6A 1Z6TA 5KQPA 2OK7A 3N3BC 2VTBA 1L8XA 4PZLA 2FOXA 3MLAA 2OBBA 2Q5IA 3S8EA 4WXPA 1SRRA 3RVDA 2II6A 4QGHA 2BLLA 3KQQA 4Q1BA 3CNEA 4BNMA 3DT9A 4YPOA 2WYUA 1TW2A 1XF1A 4D8TA 4Y9DA 4DMFA 3CLTD 4A82A 4P6VF 1IB0A 4H08A 1SUBA 2WPNA 2WJPA 3AZOA 3OOWA 4C5BA 2OESA 2ZB3A 4M1TA 1WMEA 2V4UA 2ZYAA 3ZG6A 1TKAA 4KQCA 3C3YA 3LVFO 1TUGA 4R9RA 4DLXA 5LKRA 1E69A 1Q44A 3JWIA 3Q0EA 2VP2A 4CCYA 5J43A 2OFPA 2R11A 3KEOA 1N0IA 2QDXA 3HN6A 4CIAA 3B70A 1FU8A 1CNFA 2CFOA 2XRFA 3PHBE 3Q1KA 3KLNA 4R8MA 5HUJA 3DNPA 5JUWA 1LFAA 3RVLA 1RAHA 1Q3TA 2JI9A 4MUIA 1W5BA 3H9UA 5HRUA 4RM2A 4Q1CA 4EI2A 1ZZGA 3RPEA 3BA6A 4YFYA 5J58A 1KTIA 2FZ5A 2JI7A 4MKXA 4NJEB 1M1NB 1UKEA 3F4LA 3NQ41 3OEHA 3PENA 4NE9A 3K0AA 3T94A 5BN4B 3HUDA 2R6JA 4M0PA 3NHKA 1F4LA 1XDUA 2FJ0A 2NZJA 4EZBA 1BVYF 1J2EA 4HSEA 4OMUA 2EARA 2ZM5A 1LVHA 2ZAIA 4MP6A 1CJMA 3OT4A 3GPLA 2X4LA 3RSZA 1ATIA 4DR5B 4MR8A 1IAVA 5PNTA 4D0NA 5LN1A 1Y1LA 4LE0A 2WUFA 2OLJA 1IZ8A 3BK1A 5FOVA 2NUPB 5B2ZA 1TAUA 3PIIA 4BN0A 1WVIA 3OP4A 3RVJA 5KX5B 4I3FA 3DEAA 2BEWA 2H2WA 3EGVA 3FR8A 5IC4A 4IIXA 2GAIA 3R44A 3SN6A 4LWQA 5KBYA 3DNFA 1LSJA 1ZGBA 1KOFA 2PU7A 5FPSA 4B8YA 1I6KA 4OUDB 4ZAGA 1ST2A 4OEHA 2AJBA 1FL9A 3AFMA 4KQ9A 4HX2A 4OI0A 1ZH4A 4YFVA 4AJLA 1Y9DA 4FHCA 4DIOA 2XXBA 1XXHA 4TM8A 3B8HA 1N8KA 1QYVA 2ZWAA 1CR2A 3GELA 1B15A 3Q15C 4IXTA 4CUKA 3HA7A 3NC0C 1E4EA 5HFAA 2DWCA 3NEAA 4KE8A 5D5QA 5DM1A 3W8DA 1U8YA 3P5SA 3GUVA 4X8OA 1FUIA 4YRBA 1NQOA 1QYXA 1XJQA 4C3ZA 5C7LO 5IJXA 4PX3A 3EZFA 1IDN1 1L5HA 1EVKA 1YACA 1CZRA 3TSZA 2PZKA 2CF6A 2X2PA 4PZPA 5CT4A 1E64A 3PV0A 1TOAA 5JNUA 5IJZA 3ZHRA 1JR3D 4RK4A 2GESA 1E9EA 1YVUA 2C61A 2VSNA 3TAXA 4IV0A 4D9HA 2H59A 2PFSA 2HK6A 5C5EA 3F46A 1AG9A 1YAJA 3FGOA 2IS4A 1YASA 4HH0A 3RU7A 4ZHSA 3SVTA 