1NAKL

Igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DVVMTQSPVSLPVSLGDQASISCRSSQSLGHSSGNTYLHWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTFKISRVEAEDLGVYFCFQTTHDPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recurring conformation of the human immunodeficiency virus type 1 gp120 V3 loop.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 83.1 - light chain
total genus 49
structure length 217
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2002-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakL01
5KSUB 4M1CD 3KPMA 4DEPC 2P5WB 2VXUL 1B0GA 5FHAL 2BSRB 4Y1AA 5KVDH 5E8DH 5SWZE 3RVXC 1ZHBA 5D2LF 4KKLD 5C92A 4OI7A 3DXAA 4KZDH 3IDJA 4LU5H 4X9IA 2NNAA 2CK0L 3QNYA 4EUPA 5I8CA 2QSQA 3FZUD 1I1RA 5AWNL 3VGHA 3P0YL 1I8MA 2XWBA 4RIRB 3WNOA 3FQTA 4QRPB 4F7EB 3GHEH 4LLVB 4QRRA 4MQSB 2KKQA 4MA3A 3ZHLA 1CXIA 2KPNA 3W81A 2IPUK 1QNZL 5LG1A 1XF4A 2ZPKL 3CFBB 4OSUL 5HHPB 1YJDL 3CVIL 4ZPVA 3MRMA 3BGFB 3P9LB 4U1SA 3ARDD 1EUTA 2XWTA 2D4FA 4AENB 1BHGA 2HLFC 2P5EB 4WNQB 5D4QA 3W0WE 4TUKL 1YEKL 4U1NB 2Z0BA 1HEZA 4G7YH 4LPCA 5DYOB 4OJFH 3KPLA 5IVOA 4LFHG 3ZTNL 4PRIA 5FFLA 4NQED 2A6IA 1QO3B 1I9IH 2ZSWB 3UPRB 1RJZA 4G8IA 2F5AL 5DUMH 5IQ7L 4QRRE 3NFNB 4LSDA 3TBSB 2L7JA 4H8WC 5AYQA 4AT6B 3IJSA 3FT3B 2DYPD 4IMLA 1PKQE 4LSRH 3HZYB 1FFPA 3P4MB 4HGWA 4FFVD 1A4JB 2KZWA 1ND0A 3U0PA 3BYYA 1ACYH 1S7QB 3RJQB 4ZFOA 3GSRB 2JJSA 4M93C 4YK4C 3RNKA 3ROLB 3MLWH 4Y5YA 3ALXA 4HCRA 4X98B 2A73A 2DWDA 3WL9A 4Z7UA 4Y4FD 3LKOA 4XXDB 3HAEH 4H26B 3S98A 1I8KA 5I1HL 3KPNB 3TJHC 1OCWL 3VMNA 5JR1L 1KG0A 3X13B 4CJ0A 4K3DH 3K2MC 2X4PB 1QSFB 2HKHL 1BJMA 1T80A 1H0DB 2XG5A 1HINL 3EFDL 5DI8B 5JDJA 1U92A 4M6NL 5IFJA 3BVNA 2D0FA 1LHZA 1AKJD 4YZFF 5EOTB 4EI5B 4NT6B 4OCSH 2AK4B 1X4XA 4R3SA 1NCDL 1WZ1H 1FNSL 1V3JA 2C3WA 4BSJA 3IU4L 3WN5C 4LSVL 1ZTXH 3U82B 4Q6IA 4WHDA 3ISWA 5E00A 4UB0L 1II4E 1FNEA 1MCQA 3I84A 3IJYA 3QUKB 2ZNWA 4K3JL 2ESVE 4RA0C 3BN9D 2J3SA 4AQ1B 2XQYK 1K6QL 1QQDA 5L7XL 2O5ZH 4JZJB 1KPUA 3ZTJG 1DFBH 4HKBA 4ZFZB 5F1SA 4F2MA 3MJ7B 1QSEE 1G6VK 3SGEI 2W91A 3E3QC 4BSWA 2YPLB 5F1NA 1QSFD 1YEDB 3OXSB 1BFOA 3ULUF 4J6RL 1YNTB 1TLKA 3IKCA 3B5GA 4LKXA 3I6KB 1TTFA 3PWJA 3QDJD 3VGEA 5L2JB 1IAIH 3ULSA 1MI5D 2BVEA 1FZMB 3O3BB 1L7TL 2AABH 3QXAB 1CFTB 3WE6B 3DVFA 2GW5A 2WV3A 5ID0A 35C8H 2GCYA 2P47B 1RZ7L 1BD2D 3V52L 4U0RC 3OX8B 1NDMB 2I9TA 1X3DA 2ADFH 2E7HA 2A83B 3ARXA 4QT5A 2YHGA 4YWGH 5IGXH 3LKPB 3L3HB 2NY6D 4WFGE 2NY6C 4HMDA 2BCKB 5ESQA 3BIAX 3P0VH 2DKMA 1G1CA 3JWNC 1BQLL 2WIMA 3KG5A 5EBWA 5BZWA 3QUZD 3OKDB 1IKFL 4PP1D 3QXDB 3VXSE 3BUYB 1D9KA 3LN4A 3ARUA 4O58L 4FQIH 3DSFH 4PJIF 2VTFA 4PJAB 1G9MH 5ESVA 4MB5A 5K9KB 1RUPH 3D25A 4MVBC 2AQ2A 4MVBD 2O61B 2FJHB 2NR6C 4EDXA 1EZVX 3G9AB 3MO1B 5HXMA 4BFIB 5TGBB 3O3AB 5C0JA 2HFGH 4KTDL 3FOLA 3DUSB 3QDME 4QHNA 4I18A 5EO0A 1RHHA 1BECA 2Z8SA 1EMTH 3BZEA 1C5CL 2ERJB 3SQOH 5L88L 3A6CH 4DGYH 2B7DT 3TVMA 5JOEA 5FK9B 4LOUD 1IC7H 1QBAA 1P9MC 3TPKA 4GQ9H 1P6FA 3B9EA 15C8L 2L4OA 2X10A 1MRDL 1DN0A 5F7DA 4PPTA 1AO7A 3KHOA 3WO3B 1XCQB 3QDHA 4ZAKC 4F8QA 4GKOA 3VXOB 3OJVC 1HHGA 5ALBH 3ZT5A 1N26A 1HWHB 4ZOCA 4PJ8D 4WY7L 2AS5M 1SJXA 4URTB 2Q86A 4NQEA 1MY5A 1KIRB 4OGYH 1QZ1A 2EDBA 4NO2A 4HF5L 1RJCA 3TN0B 3TH3T 3LOWA 5FXCH 4XMLH 4AMKH 1CL7I 4PJEB 4MMZC 5D1ZC 5EFIA 2DN7A 4JFDE 3ARDA 3GI9H 4CW1A 1I7RA 2OI9C 1QR1A 2QKIB 4IOSD 1H3VA 1LNUB 4NRXB 5KSAD 1FGNL 1NAMH 4PJ7A 3AMKA 4PRPB 4P2QA 2QHRL 3THML 3RJDA 5C09A 3BQUA 4NPYA 4N0UA 3P30L 2PKDA 1CFNB 4L5FH 5AG9A 1S8DB 2BK8A 4I0PB 1NEZB 5JIPA 2YXFA 3CGTA 2GTWB 5EPMB 3BZ4B 1ERNA 1XGYH 2VH5L 3A67H 3G5ZA 2HH0H 4ZYKB 4DGVL 3PV6B 4OFPA 4BKLB 1CT8A 3WEXB 8FABB 1FFNA 1F4WH 3T3MF 4WO4B 3NCBB 3QP3A 4DEPB 1EJOH 1JCKA 4UQ2A 3DYOA 4TQEH 3Q3GA 5I1IL 3TJEL 3MJ9A 1LDSA 1B0WA 2AV1B 1BVLB 4P3DB 3VI3E 4Y16D 1X6NA 1L0QA 1J0ZA 3RQ3A 3IDUA 2NY0B 1A1MA 2J8UB 4O9HH 3UPCA 2IPTL 4LCUB 4FQXA 4P2OD 1WWAX 4PRPD 4JFYB 2FJGB 1V3LA 2GTZA 4RBPH 4RGNB 5C1MB 3CD4A 1XF2B 5FM4A 4ZS6D 5C07A 4X9GA 1ZOXA 3WXWH 1S9XB 4GAYA 3LVEA 5L88H 4B7LA 4DGYL 3VFSB 1YYLL 1WBZA 3FQXA 2KBGA 5EBGA 3AAZB 4YHYB 5IB5A 2Q3AA 2YD2A 5DQJA 4S0TD 4ZD3H 4HKZB 1T20B 2QQLL 4Z7WF 4QTIL 4PR5B 5KW9H 3S36L 2D7QA 4LPWA 3WBDA 2JELL 1BFVH 1HE7A 3T0BA 3RX8A 1NFDA 2FX9H 4P59H 4PY8I 4JO1L 1KLGA 1A6AA 4KRMB 4CU7A 4F9PA 4MQXD 3KYMA 4PRID 1JWMA 2X41A 1HCFX 2R0ZL 5BVPH 5HVGB 1NCAH 1ZGLM 3R0NA 1CK0H 1L6ZA 3MRPA 2OLDA 1QHPA 4YHNA 4NJAH 2YEZB 2D2OA 2VZ1A 5F88B 1KT2A 2L0DA 4OM1L 2P1YA 1AP2B 4HIIA 3P0YH 4IRJC 4FQLL 3TT1H 5DJ2B 5J6HB 4HSQA 4DKFH 1NAML 5JOPD 1U3JA 5ERWA 1JHTA 3ECBA 3S36X 3RKDD 5CJ5A 1VKXA 3QZWG 3RDTB 3U4EB 2VXSH 3MRFA 4MGXA 5TQ0H 4NNPL 2OQJB 4HUNB 2A9NL 4PB9L 2C3GA 1RUMH 1MFDH 4JY4B 3ARFC 5HDOA 1IGML 4KPHL 1GOFA 5GZNC 4HBQA 2AGJL 4LEXL 5MEND 1FRGH 5DD0L 3OR6B 1I3GH 5F7FA 3S4SA 3VXUB 5I1IH 3VW3L 1D6VH 3GO1H 5JXAL 2VNCA 4ERSH 5D6CA 2XA8H 3KPMB 4WI4A 4OCYL 1QKZH 4R4BB 4GAJH 3V5KB 4Y1AB 3SKNA 4I77L 4H0IA 4G80B 5JQHC 4RMRA 3DXAB 3IDJB 3WNLA 3TCLA 2YWZA 4AQOA 3QNYB 3VFUA 4LVOC 2E7LC 4JFEB 3BJLA 5IG7A 5T3XL 5F7UA 1I8MB 5GS0D 2XWBB 4RIRA 5DZOA 4MSWB 4QRPA 3MUJA 4F7EA 1QRNE 4LLVA 