1NAKL

Igg1 fab fragment (83.1) complex with 16-residue peptide (residues 304-321 of hiv-1 gp120 (mn isolate))
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DVVMTQSPVSLPVSLGDQASISCRSSQSLGHSSGNTYLHWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTFKISRVEAEDLGVYFCFQTTHDPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83.1 - light chain
publication title Recurring conformation of the human immunodeficiency virus type 1 gp120 V3 loop.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2002-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nakL01
3QI9B 1KENL 3I50L 4N8VG 1KCRL 3P73A 1IQWL 4UQ2A 4YHMH 1FSKC 3ROLB 3G5XB 4NO0A 1V05A 5GGQL 4M43H 2OZ4L 2NTSP 3PHOA 4ERSL 2HRLA 2CQVA 4MLIA 1MAKA 1NLBL 1CR9L 4HHAA 4XCCH 4LGRB 5JA9A 3PWJB 4KJPD 3MBEA 4GSDH 1U3HA 2W91A 3BKYL 3MZTA 4X6CB 1B0RA 2VXSH 2BC4B 3E8UH 4RMQA 3QFJB 2X4NA 3AU1A 5C08B 4MNGB 2YA2A 3AXLA 1OGTB 5I8CB 1HNGA 4LOUC 3V0WH 2IJ0C 3ULVL 2WBJC 3VXNA 2VISB 1LO5B 3FFDA 1W0YT 2ED7A 3JV4B 1OWWA 1TZIA 4LIQE 3IJHA 4W6XB 4NSKA 4X9FA 3UJTH 3QDGA 3KNBA 3GSNB 4GSDL 3ZMRA 3P9LB 4QT5A 2IALB 3CXDH 3W11D 1G7QB 2C4XA 3KPPB 5DMGD 2P46B 1FJ1A 2HT3D 5JMOC 1L0QA 4A2LA 5JIHA 5C0FB 5LBSL 5HPOA 2AXGB 5GGRY 3D39A 4WNQA 4P2QA 1PZ5B 1NMBH 1DDHA 5E9DE 2DB8A 1FVCA 3P9WB 2EDOA 3HC4H 4FFZH 3QZWA 4CDHA 4I4WB 5I66B 2X4PB 4PGDA 4KKLD 4UILH 2CRMA 1ZA3A 5K9KB 4Y88A 2D0FA 5D93B 4M6ML 3VD5A 4M9PA 5D7IB 4QTHA 5F88B 5GS2H 3VWJC 3R06B 4NKDB 4C4KT 1CS6A 1H5BC 4PJXA 2YK1L 3LKOA 1INDL 4HUWA 4DAGH 4YHPA 3QDAA 4RWYH 4PJ8C 2BNRB 2EE6A 3BKCL 3QT2A 4QRTA 1ZLVK 1S9YB 3VFRA 5HYFA 2IAND 3P9MB 4Y4FB 4B53A 3GMRB 3T4YA 3MA9L 2H2PC 4J6RH 4G3YH 4HG4K 3L3OA 1OP3H 3U4BH 3DTXB 3P4OB 3QZWG 3E6FA 4OZFB 5L2KA 2BCKB 1Q72L 1X5XA 3TA3A 3VXUA 4ZXBC 2DI9A 1EUTA 4IIQC 4LRIA 2PXYA 2WBJD 3CU1A 4KPHH 1NQBA 2W0FA 3QPXL 2DM7A 4L8DA 5BXFA 2X9XA 1AQKH 1AXIB 4PJBA 4PG9B 1I9RL 4Y2OA 5JR1H 3KWWA 5IIEA 4H0IA 1CLYH 3NOIA 5FF6B 4K3GA 5DJZA 5KS9A 1YEEL 4GKSB 4DQOH 3MBEC 4MQTB 1IGFL 1KJ2L 4QHUA 2BSRB 3H8NA 5HGGS 3IFNH 3MJ6A 4F3FB 1N7MH 5DEZA 3SKOB 5KN5B 2FWOB 1UYWL 3EYQC 4NQCE 3KYAA 5EZOL 2QTEA 3L3GA 4AIZB 3TEUA 3ZDZF 5I71B 1DQTA 3MLVH 4G9FB 1EGJH 4JB9L 5D9SB 1LK3H 2NNAB 2VOTA 1B90A 4OF5A 2ZOKA 1IGCL 2PO6C 4NQSB 3SJVB 2ERJB 5GSVA 2AXFA 3EYVA 4DQOL 3VFOB 3PV7A 1CL7H 2FL5A 5ITBH 5HHVL 1I7ZA 1I8IA 1TIUA 2FH8A 3IFNL 4QXGH 3QXAA 4PP2B 1P7QD 1AKJA 2DQFB 5IQ9A 1E28A 3VXSE 1FO0H 2DQIH 5HDBE 2C1PB 4NWTL 3U0PB 4M1GH 2ZUWA 2H2PD 3OAUL 2DQEH 4XZUB 5B3NA 4EQ2A 2YPKA 4UNVA 4PJ7F 3BRGC 1RUKH 3MV9B 4KI5E 1MHHB 4L4TE 3QIBC 1D9KA 4LHUB 5KVDL 3HNVH 3FN9A 1MJJA 3DRQB 4OQ1A 4ZXBD 1KTLA 2MTPA 1T6VN 1BVKA 1J1XH 3PDOB 3B8SA 1NMCB 1A4JB 2BFVL 1LILA 4JFDB 3U36B 4E41B 1XH3B 3NCJH 4PJ9C 1A1MB 1F8TH 1NDGB 1YY9C 3AVEA 1OP3K 1JGVH 4U1IB 4CGTA 3UP1A 4DGIH 4GXUM 1W72A 1RJYB 1T4KB 3IDMB 3MBED 2YS4A 3VRJB 4OT1H 1N26A 1A21A 1RUAL 4M7LL 