1O97D 3OTGA 3WKAA 2GPTA 3F97A 5E2BA 2FR8C 2EZUA 2FCRA 4HXYA 5CTJA 4LJ6A 3ID6C 3IKTA 3RRYA 5LQNA 4D4LA 1E2BA 3IT1A 5H16A 3D6MA 2B35A 1PFGA 3GN1A 5JRJA 1JDSA 4WZAA 2NXCA 1RVV1 1KZ6A 1JQ3A 2C3OA 3ERCA 3OJEA 1P4RA 5F12A 2O48X 1NRIA 1XK6A 2QPLA 3X2EA 5J4LA 2PRSA 3ZWDA 1MW8X 2JJ8A 1CVRA 2DWUA 2A9KA 4DMMA 1Y9ZA 1VL2A 5F2EA 4H3KB 2CHVA 1KEVA 3ELWA 3DGFC 3LPDA 2GWRA 1P4AA 4RXMA 1BMDA 2D1YA 3PNYA 3CNLA 1QRRA 1HYQA 5CYPA 1PLKA 5CT5A 5EP1A 2F8MA 2QU7A 3CN7A 4BNIA 4YWJA 4B6JA 2M1ZA 4IIJA 2YBEA 4NHEA 4FOLA 3D0KA 2VK8A 4MQ5A 3HGMA 4PFSA 4DNOA 3C3EA 4DV5B 3GLGB 3KP1A 1X7HA 1SA0A 3FD8A 3OEHD 4Z4HA 2OO5A 1Z35A 4S1VA 2R0QC 3EWAA 1H2EA 3E3LA 1W9MA 4C4RA 2WD7B 3ZQ6A 1TTQB 4AP9A 1OLXA 3J81k 3X2FA 1K3FA 2A9VA 3IBFA 1U1EA 4M1EA 5AVOA 3JCZA 2X23A 3A6DA 3TQCA 3L4EA 4C5AA 1PP4A 3AM1A 1EJ0A 2C59A 4C5CA 4L95C 1WHSA 2H92A 5I8WA 3ASYA 2PUHA 3M33A 5ULLA 2QROA 4X41A 1R8SA 1SKMA 5H70A 2G1JA 3T7KA 3L01A 3FUVA 5HZHA 3DXZA 2N47A 4KUEA 2X9QA 1KC1A 3HXKA 2PVCA 2D0IA 1TYCA 4D4JA 3E27A 4BKOA 4LUCA 3E9RA 1L7OA 1XMIA 2BFFB 5CBKA 1PD0A 1OASA 1RZUA 1DTSA 1F8UA 2H1CA 3K4HA 4BB0A 3K9LA 2Q1WA 2Z2JA 4Q9LA 4EQ6B 1XMOB 3L0OA 1ZEJA 1HFJA 1PGNA 4UCFA 1W25A 3WGYA 3HV2A 3GWGA 4P0TA 4CM5A 1XHLA 5FV4A 4DB2A 3JR3A 1NP3A 2RGNA 4I4IA 4M7RA 4NJMB 3R3XA 4MB0A 4RVCA 5DX8A 4AUEA 4AUKA 1GUFA 2CMDA 1GRRA 1NW5A 3THXA 1XZCA 2HBZA 5BV1A 2HSJA 2EFJA 1PUIA 1O77A 3U3MA 3S70A 3OCVA 3O8BA 2JFUA 3A26A 3DF9A 4WGFA 4B5KA 2P9CA 4NMXB 5JCJD 4K9QA 4HDSA 2FR8A 5AI8A 3ZC3A 5CCBA 2PQ2A 3Q7QA 1JEEA 2XKBA 3CLVA 4I1UA 5B2FA 3I01M 1EWTA 4TMZA 1QYWA 4MUAA 2EFYA 1QPZA 4HVLA 4L22A 4XIIA 2NU7B 2VAMA 3L4SO 1CQIB 1Y4UA 3LCUA 1H4VB 4AG3A 1MHPA 1J2RA 1U1DA 2ORED 2FCAA 3C6KA 4DBVO 3HZRA 3QIAA 3DD1A 2GK6A 2ZUEA 2A1TR 