4QRRB 1FCCA 1X5IA 4P2QE 4HDIB 1OGAA 1LEGB 4LLUA 1I7ZB 1KFAL 4K71C 1MFCL 3ARRA 4Z95H 1ACZA 1XF4B 1D5ZB 3CFBA 5HHPA 4WENB 1MEXH 4JPKH 4YHZH 4JG0L 4K3DL 3P9LA 4U1SB 5FGCB 5LVEA 1YZZA 3BP4A 2XWTB 4AENA 1QLEH 1KB9J 3X14B 2P5EA 2B1AH 3T2NH 2AXGB 4WNQA 4XCCL 3O2WH 4S1SL 4U1NA 3O9WA 1GAFL 1HEZB 5FM5M 3OZ9L 1KPRB 3KPLB 5C08E 4P9ML 4PRIB 3UPRA 1QO3A 1A7RH 3HB3D 1RJZB 4TNWK 4G8IB 4FQCL 5DFVD 3NFNA 7FABH 3OG4B 3RY6C 3TBSA 5CLWA 1PFCA 1UB5A 4FNLL 3SO3B 3IJSB 5IOPA 4IMLB 3BESR 3HZYA 1FFPB 3INUH 3QUXC 2I5YH 3P4MA 5IMLA 4PJFF 1A4JA 3IYLW 4JO2L 1ND0B 3U0PB 4U1JA 1S7QA 4M02A 4ZFOB 5DFWH 5EZIH 5E9DD 4GKSB 4HC1A 1BP3B 1NCNA 3CSGA 4RAVB 1CE1L 1M7DB 3RNKB 2DD8L 3ARFB 3ROLA 5HD8D 4X98A 3LKOB 4XXDA 4H5SB 6FABH 2FO4B 4IRJD 3D5OF 4HCRH 4D3CL 3S37H 1I8KB 4NZTL 3GI8H 3KPNA 3L3IA 3QCUH 4OM0H 3DRTA 3WHE0 3X13A 2VMFA 3SDDD 1QSFA 3V8OA 3VXQB 3AB0C 1A7OH 1U92B 3ZKXC 1JYXA 3BVNB 4ZFOL 3UDWA 4KKCC 3EJYD 4KK8C 4M5YL 3QIUC 4EI5A 3EJYC 4KK8D 3VXUD 3N06B 4R3SB 4FFYL 1N64L 4OLZH 5JMOC 1KLFA 2QV2A 3K8MA 4N8VG 4JFFE 3R8QA 3MUGA 3FO0L 4XPBH 3GMPA 2FATL 4RSVA 5JDSA 1QACA 4Q6IB 5E00B 5EU4B 1FNEB 3QUKA 3IJYB 3ESUF 3QCTH 5GXBB 1A21A 2NXYD 4K94H 5CJ8A 5HYIA 5HD8C 4JZJA 2ILLA 3QQ9C 4NBYB 2EH7H 2NLJA 2ZUQC 3S97C 2IQAA 4ZFZA 1E4WL 4F2MB 2YPLA 5F1NB 3H3BC 4EDWL 1BFOB 2C1PB 1DDHB 3IKCB 1MSPA 3MLVL 1DBAH 5FGRA 4ELMF 2XZQH 1A7NL 5BVPL 4Q0XH 3V4VL 3I6KA 3PWJB 1KUMA 4UNUA 5L2JA 3BD4A 5FYJH 4XVSH 1J18A 2HKHH 3ULSB 5KOVC 1QSEB 3O3BA 3K3QA 5FUZL 2B4CH 1PEZA 1UEYA 1WK0A 3WE6A 1SEQL 4MJ6B 2PXYC 4F37K 5D96B 1C5BL 2VDML 5GRXG 3MV9E 15C8H 2GCYB 3OX8A 4PJFE 2GEEA 2SEBB 4DKFL 3CH8A 2A83A 1J1XL 3BP5B 3HE6B 3RX7A 5CBAB 1ZTXL 3LKPA 1RVFH 3L3HA 4C4KO 1JPFA 2FNBA 3MQIA 4WW2F 5ESQB 2VXSL 1MCPH 2JCCA 3F12A 3OKDA 1CLYL 4XP9L 4BQ6A 3QXDA 2V5TA 1EBPA 4D3CH 3VFGH 5DS8B 3BUYA 3RZCC 4NUGL 1RZJL 5CZKA 3SDCD 3MNWA 4JFHD 4FQ2L 4PJAA 5ESVB 4YXKL 5K9KA 3TBTA 5GHWH 5E5UB 4X8JA 3TA3D 2O61A 2FJHA 4EDXB 3UO1H 1KEML 3CFCH 3LKSB 3MO1A 5TGBA 3O3AA 3K80A 4ZO6A 5D6DC 1I75A 3DUSA 4CN6A 4QHNB 4I18B 4KROD 5EOCH 3OBAA 2OI9B 1RHHB 3BZEB 4TVPD 4KQ3L 4RFEA 2X5PA 1J1OH 2D7OA 3PV7A 4CUCA 1S7VB 5DEGA 5EUOB 2B39A 1NGXA 4M61B 2NZIA 4QGTA 5BV7C 3E6HB 1W8NA 3D3VA 3K4DA 5E2TL 4MZ3A 4PJAE 3B9KB 4PJ5E 1NJ9A 1TDQA 1EJOL 1F3RB 1CICD 1R3LA 1SVZA 2Q86B 4NQEB 1G7LA 1E6OL 1KIRA 4JG0H 4NO2B 3TN0A 1EGJH 2BY3A 4G43B 3BJ91 3MXWH 3NMEA 5F6IC 4XNMA 2BFVL 2CDEB 4PJEA 2XZQL 3PWPA 4WWKC 1Q94A 1F6LL 5EFIB 4H1LB 4IOFC 3LIZL 2YD1A 1I7RB 4LPVA 3RZCD 2QKIA 3MBEC 4BYHA 4NRXA 1AHWB 3GKWH 2BHUA 4FFZL 4JFOB 1NGQH 3FMGH 3O81A 2DAVA 4JRYE 4AEEA 5BOZG 2FD6L 5T5FL 1C5BH 4OV5B 2OL3L 2VDMH 4WFED 1F42A 1AD9B 1TFHA 4LQFH 5CZVL 1X5JA 3B9KD 3K74B 4I3RL 5IVZB 3NFPA 3BQUB 1MELA 4L1DA 1QPXA 4RMTA 1S8DA 4I0PA 1NEZA 1X5KA 1FPTH 3HAEA 4JM2D 4FQXC 2GTWA 1TQCB 4XCEA 4S11A 5EPMA 3P9WB 2ESVD 2PYFB 1YN6A 4LNRB 1OAUL 1MHEA 4PRPE 1CT8B 3WEXA 1NCBH 1NQBA 3GK8L 1BLNA 4WO4A 3OR7A 3MV7B 4EIGB 1BPVA 4NZTH 1F2XK 4WY7H 5CEZE 4UQ2B 2B20A 2H6PA 3NIDE 1CIDA 2AV1A 4WEMB 2IFGA 3NCYS 4P3DA 2J8OA 3I50L 4WGWB 1H8SA 4UOJA 1MIEH 1JZ2A 4FQLH 3TT1L 1A1MB 2J8UA 2Q87A 4LCUA 2R29H 4FQXB 4GKZB 5MI0C 4JPWH 3Q5OA 3RDTD 2GTZB 4GRWB 4IIQC 4QLRA 3O3UN 1N64H 1GGUA 4WUUD 3TJHD 1HZHL 5IKCB 4OCRL 2AK4E 5E56A 2A74B 1MCOL 4XP1L 1Q9KB 3VFSA 4P9HL 4XNXH 3C5ZC 1WBZB 3FQXB 3QFJB 5IMKB 3VD9A 3AAZA 5IB5B 4U2YA 2HRLA 3LZFH 2IMMA 5E8OA 1SMAA 5ISZB 3E2HB 1T20A 2HVJA 4PR5A 2NZ9C 5DMIL 3KYKH 3BH9B 4LRNL 3NZHL 1KLGB 1HHIA 1GIGL 1T0MB 2WUCL 1JWMB 1VEPA 2XICA 4ZPTA 3D48R 4POYA 4TUKH 2ICWJ 1KYOK 2ESVB 2JJTA 4JRYD 1G6RB 3MRPB 4NSKB 4MA7H 1QTYT 5EZOL 4P4RA 3DGCR 3GSNH 1MHCA 1OAQL 3UMTA 3WJJA 1JFQL 2I9LA 1AP2A 4HIIB 4DJMA 1MWAH 2Y5TB 4FTVB 1LGVA 1S7SA 4HAFA 1TETH 1KV3A 2ZOLA 4F15C 3C6LB 3WS3B 4RWHA 5T1DL 3BP6A 4XCFH 5ERWB 5LGKA 2XFXA 1K8DB 5CJQH 1VKXB 1BZ9B 2ED8A 4Z95L 2R4SL 3M45A 3RDTA 1O7SA 2W07A 3WXWL 3U4EA 2AV7A 3BHBA 2A9MH 3MRFB 4L1HA 3QDJB 4XC3H 4ZFGH 1RIVH 2OJEA 1ITBB 3TP4A 4CVUA 4JY4A 3UTPD 3ZL4L 2BVQA 2XZZA 2FX8H 3QQNA 4IJ3B 4AH2A 5J3HD 1N0XL 3U48A 2APXA 3JV0A 1B4RA 5J8OA 3OR6A 3VXUA 3ZKSD 5D6CB 4U1KA 3TNMB 4KJWD 1V3MA 4PUBH 4KWUA 4ZUWA 4LHUB 4R4BA 2DQJL 3OB0K 1WZ1L 2X40A 4TVSa 3V5KA 3RY6A 3SKNB 4G80A 1NAKL 4BZ1H 2VLMD 4PLJC 2OBGA 5I8EB 4OQTA 1FYTD 3TCLB 3FONB 4OZGF 2BHZA 3MZTA 4IRSC 3VFUB 3NFSL 4JFEA 4UINL 5EBMA 1BJ1J 5IG7B 4C57C 5IESL 4KDTA 2DM2A 3PGFH 4MSWA 5J56B 3SGDI 5MHSD 1WTLA 3I6GA 4UIMB 5D7LE 4HDIA 1OGAB 1LEGA 4LLUB 5D2LE 1I7ZA 4D9LH 3S37L 1G6RL 5IBTL 5F6HJ 4B0MM 1D5ZA 1WFNA 1U8LB 2PTUA 3R8BB 4JR9H 5KOMC 4P46A 4TSAL 1JNHB 1RIHL 5E95B 3BP4B 4GH7B 2B1HH 3HKFA 3D18B 1FO0L 1RJYB 4IDJL 4LCIH 5DF0A 3X14A 3OAUH 2AXGA 1MF2H 2E3VA 5KG9B 3C5SB 4OCNC 2MHAB 3I9GL 3O9WB 3SO5A 1G9NC 1KPRA 3RY5A 4Y5VA 1Z0NA 3CDCA 3ZO0A 3IDYB 5C0CE 5IM7A 2APVA 2A1WL 5JHDE 4OKVB 3RP1A 4Z7OF 1QSFE 4O4YH 1UB5B 3ES6A 5T33H 5IOPB 1HQ4B 1YPZE 4HXAH 5IMLB 1RZ7H 1TETL 4EI6A 4U1JB 3CLFH 1R5IB 4HUMB 5DD6B 1J7VR 4WIQA 4GKSA 5KSBF 4HT1L 3C6LD 4RAVA 2ID5A 4NP4L 1M7DA 1QEWB 4MJ4A 2VZOA 3ARFA 5B8CB 3UTSA 4H20L 3CZJA 5C9KA 1UM4L 1F3DJ 4FABL 2EE9A 4H5SA 3KDMB 