1EAPA 1MAMH 3LRSB 3NCJL 1QYGH 2ZCKL 5J11C 2PXYC 1HIMH 2B1HH 3IXTB 4HGWB 1UEMA 2A6KA 5CIPH 3FB7A 3LEYH 4QRQA 2D7PA 5FO8B 5FO7A 2PO6D 5GGSY 2W60B 4K23L 4P4KA 5JDJA 1RJLB 3GM8A 3BGMA 5ICXA 1XGYH 1C5DB 1I1AB 2J88H 2F54B 3C6SA 2G2RB 1SBBA 3EGSA 1KTDA 1MAML 3G5VA 3EJJX 5SWZE 4DGVL 3V6ZB 1HCVA 2VITA 5C1MB 1YUHB 2B2XL 2D4DA 4LF3A 1ZOXA 3MYJB 1DLHB 3CCHB 4CMMB 1LEIA 1WIPA 2PYEE 2GJ6A 4G6KL 3GSXA 4P2OB 2MOVA 3L5WB 2NW3A 5C2BL 1H3VA 3CFEA 3LS5L 4M4PA 1MCBA 4N1HB 4BKLB 1MH5B 5DD5L 1RZGA 1U8HB 3MJ7A 5TQ2L 3U0WL 5FB8A 3BRFA 2AK1H 4WWID 3ALPA 4YWGH 2J88L 3PQYB 3DUSA 4KUCF 1S7VB 4JY6B 2IEPA 3ULSA 1P5UA 1UXWB 4S1QH 3F7VA 4J3WA 3F5WA 3S9DB 3FMGH 1TVDA 3T0EE 1LNUA 5L6YH 2DYPA 4MAYC 4PJBF 4C83A 5I1GH 2UVFA 3C6LC 1Q9LB 2DJSA 4HWNA 2VDQL 4HGKC 1JGUH 2R1XB 3OKLB 5L2KD 3CDYA 1UB6B 1JPTL 3DGGB 3LN4B 4ZFGH 3LEXA 3ARFB 4KUCD 2H8PA 4S0SD 4FQIL 4X9HA 1PEZA 4LLMB 1EFQA 5SWQA 2YPVH 2H9GB 4DFHA 1JRHH 5GSRB 4ORZC 4JHAL 1MVUA 3HNSH 3B9KB 5E6IB 3JV6A 2PXYD 4OD2B 3D0LB 5EN2B 1NEZB 4ZD3H 3GIVB 2VDNL 5MENA 4BA8A 1QNZH 1LD9B 1S5IH 4DCQB 4XGZB 4I0KA 2VNCA 3KPNB 3T3MF 1HZHL 3KYKH 4NKQB 1HQRB 3V6FA 1QBAA 4OBSA 1J1PL 2A6DA 3H7LA 3EJZC 2YPVL 3MRKB 1T0PB 2FO4A 4R97B 1KJVA 1FDLH 1MJ7L 5CKAA 3M07A 1BPVA 5CILH 1BMGA 3L95B 1ZAGA 4I18B 3D85B 5I1LA 1AGDA 5A16B 1WC7B 2RFXB 4AL8H 4EUPB 3F65A 3Q5OA 4JG1L 3CC5B 2CUIA 3N9GL 1LQSR 4JRYB 1FZMA 3HCVB 1C8PA 5TE6L 1AKJD 5SWSA 2HFGL 1Q9KB 5BZDA 2DQTH 4MAYD 5F1KC 1FNLA 2BDNH 4Z8FH 4IM8A 5D6CA 3I6KA 3W82A 4E9LA 5EBGA 1FNSH 5I1CL 5TGBA 1F5WA 3DRTA 1PKOA 3I3DA 4O2EA 2J8UE 1D9KD 4O58H 1FYTA 2QKIB 2AGJH 2KBGA 3I2CL 1ORQB 4BUHA 5J12B 4P2RA 4NGHH 1TZGL 4YAQA 3HS0A 3KPSD 1PDKA 3IDUA 4GAYA 2DQTL 1DLFH 5H37H 2BDNL 2VLRB 5E2VL 3MGOB 2Z93B 5C0NC 3B3IA 1FNSL 5AWNL 4I8DA 1M6OA 4MWFB 4JRXE 3ZKNC 3VH8G 2E7MA 4L29B 2VQ1A 1G9MC 2R0WH 3EJZD 3SCMC 4JO4H 3P3YA 2R4SH 4X6FB 3W81A 1JF5A 3HR5A 4QRRE 3T4AB 5D1QC 5DJYA 4L3EB 3OKYA 1LO2H 2R9HC 4JFPB 3VGFA 5JXAL 2C4FU 5EORL 3WHE1 4PBVC 4S1DD 1T5WA 4AEIL 3GSVA 1ADQH 1ZT7B 2GTWA 4RGMC 5HYIA 5MEQA 5J4MA 2MQ0A 1KPVB 2VL5A 3SGDH 5F7FA 4P4KD 4EQ3A 5I6XB 1MCFA 5C07A 5EU4B 3SDYL 4QHMB 2HKHH 2X70B 1CGSH 3QEQE 4X80L 3LN9A 5C8JB 4OAWB 1XF1A 1S9WA 3AY4A 1MLBB 3ARBA 4H26A 5I0DA 3HZVB 4PRIE 2VXTL 4UUJB 2R2HA 3H42L 2GT9B 4K3DL 4PY8I 4A6YH 4KI1A 4LPTA 4XVJL 1ADQL 1QQDA 5CJQH 4OCYL 1IGML 4NBYB 5I19H 1WFOA 2YEZA 2R0LH 3H9HB 5GGSA 1JI1A 2F74B 1MUJB 3BSZL 2HKHL 1BJ1H 3QUMB 3MNWA 4HXAL 1ZGLP 1T83C 1I3RA 4MA1C 1INEH 3H0TB 3QEQB 4LSSH 5AZ2H 4KROC 3VFMB 3MJ9L 2NX5A 5EFIB 4NQUA 4ELMA 3SDDA 5FUOL 5C0ND 3X3GH 3F8UB 3DURB 5ESVA 2DYPD 2GSGA 3K8MA 2E9IA 1OAZL 1C08A 3ZKND 4PY8J 4F7MA 2OK0H 1MQKH 3AGVA 5I19L 4ONFL 4R0LB 4OQTA 2A77L 4XPTL 3SCMD 3LAFA 4XXCC 1HHIB 4ODWA 2A83B 1IGJA 3W0WE 4G8GA 3O4OC 1G6RL 1RJZA 1OHQA 1FHGA 2F58L 3FRPA 2CPCA 3OKEA 5AD0B 3CGTA 3JTSB 3B4NA 3UMTA 4PGBB 5E8DL 3MLSL 1NGPL 2OR7A 4PBWD 