4KR6A 4L02A 2LDXA 3WQQA 3ZE8A 1B23P 2Q6LA 1QE3A 5JQGF 3FMGA 1JG2A 1N2SA 1E1RA 4DYVA 4AQ7A 5EE3A 4TV8F 3TQIA 4IDAA 1AN9A 3MQ4A 4BZZA 1N8NA 1DXQA 5K8LA 2WMNB 4OQPA 1P1HA 4JQYA 3KTDA 2ZAOA 1N5RA 1EHIA 5LCXA 3ZV6A 4DJAA 5EHXA 1TRKA 2ZRPA 2IOQA 3MJHA 4BU0A 4MQ6A 3A2KA 3R7NA 1GKYA 1N1DA 1PGJA 1E3TA 5AVZA 4XSGA 2HDOA 4J7UA 3DDOA 3DZGA 5CHEA 5IDWA 5I7UA 3E61A 1JU3A 2JFPA 4KRXA 1RP1A 5AJZA 2OGTA 2Q6OA 1D2MA 4RTMA 4OFWA 3DCIA 3PE4A 5DM70 2NUAB 2G06A 3H6HA 4E0BA 4NKRA 4Q3CA 2P9ZA 4HXFB 3LLCA 2DPXA 2E82A 2XUOA 5IJ0B 3OZFA 4L6CA 2JVJA 5JNWA 4GICA 1PVOA 4E4TA 4H77A 1R4NB 3C48A 4KSCA 3V33A 4M1ZA 2BF4A 3HSYA 2BDEA 4ZOLB 2OEPA 4NZZA 1SZDA 1VBMA 3CZRA 4L9RA 2FZCA 2MMCA 5IFKA 1TCBA 5L3VA 5LQAA 1I3NA 1II0A 1Q95A 1Z83A 1GSHA 3P8ZA 3QSGA 2F1RA 3R3ZA 3V1KA 3ZWCA 4L50A 4ZI3A 5TDHA 2IUSA 2FEMA 3INRA 3P9RA 5ERYA 1YE8A 5JAPA 1PJ4A 1RJGA 3RU9A 2C4WA 2OC4A 3CIFA 4JGBA 1NVAA 3OM9A 4K2HA 4DR2B 1NUHA 3L8DA 3Q9NA 5ITZA 4RZHA 2QUIA 2YV1A 1N7GA 2IYLD 3K9WA 1GTRA 2B4KA 3MGCA 2BM0A 1C9DB 1DC7A 4PGFA 5EIXA 1UFQA 1Z0ZA 1UMBB 2ROQA 4BLTA 2HMYB 3ZY6A 2YN4A 1XQXA 1AZTA 3IKVA 4OSOA 4MKGA 4C4ZA 3I0NA 2PRKA 5CFRA 1UBSB 2WHEA 4EKGA 4E46A 5DU2A 4URXR 3IIJA 1OAAA 2PS1A 3ZL9A 3UJHA 4FMCB 3A25A 4MW1A 3SZUA 1M0SA 4N01A 3GLIE 2QS9A 4UEWA 4TKUB 1AUVA 4KWTA 4O25A 4N03A 3AI2A 2PKCA 3C7DB 5K3SA 3RYFB 2Q3CA 1M6EX 4NBSA 2BE9A 1VYHA 2X5XA 3HCOA 4UDXX 1RXEA 5A3RA 5TIIA 3VR3D 5GVRA 2W2PA 4DG8A 1DG1G 2PR7A 1ECJA 4R2HA 5AI5A 5KS2A 4GM4A 1Q21A 1EZ1A 1I7NA 221PA 1NGSA 2XYGA 3K0HA 4RE6A 1V4BA 3FKSD 4QTUB 4YI5A 5DN9A 4UMEA 3ZWAA 4B3DA 1FW6A 4DHWA 4G63A 2WKQA 3A31A 2R6AA 5TPZD 3LQ2A 2IE8A 4RK7A 3QBTA 1VC2A 2QMOA 2SCUA 2HK7A 3A6LA 1WKVA 3A6KA 1XF9A 3OCUA 4RHTA 5DHTA 1O94D 2JBWA 1T8SA 2ZUFA 