4PS4L 2FO4A 1RU9H 1KULA 1BEYL 1FFOA 4HHAB 1J8HB 3L3IB 5L8KB 5FECB 5I1JH 3DRTB 5EU7E 3WIHL 5C2UB 1N7MH 1F4XH 2MQCA 5FYJL 3VXQA 4GBXA 2XWJA 3L5HA 2D7MA 2WINA 1E27B 4MXQC 4HXBL 4YQXL 4JZOA 2OYPA 3RWFA 3S88L 1SEQH 3WV0A 3HZMB 2HTKD 2YKLH 1GAFH 4M43L 3TNNA 4P4KC 5GJSH 5A2LH 3EO0A 3SCMD 1RULL 1BOGA 5AZ2H 1CIUA 2ZNXA 2P45B 4JPWL 3PWVA 2FJFA 2EH8L 3MUGB 4KZDL 3H3KA 5H2BA 1GXEA 3GMPB 5JDSB 4NKQB 4YNYA 5EU4A 4LHJB 5IESH 3MLSL 3KR3L 3PGFL 1FJ1A 3VXSB 3C6SA 4YGVB 3TIEA 1JZ4A 4QKXB 5EU7C 3T2OA 4WFFD 2W9LA 4XP9H 5BOPA 2NLJB 1NLDL 4IHOB 1S7XB 1RQ5A 2K3TA 2IQAB 1QNZH 3H2WA 3SKOB 5EDXA 3VGDA 3UP1A 4MS8C 1D5BA 1ZE3C 4OZHA 4MS8D 5C0BB 4D9QD 5GS0L 3V7MA 1JRHH 1F13A 1Z5LB 2C1PA 3AS0A 4LCIL 3BH8A 1DDHA 3OKKB 5GGRA 4LMQE 4ZUVA 4TOYH 4LRIA 3O4LE 1JGLL 3CIQA 3LHPL 4JDTH 1IEAA 3C2AH 4LDLB 5JIKA 1BREA 3HN3A 3V4PH 4Z7VA 3MBXH 3OF6A 4JM4L 4X7SH 1QSEA 3FN3A 2DM7A 2HFEA 4HJ0D 2VB5A 3F6IA 3L6FA 4MJ6A 3T0XA 2N7BA 4OZIE 4TNVK 5ADPL 2SEBA 2IGFL 1UH4A 3BP5A 3HE6A 3RPIA 5CBAA 1X4YA 4R2GB 4WEUD 3CFDA 1JPFB 2FBJL 3T0AA 1J0JA 5DGRA 2BJML 2JCCB 2CIIA 3MJGX 3CXHK 3MLRL 3F12B 4J4PC 4WV1B 4QRRD 3BPLC 5DS8A 1NCWL 4HFWA 3G5YA 1Q8MA 1YQVH 1ORSA 1PSKL 3MNWB 3V0WH 4UAOB 2A38A 1F4XL 4M6OH 1CU4L 1CYGA 2YC1A 5DTFA 3TBTB 1UACH 4YDVA 1UH3A 4X8JB 4HGMA 3HUJF 3MLZH 1AQDB 4M1CC 1DQDL 2F8OA 3LKSA 4ODVL 1CDYA 1NCTA 1TJHL 1TXKA 1DVFD 4EUPH 3MV8E 3ARDC 3DOSA 4GXUN 1NFDE 4RFEB 5GGQH 1HNFA 4U6HA 4NFBA 1S7VA 2NY4C 5DEGB 5EUOA 2YD3A 2F74A 4R2GD 1U0QA 1NGXB 3DX8A 4G9DA 3ULUD 4M61A 3EYUL 1CWVA 3E6HA 3D3VB 3B9KA 1G7PA 2FR4B 4QTIH 4TPRH 3LD8B 1NJ9B 5IFHL 4MA8L 2AVGA 3BDYL 4X6BB 1R3LB 2EDNA 2BVUA 1G7LB 3LMJL 4HC1H 4QEGA 1FSKB 3VXRD 2DLHA 4G43A 2FIKA 3QRFM 4XNMB 1MIEL 2CDEA 3OAUL 1K4CB 3PWPB 1Q94B 4P46D 5HYFA 4Y5XC 4G7YL 4H1LA 3UCRA 4L29B 4PBWD 2FRGP 3SGJC 4XNQA 3MBXL 5GIRA 1AHWA 3H9ZA 3PP3K 2W59A 4O4YL 5GGSB 3ARFD 3HNVL 1K4DB 4JFOA 4XNXL 4OV5A 3B6SA 5D7SH 5I73B 3WIFB 1AD9A 2EDOA 3RU8L 5IVZA 4ENED 4YHIA 3NFPB 1DR9A 2IGFH 3VG0L 2ZCKL 3LN9A 1F4AA 2D03H 4POUB 3HAEB 1A6TA 2P42B 4XCEB 1RZGA 3KJ6H 2P8LB 2PYFA 4X5WB 3MMEB 3W2DH 2JB6A 1YN6B 4LNRA 1C7SA 1MHEB 4NM8L 4LASL 5GRVL 1BLNB 2ICCA 3WNPA 2D3VA 3OR7B 3MV7A 1EZVY 4Z7UE 3GSXB 1WZMA 4PJGA 3VD3A 1KLUB 5CEYB 3RUGE 1MH5B 1FRGL 2CUIA 2H6PB 4WO4C 2P8PA 1SJHB 4HGKC 2EDWA 4ZG1A 3PWNB 3Q6GH 2HJLB 2QSVA 2VAJA 2NY4B 2J8HA 4UU9A 2VQTA 2GJZA 3VCLB 2PYEB 4GKZA 3GMRA 4ZXBD 5GJSL 4XCFL 3SN6N 3PWPD 5F9DC 5IKCA 5LKNA 4JFQA 3HRZB 1KJVB 3P3YA 5I75C 3IDXL 2A74A 2AJSL 1D5MA 1Q9KA 5JXEC 3QFJA 5IMKA 1H3XA 3OB8A 3VI4E 4R6UA 5E8OB 3FB8B 3VWKC 5ISZA 4F33A 2HVJB 1BD2B 2YZ1A 1ORQB 2LAGB 2M26A 4JKWA 3BDYH 4B53A 1FORL 3BH9A 2DL9A 5F7MC 4HC1L 2DTML 1HHIB 2FECL 5CP3H 2UZIL 1T0MA 1OWWA 1FGVH 3UYOD 4PLOB 5M7QA 1KTDB 4ZPTB 2ESVA 1G6RA 3DMMD 3WKML 2OTWB 4V2BA 4NSKA 2R8SL 3DXAE 3MRKA 3ZKND 4GAGH 4P4RB 5CCKH 1WAAE 3QHZH 1MHCB 3VXNA 2ICWI 4FNLH 3W9EA 4FQJL 2KH2B 3IS1X 2R2CA 2I9LB 1RV6X 2NY7L 4QOKD 3M17A 5IFAL 2COQA 2Y5TA 4FTVA 4TRPL 5AWNH 3SJVD 3WFZA 2VDPH 1S7SB 4Q7DA 2ZOLB 3C8HA 3C6LA 3MRGB 3Q0HA 4OFYD 4Q74A 3WS3A 3BP6B 3B2VH 3QQ3A 2XFXB 1CLOH 1K8DA 1LDPH 1UZ6F 1KGCD 1BZ9A 3ULVE 1ODAA 2VE6A 5HHVH 2AV7B 3BHBB 5KTEL 1C08B 4JQXA 1GGCH 1NMCB 4PRHB 3U9PL 3QDJA 1QD0A 1PG7H 2E6PA 2OJEB 4G6MH 2WLYA 4U1GC 3EDFA 5CGYC 4X80L 2O5YL 2BVQB 5EUOE 3LEVH 1J0IA 4Y5XA 4AH2B 2FIRT 3VWKD 1A3RL 2Y36L 2XNAB 5JOFB 4BZYA 2NY3B 1Y6MR 5IWLC 3G6DH 5EU6B 3V0WL 5C07E 4OF7A 1CICB 1MFEL 1MJ8L 5MERA 2YZ8A 5IEKB 4U1KB 2BRRL 3TNMA 2V5MA 4K8RD 4OV6F 1TIUA 5D72L 1X5YA 2X89A 4ZUWB 1IM9B 4LHUA 1JNLH 3H0TA 3CDFA 2Y23A 2VDRH 5L2KD 4XXCA 3C09C 2OJZL 5I8EA 3FONA 4H1LH 4ZUSA 1EAJA 4GMSL 3NCYP 5EBMB 3ZKMC 4F15B 1FZJA 1T5XB 5I1EH 3MJ9H 1MPAH 5IW1B 5F8RC 3I6GB 4UIMA 3WHE1 5D1ZD 4NN7B 5F7KC 3W82A 2F19H 2Q8AH 2VXQL 1U8LA 1QBLL 4P46B 3IS0X 1JNHA 2EDKA 1B9ZA 3QG7L 4BZ2H 3D18A 1RJYA 1X5HA 1UKSA 2BNQD 2Z91A 3T08A 5KG9A 1NCCH 3C5SA 5B3JF 5I1KH 2MHAA 4PGJA 4WUUE 5JPMA 4OLEA 3KAAA 1OAXL 3NTCH 1NFKA 2WWKO 4Y5VB 1CXHA 2MNUA 3DIFB 3EFFA 5IM7B 5HHOB 4PJ7F 4OB5H 5MENA 4OKVA 3DGGB 4Y5VC 5SWSD 3WS6A 5I18H 3ULVD 1MCFA 4X9HA 1MCHA 3ES6B 4QRSA 1QFUL 4OM1H 1HQ4A 3WUWG 3RL2A 4KRPB 4W68A 1EO8H 2B2XH 4PGDB 4EI6B 5HVFB 4X83A 1R5IA 1LK3L 4M00A 3HS0B 3F6LA 5DD6A 1VFOA 1CR9H 1QEWA 3KPRE 3V0AC 2AQ1A 5B8CA 3UTSB 1EEYB 1U9KA 3ULVH 1RZKL 2E6JA 3PGCB 3KDMA 5I8KL 5T3ZH 2P46B 2CKBH 3JWDL 1FFOB 4FQHB 4HHAA 4IRSD 1J8HA 2O5YH 5FECA 5EZLA 2QADB 3EJZD 2PYED 4LLMB 2J8UF 5FKAB 3O2DA 4GBXB 2XWJB 4APQC 2N7AA 3H6JA 1FAIH 2WINB 1E27A 3SOBL 2BNUB 3KLDA 1IAMA 1IMHC 1P4IH 4JZOB 3RWFB 2DI8A 4HUKB 2IPUG 3HZMA 2DQIL 5IT2H 1M05B 2F9BT 2J6EL 5F89B 3REVB 5GS2D 3TNNB 5DJCB 3WUWB 3EO0B 1WF5A 2VITB 4NYLB 4O9HL 1BOGB 4PJDF 3D39D 1QA9A 3PWVB 2FJFB 3QZWA 4XPHL 3EYSL 5H2BB 3UZQA 1KN4L 2EECA 3JWOC 3QI9A 3VD4A 4U1GB 1F8TL 4YNYB 2WUBH 1J8HE 1K2DB 3S5LG 3QO1A 4OLYL 2QQKL 1CDCA 2FBJH 1FJ1B 3DPBA 4R7DA 3OGOE 3C6SB 4YGVA 3TIEB 3VXSA 4FS0A 5C0AB 12E8H 3MLRH 1A7PL 3HMWH 3MROB 4IHOA 1MI5E 1MREL 1S7XA 4NO3B 2D7PA 1UFUA 1FH5L 1CDBA 3QA3A 3SKOA 4KUZH 3V7AG 4K94C 1D5BB 5SX5H 4OZHB 5C0BA 5K93A 2AEIT 1F3DH 1Z5LA 