5CSZA 1QFWM 5HSFA 3P77B 2R23B 3GK8H 3QWRD 1F2QA 7CGTA 5IVXB 3SPVB 2GEEA 5AYQA 2IFFH 2FR4A 3CVHH 1NCUA 1J0YA 4NKMB 3LV3B 3HE7C 2YD4A 4GW4B 2UVEA 1CD1B 3D25B 4YBLC 2P5WE 2DOCA 5MEOB 4MD5B 1N2RB 3AREA 2FO1A 3GSRB 5FUCC 1MFAH 1BECA 3FRPG 3IF1B 4S0TD 4WJ5B 5MP6H 43C9B 5INDB 2V7HB 2GW5A 2GK2A 4RGNE 5A2LH 3L7EB 5DT1L 2F15A 1JZ4A 4ZPVA 1EA9C 2ILLA 3TO4C 5TDPA 5JTWA 3U4AA 2YWYA 3RWCA 3OKOB 3LQAC 4KROD 2D03L 1FORL 3WFHB 1HYSD 4NKOA 2N4IA 5F6IC 2JJTC 1EERB 4S1RH 1MFAL 1H15B 4LCCB 1DQLH 1T0MB 2IBZX 2Z8VC 5GS3A 3K0WA 4NUGH 3NACH 3EFFA 1BEYH 2CDGA 4QTIL 4WW2B 3A67L 5C0BB 2MSPA 5ACZA 1FYTD 4LFHG 1H3GA 2FJHB 4L8SA 1B3JA 4P2RD 1GC1L 5KSAC 3BP6B 4MJ4A 4PJEB 4PJAA 5I18L 1FBIH 3UTSB 3I9GH 4JFHE 1LP9E 1RVFH 2R69L 5C0AE 1SJHB 4R4ND 1RHFA 4X6EA 3UPRB 5E70A 5FDWA 3S96B 1JGLL 2DJ4A 5J9PB 4DN3H 3RL1B 1A7NH 2GSIA 1MPAH 3DMMB 1IC4H 2GTZA 3KS0H 1CBVH 5KSBE 4LCYB 4C58B 1JWSA 4FTVE 1F4AA 5D8JH 1J7VR 1UWEL 4R90L 3AFLA 3DO3A 5TJWK 1MF2L 3QUYC 2LQRA 3CLFL 3I9GL 2WZPD 1RVFL 3QEGH 4PRDB 3U1SH 4U2YA 3CSYA 4BH7B 4XNXH 1YMMA 4NC1E 3DVNA 1QLEL 1S9KC 2C3GA 4JZOA 3LEVL 1A3RL 1BLNA 3L7FB 1EAJA 3IKKA 3L3IB 3RVXC 1WT5A 4ODXA 1QFWL 1YEGL 4HBCH 4Z5RA 2NY6B 5F1OB 3X17A 1KLGA 2WLYA 1YZZA 2NQCA 3VU2A 1SQ2N 4JQVA 4FXKA 3GJFB 2Y36H 5L88L 4D3CL 3MROB 5I76A 2X10A 3PABB 5KG9A 3I6LE 4UT7H 1J11A 4OLWL 4JG0H 3BP5A 1ZVSB 5D4QA 4ELKB 3ILPA 3CZFB 3N85H 4JPIA 3PL6A 4F7PB 1AHWC 2J3SA 5KSAD 4I9WE 2X4QB 1OQOA 2Y36L 3QHFH 5GXBB 4JHBA 1PW3A 3D18B 3MGTB 4PLOB 1FNEA 4YE4H 3SE3C 5FHAH 3SDDD 1ORSB 1P9MA 3FQXA 5F96H 5BO1L 5B38A 5JW5A 4F2MA 4YR6B 2FIKB 2F9BT 4NM4L 5LGJB 1Z3GL 3RY6A 4WO4A 1WBYB 3MRJB 2V9RA 4LPCA 4Z7WF 2VAJA 1CK0H 5T1DL 1ZE3C 2E7LC 1F3DJ 4OCNC 4PRBA 2P8LA 3VFVB 2DQUL 2F19H 3FFCA 5DJCA 2BVUA 4ZAKA 1LEKA 4BSVA 1JP5A 2QLVB 5IB4B 4XAWL 3T0AA 3ZT5A 2QSCL 2Q3AA 3G6AB 1CFVH 1RJCA 2CRYA 5GRVL 3UYPA 5KZCD 3PWLA 5K9OB 4XX1G 1B9ZA 1CU4L 4LCWD 4MX7B 3RVXD 1TCMA 3HE6B 3QG7L 1QR1B 3DV6B 5BRZB 4JO3L 2OMBA 3O41A 5JPNA 5I8EA 1NFDA 4QNPE 3VD4A 2HN7B 4U1JA 4ISVB 5B38G 4W4NA 4M8VA 1CK0L 2E9WA 1ZLSL 2AP2A 1P1ZB 4P9ML 4XCEA 2UV3A 5ETUA 2UWEB 5FM8A 1KIRA 4HPYH 5IMOB 4YNYA 3MXWH 5HVHB 1J0KA 3FQUA 4MD4A 3NZHH 3MREB 2WWKO 5FGCB 2HFFA 4H0GA 1G7MB 4TRPH 1IGIH 1W2KT 1OOAA 4WENB 1F4HA 2AJ3A 1JHTA 3PDDA 1J05A 5DK0A 3GIZH 4JDTL 1R3HB 3CFJA 3DI3B 4M61A 5HYEA 4P46A 5D2NC 1KPUB 1DQQB 5T1MA 2I5YH 4LFHD 5K9JL 2YRLA 1S7XA 1N8ZA 2FH6A 3O4LB 2H45A 3EOTL 1GGYA 1J5OH 4YFLI 1KYOK 4PRAB 4AM0B 4AIOA 4H0HB 1QR4A 5F7WC 4ZDHA 4YHLH 4KTDH 1MFNA 1QLRA 2WIIA 3IETA 1VHPA 2CDFA 5JPMB 1YQVL 4OJFL 4PJCE 3TVMA 5HD8D 4Y2DA 3U7YH 3RUGE 1VEOA 1DBKH 1UT9A 1G9MH 3T3PF 4H5SB 1DP0A 3VDCA 4XBEL 4O5LH 4X99A 3EO1A 1TZHA 2QV2A 3BPNC 5J57B 4MJID 4JVWA 1YNLL 2NR6D 3STZB 4Q6IC 3A0OA 2R39A 4M3JA 3LD8C 2CR6A 2EEDA 5DJDB 1IKFL 1MIEL 1EEQA 1G7HB 3ULUL 3RJQB 4L5FH 1D5IH 3QEUA 4WEMB 1EMTH 3C9NB 2JJUA 1FH5H 1ZKAA 1S9VA 