1GHTA 4KHPB 3WNVA 4TTQA 4OAQA 3L02A 3DLHA 3G7UA 1RYMA 1G64A 3A6ZA 1WW8A 4ICIA 1YULA 3AUSA 4OF4A 5LMNB 2ISCA 4YRTA 3ISTA 3RT1A 2R7KA 1AXGA 1YU6A 1T9GS 5DH9A 3I61A 1N3IA 3MWDA 3WK5A 1VRWA 2ZI3A 2ZIZA 4IXWA 2MSNA 5GGXA 4CI9A 5HK9A 4LFAB 1T3TA 3VR6D 3EQZA 2H4JA 3HU5A 2C94A 3EXG2 4GM0A 4TUYA 2RDMA 4G0ZA 5C1IA 3UH1A 4S0XA 2XNKA 1QC5A 3ENKA 3GCWA 4X61A 2P27A 2ZYGA 4BVKA 1VIMA 3GLGA 3PGVA 2GT1A 3TQHA 4OI2A 2NTEA 1F0NA 3LF1A 4AJEA 4M1YA 2CMKA 4JEHA 4I99A 3B1YA 4FVTA 4PLVA 1NN5A 2Q9BA 3BXGA 3C74A 5JC8A 4NXMB 3G0OA 2AYZA 3COYA 1NPTO 3CZAA 1BG6A 3O73A 4GXQA 3OJLA 5GONB 3UV6A 5CDFE 3LT2A 1W0CA 4HGNA 2O8EB 3IBYA 1HA3A 3FUWA 4PFQA 4Q16A 4E51A 3S44A 1FYVA 4Q24A 2IODA 3K2BA 2ZT5A 4BEJA 3EA0A 2L69A 3N7AA 1GNVA 2HIAA 1B3BA 3REOA 1N9GA 3CMMA 3RHSA 3DQZA 3BXPA 5J59A 1NG1A 1PQYA 3VU1A 3A2NA 3DZ8A 4PYOA 2CD7A 3ORYA 4RQUA 1SD1A 1XP8A 4H6WA 3UYLA 1FZTA 1XZAA 4HDNB 4P4NA 1A5TA 2OV2A 1J0XO 1I80A 2VNAA 3MNFA 3OT1B 4HGPA 2B7CA 2ZBUA 1Q83A 3H75A 4R1OA 3UJNA 1E61A 3M4YA 1YQGA 2R85A 4R0MA 5DEOA 1IWBB 1T1RA 3U31A 4AF7A 3TFOA 3PJRA 2CD9A 4ARAA 5ICCA 1FBNA 2KLBA 4JKYA 4ZJUA 1OAOC 1RPTA 2LE0A 1KHHA 2AJDA 2QVCA 3B6IA 2F48A 1YE3A 4UZEA 5HZKA 5KDDA 2BKXA 2EG5A 3WICA 4CG0A 4JXKA 4KPEC 4ZU6X 1KAHA 1MEEA 2AS0A 2BBWA 3ZWKA 4G97A 4AXBA 1Z08A 3ILVA 4NJEA 5A03A 1V71A 1FIUA 5KO2A 3WDMA 4DLSA 2I8CA 4HAIA 3RVMA 2C0QA 5A62A 3AESA 1REQB 4MUNA 2LZ0A 1SD2A 5GZ1A 3K09C 2FF5A 4XIGS 1GQSA 1DBQA 2AE2A 4C6HA 4EG7A 5K0TA 421PA 2FU5C 1BOOA 1XROA 2O3QA 3D4PA 5D3QA 2QA5A 1LC0A 3H5IA 1GZ4A 3L7CA 2AXPA 2OZPA 4ZDWA 4ZO8A 2A84A 3ZJYA 3LBIA 3K0CC 1KBZA 3RRMA 4BLSA 2Z43A 4FFPA 2PL1A 4NDNE 4ZVTA 4CCWA 3HA2A 4Q4HA 2VCEA 3OLCX 1QIHA 4LNUB 1NNUA 4TLLB 4HQFA 2JH3A 3RRXA 5G0WA 3T15A 3ZKWA 5JCXA 