1PAMA 3BH8B 4W4NA 3OKKA 5GGRB 5CGTA 4ZUVB 1NCCL 2HTLC 1IEAB 2DL2A 2QADC 3H7BB 2QSCL 3GDBA 3QDMB 1MRFL 1ZMYA 4Z7VB 2M1KA 1N59A 4LLQB 4K9EH 2HFEB 5C08D 4R96A 5D1XB 3D9AH 1FAKT 1A1NB 1H5BC 1A6UL 2W9DH 3L6FB 3V95A 5FOBB 4DQOL 4GQ9L 4ZO8A 4FMKA 3C9NA 3T09A 5E2UH 4P3CL 4K3JH 2CDFA 3N85L 1SEBA 1K6QH 3RPIB 4C58B 2LV4A 3CFDB 4F57H 4LSTL 1TENA 2AAVA 4LL9A 4X7DC 4DN4L 4OGYL 2VUOA 1MCRA 2MWCA 4KJQC 4P2QD 2CIIB 2KL6A 4L4JA 4GO6B 3DVNB 3BKCL 4WV1A 3AREA 1CDIA 4HFWB 3G5YB 1OAZL 2BC4A 4N90E 1ORSB 5IJVA 1REIA 2EDDA 3GZKA 1SQ2N 4JREC 3RI5F 2YC1B 5DTFB 2P8MA 4NDMA 1Q1JH 1N3NA 3MLUL 4ZQKB 3TWCH 4BQCA 4YDVB 5JXED 1QRKA 4RQQA 2IC2A 4M5YH 1AQDA 1JPTL 3SDYL 2V17L 5E24E 1FL5A 5MENE 2OK0H 1FG9C 1BBJB 3EYSH 4NCDA 4U6HB 1CGUA 4KKCD 2F74B 1RZ8A 4YWGL 4MXQD 3FKUS 3HUJE 3LDBB 4NN5B 3DX8B 3RVXD 4G9DB 2J12B 4M8QA 1A9BA 3B9AA 4ETYA 3MJ8A 5HI5D 2CK2A 1FIEA 3GJFA 4GS7B 1ADQL 1G7PB 2FR4A 3C09B 4S1RH 2FL5A 1YYMH 3QULB 1QRNA 4X6BA 1S78D 1TVHB 4PGZA 1PX3A 5C0EB 1W72B 3UJTH 4O58H 1INEL 3BRDA 1MCLA 3QT2A 4XP5H 1S7WA 2FIKB 3RGVC 3D3VE 4ZOBA 4Z18A 3Q6GL 3U83A 2B1AL 4AY0A 1K4CA 4WEBL 4HLZG 1N8ZB 1U93B 3DNKA 4YHLL 4L29A 1J8HD 1S5IH 4IOFD 4WU7B 5BRZD 4M6OL 3RUGA 1INDH 1OD7A 4XNQB 5GIRB 5GRUH 4XVUC 1DQML 4KTYA 4YEEA 5JUEL 2CR6A 5GGSA 3CFIC 4N9OB 5FUZH 5KVMC 2MPAL 3GB7A 5DT1H 1K4DA 4ODVH 1AHWC 3B6SB 4Q97A 3WIFA 1FSKC 3FTGB 1OARH 4PRNA 3NAAH 2DWEA 4P3CH 2J1KA 3RNQB 4HWEL 5BVJA 4NKIH 4YHIB 3QJHA 5I1AB 4GAFB 3B8YA 4U4BA 2V5YA 3D39A 1G9MC 3PDOA 4GFTB 1A6TB 2CXGA 3PXJA 1RZGB 5I1GL 4ZFFA 2P8LA 3D2UD 4X5WA 3MMEA 4QOKE 1KB5L 2JB6B 2NTSP 4XVJH 2FX7H 4UTBH 2Y4SA 5JHLH 4H88H 3AB0B 2FX8L 2X9WA 4XNUL 1P84K 1MUJB 3GSXA 4PJGB 1KLUA 5CEYA 4YBLB 4PJ9B 5EUKA 1VERA 1MH5A 4LLDA 1V5JA 4ZTOL 2W0KA 4OFVA 2P8PB 1SJHA 3WXVL 3WNKA 3DI3B 2HFFB 3TPUA 4XB8A 3PWNA 5BV7B 2QTEA 4LPTA 2HJLA 1VPOL 3B5TA 1EV2E 2FEDC 3P40A 4UU9B 5FCSH 3DX7B 2GJZB 3VCLA 4R90L 2PYEA 4OTXH 3GMRB 4LPUA 1OTSC 1YEJL 4ZUUA 4AJ0A 2X09A 4LU5L 2NCMA 5DHVH 3FO9B 3Q1SL 3UTPE 3IFNL 2B4CC 4JFQB 3HRZA 1KJVA 4NQDA 3BPLB 4ONFL 2PXYD 4CJ1A 3WHXA 4WV1C 3ZYJA 1D5MB 4P2RE 2ATPB 2C4FT 2K9UA 1F8TH 1PG7L 4YXLH 4M7LT 5IB3B 1CLCA 5I71C 4JO3H 3SO3C 3FB8A 3L7EB 4O5LL 4R26L 4F33B 1IAOB 5EA0L 1BD2A 4L4TD 1DEEA 3HNSL 2DICA 1JTOA 1ORQA 12E8L 3LAFA 3X17A 4F37F 1T7WA 2APFA 4XP4H 3EOTH 4F9LA 1M6OA 2VDLH 1IM9D 2Q7YB 1MFEH 1MJ8H 4UDUA 3WFEH 1KTDA 5JOPE 2XTJB 3CMOL 4NRZB 4JN1H 3AY4A 3FN9A 1RUKL 3HPJA 3MRQA 2E9BA 2OTWA 3MRKB 3HRPA 1WLHA 4JPVH 3VXNB 3W9EB 4XCYB 1RMFL 3PL6D 5BMFH 5C0RL 4X99B 3IFPB 2H26A 4NN6B 3M17B 5BS0A 2AJXL 3GHBL 2BDNL 1DEDA 1DSFH 3MRGA 3MOQA 1UVQA 4LVOB 1LP9F 3QQ3B 5K59F 2LVEA 2CLVB 2CUHA 2W0LA 4QHKI 5C07D 2VE6B 2H2PD 3QUMB 5ITFB 4YHZL 4LARL 1C08A 1KTLA 4KV5E 3PHSA 4PRHA 3BW9A 4YPGB 2R1YA 2CMRH 3W11C 2I07A 3FQUA 3X3FL 4WCYH 4Y5XB 1MCIA 2XNAA 5GJTH 3U30C 5HVWA 5JOFA 2WSKA 1N5YL 3CH1B 1KYOJ 1OQXA 5EU6A 1GVIA 4FQ2H 1CICA 2XZCH 1J11A 4D94A 5MERB 2KZ1B 3TV3H 2AP2A 5IEKA 4EIZC 5CJXA 1IM9A 2X1OA 5JO5A 4FXGA 3H0TB 2VZ3A 3QPXH 1HXYA 4JO4L 2VXVL 4ZUSB 4UIKL 5D7IB 4B50A 5K9QG 5T1KB 4NHCH 1SM3L 2Z4QA 4PTTA 3VD5A 4BH7A 1FZJB 2AJYH 4QNPE 1T5XA 5HI4D 5IW1A 2D9QB 5FGBC 4DZBB 4PB9H 1OM3L 4PJHF 4MWFA 5AYUL 2XTLA 4PJIA 3B43A 1T0NB 1OP3H 4LFHD 4R4FH 4PJEF 4XP4L 4DK3A 2W9EL 5EIIB 5BV7H 5D7KE 5E7FA 4LCCB 5D2LB 2VDLL 3U2SA 1MFAH 4QF1A 2Z91B 4XP6H 1H3GA 4U6XB 2XA8L 5DMJB 1URLA 5JPMB 4MNQA 4TSCL 2JE8A 2NY2B 3P0GB 2N4IA 4EJ1C 3GBNL 4Z76A 4AEFA 5DFVC 3DIFA 2FEEI 3ET9F 3EFFB 4ONOA 1TVBA 5HHOA 5MENB 1S9KC 1UM6H 3DGGA 1CLZH 3MLXH 3O0RL 4JQIH 2VLKB 1KN4H 5J06A 2BRRH 1E4KC 4QRSB 1JFQH 5HBBA 3QUYD 5LBSL 3RL2B 1UQSA 4QXTA 4R0LC 2P5WD 4QHLA 3U7YH 4ZAKD 4PGDA 2BOBA 1AR1D 4HS6A 4NO0D 3HS0A 2IAMA 2EEBA 4UMGA 1MQKL 1E4WH 4LCWD 1MJJA 5C0GA 4XRCB 1X44A 4RDQF 4QRPD 4ENEC 1EEYA 3PGCA 1MJ7H 4KRNA 1CL7H 4YHMH 1WITA 3O4LB 3PDGA 4XPAH 1HN1A 4MXWH 3QIWC 4FQHA 1BD2E 2NY4D 2VDQH 4WTZA 1NKRA 5EZLB 4ODBD 5FKAA 4LLMA 2FHFA 5K9QI 1LMKA 3MGAA 3ARBB 2BNUA 4KI5C 4RISH 4NQEE 3ARQA 1A7QL 5D8JH 1M05A 5F89A 3REVA 1VB9A 2I5YL 1IGYA 4DAGL 2HFGL 5DJCA 1IM3B 3TEUA 3WUWA 4M7JH 2VITA 4NYLA 1B4JH 5I6XC 3QUZC 5LJYH 1Q72H 2VLJA 3IT8D 1QA9B 3QZWB 1CXKA 1RK1A 3TT3L 4YFDB 3QI9B 2VXTH 4JFDA 1K2DA 4X5XA 3QO1B 3QWQB 4P9HH 4R7DB 2Q6WB 5C0AA 5DJ8A 1IGFL 3MROA 5ACLA 2V2TB 1NUDA 3SE8H 4X4MA 4O5LH 4R26H 4NO3A 1SBSH 3QA3B 2FBOJ 3O6MH 5E08H 4JEGB 4TSAH 4XVUD 1U8NA 2CSPA 4IDJH 3FFCD 4IRJA 2A6DA 4AEIH 4BK5A 1GGIH 1A6ZA 3O4LD 5HVHB 3QFDB 1YECL 4KJQD 3H7BA 4WFGD 2EIEA 3QDMA 1X5LA 1FZKB 4L4VD 5D1QA 4IMKC 1N59B 4LLQA 4Z5RB 3ZE2F 4JPVL 4R96B 4LQ1A 2KQNA 2FZ3A 5D1XA 1A1NA 4G9FE 5FOBA 1A2YA 1CFVH 1S78C 3C9NB 3T0EC 3G04A 1AFVL 2AXHA 4XPTH 2CDFB 2GJ6E 1CD0A 1AO7E 5FYKH 5HY9A 4MAYD 1SEBB 1A14L 2C1OA 2HT4C 1JK8B 2D03L 3O11B 2EE6A 5A2FA 3QXWA 4Y16C 2GSIA 1K5NB 2NW2B 2NY3D 4LVNC 5KVGL 4ZFGL 1P53A 3DVNA 1FN4B 3AREB 4K3GA 3HI6H 5J1AA 3QXVA 3IDYC 2BC4B 5GQBA 1BBDH 5IJVB 3QIBD 5I0DA 4LLYA 4QTHA 5GRJL 4A6YH 3ZKNC 4XVSL 4MNHA 3AM8C 3RGVB 2P8MB 2DM4A 4NDMB 4CGTA 1WQVT 1N3NB 3FT4B 5C8JA 3ZDXE 4N0RA 4ZQKA 1DQMH 5JUEH 2YD8A 1NBVH 4RQQB 5CHNA 2WBJD 