1QPXA 4FQCH 4O5LL 3UDWA 1BVLA 2VC2H 4J3SA 1WBXB 2PW1A 2BVOB 1S7SB 4NO5A 1KN2H 4KVCH 3BMVA 5E1AB 1BAFH 1OPGL 3PWNA 4Z95L 1BOYA 1BFOB 5JORB 1U58A 3OXSB 1A7BA 1YMMD 3TN0C 2F53B 1S7TB 1EMTL 1HSBA 5ESQA 4P4RB 2AKRB 5TDOA 2P7TB 2NY5C 3NFPB 3PE9A 3T0VA 3TBWB 3PWVA 2X5PA 3RU8L 2AJSH 4FFWC 5DJAB 1ZHKB 4KAQH 1NJ9B 2CKBA 5TQ0L 1JIBA 4PRPE 3HZMA 4FXLA 4AEHH 4TVPD 1AQDB 2NY4B 5JNYB 1UM6L 5EU7E 4GMTL 5DQDH 1MHEA 3GRWH 2R29L 4Y5VA 4PP1D 4LLVA 5GS0D 1CLZL 4FMKA 5D7LB 1AGBB 3GSUB 3VG9C 4XPHL 3C08L 3V52L 2DKMA 3QUZC 2GUOA 4ZPTB 2JLLA 2AJSL 1GGUA 4JN1H 5D2LE 1GGCL 3PL6D 3TNNB 1F3RB 2Y5TA 3K8KA 4KAQL 5BS0B 3HAEH 3QCVL 4G6JL 3QFDB 1DBJH 1B2WH 43CAB 4X4MA 1G0DA 1TJIL 3EDKA 4OZIB 1VEMA 3SKJL 3ULVE 4J4PC 4Y19A 4WWKA 2AABL 5D70L 1U42A 2IADB 3LVEA 3TVMC 3BPOB 1NCWL 1W0VB 4WO4D 1T1XB 5F1IB 2QJDA 5GRJL 15C8L 4RFEA 2H32A 4PJHF 4UOW1 1QBML 5GGTH 2PYFB 5B8CA 1IAKB 3HLAA 1QTYT 3DROA 2P49B 4KV5E 4B5EA 1P4BH 4O4YL 4XNYL 4GRLA 3FFCD 4PJDF 1JBJA 4ZAKD 3TV3L 1JPSH 1OM3H 4QOKA 5BOPA 3WSQH 3U46A 2CXGA 1YNTA 3UX9B 1FFPA 3O9WA 1AD0B 1DQJB 4FQJL 4EOWH 5IHLB 2R2EA 4ZUTB 1HKLH 5HHQB 1LE5A 4M5YL 1ZMYA 1BJ8A 2VMFA 5T5NG 3NAAH 2IAMB 3GHBL 2OXHA 5IBLC 5IKCA 3IDNB 4F8QA 3QCTL 2VZVA 2RJMA 3BPLB 3LQAH 4NZUH 3SBWA 3M1BA 4M5ZH 4N68A 1RMFL 4D2NA 1NAKL 1N59A 1VERA 4I3RH 2WP3T 5IOPA 4QKXB 4OGXH 5L7XL 1KEMH 3CFKB 4Z7UA 3MRFA 1V7NL 2FYYB 3SKMA 2ZCLL 2LE9A 5I0ZA 1HSAB 2QQQA 1HINL 4ALAL 2XPGB 3ZE0E 5HVWA 1W0WB 3F62A 1YPZE 4D0DB 1T7ZA 1SY6H 3CPLB 1A9EB 1G7PB 2EDWA 3QUZD 4KHXH 4K3HA 5CCKH 1A14H 4R26L 2GHWB 3IJSB 2DTMH 1FVEA 4YDVB 3DETC 5EU3B 4NFBA 3WFEH 3LMJL 1WGOA 1IM9B 4POYA 2XRAH 1RK0A 4XWOD 2D7MA 4U6XB 5T1LB 5FUZH 3RTQA 4UNTA 5DJ8B 5DMKB 3VFTB 3OF6A 3DX8B 4J4PD 1I9EA 1FIGL 1KF9B 2OTWB 2GYSA 3G6JA 4KDTA 1SVZA 3OKMB 1MRDL 4NFCA 3TVMD 5M7QA 4YO0B 4AJ0A 1RFDL 1A14L 1M71B 2NY0D 4E42A 4LLUB 4X4YB 2XA8H 4YXKL 1DEEA 4JZJA 3EDEA 4PJIE 4OZGE 5M95B 2VAAB 4LEOB 1S8DA 4KRMB 3BWAB 1LEGA 5HHMB 4GAFB 2OI9B 3LIZL 2C7UB 4R4FH 1J86A 1ZEAL 4F7EB 2ZOLA 5DJ0B 3IT8D 4L9LB 4V2BA 3PIQA 2Y7QB 4X7CC 5GJSL 4XHJC 5IBLD 5DHYA 5FECB 4M8QA 4OQTL 1P4IH 5E4IA 4D0BB 3RVWC 3QIWC 4L4VB 5HHPB 4R7NB 4RMUA 3M17B 4C56B 1VPOH 5IF0B 4EDWH 4Y1AB 5IESL 3Q3GB 4R4FL 4NJAH 1KJ2B 1WQVT 3NFSH 3GBMH 4KRNA 2P24B 1HQ4A 5GPRA 1TETH 4I3SL 1UKSA 4APQA 3WFBL 3BFOA 1FNAA 4IRSB 3DETD 3UTZB 2WINA 2ZUXA 3VI3E 2DWDB 4JHZA 5T3XH 1U41A 5C0CB 1KT2B 3J7HA 3L6FA 1RZJL 5HHNB 4F37F 3P0GB 4OSUH 3EBAA 2P5ED 1UWGL 1MLCA 3MLWL 5IR1B 3RL2B 1LO0L 5I1DA 1GGBH 1LVEA 2GCYA 3NFSL 3QRGL 4F9LC 3DX7A 1TETL 4FQQB 4G6ML 4BQBA 2NLJA 1IBGH 5EUOF 3QI9A 2XI9A 4Q9QH 5JW4Q 2O5ZL 5B4MD 3WN5C 3N1FC 4YDKL 2E27H 3ROLA 3QDJE 3G5XA 3KYNB 2QL1A 3FONB 4IDLA 4YIQB 4AQOA 4W70A 3MACL 3OGCB 1KPRB 4OZHF 5L2JB 1EZVX 2AJYL 1U8OA 4DUXA 1GGBL 3QNYB 4L3CB 3B2UC 3OSKA 5E5MB 2VDKH 2KH2B 5I75B 3Q1SL 3PWJA 5IMLB 2VLLB 4WV1B 1I9IL 2JE8A 1KCUL 4XHJD 3EIFA 