4FZJA 2OY0A 2I6XA 3I42A 1KWGA 1D5CA 3I6QA 2Q5JA 4L51A 3RYIB 1FDSA 4B3TB 5I3CA 1RM0A 3KJGA 2B34A 3AGPA 4W7SA 1EX1A 2PSJA 1EX7A 5EJ9A 5KNLA 4IMPA 1DEOA 1LVUA 4WX2B 2MINB 3A1TA 3H7IA 2OB1A 4KQMA 2A8YA 2NIPA 5CYGA 4V24A 1TK3A 2A0UA 2ZUBA 2HX1A 2ECFA 2COEA 1IB6A 3E9EA 5AVJA 4EHDA 3WK9A 2HQ1A 3U61B 1GKLA 3BSYA 1OZFA 3SI7A 3TEJA 5EC8A 1LLQA 1XTSA 5IZCA 2J30A 5LB2A 3SJBA 4DRXB 1ZJ6A 3CEPB 3H2JA 3WK7A 2QTVA 4NCAA 1C3OA 2FUG6 4UQOA 4XSVA 4MUEA 5FAXA 4YJHA 1Q1QA 3H9EO 5KYUA 3EMDA 1DQYA 2FMHA 1F51E 2P8JA 1LQUA 3H1EA 4LHYA 5A7HA 4JH0A 4XM1A 2JZCA 3GCXA 1X1RA 2WAXA 5D5HA 1XRMA 2ZWOA 1L7BA 5EINA 4NDAA 3TJRA 5BQXA 5HX7A 1CG6A 1RQPA 1BE1A 1V8PA 3ZGVA 1IOWA 1VE1A 3QOFA 5A3QA 4WKPA 3QY0A 1FS6A 1X80A 1X38A 3JU3A 5G1NA 4MUHA 4HUQA 1R12A 1NC3A 3ME5A 2VZ9A 3L77A 2PIAA 4JIGA 4HH1A 4E88A 2FUNB 3THYA 1OLSA 1VIYA 1QZUA 1WKBA 3PNKA 1FYXA 4FFMA 1XDBA 3KQWA 5CUQA 5AKIA 5TJHA 1B6RA 5REQB 2Z6AA 5F33A 5LZ4A 1VGRA 2B1IA 2Z9CA 1GLVA 4HNVA 4QYSA 1KI2A 2OAQ1 1O1YA 4K0RA 5LQJA 1J8DA 1U0BB 4R1UA 3PX7A 1GNRA 3VPSA 5CNIA 3EXFA 3WMWA 3L8CA 4AXXA 1QIFA 1I4WA 1QH8A 3OLYA 5T4BA 3GFTA 2BEUA 4WINA 1XOIA 3VU8A 4LTMA 2DUUA 1OZHA 4JR2A 4LV5B 3CVUA 4BJ6A 1ILEA 1QB8A 1QO9A 5I9MA 3C6MA 1EESA 4B6GA 2Y71A 2HR1A 1MJHA 2A5JA 1UXKA 3FRJA 4F91B 1T0BA 1XTZA 3K9NA 3M82A 3N76A 10MHA 1Z38A 2HU8A 4WY2A 1TQDA 4ED9A 1A69A 1VMEA 3WRXC 3N70A 1CVIA 3MFYA 3DW1X 3ABIA 3T0IA 1Z4MA 3GFOA 4LOAA 1R3UA 2C7OA 3HA3A 2PUBA 3FNGA 2CXQA 4EI9A 4RMJA 4U63A 1ZIOA 3RFFA 2QTHA 2Q3FA 4EHKA 2RK4A 5E3JA 3K6JA 5F7OA 2QRVA 3PXGA 2MSCB 1EB8A 4RTSA 4FFSA 2PUWA 4QAJA 1DAIA 1IQRA 5F3DA 1VJRA 4YECA 4HWOA 3DUFB 1AT1A 1A9TA 1F9EA 1KH3A 2IZ5A 2JPDA 3I9NA 4D9NA 2HDHA 1TYAE 2AOXA 3F1LA 4KDCA 4PHTA 5G4KB 3KTAB 4KXMA 4RFLA 