4I0CC 2YKLL 1MHPH 4MAYC 4JB9L 4PYGA 4Q9QH 3I2CL 1ZAGA 1AXTL 4LQFL 4YFLF 1FO0A 1LO0L 1FL5B 1RUQL 5F96H 2EDQA 1CDJA 5TE4H 1BBJA 4TVPE 3OGCA 1WISA 1RZ8B 2J7LA 3E3QE 3L1OH 4NN5C 3H9YA 4M8QB 1A9BB 3MJ8B 3QBTB 5I1GH 2HT2C 3KR3H 3GJFB 2FX7L 4U6VL 5GZOD 3Q48A 4KRPD 1MAJA 1U3ZA 5E1AA 4JANA 2FL5B 1CLYH 3F62A 3QULA 1QLRA 1XGQA 1QRNB 3FCTA 3SE8L 3ULUL 1TVHA 2WBWB 1NMBH 1Y6KR 5C0EA 1OHQA 5HDQH 1W72A 3QDAA 4OLWH 4JO1H 3GSOA 2OXGA 1E28A 1OF2A 1OP3K 3ILPB 1O7VA 1EDQA 1S7WB 5ITBL 5TE7H 5GHWL 5I15H 3CXDH 4QRQB 4HH8A 5EWIL 4YGAB 3SGJA 1N8ZA 3RIAF 1U93A 1Q0YL 3NH7L 5LGJB 4WU7A 5D1ZA 4OGXH 4OZGB 3RUGB 4JZJC 4GW1A 2NY7H 4YC2B 2QJDA 3BPCB 4OQTH 3GB7B 1MCOH 4XP1H 1JPTH 4LSRL 1F02I 3O3DA 4OI9A 3FTGA 4ODTH 5EZJB 4IRZL 4PRNB 4UV4H 5FCUH 1LILA 2DWEB 3RNQA 1LE5A 5BVJB 1LDPL 3OJDA 1I9EA 4EOWL 3QJHB 5I1AA 1J10A 1S7UA 3D39B 3PDOB 1NBZA 2VERN 4TSBH 4WUKL 1KJ3L 3FRPA 1ZHLA 4LRNH 5C0NC 2YK1L 4ZFFB 5LWYL 4NQTA 4O2FA 4APQD 4N8PA 3UDWC 4DVBA 5KVGH 5DR5L 4PJXE 5BO1H 4BA8A 1CL7L 4X5LA 4PS4H 3O6KH 1MUJA 1IKNA 1TPXB 2IFFL 4G5ZL 1YQVL 4PJ9A 4YR6A 5EUKB 5JR1H 4LRIC 1F4YL 4LLDB 4G6JL 3LIZH 1I9RH 4A6YL 2W38A 2E8ZA 2HFFA 3TPUB 5M95B 5DJDB 3P11L 3BKJL 1LO4H 1Z3GH 4YC2C 4GT7A 2BDNH 4GAJL 3CVHA 3DX7A 5CKAA 3OMZA 5GISH 1CFBA 1DE4B 3UTSD 2W92A 4YK4B 1CVRA 5C09D 4ZUUB 4U33A 3FO9A 3IDIA 4NZRH 1UT9A 5E4EC 1MY7A 5DGQA 5GRUL 5E8DL 5I1CL 4MQ7B 4Y19A 4LAQH 2FDBP 5CD5C 4NQDB 4O00A 1CBVL 3WHXB 3K0WA 4J4PA 3NZ8B 2ATPA 1DTUA 1WT5C 2IJ0C 5K9JH 3MJ9L 2MMXA 1CDGA 5IB3A 5SX5K 3FO1B 3NABL 4YDKL 1MCWW 3L7EA 2NY1D 1IAOA 4I5BB 1DEEB 1P2CB 3JUYA 2Q8AL 3UBXI 4DUXA 3SDAC 1LO2L 4Y7MA 5C6PB 5D2NA 1M6OB 3BI9X 5E08L 2Q7YA 5GGVY 5J7CC 4MXVE 2JIXA 4UDUB 5D96C 3HE7C 4NRZA 5D1XD 3GKZA 5JHLL 5CGYD 1UEMA 3HPJB 1ED3B 3MRQB 1OSPH 5DVNA 3HTLX 4DN3L 3DYPA 4E42A 2RR3A 2I25N 2AXJA 2FH8A 2XG4A 3C2AL 3NH7H 5HI4C 7FABL 4MAYB 2R0KL 4XCYA 1UJ3C 5DD5L 4X99A 3IFPA 1K9TA 2H26B 4DOHE 2I26N 2VLME 4J1UA 4NHCL 43C9A 5IBUG 5BS0B 3QHTC 3TVMD 5I9QB 3RWCA 1CFVL 2R2EB 1UVQB 4PG9B 4C83B 2OR9L 4JRWA 1NKOA 2R9HD 1CR9L 2CLVA 5DURB 4Q9RL 3DJ9A 4YZFE 3VMPA 4N0YL 5D7LD 3CX5K 2DD8H 3BPNB 1NC4B 2AJ3A 2P49B 3QUMA 1P1ZB 5KVEH 5ITFA 4B7IA 1KTLB 1P4BL 4KRPC 1KJ3H 3D0LB 3S35X 3BW9B 4YPGA 4M48L 3O2VH 3UC0H 2R1YB 3MLWL 4NC2B 4HCRL 2I07B 3FQUB 3BKML 3MBEB 4OCWH 1JV5B 4XHJD 5DVKA 1YPZB 4RMVA 3EOTL 2RHEA 1YMMD 3MCKB 1X5ZA 3CH1A 5MHSE 5E6IA 1T66C 5DA0B 4OZ4A 5GS3A 4JN1L 4OAWA 1T7XA 5T33L 2IAND 4ORZC 2B5IC 5JO5B 4FXGB 4N0CD 3VFTB 4XC1L 4UOW1 4PY8J 2X9YA 4LAJH 3CLFL 2PF6A 1CN4A 1HXYB 2CJUH 1C1EH 3ZT7A 1AXTH 2VIRA 2AI0L 2DJ4A 1OTTC 3H9SE 5D7IA 5T1KA 2WUBL 5TE4L 1D7FA 1N6VA 2AJXH 2Z4QB 4PTTB 5GGQL 5HGBA 3R4DA 4NFDA 4BH7B 2C4XA 2GY5A 5L9DH 3DARA 1MJ7L 1PGRB 5CEZD 5ICZB 4DZBA 2D0GA 4XT1C 1S9YA 4MWFB 2W65A 3TZVD 2LQRA 1K8IA 4PJIB 1T0NA 1SVCP 3EDEA 4JVUA 1LO2H 4NZDA 1SMOA 2ADGA 5FUCC 4TN9A 5EIIA 5HDQL 5J1SC 3H9SD 5MEQA 4LCCA 5D2LA 3U2SB 4M6NH 4QF1B 3RUGF 1AQKH 4LMQI 1A7NH 4U6XA 2AERT 1MNUL 3NVQA 4MNQB 2ZUVA 4LNVA 2O5XH 3V0VA 4E5XB 4Z76B 2VXUH 3ZYIA 2XTJD 1TVBB 2C3VB 1MCNA 3UYPA 4MJIA 2VLKA 4LSVH 2UV3A 3GFUA 1UQSB 4QXTB 5KVFL 4QHLB 4K8RL 4S10A 1DUYB 2BOBB 4HS6B 2IAMB 2WZPD 1J1XH 4JG1H 3UTTB 4EXPX 1LO3H 4BJLA 1G6RH 4U6YA 9CGTA 2R39A 1MJJB 5C0GB 5DQ9B 4XRCA 2PXYB 2M8XA 1DN2A 1XZ0A 5JW4M 3O4LA 4WWKD 1YDPA 4IOIA 1Z9SA 4JVPA 4NZUH 2E9JA 4AEIL 2VUYA 3UTQB 1LQSR 4P3WA 3V8CA 1DQLL 5I1DB 4Y2DA 2ADIA 5SX4H 1QLFB 3QNXA 3ARBA 2X4SB 1VADA 4WO4D 3MREB 3RBSA 5CUSL 4U1LA 2G75A 3BDXA 4KJPD 1IGYB 1IM3A 1AFVH 5C70A 2H3NA 2VLJB 4OZFG 1PBYA 3ULUC 2B0SH 4JJ5B 2N1KA 1MWAB 1J1OL 2DLGA 3K7UA 4L4TB 1RK1B 4PJXF 5J13B 1J5OL 3CUPA 4JFDB 2NXZC 4X5XB 1HSBA 5F3HA 4LCCC 1G0XA 3A6CL 4BH8B 2IH1A 1OD9A 3K2UH 3P0VL 2YBRB 1OOAA 1UM4H 4WI8A 2Q6WA 5DJ8B 2V2TA 5KAQG 1RU9L 4Y19D 3QFJE 1MQKH 5I1HH 3MYZA 3T77A 5CAYB 1INEH 4ISVB 1LK2B 1QBLH 1I7TB 4X4XA 3VXMD 3MODL 3M8OH 1DVFC 1U8NB 4P59L 2EDLA 5BW7C 4IRJB 3TBYA 2A6DB 1FGVL 1H8OA 3ZKXB 3CU1A 1A6ZB 4WHYH 1AJ7L 1ZT4B 3QFDA 4WTXA 4KRLB 3GNML 2OM5A 4P99A 3I2CH 4OBSA 3MACL 1FZKA 4JKLA 5D1QB 1IQWL 2NYYC 4Z5RA 1E4JA 3QHZL 4HUUB 5D7LB 4KMLB 1WTGT 3VWJC 1RZFL 2FZ3B 5IB2A 4EBQH 4MAUH 1A2YB 1KCKA 2OXHA 5D8JL 4L8SA 3G04B 3VA2C 2G60H 5HY9B 3MXVH 5E6ZA 3VI3F 1XR9A 2C1OB 1JK8A 3S6CA 1DFBL 3O11A 1UXSB 1OP5K 2GSIB 1K5NA 2NW2A 1XIWC 3FQWB 4KKBC 4UTBL 1AC0A 5CWSA 3VXTA 5MP6L 3OPZH 1FN4A 4G6ML 4UNTA 5J1AB 1H3UA 1MFDL 1UWXK 2PETA 5INDB 1QSED 2YD7A 2Z31D 4RGNC 4ALAH 3WNMA 4LLYB 4QTHB 2IG2H 3ZE0E 2IH3B 2FGWL 3AMLA 3ULUE 2RBLA 4MNHB 1ZEAH 3RGVA 4Z6AT 4JZNA 1YEFH 3FT4A 5C8JB 3G6DL 2ZKHL 1D6VL 3GO1L 4JDZA 3QDJE 3EYQD 4OQTL 5CHNB 3HNVH 4QO1A 4E41B 4G8GD 2VYRE 2Q20A 4WW2B 3TIDB 4MD4A 1FO0B 3THMH 2NXZB 3QPQC 3OGCB 4ZODA 4PJHB 5ANMB 3C5JB 2WBKA 1WZLA 3KJ6L 5GGRY 3CX2A 4HK3N 3OQ3B 1RUAL 1BFSA 5E1AB 3D85D 3B2UD 3LH2L 1MCKA 4JANB 3RA7H 5D93C 1IKFH 1UWEH 4PJ9D 3VFVB 1HK6A 1QLRB 1XGQB 1R5WB 3FCTB 3KPRD 5HHMB 2F19L 3ZT6A 3GSOB 1E28B 4G6JH 3QFJD 4M3KB 1I9RL 1OF2B 1G9ML 1E6JH 2E7BA 3I3EA 3ILPA 4KC3B 2PCPB 3GSQB 3FJTA 1D5XB 4CN4A 4E41E 4QRQA 3UEZA 1EVUA 1F5WA 1ZT7B 1IC1A 3ARGD 4PJBA 3MV11 4KTDH 