4DVBA 4Y19D 1TJGL 4BFBD 1FO0B 1NSNH 1I3UA 4HDIA 1YY8B 2E8YA 4PJFE 3C5JB 2G60H 2D9QB 3IRZA 2BC4A 3GNML 4BFIB 4MXVE 1UJTA 3MV8B 3QFJA 5C08A 4CRPA 4MNGA 2R2CA 1IL1B 4HIJB 1I1YB 5I8CA 1D7FA 3EYOB 2DM3A 2VISA 5EC1B 1EHXA 3JV4A 5CGTA 5DQJB 4WW1B 4JDVB 5IJKA 4MDJB 5F8RC 3GSNA 4HGMA 3P9LA 2IALA 4XP5L 2XWJB 1R5WB 4WGWB 4ZTOH 3KPPA 1CFSB 3X12B 4TNWF 2VDOH 3BZDA 2BNUB 5C0FA 2B39A 3KDMA 2AXGA 4RGOH 4JFXB 4QO1A 2OCFD 2Z8SA 1PZ5A 4TVPH 2D4FA 1WZLA 1ZSDB 3ET9F 3LRGA 3PGCB 4X6DB 4HFUH 1KJMA 3QDMD 2AQ2A 2B1AH 5DJ6A 1F58L 2R56H 4I4WA 5I66A 1QA9A 2X4PA 5K9KA 2VDRH 3UCRA 3KPRD 3MRBB 4YX2H 5JHDE 5C9JB 5D7IA 5ALCH 2XFXB 3R06A 4PGZA 3BUYB 4NKDA 3HMWH 4BQ8A 4Y7MA 5ACMA 5I1KH 5GRUL 3HI5H 4TVPL 1I7TB 4K9EL 4U7SA 5FA4B 2BNRA 5IROA 3VXMD 1L4IA 1B0WA 2R1YA 1S9YA 3RWJB 5KVFL 3P9MA 4FQ1H 3GMRA 2W0PA 1TITA 2VXQH 5GISH 1QSVA 3DXAE 5GS0L 5HHXL 2X4SB 1U91B 3DTXA 3P4OA 5E8EA 3VXRA 2BCKA 4JCMA 4NQDA 4HT1L 3BE1H 1RZ8B 4OI7A 1TNMA 5GS1B 4U6YB 4FQ2H 3EO9H 1R3JB 1Z5LB 1VADB 3WJJA 3NH7L 1RI8A 1JRHI 2RGSA 1T04B 4Z0BH 1JHKH 3VXQB 5EWIH 3UTTE 1YEIH 4OFPA 4PG9A 4TQEH 3EJYC 1KLUB 4DUWA 2W65B 4AG4L 4CNIB 3MLUL 2R8SL 3JV0A 1J8HE 4BK4A 3INUH 3ECBB 3GO1L 1OSZB 4PD4J 5D5MB 4QRSA 4GKSA 1QSEE 3BE1L 2ATKB 2BSRA 2DWEB 5HDOA 3VW3L 1F4WL 1XGQB 4U1SB 1MCIA 4K2UL 2VKWA 1L9MA 3SKOA 2AEPH 4GXVH 4RFNB 3L5HA 5KN5A 2FWOA 1JHKL 2CUMA 1IMHC 2DQCH 3HZKB 3WIFB 3WD5H 1ND0A 4AIZA 3H2WA 3O45B 4G9FA 3WXVH 5ICYB 3P4MB 4OGAC 5D9SA 3INUL 2NNAA 1GL4B 1RQ5A 3TJEL 5IJKC 4GLRI 2P4AB 4ZS7L 3SJVA 4IS6B 5CEYB 5DHVH 2NY5L 3VFOA 2Z35B 3MLTB 3MRRB 4WI5A 2DLFL 1SMAA 2JELL 1RULH 1AO7D 3BN3B 4GXVL 2DQFA 3RBGA 3S3JA 2Z0BA 2FX8H 1DBML 2C1PA 4X9IA 1A6VH 3U0PA 4F8TA 4O51B 1GZQB 4XZUA 4YK4C 4NN6C 3U7AA 5C09E 5JHLL 1BJMA 5FGBA 2IPTH 1MHHA 4LHUA 2IANE 3S37H 1MIMH 1XF4B 2NXZC 3DRQA 4M6AA 2H1PH 5AYUH 5JW4M 1YC8A 3N1QC 1TPXB 3PDOA 4AENB 1VEPA 4M93B 3OPZL 4GXUN 3V8CA 4JR9L 3BVNB 4JFDA 4E41A 4OI8A 5DYOB 2Z8WC 1JNNL 4W6YB 2YXMA 4BFEA 1A1MA 1NDGA 1AP2B 3EJYD 3DIFA 1FSKB 3HG1D 4U1IA 3CXHJ 4XCFH 2G5RA 3A6BL 5KVGH 2Y23A 4B41A 5TE4L 1RJYA 4HWBH 3WEXB 2FIRT 3O6FA 1CGYA 2DL2A 1MIML 1NBZB 4FNLH 1GAFL 3RVTC 5DD3L 4JKWA 1NCDL 4LHUG 4ORGB 2VABB 5CJOH 2HJFA 5C08D 2ESVA 3I6GB 4HZAA 3WV0A 5JQ6L 3LRSA 5F97E 5IJVB 2QHRL 3QUKB 5KW9H 4HGWA 3IXTA 1WV7T 5DRWB 2KUTA 2VJXA 5TF0A 4D8PB 3BDBA 2NY1C 3IAPA 1MVFA 5FO8A 1O7VA 2WBJB 1KXQE 2W60A 2DF3A 1RJLA 4WRLA 5JUEL 2CIKB 1C5DA 1GPOH 4RA3A 4KZDL 5A2KH 5CZVH 3QHTC 2DDQH 1C16B 2G2RA 3TCLB 3V6ZA 3H9SE 3LN5B 2IGFL 3LKSB 2YD5A 3DO7B 2CLRB 3R0MA 3MYJA 1DLHA 3CCHA 4CMMA 2FZ3B 3GHEL 4P2OA 1D5BB 3L5WA 5EC2B 2X42A 5JDSB 4JFED 2FX9H 2YPLE 1A64A 1NH6A 2IWGA 4CN4A 1NGQL 3W39A 4BKLA 4J23A 1U8HA 4N0YH 2XY1A 3MGAA 1NPUA 1UJ3C 1I85A 4D9QE 3PQYA 2ZKHH 3RWEA 1S7VA 4JY6A 5K59F 4H88L 3GGWB 1UXWA 4RBPH 4L1HA 5LGKA 2W1NA 1VFBB 4N8VB 1LO4L 5DURD 1ZA6B 3VWJB 1WEJH 2YUVA 3MRCB 1JFQL 1H5BB 