5L3RA 3E3NA 4LF9B 1K8RA 3BWDD 1ZCZA 1NTOA 1YGYA 1ORTA 4KQGA 4RGQA 4UTVA 3UQZA 4ZKDA 2FPIB 1ODLA 4M9UA 3DA8A 4E15A 3M83A 5DTMA 3PLRA 4F9EA 1FVXA 1GL6A 4ENWA 2E4AA 3A28A 4EG8A 3T1VA 1FEZA 3QMWA 1KO8A 3SCZA 3UWPA 4QM7A 3P2YA 3BERA 1W75A 2VNJA 3S1AB 1VP3A 3KWMA 3NCTA 4ZMBA 5HSGA 1KIAA 1ML3A 2ATEA 2KYRA 5K8IA 4D9BA 2VYFA 2AFHE 1JIIA 2JBAB 3ELBA 1SU7A 4KGDA 5FI5A 1PAUA 4TX1A 5HPYB 3DMNA 4A8TA 4NMLA 3H1FA 1SUDA 1E1QD 3GLHE 2FPGB 4OHMA 3WR5A 3GT3A 3W06A 4LXUA 3RU2A 3ND6A 1U02A 4MKFA 4DEVA 1QCCA 2H51A 1JAIA 1TD9A 3HDQA 3QPWA 2FW6A 1GWNA 2XA2A 4MUXA 1NXPA 2KHZA 1MW9X 2X42A 3WQRA 2OLKA 1R18A 1U2PA 2IPAB 2JLRA 3KD3A 3VAAA 4BV8A 3L93A 1DLJA 4B76A 3SJZA 4GBGA 3ZV4A 2COUA 1P2UA 3FGNA 2GX6A 4QNRA 4IG9A 2I67A 3PR3A 4G5HA 2G6BA 4R01A 1JMYA 1S6YA 2ZJ6A 3OESA 4KLZA 3I6IA 4BO5A 1KWKA 2QT1A 2GCOA 2YJ5A 1TO1E 1DTWA 2CLLB 4MV7A 1V8BA 3EFOA 3TFWA 2VTKA 4KLAA 5FFFA 5BWLA 1UEXC 3FWKA 2IITA 3VFDA 2W6JA 4RMGA 5CAEB 3NONA 3KJNA 4PNZA 1KZ4A 2YZKA 4WLUA 1TCUA 3RS7A 1BE0A 3TZQA 4B40A 3BMQB 2PT6A 5H1YA 3GU3A 1CUEA 3ND5A 2FHPA 5IHPA 1SVOA 5MDHA 1HUQA 2MJLA 4DANA 1ODKA 3UJDA 2VOJA 1BDIA 4RDHA 4DT1A 4U9UA 3K0FB 2DQZA 4WJZA 3TQSA 2HSZA 1MB4A 4LSWA 1JVSA 2VA8A 3CVOA 3EZ6A 1E1LA 4NESA 4WZAB 3P20A 3VI4B 1PW7A 1UZMA 3J80A 3HVKA 1KRXA 1LJUA 4BVJA 5CGZA 4JXZA 2AH5A 2WZQA 1DL5A 2H48A 4IO1A 4PYNA 4KU4A 4LPSA 3V7NA 4E11A 1P62B 2WE8A 3H0CA 3QELB 1SCIA 2R44A 2VJYA 4JA0A 2HFJA 1E2IA 1ZESA 4JODA 3GC6A 4DQUA 4AZ3B 2QRLA 2H8GA 3AM4A 2DQSA 1CY4A 4HD8A 1BGVA 5E3IA 3T9BA 3KKOA 3FPJA 3SQDA 5K2MA 1QGED 3TMAA 1NLUA 1K5PA 1GZDA 1Y33E 2J0EA 3N39C 4OHKA 5KWEA 1O4VA 5CJJA 3C1AA 1V4VA 1E6LA 2YWCA 4FZ5A 4B7XA 5A2QA 3JSAA 2JGNA 2N42A 4QOFA 5M2QA 2HXYA 1Q92A 1TC1A 1Q14A 2HA0A 3FMOB 3KDAA