4H0HB 4NZJA 5LGJA 3O6LL 1I9JH 5D1ZB 4OZGA 1ZKAA 3MYJA 2LE9A 4GW1B 4K55A 5IJKA 1XGPB 5FB8A 5CMAA 4W6WB 3BPCA 5F7LB 4MAUL 1YYLH 5E2VH 2GQHA 1JGDB 2IAMC 1S7RB 4RX4A 3O3DB 1E4XI 1RY7B 2E9WA 4MZ2A 5EZJA 5T1LD 4JY5L 1UWGL 1LE5B 3OJDB 1DBKL 4TPRL 4QY8B 2HTKC 1TZGH 5IFHH 1BFVL 1S7UB 5FDYA 3ZYOA 1NBZB 1PYWB 1XF1A 4FTVD 4NQCE 3PGDA 1ZHLB 3LV3A 4O2FB 4ODWA 4DVBB 4HS3A 3SDXF 4RA3A 3LEXA 1TVDA 5ESAA 2A0LC 3BKCH 3HAEG 3OKYA 3JWDH 3EOBA 4L8SC 1JI1A 1H3PL 3CPLA 4YR6B 3QAZB 4JAMB 2JJTC 5FYLL 1KPVB 3W5NA 5DD5H 4WI5A 3UTTE 3P4OB 2EDXA 3IB4A 1KNOA 5DJDA 4YHKL 3UBXA 1M4KA 2DRUA 2XOTA 4GLRI 4KZEH 3CVHB 1H8NA 2OTUA 1DE4A 3E8UH 1V8HA 2E6QA 3QCVL 3IDIB 2PW2B 1DBJH 4NO5A 3JZ7A 4MQ7A 4KVNH 4Y19B 2J5LB 1SM3H 4MYWB 4RAUA 2APTA 3KPTA 4XPBL 3NZ8A 1QSZA 4UUJB 5TQ0L 1P7HL 3FO1A 4L3CB 4AG4L 1OM3H 3OKLA 3A67L 1RUML 1G7IA 4I5BA 1P2CA 3D69B 1C12A 5D2NB 5A2JH 4U3HA 1RIHH 3BWAA 1MCBA 3L5JA 3VGGA 2VOTA 4Y4HC 1IC4L 2JIXB 1XGTB 5GRYA 5BO1L 1EHLL 4OCYH 5ELIA 4YE4H 1ED3A 3GBNH 4FP8H 2P44B 2M2DA 1AGCB 4XC1H 4RGOL 4E42B 3DHJA 1T5WB 4YX2H 2ZUTA 4XNYH 2HWZH 4MLIA 5J12C 4MAYA 4LPXA 2ED9A 3ARYA 3I75B 3VG9B 3RKPA 3KPSD 4OT1L 3SE4C 4J1UB 2EDHA 1TITA 43C9B 3RWCB 5L9DL 2MOVA 2R2EA 4PG9A 4C83A 4TNVF 3BUTA 4HWEH 2BVPB 1T7ZA 1KENH 1NC4A 2AJ3B 4CVZB 1P1ZA 3HPLB 1ZV5A 1JYVA 1DLFL 3QUXA 1KIQA 1I1CA 3D0LA 4RFOH 3GIZL 3MBEA 1AQKL 1JV5A 2R0ZH 1F6AB 3KVQA 4JRXE 3O2WL 3AY4C 3ZDZE 1L6XA 3VFNA 1YPZA 1N7ML 3VFGL 3MOBH 1YY9C 5GGTL 4GW4A 1EA9C 5FO8B 2VLKD 3QCUL 3MCKA 3KXFB 4OM0L 4OIIL 2DIJA 1QRND 5E6IB 2K7PA 4OZ4B 3ARGC 4OAWB 2BRQA 1BJ1H 1EEQA 3UAJD 2C9AA 3VFTA 4MNGA 4GRMB 2B2XL 1BWMA 1CXFA 3WS6C 5SV3A 5D7JC 1SYSB 2Q76B 3WFDH 2VIRB 3PP3H 1NH6A 2XKSA 4KTEL 5E8PA 4ELME 25C8H 1KCLA 2PO6C 2VLKE 5HGBB 3BD5A 4HBCH 1JWUA 4M3JA 4D0BB 3OKEB 2JCCF 3ZZ1A 3P73B 1QPPA 5ICZA 4UILL 1TQBB 1IGCH 4JO3L 3EAKA 1WVZA 1S9YB 2W65B 1X5GA 2PTTB 1K8IB 4LIQH 3RA7L 2UWEF 1DQLH 2X4OB 3JV5A 4DKEH 2ADGB 1FVDB 1PVHA 5B21A 4LEXH 4PB0L 1FAIL 5MEQB 1SY6H 4GG6A 4JCMA 4CRPA 4YHOL 3DV6B 3IJHA 4E5XA 3V0VB 4YE4L 1ZVYA 1G9EA 1KSRA 3RWDB 1NMAL 5F70A 4PREB 2C3VA 2EZ0D 2ZJSL 1JWSA 2ITCA 3QPQD 1BMGA 4MJIB 3KLHD 5DD3L 5EORL 1QFWL 3T0ED 4I1NB 2GJ6A 2QSTA 3BT2L 3KPQB 4LP5A 5TPWH 5TQ2H 4N0UE 4FFZH 4GBXC 4APQB 1DUYA 1MPAL 4OZHE 3BGFC 5J13C 4JGUA 3UTTA 3IDGB 5DRXB 3U30B 4AL8L 4OLXH 5FUCE 1MREH 1MFCH 5IW3A 4I3RH 4U6YB 1KCSL 4WU5A 1MEXL 4JPKL 5DQ9A 5EU6E 4KMQA 2AJUH 5HJ3A 4D2NA 5FDWA 1JE6A 2PXYA 5BRZB 1XZ0B 3O9WD 5IB1A 1YDPB 2Y25A 4IOIB 4XVJL 5DJ0A 3EJZC 1C16B 3UTQA 4GRWH 4FFWD 1FIGL 1ZGLP 1VENA 1QBML 5I1DA 2IBBA 5DEZA 5AAWA 4U1HA 4KKAC 3WLWD 4Y2DB 4LIQE 4OZIF 1UJ3A 1T89A 2ADIB 1QLFA 2HT3D 3QNXB 3QSKB 4PV9B 2YPKA 2X4SA 1VADB 4P57A 3MREA 3BPOB 4JKPL 4WGVB 3UZEA 4U1LB 2G75B 3DBXA 2AEQH 3DROA 3WLBA 4BELD 1CE6A 1W0WB 5SWSE 5GGSY 4G9FD 5B3NA 3DX6A 4R4ND 5D70L 2H3NB 4GMTL 3KYNB 2F5BH 3MXVL 4BSVA 4JJ5A 5EC1A 4KMTL 5C6TH 1MWAA 4G7VH 4O02H 1Y6NR 4L4TA 1DBJL 1J8KA 5IW6B 4JM2C 4UIKH 2D4DA 3CUPB 3SDAD 1DJSA 1HSBB 3EYUH 5F3HB 3QWRD 4BH8A 2IH1B 2ORBL 4YIQB 2YBRA 3JBG7 2UZYB 4P46C 3HCVA 3NCCB 5C0IB 4AG4H 5E2TH 2F53D 2HFTA 5DZNA 1GC1C 3T77B 3HNSH 2QQNH 4ISVA 5FGBA 1LK2A 5IP4A 1I7TA 4X4XB 2YPVH 4C59B 2EO1A 4YXKH 3GGWB 2DTSA 5TE7L 5I15L 3TBYB 3MA9L 2XIDA 3RX5A 5FGCE 4IRSA 4JRXA 3AREC 4JE4B 3EO9L 3VRJB 3TA3C 2Z8VC 1ZT4A 4KI5D 5KANI 1EO7A 5DZLA 4LHUG 2VZTA 4MA7L 3D1MC 3S9DB 1AR1C 4KQ3H 2EIBA 4HUUA 5EULV 5D7LA 5HYSB 3JV6B 4NQSB 2XYCA 5IB2B 5F1KC 5CUSH 4L8SB 1DQQA 3KGRA 4EUPG 1A4KB 1CDUA 1M7IA 1JTTA 4BFBD 3T0EB 3BQUC 3HZKB 5I30L 3VH8G 3WD5H 4OD2B 1XR9B 2EH7L 4HH9A 1OVZA 2FCBA 1UXSA 1KCSH 4I13B 4N8CL 2YMXH 3FQWA 5SX4I 5CWSB 4K3HA 3TBVB 3VXTB 1IT9L 5JZ7C 1IEBA 1L4IA 4WDIA 4HJGB 5INDA 1BZ7B 4M7LL 1NGPL 3O6FD 2IH3A 5B38A 5EG6C 1PZUB 1HIML 1A47A 1RHFA 3U7AA 4JZNB 4XCNB 1FNLA 3ETBF 1A5FH 2FEEL 3QQ4A 4JDZB 4YAQB 3X11B 1ZLVK 1U8QA 3ZKMD 1IRAY 1HHKA 4HWZA 4E41A 3VMOA 1YJDC 4WW2A 3TIDA 1DL7H 4MD4B 3BPNC 3JTTB 3K8KA 1K85A 2MQ0A 1LEKB 1CBVH 3K46A 4PJHA 5ANMA 3C5JA 4ONHA 1UH2A 2ADJA 3W11D 5GPRA 4DN4H 1T04A 4QRTB 5I19L 2XXCB 5EO1A 3T2PA 2OZ4L 3LN5A 1AGDB 2GI7A 2ZUYA 4H88L 2GIYA 3VFVA 2EYSA 3BZFB 5JIHA 5CD3A 1R5WA 3HUJA 4XWOD 5TDOA 5AYUH 4U49A 1QVOA 4J4PD 4R4FL 1JIBA 2CDGA 1T6WA 3C5ZA 1FLRH 1A6PA 3P4NB 3HE7B 2PCPA 3GSQA 3OPZL 4FFVC 1D5XA 4HD9A 5I2IB 2V7NA 3F58L 1ZT7A 3CFEB 5H37G 3QIUD 2DMBA 2MJWA 4PJBB 4KGLA 1P7KA 4UBDC 1KF9B 4RWYL 3MYJB 5DSCB 2XN9E 3DECA 3MLYL 1XGPA 3CAFA 5FB8B 1VEMA 5CMAB 3DMMC 2E9IA 2OP4L 2G9HB 5FYLE 3TZVB 2VDPL 2BNRB 5HYJA 1B0RA 4XHJC 3DYMA 1QFWH 3DMMB 1JGDA 1S7RA 2EC8A 1UJTA 2DJUA 2UZXB 3HE6C 5F8QC 2XKNA 4Y8AA 4G6KH 4K3EH 1ZLWK 5T1DH 4QY8A 1DUZB 3G6JF 4DWHA 2HMID 1P4BH 2GJ6D 1PYWA 3PGDB 3UROR 4M48H 5L6YH 2R9HC 3LV3B 2YMXL 4ODWB 4HUVB 4H20H 1BQUA 1WIOA 3QHFH 4HS3B 4NCC2 4D8PB 3LEXB 3LH2H 5ESAB 3EZJB 3FRPG 1FVEB 3OV6A 3JVGC 1BEYH 3EOBB 3CPLB 1FIGH 1TPXC 4B41A 3TYGH 4JAMA 2VSCA 3GJFK 4KKNA 1KPVA 3A6BL 2VRAA 2AEPH 3RIFK 3P4OA 5A43C 1KNOB 1PKQB 2C26A 3UBXB 1MJUH 4WJ5A 4QYOA 1I1FB 2WM0A 3LRHA 1QUNA 1ZLSH 5D1XC 2OTUB 3KLSA 4N8VA 1L0YA 3PWPE 3QO0B 3O6LH 1C1EL 1I9JL 