4JPVL 4N5EC 3RWFB 4PJ8B 4UBDC 1KFAL 1Q9LA 4CL7A 3B9DA 5HI4C 3OKLA 3VXRD 1BQHB 4NQDD 1UB6A 5ISZD 3DGGA 1JNHB 3ARFA 4LLMA 1XR8B 2H9GA 1CCZA 4H8WC 5A2IH 4PFEA 3B9KA 5E6IA 4ZOEA 4OD2A 3CFBB 1BJ1J 1NUGA 1TVHA 2DQHL 2VZTA 1Z9SA 1NEZA 3H9ZA 4ZXBB 3GIVA 4V1DD 2BMKA 1LD9A 4IIQB 5EA0L 4LLDB 1T7VA 4DCQA 4XGZA 3EW3B 1UB5B 1X4ZA 4OLUL 3KPNA 3ILQC 1G6RB 5I1EH 4P0DA 1QOKA 4P23C 5L0QC 1HQRA 4KFZC 4DEPC 2VDPH 2P8MB 4PIRF 5IMMA 1BZ9B 2FLRT 2PUQT 3QDGE 3MBXH 3MRKA 2BVPB 4PJ7B 4Q9RL 5IFHH 5BW7A 3MBEB 3G5YB 1MCDA 2XV6B 1VKXB 1KCSL 2IBZY 1NEZG 3D39E 4FFVC 4G9FD 4P2QE 3L95A 1H3PL 4I18A 1QSFD 3AU1B 3ARRA 3MFGB 2M8XA 1WUNT 3SJVD 3T1FB 4EUPA 4GKNB 3NA9H 4HUKB 3CC5A 1S78C 5DJXB 2GAZB 4P9HC 4JRYA 3MBXL 4XMPH 3VGEA 4JQIH 3HCVA 2PO6B 1M7DA 4GG6F 2RB8A 4M4RA 1Q9KA 1UACL 2A74B 3RBSA 3FN0H 4TOYH 4OF0A 1JNJA 1Q1JL 1IAMA 3PP4H 4PJXE 4LDOB 4X7FC 1R3LA 4UBDD 1EHLH 1CICC 1EPFA 3MNVB 2R0KH 4OTXL 3MR9A 2QKIA 4RBPK 1DDHB 3NA9L 5LGHL 5E7BA 3PHSA 1T66C 3A6CH 1MFCH 1MCWM 3Q48A 2VL4A 4EUPG 3QB7C 5IQ7L 2HG5B 3QIUC 3HFMH 3QIBB 5L2KE 1ZA3B 1DL7L 3HN3A 1I1RA 3WYRA 4E41D 3WJLC 1N6VA 1A5FH 3VXUE 4ONGH 1GJIA 5DD0L 1K9TA 4KU1A 2VLRA 3MGOA 1PYWA 2Z93A 4IHOB 5TPWH 3B2VH 1AJ7L 2VDMH 2AK4B 1NCAL 3HI6L 3ILQD 3KPOA 4MWFA 4PJ9B 3LKOB 4P23D 2AS5M 2R0KL 4YHPB 4L29A 3O6FD 5FYJE 3B6SB 1QFWI 3UJJH 1KXVC 4LMQI 1JF1B 3TT1L 3VFRB 3UAJC 3SQBA 3BDYH 1A3LH 4G7YH 3RWGB 4RWHA 2R1WB 3K81A 1G9NC 2ESVD 2Y07L 4L3EA 4YHIB 5KS9E 2Z4QB 3F7RA 4JFPA 1TJHH 1OSPL 2AXJA 1T2JA 2AI0L 4JFFE 4TNVF 5E6ZA 5TPWL 2EH7H 4FQPA 1JJUA 1ZT7A 7FABL 4BH8B 3UJIH 2YD3A 3WXWL 5K9QG 4KHTH 1KPVA 3BO8A 4G80B 5J11B 1HXMB 2PXYB 3D3VD 4J2XA 2W0FB 5DDHB 2EECA 5CLTA 5EU4A 5BXFB 3LB6C 5E1HB 4MQXC 2X1WL 4QHMA 1AXTL 2X70A 2X1XR 4XP9H 4OAWA 4PJBB 2EIDA 3BDYL 4LSRH 3DPBA 5JOFA 4G7YL 4ZO6A 4LAQL 2M2DA 2X40A 2O5YL 2LV4A 4UUJA 4XBGA 2GT9A 1E4XL 5BVPH 1I1FA 1YMHA 1CICD 3L3KB 5F7UA 2I24N 3UJIL 2XG5A 4QCIB 4KHTL 4RFOL 3P11H 1T66D 1NUFA 2F74A 1MUJA 5F8QC 3L3GB 3QUMA 3QIUD 4PRHD 3SE8H 3FB5B 2NPLX 3QISA 5DGRA 3H0TA 4GMSH 1INQB 1HKFA 3SDAA 4LARH 3VFMA 1P6AB 3DSFL 3QHZH 3WFZA 1Z9MA 3OXRB 5EFIA 3BD3A 1YYML 3DURA 5E99H 4CN6A 4BK5A 2KZWA 5FOBB 2HRPH 5DWUH 2YOCA 4R0LA 4X5WB 4K8RH 1KG0B 2P48B 4XPBL 5EOTB 2CLVB 4MAYB 1X5KA 1HHIA 3UAJD 5FYJH 2A83A 3C6LB 4WCYH 3O2DH 4GMSL 3MX0A 4RAHA 5D7SH 1MRCL 4ZFZB 3KLHC 2D3VA 1QFHA 1GIGL 1YEFL 4O02H 4NQED 2IC2A 3QHZL 3WMSA 4TUKH 5J0BA 4IRJC 1FZJB 4HIHB 5F89A 4PGBA 3CDGB 4LSQL 2DLIA 2NTFB 3VFSB 4RA0C 3P77A 4TSBH 2R23A 3V5HB 3KPSB 5IVXA 3LB6D 1DQDH 1AY1H 4FG6C 4MQXD 3SPVA 4YXLL 1JZ6A 1BWMA 2WK2A 4XWGH 4NKMA 2B0SH 3LV3A 3U30C 1RZ7H 1CD1A 1KB5L 3D25A 1QBLH 2E7CA 2CLZB 4TSCL 3ARUA 1A1OB 1KC5L 5GRWA 1N2RA 4LSTH 5MERB 3IF1A 5T5FL 4WJ5A 1BBDH 43C9A 4LSDA 5J6GB 4ZG1A 1CDUA 3IU4H 4M7LT 3L7EA 3G04B 1DQDL 3BJLA 3GKWH 3NN8B 2GJ6E 1EEYB 4MMZC 2FGZA 6FABH 2IH3B 2E6QA 1RZ7L 1T21B 4JRYD 3DUHA 3OKOA 1K5NB 3D87B 4R4BB 3U9PL 4DKFL 5ALBH 3WFHA 2OL3L 1MCEA 5CJXA 4DWHA 4F80A 4LSPL 1RIVL 3BQUC 4PBXA 1AR2A 3UO1H 3WIHH 1H15A 1TXKA 2ICCA 1C12B 1T0MA 2V5SA 2YN3A 2Z92B 1CDJA 2UZIH 1VENA 5H2BB 4JFOA 2V2XB 2OP4L 3G5VB 3PWUB 3GKWL 3ULUE 2BHYA 4LHQB 1EO8L 1U6AL 2BNQD 4LF3B 4HIXH 1IFHL 4K7FA 2FJHA 3KLHD 1O7SA 2JB5L 3BP6A 2DLHA 4PJEA 1K3ZA 3GSXB 2NW3B 3UTSA 1QFUH 2Q8BL 4IRJD 4OFVA 1SJHA 3UPRA 3MJ7B 5F71A 5J9PA 4DZBB 3RL1A 1XGPB 4IOSD 4OLXH 4PJGB 3IDXH 1K8IB 3DMMA 3MUY1 4Q7DA 1U8JA 2MHAB 4LCYA 5F9WC 3OQ3B 4FG6D 2XQBH 1KSRA 3F5WB 3VFNB 1XFPA 4PY7B 5GGRB 1F6FB 5MENE 5IW1B 2X4UA 4LLYA 2DYPB 2NXYC 1KGCE 1V3MA 2OXGA 4GRWH 4KDVA 1LGVA 1XCTB 4LSUH 4L3ED 4PRDA 2FRGP 2EH8H 4NO3B 4EBQL 4FFYL 4U7MA 3SCMB 1HN1A 4BH7A 1OAYL 3HMXH 4LPXA 4FP8H 3QH3B 1UGNA 3TWCH 2J4WL 4ZSOE 2FLBT 3L7FA 4XPGH 4GAGH 4PB9L 5SWQB 3ETBF 1M05B 3KGRA 3L3IA 1C7SA 2AJVH 1PSKH 3FAXA 2DAVA 3JV6B 1BIHA 1SBSL 5HDQL 1I7RB 4K71C 2UUDH 5LWYH 3ZT6A 3VCLB 2K1MA 4C4KO 2CXKA 4FHBD 3GJFA 3F7YB 3BQUD 4HZLA 3MROA 3PABA 1FGVH 2HTLC 1WTLA 3HMXL 5KSVB 1BM3L 4LSVH 3RIFK 1MCOL 3V6FB 3RX5A 4XPGL 5SWSE 3CMGA 1PSKL 3MODH 1CE6A 4ZO9A 2CGRL 3CZFA 4PLKC 1CFNB 5EULV 4F7PA 2A6JA 2VZ1A 3DNKA 1DJSA 4H8WH 4U6VH 4ZTPH 4DW2L 1Y6NR 2WQRA 2G9HB 1P69B 2F8VA 1J1OH 1XGUA 4WFFD 3MGTA 1FYTE 1J87A 3D2UB 3SDAD 3T0WA 3EYUL 3K2UL 3SO3C 3EFDH 5JXEC 4DJMA 1HHJB 4P2RE 1S3KL 4MA1B 1ORSA 5J89A 5CBEB 1A6AB 3QCUL 3PGFH 4KROB 2JCCF 4YR6A 2O5XL 2FIKA 2XKNB 5LGJA 1BZ7B 1B88A 1WBYA 3MRJA 2YD7A 5B3JE 5FCSH 2NXYD 2YRZA 4X5XB 3K80A 2KZ1B 3GM0A 3I6KB 4XVSL 3VFVA 3VH8B 3EYFB 3T2QA 3BZ4B 1NC4A 3HRZB 5E8NA 2ZP0T 2EXYC 5D7KE 3BD4A 2ARJQ 3G6AA 3CU7A 4OCWH 3GI8L 5K9OA 5I8KL 2PR4H 2CH8A 4MX7A 2ZWLT 3HE6A 5D6DC 4MJ5B 4P2RB 4MA3B 3DV6A 3O4OB 4OIIL 5BRZA 3I3BA 4HMCA 4YZFE 1MY5A 2VIRB 2HN7A 4ISVA 5KTEL 2QEJA 4F58L 3LPWA 1P1ZA 4XAKD 2HVKA 1MAJA 2VLKA 5IP4A 4QGTA 3LZFL 4NDMB 3AAZB 3C87A 2Q7YA 5IMOA 5ECJE 3MRPB 5C07E 3SE4A 3MREA 4O2FB 1G7MA 3HE7B 4N0UA 5IBUG 4U33A 3ARDC 4YBLB 3OV6A 4PLKD 1DQQA 1FNHA 1H0DA 3GJEA 3WO3B 2WLZA 3DBXB 5KVEL 1DQML 1SJVA 4P9HL 3O4LA 3JVGA 1ZGLM 4QWWC 1UZ6F 5DLML 1CTOA 1MHCB 3GSVB 4PRAA 1TTGA 4AM0A 4LGSB 5JMRA 3BI9X 3EDDA 3GBLA 1JWUB 4Z6AT 1X5AA 5EO9B 5FKPA 5JXED 3TO4B 3AM8A 2XKUA 4HK3J 5CUSL 1ZS8B 2V17H 4EI5C 4HS8H 2D0HA 3UBXA 4KRPD 2Y06L 4HLZH 5D1ZC 4H26B 4WFED 2ZG2A 2NX5E 5F6IB 3AMKA 4ELME 4H5SA 1ZWIA 3SGKC 3AS2A 2R2HB 3GI9L 3ESVF 4FZEL 3BEWB 2MKLC 3STZA 1NKRA 4RSVA 2EXYD 3UTSD 1MJ8L 2OR9L 2HKFH 2F8OA 4EXKA 3D5OF 5EOCL 1UG9A 5GGSB 1G7HA 4EEEA 4JVPA 1VFAA 5KSAB 4G8GE 4DTGH 2CR3A 2BP3A 2VWEE 3C9NA 4GW5B 4BYHA 3MLPA 1MI5D 1T1ZB 3QUXC 2FEEI 4DOHE 4NN7C 2DQGH 3UBXG 4M7ZC 2XZQL 1WAAA 3LKNB 4ODBD 3P30H 5EUKB 1MCPH 1Z0MA 3HHRB 3S6CA 3P40A 1WBXA 3MRHA 5B39A 3SDDB 4W4OC 2BVOA 3CH1B 4Z0XB 2FATH 1G9NL 1S7SA 3SE9H 3TZVC 1OTTC 4F9PC 2CJUL 1C08B 1OAQL 5DZNA 1GGIL 5E1AA 4XP1L 3ZO0A 5JORA 1BFOA 3RIAF 