1DANU 1YEIH 2PW2A 1LO0H 4JQVC 4NO5B 3GMNA 5LGHL 4Z0BL 4LSSL 2F53B 1U3HD 4RAUB 4LEOA 4F7PB 1KTRL 2X4TB 4WI9A 5ID1A 5E2VL 4KY1L 5CS7A 4UUJA 1TCMA 1AH1A 5TDNB 3RVUC 3MRJB 4L3CA 4LP4A 3OKLB 4HUXB 5L2KB 4M1GH 4R97B 1G7IB 4JFFD 1G0DA 4J3OC 3D69A 2VLJE 4XNUH 3S96B 1C12B 1BQHG 1N0XH 1XFPA 3BWAB 1KCVL 2AEWA 4J3VA 4NJ9L 5JZ7D 2W1NA 3RPKA 2BSTB 4OGAD 2X4RA 1OTSD 3N1MC 2NYYD 3UXFA 1XGTA 1FLRL 3QUZA 4HS8H 2HVKA 4A6YA 2EICA 3IDNB 4PJGE 1AGCA 3SKMB 3DO7B 4DW2H 3QPXL 1T5WA 3IRZA 1NAKH 2IF7A 5DQDH 1QSVA 1Z0MA 3I75A 2X7LB 1D3CA 2BNQB 1A02N 3JUZA 4UINH 5JA9A 3RGVD 4MCZB 1PKOA 2EXWD 3OG6B 1TJGL 3VXMB 4XBEH 3NPSC 5ECJE 3Q2CA 4ESKA 3QCVH 4PLKD 1DLHB 5ADPH 4RFNC 2BVPA 4RX4D 3S3SA 2JCCE 1KC5H 4LIQL 3DETC 4NNXB 4H25B 4CVZA 3HPLA 4Z7NF 1L7IH 1KIQB 3QUXB 5FGSA 5E99H 1FE8H 1GL4B 1N6QL 2DQEL 4ZTPL 5ISZE 3UBXG 1YEEL 1B6DA 1F6AA 2VZUA 4MMXC 5DVMA 1BQLH 2H1PL 1GOHA 5IVXA 3TO2B 2VR9A 2WLZA 3VFNB 4TULH 2NTFA 4U05A 4GW4B 5FO8A 2Y9RT 3DRQB 2WMPA 3KXFA 5E0QA 5TH2A 4YBQD 2IALA 4XAWL 2C3XA 4ODHH 5BMFL 5C0RH 2P43B 3EO1B 1UACL 2LU7A 1WWBX 2A0LD 4YQXH 3M07A 4MNGB 4GRMA 3SE9H 3VGAB 7CGTA 4KK9D 4NWTH 2ZG3A 1QBBA 3FN0H 1WBXA 3G9VA 1SYSA 2Q76A 5JIIA 3NIDF 2VLRA 5E8PB 4NP4H 3U1SL 4LLWB 1GGTA 2V2WA 5T5NG 5KSAA 4ZDHA 3BPOC 1JWUB 3V6OA 4D0BA 3OKEA 2RAMA 3A0OA 3P73A 4XC3L 1U3HB 4FABH 2HT2D 1IAIM 5MEOB 4UBDD 4QHUB 3EGSB 2PTTA 2RCSL 2X4OA 4MA8H 1PG7W 1KJ2A 2WQ8A 5D7IE 5HVHC 3QEHB 3HC3H 1NMBL 1FVDA 4FHBD 5LXGH 1KN2H 2G5RA 2WK2A 3QRGH 3R0MA 4YBLC 4LHUD 4GG6B 1PJ9A 4FZEL 5SWZB 4LSQH 5BW7A 3G6JE 1ZLUK 5IHUH 1GGYA 3DV6A 3IJHB 3PG2A 3IXTA 2NX5D 3RWDA 1B4JL 4TOYL 5GGTH 4PREA 5EWIH 3OHXA 4MB4A 2HMIC 2Q8BL 4Q2ZB 1JWSB 2ITCB 2F5BL 1X9QA 5EU6D 2CKBB 5DQDL 4ZXBB 1G7QB 2HJKB 5CSZA 2EIDA 4RWYH 2W0FA 5CILL 4N1CA 5DJYB 4G8FA 1CGTA 2GJ6B 4K7PH 3MGTA 2ICES 3KPQA 2P24A 2ZUUA 2CRYA 4APQA 4AZ8A 4HULB 5GZOC 4UZGA 2NY3C 1JYWA 4NQXB 3IDGA 5DRXA 3SDXB 5FV1L 4D9LL 3UAJC 4WU5B 2XRAL 1CGWA 1YJDH 1ZVSB 3H9HA 5KVEL 3WIIL 5HJ3B 2YPVL 5FDWB 3PWUA 5BRZA 5B8CC 4PP2A 4KXZH 5IB1B 1PD6A 4LF3B 1KELL 1EK3A 5DJ0B 1C16A 4DGVH 3OAYK 4G6AC 4FXKB 2GK0B 3DSNA 3I9GH 2ZOKA 5D5ME 4M6AA 4JFFA 3O6KL 1NSNH 5T5NF 4U1HB 1OPGH 5C2BH 1MIMH 1UJ3B 4LSUL 3TWCL 2VO5A 4P4KD 2YPKB 1HXMA 4P57B 4PV9A 3F7RA 3HA0A 4BQBA 1U91A 4WUUA 2VAAA 3DBXB 2PO6B 3QWOB 3DROB 3WLBB 3PQYB 1CE6B 1LO4L 1HI6B 1W0WA 4KFZC 4PGBB 4WFHD 3DX6B 4NWUL 1MFBH 2FHBA 3KYNA 5FYKL 4BSVB 5EC1B 2BY1A 1FNFA 3SE3A 1OWRM 4UTAH 2OMBA 2EC9U 2AI0H 5IW6A 1EMTL 5ISZD 5C7XL 4LVHC 2VABA 4WI7A 3CX5J 3SQOL 2H41A 5CP3A 4YIQA 2YA0A 4QWWD 3HCVB 4JKMA 1K3IA 5C0IA 1SYVA 2DOCA 1AIFB 3SDDA 3MTRA 3T4AA 3S36H 1IZKA 3UTOA 2EDRA 2NY0C 2OMNA 2EIZA 3LCYA 3VWKB 5C6WH 3GGWA 3K4ZA 2EDFA 4NJ9H 2DB8A 5DMYA 5LXGL 3AS1A 1CVSC 2FO1A 4OBRA 4IRSB 4JRXB 1EEZB 3S88H 3O4OC 1VDGA 3VRJA 4YO0B 5IMOA 4YHLH 4GRWF 3V4UL 2V6HA 4GXVH 3C2SA 5GRZA 1Q72L 1GC1H 3PE9A 4IIQA 3RWIB 4C56D 2NX5E 5HYSA 3JV6A 3MUY1 4NQSA 5I74B 5E7BA 5J6GA 5DRWA 2DF3A 4Z7UF 2VXTL 1DQQB 4TRPH 2VC2H 4GW5B 3PHOB 1GPOL 1A4KA 4HPYH 4QXWA 3B9VA 4GMTH 1M7IB 4HLJA 3HZKA 3T0EA 3FFCE 4IJ3C 4G7VL 3C60D 4OD2A 4K7FA 4HH9B 2D7NA 2QL1A 4N0YH 1VFAB 2J4WL 1SY6A 3CVIH 3KXFD 1NCUA 2C7UA 5FHBH 1MAKA 4NQDE 4RZCA 3TBVA 5T1LA 5ITBH 4J6RH 1IEBB 4EI5D 4ZTPH 2EE2A 4L8BB 4WDIB 5A3ID 4HJGA 1MCCA 5FYJE 2VKWA 1BZ7A 4X7FC 2G5BA 4XI5C 4OJFL 5B38B 5DA4A 3B4NA 4XCNA 3ALWA 4JDVB 4X7SL 5DD0H 3FFCA 3QQ4B 4YAQA 3I02B 3X11A 1Z2KA 3RHWK 4ERSL 1U8QB 4L3EE 1RAMA 3BE1L 1HHKB 3HHRB 4HWZB 4S2SA 1LP9B 1YEJH 5FYKU 4NWUH 3JTTA 3LKQA 4K3EL 1EIBA 1LEKA 1KCUL 1T1WB 4N0FA 2OJZH 4ONHB 4NOFA 5L0QC 2ADJB 5C7XH 1EXUA 2Q3ZA 3HFML 4F9PC 2AJSH 3BFOA 2CLRB 1T04B 4QRTA 5EO1B 1R24B 1AGDA 3LN5B 2KUTA 2IANB 2EYSB 3BZFA 5CD3B 3BGMA 3HUJB 2BX5A 4P23D 4HEME 5TDOB 1MCEA 1QVOB 4XPGL 4NC1C 3GJEA 1F4YH 1PSKH 4WTZG 2DKSA 2CDGB 1NC2D 3HC3L 3C5ZB 5HHNB 3TA3B 3P4NA 2XTJC 3HE7A 3UX9B 5I2IA 1MJUL 2V7NB 4N68A 3CFEA 3MRCB 4S1DD 5EC2B 4KI1A 2PYEE 4M7LH 1P7KB 4M62H 4WHYG 4RMSA 1HIMH 2VN7A 4NJAL 1Z6JT 4WHTA 1IQWH 5DSCA 3UTSE 3VI4F 1A5FL 2G9HA 3TZVA 5I71B 1F4HA 1RZFH 2BNRA 2ZG1A 1B0RB 3G5VB 4TUOA 5HYJB 5CILH 4OCXH 4CL7A 4K07A 3DMMA 3MV8D 3KWWA 2ZWLT 4YDKH 3LB6C 5CJOH 1U6AL 2XKNB 1JZ8A 3MRLA 4RFNB 5D2NE 1DUZA 4Y1AD 5DEFA 3S4SG 3U4AA 1CE1H 2CMRL 4RCAA 4HUVA 3QEGH 3IF1B 2CO6B 2XXMB 3MNVB 5J0BA 3X3FH 4D8PA 4NNPH 1MCDA 1OW0A 4IBLT 1FVEA 2PO6D 4G9FB 1Q9OA 3HC4L 3QXTA 4AM0A 1A3RH 2Y36H 1JGVL 1CD9B 2YUXA 2YRZA 4I2XE 1PKQA 1BQHA 3F58H 2QADD 1HHJB 4QYOB 1I1FA 4WJ5B 4EQ3A 1F2QA 4EZMA 3I6LD 2DQHH 2DI7A 5CIPA 4N8VB 5C09E 35C8L 3QO0A 2VQUA 3U0WH 1R6VA 4WWKB 3GMNB 4Y4FC 2F53A 2R1WA 3QR2A 4LEOB 4XPHH 3NACH 4F7PA 2EEDA 3VFPB 2X4TA 1OL0A 3VDAA 1GGCL 5ID1B 5JHDD 3WDIA 4QXGL 2CO7B 4P9HC 1L7IL 5TDNA 5E99L 3MRJA 1OAKL 3WN5B 2QEJA 1A7BA 4HUXA 5L2KA 5JORB 4OCWL 5C0BD 4Q9BA 2JTDA 1RUAH 1ZHKA 1T2JA 4CMHB 2H1PH 1I3UA 1FYHB 4FQ1L 3S96A 4N5ED 2I24N 3B9KC 3J7HA 2LTQB 2V2XB 5I8OL 2BSTA 3L5IA 3BP7B 2IADB 1CGSH 2X4RB 1E6JL 2O93L 2XKUA 3OSKA 3WO4C 3QUZB 2HVKB 3CJJA 3OAYH 4A6YB 1Z3GL 3EIFA 3IDNA 1GJIA 3SKMA 3DO7A 2VLRD 1JHLL 4HIHA 2P5EE 1KTKE 3FAWA 4N9GB 3NIFE 4J3TA 5DD3H 2X7LA 1GC1L 3C60A 5KAQF 2BNQA 4K9EL 3AS2A 3WYRA 1I1AC 2H2SD 4LBEA 5E9DE 4MCZA 4EBQL 5F6HI 3O4OB 5A3IC 5JHDB 1KXTB 3VXMA 1EFQA 2BOCB 5E2UL 5FKPB 1DLHA 3KPPA 1IILE 1R5VA 5DWUL 2D0HA 4NNXA 3KLAB 2F8VA 4H25A 5GS0C 4OI8A 3Q6FB 3LQAH 5KZCD 3DVGB 3FHAA 3F7VB 3ZHDA 3QG7H 4JGJA 4F57L 3SDCB 1YEHH 4M1GL 1TCRA 2EDTA 4NQCD 5IEHB 1FYTE 4KQ4L 4PG2A 1FFQA 1X5FA 2BHYA 4U1MB 4X6CA 3MLPA 4ACPA 5IVXB 1AR2A 3TO2A 6FABL 4DUWA 4PJ8A 2NTFB 3MV9B 3V6OC 1H3PH 4PJCE 3DRQA 2R0LL 5TH2B 2FGWH 3T8XA 2IALB 3N1QC 1J87A 2Z93B 1EX0A 1A7OL 5DUBA 3EO1A 4WWID 1FGNH 1HCVA 2NY2C 4KZEL 3QIWD 1WBXB 3E8UL 2PR4L 3TF7C 4J2XA 3LS5L 1I1YB 3IXAB 2VLRB 3EBAA 4NHUB 2DQUL 4LLWA 3NACL 2V2WB 5HHVL 5KSAB 5KTEH 4ZDHB 4OF3A 3E0GA 4PJCF 5BQ7A 2VZVA 3U9PH 5CZXC 1MLBA 3CDGB 1U3HA 1H5BB 4Z77A 5MEOA 2QQKH 4QHUA 2CKBL 3EGSA 4YEFA 2ARJA 3SDCC 3QNZB 4RMQA 4UT9L 2UY6A 1A6WH 1BX2B 43CAB 1KJ2B 3QEHA 3HE6D 1MCSA 1B6UA 3TJEH 4Y2OA 2IQ9L 5SWZA 1NGZB 5GSVB 2R15A 3SOBH 1NLBL 3VFRB 2J6EH 3U0TB 3EYOB 3IXTB 2H45A 3MFFB 4ONGH 4Y4KC 4DKDC 2OZ4A 1AGEB 4WEBH 1ZANL 3OHXB 4Q2ZA 3D0VB 2CKBA 4ZXBA 1QG3A 1G7QA 1VACB 2HJKA 5CSZB 3MV9D 2BSED 1T1YA 2W0FB 2YS4A 5DJYA 5ALCL 4G8FB 5TFSH 1YNKL 2P5ED 1BIHA 5GSRB 3MGTB 4YUEH 2P24B 5IHBA 4OCXL 3K2UL 5I1EL 4W4OC 5F71A 5IWLA 1Z9MA 4NQXA 4HV8B 2FHCA 3MOAH 2X9XA 3SDXA 4X4ME 5CEXB 3WKNA 1KJMB 5LCVH 3H9HB 1ZVSA 3F7QA 2XN9B 5AAMA 2RGSA 3PWUB 1PDKA 1U41A 3L5WA 4P49A 4PP2B 3RIAK 3RL1A 5KSVB 1X5XA 4LF3A 1AY1L 4JQXC 4KHTL 5HI3D 5I1KL 1AD0B 4KQ4H 4FXKA 1BBDL 2GK0A 3U4BL 1NCBL 2JJSC 3GK8H 2ZOKB 4DGIH 1NGPH 2IWGA 4RBPK 4JFFB 1I8LA 5DC0A 1F45A 3LY6A 4ZO9A 4OB5L 1HHHB 2NY5H 1HXMB 4Y4FB 1A0QH 5EO9A 3ARPA 5TDPB 2X4NA 1U91B 2W9DL 4WUUB 2VAAB 2MSPA 1XMWA 4YHPB 2PO6A 3QWOA 5F44A 3PQYA 1VPOH 1HI6A 4PGBA 1DL7L 5C86A 1F3JA 4R90H 4A2LA 1VGEH 1NGYA 3Q1SH 1Y0LB 4I2XB 5EOCJ 3SCMC 1JGEB 1C5DB 5JTWA 2VABB 32C2B 5EN2A 3C87A 2C4FU 3MV01 3JVGA 4HQQL 5D6DA 1NAMA 3QG6B 2OZ4H 1EHNA 1SYVB 2X1WL 1AIFA 3SDDB 3T4AB 4H8WL 3C08L 1IGMH 1U8HA 4LVEA 4ZNCD 2EIZB 3VWKA 1XGRB 2OL3B 1RIUH 3L3DA 4PB0H 1E6OH 5IQ9B 3O3EB 4G8EB 1P4IL 2YD4A 4X6CE 1EEZA 3E6FA 3QYCA 3BE1H 4YO0A 3VXRA 5IMOB 5BXFB 2V17H 1U8PB 5KSBA 1TZIA 1ZANH 5IR1A 3RWIA 4IIQB 1U8IA 2ZJSH 1X5AA 1U8JB 4PD4J 1B90A 2OP4H 3T4YB 1S5IL 3FO0H 1E4XH 5J6GB 2YRLA 5DRWB 1J5OH 5F1IA 5TFSL 1MWAL 4GW5A 3NA9L 1XH3A 3PHOA 2AJZB 2P7TA 4OLYH 4MJ5B 2DKUA 1XR8A 5DJ6A 4G42B 4S0SD 3OKOB 5D71L 2IMNA 3JWOH 4K7FB 4TSBL 2YPLE 4WUKH 1NC2B 1K3ZA 3OAZK 1VFAA 3U9UA 2R1XB 4N5UA 3V79C 1AGFA 4I4WB 2C7UB 3TGXA 3MODH 4R97C 4RZCB 4D9RE 5T1LB 2I27N 3T3ME 1WEJL 2AXFB 1UM5H 2XY1A 3W9DA 3BSZL 4L9DA 2XACC 3T2NL 3GIZH 4L8BA 3RAJL 5BZDA 5DUPH 4S1SH 5H94A 2G5BB 4ZNEE 2WANA 1JZ6A 2Z8RA 4GLRH 1A7RL 3DTXA 4RGMC 3STZA 3T1WA 3T1FB 1KXVC 4JDVA 4I3GA 2R0LH 3FFCB 3BRGC 3I02A 2B4CL 4OZFA 4KJWC 2PTVA 1NEUA 3INUL 3ILQC 1LP9A 4S2SB 1T83A 3GRWH 1KCRL 4JY5H 4KAQL 1ZA3B 2R29L 4FRWA 3LKQB 1U6AH 1BVKB 4OTXL 2X6MA 1DBKH 4X6EA 1T1WA 5C6TL 4N0FB 2DLFH 1IZJA 3EJJX 1EXUB 1RVFL 4LHQB 4LSTH 4AEHL 4OF6A 2CLRA 5DO2D 4ELMA 3S7GA 5A1AA 2R56H 3FB5B 2IBZY 3QEUA 4YXLL 1R24A 2Z31A 3QIBB 4NBZB 2IANA 3BGMB 3VWJB 1IC5H 4HJJL 1KCVH 5EBLA 4EVNB 3GJEB 4M9OA 2VDOH 1T03L 1MI5B 2DQGH 1N5AA 1AGBA 1XEDA 1JF5A 4KVCL 1G9NH 1RIUL 5HHNA 4GBXD 3TA3A 1YEFL 4HS8L 5GGVL 1N2RB 4QWWC 3SGKA 3CSBA 4XP6L 1MF2L 1IGTA 1MHHB 4DW2L 3BEVA 2X4UB 3MRCA 3N1PC 5EC2A 4PGCB 3D87B 3P4LA 2JJVA 5GS1C 2HT3C 1X7QB 2GK2A 3IFNH 4WHTB 3SGDH 1XF5A 5E8NB 2HN7A 3G5VA 4TUOB 2FATH 3WUZA 3TFKC 2ZZUT 4W70A 5LBSH 4E0RA 1BIIB 4U6TA 4YUEL 3KWWB 5TQ2L 1CI5A 3LKNA 4O2CB 4JVWA 5I75B 3MV7E 5ICYA 3MRLB 5CP7A 4Q58C 1V7ML 3D6GA 4F7MA 3EYVA 4FQ1H 3RZCB 5DEFB 4AL8H 4X6DF 3I85A 3MFGB 3CNKA 5BS0D 4GG8B 4OUUA 4AIOA 4FTVE 2YR3A 1CFSB 4FFWC 2E7CA 4OFKA 5EIQA 3IF1A 3MNVA 1A3LH 4ZO7A 3O9WC 2NZ9D 1AY1H 1A1OA 2RJMA 4KHTH 2X05A 3CSYB 5DK2A 5DK0A 4G9FA 4QNPF 4KROB 1Q9OB 1SJVA 3T04D 4OLUH 4WCYL 4AM0B 3DUUB 4JM2A 3I3BA 3GEWB 5F7YC 1BQHB 1HHJA 3SE9L 4S1DC 2PW1B 2MPAH 1VESA 5JW3L 4I48B 3AC0A 5CIPB 2DM3A 2JJUA 1UWGH 2N56A 4WWKA 3MRHA 3VD7A 4X4ZA 4OF5A 5C0DA 1AE6H 2RFXB 2R1WB 1TZGL 4FZ8L 3VFPA 2WBJC 4FA8A 4M03A 4BQ8A 5I73C 5J4MA 2RB8A 1OLZA 1DLFH 3V6BR 2HAZA 5KSBE 3WN5A 3IRPX 3LS4H 4Y2DD 1EHXA 4YDLB 5JORA 4M6ML 5A40E 4G3YH 1ZHKB 3JV4A 3ME0A 3BMVA 4HZAA 4FMFA 4OF8A 3U46A 3H42H 2V2XA 4H8WH 3BP7A 3C08H 2IADA 3TYFB 5EU3B 1UCBH 1Z9OA 4JFXA 3G6AA 5BV7L 4F80A 5K59E 1AXSB 1YUHA 2MKWA 3KPOA 5HGDA 2OS7A 2CGRH 3GJFH 2I60L 4HIHB 4DCQB 3HC4H 3VFOB 3MR9A 1D6EB 1I3RB 4N9GA 4PJXA 3ZTNH 3C60B 5D7JD 2L7UA 1OQOA 3EYFA 4OCRH 3MLYH 4ZXBC 3FB6B 3MLXL 5HSFA 4LBEB 3EOYG 3DVIA 5JHDA 1KBGH 1NGWB 2APWA 2BOCA 1EH9A 1QYGL 5H35B 5J11B 1IGIL 5FKPA 1NUGA 1PZ5B 3KPPB 3U7YL 1DVFA 4Y19E 2AJVH 1R5VB 1FV1A 2V9QA 3FQRB 3WD5L 1FNHA 3KLAA 1N4XL 1VSCA 3Q6FA 1KXQE 3DVGA 4PJDB 4NQVA 2W9EH 1WZKA 2R4RL 2HYMA 2XZAL 3F7VA 2NY6B 3SDCA 2IEPA 1MFAL 1S3KH 1TCRB 3AGVA 5IEHA 2B5IB 3F8UB 4X6CB 4U1MA 1L9NA 4TSCH 4PJBE 2V7HB 3QUYA 2EKSB 4FP8L 2CIKA 4PJ8B 3MV9A 2ZCLH 4U3CA 4XBPA 1YY8B 1CGSL 2R0WH 3T8XB 1JPSH 2Z93A 4YFLI 5DUBB 3GKWL 3QI9C 1YQ2A 5B4MD 5T3XD