1NGYB 4HK3N 2DD8H 2F53A 1VACA 1S7TA 1RURH 3OAYK 3SOBL 1NCCH 3EZJB 1ZT1B 4YQXL 4P4RA 1R0AL 4MCYB 2AKRA 4MS8C 1DBBH 3NFPA 1MCPL 1EBPA 4QWWD 3TBWA 5KZCB 3EOAB 5DJAA 5I1JH 1ZHKA 1EZVY 1NJ9A 4LCWB 35C8H 2K7PA 1AQDA 1BFVH 1LO3H 4Y16A 5B39G 5JNYA 5LJYH 2O61B 2MKWA 4Z7WB 3RVVC 1GOHA 5DEFB 5D7LA 1A02N 4P5KA 1AGBA 3GSUA 3LKRB 4JZNB 4HKBB 5CZKA 1A22B 4ZPTA 3MPCA 1MQ8A 5BS0A 3MJGX 4KMTH 5F9OL 1N5YH 3QFDA 4HUVB 2ZUTA 5CGYC 43CAA 5CEZE 4KK6C 2XTJC 2ATPA 1AHWB 4WU5B 4OZIA 2X7LB 1MCCA 4PJ5D 4LASL 4S1SL 4PJAE 3MUHL 3QUXD 3VMPA 1NAMH 3M8OH 2VO5A 4JHWH 4NOFA 2IADA 1WICA 1W0VA 4N8CL 1T1XA 5F1IA 4NO2B 4EI6B 5C6WH 3NIGF 4Q74A 2PYFA 1IAKA 2P1YA 5DVNA 2DIBA 4BZ2L 3T3PE 4NBZB 4Y5YA 2EDKA 2A73B 1GHFL 1NC4D 3I84A 1FRGL 4YDLC 2HT2C 1NBVL 2N1KA 1FFRA 5F9JB 1AD0A 5KSUB 1AR1C 4UB0L 1E4JA 4MJIB 3HE6D 3MRGA 5E2WH 1NAML 2APFA 3NIDF 4JHWL 4MS8D 2IAMA 5JOPE 2BERA 3IDNA 3VD9A 3F58L 3T09A 1IC7H 3BN9D 5TE7H 3BYYA 2VLKD 3LQMA 3NGBC 3EOBB 1KIPB 3OX8B 2HA1A 4Z7NF 4X7DC 4LP5A 4XNZC 3TH2T 2AEWA 3RVVD 5IGXH 3CFKA 1CE1H 2FYYA 3O0RL 1HSAA 3TBTA 3GSWB 4WU7B 2XPGA 5D71H 5E2WL 4EIZC 1A7OL 2NY2C 1W0WA 3CPLA 1A9EA 4MHHI 5E8OA 5SV3A 1N0XH 1MREH 4ZS6C 5LQBL 3IJSA 4YDVA 3FRUB 4UT6L 1P7HL 1KN4L 1YMMB 4QYOB 5EU3A 1D3CA 1RUMH 1Q94B 3THML 4YDIH 3Q6GH 5D2NB 5CGYD 4ODTL 2ZCHH 3QXVA 2XTJD 4KK6D 4U6XA 4XC3H 5GHWH 2ZUVA 1CVSC 1OF2B 4GH7B 4Y16C 3VFTA 1RIHH 2ZG1A 2O93L 1PG7H 1RSFA 3DX8A 3SKNB 5CEZH 5LXGH 2ADFL 3S97C 5F3BB 2OTWA 3OKMA 3RZCA 4FXKB 4XVUD 4XX1E 4YO0A 4YJZL 4OKVB 5JOEA 1JK8B 1M71A 4LLUA 1N0XL 2EDTA 4JAMB 2MCPL 5D7JC 1U36A 4NWUH 2VXUH 3S4SA 4JKPH 3PP3H 3BWAA 4XC3L 4DGYL 3BW9B 2C7UA 4AZ8A 3EYSH 32C2A 4F7EA 2DQDH 5DJ0A 1ZTXL 4L9LA 5IHUL 1UM5L 3DX9B 2ICES 4HF5L 1Y18B 5FV1L 2Y7QA 4Q6IB 2GITB 1OGAD 3LD8B 2PETA 2WSKA 3IDGB 3Q5YA 2EICA 1FNEB 1H8SA 4L4VA 5HHPA 4R7NA 1EEUA 3M17A 2VRAA 1OTSC 5FFLA 1NFDE 4ZMAT 4Y1AA 3V6OA 3Q3GA 5C0IB 4HV8B 3S4SG 2XT1B 5GQBA 4Y5YC 1CIUA 2P24A 2C1OB 4OI9A 3X14B 2NY2D 1EK3A 1JTPA 3U2SA 1I3GH 3FFCB 5DJCB 4ENEC 4ZAKB 3C8KB 1XIWC 3ZDYF 4QRUB 2LVEA 4IRSA 3GMMA 4P3CH 4MA8H 2DWDA 3TNMB 5C0CA 1KT2A 5HHNA 4F57L 3PWLB 3S34H 2VSDA 4ZNCD 2R4RL 1S5HB 3H6JA 4Y16D 5IR1A 3RL2A 4TSAH 5I8EB 2X4OB 2YUXA 2BHZA 1F90H 1E6OL 4WVRA 4PJHB 1A1NB 3MLRL 4XCEB 2RCSH 5ETUB 1KIRB 4MNQD 4IBLT 3FQUB 4PJDB 1E4WH 1SVCP 1RZFL 4JO1H 4MD4B 4ZOAA 1QKZH 2JJSA 3LKPB 3UZQA 5E08L 1EGJA 3QWQB 1NL0L 2YC1A 3KYNA 3FONA 3VG9B 1JHTB 3OGCA 1KPRA 5L2JA 1J05B 1CXKA 5ILTH 5DHVB 3QUZB 3SKUD 3QNYA 2J2ZA 4L3CA 3MFFB 5E5MA 3VI4F 5K33A 2VLLA 5IMLA 4WV1A 5E94B 3RGHA 4UV7L 1QLFB 3RP1A 5AZEH 1FO0A 2CUHA 3C5JA 3RZCC 5FCUH 3PP3K 1QKZL 4BFIA 3WFDL 3MV8A 3IETB 4KQ4H 1I8LA 4UDUB 1OTSD 2IBBA 1IL1A 1JNLH 4HIJA 5ILTL 3EYOA 1E27B 2YD9A 3TVMB 3ZYZA 1NBQA 2B20A 5EC1A 3B8YA 5D72L 4EIGB 4KK5C 4WW1A 3OMZA 1JTOA 2ENSA 4JDVA 4X99B 5FYKH 4MDJA 2QSTA 1ES0B 2VB5A 4XTRC 3TT3H 4ENED 1XIWD 4NQXB 4U1KB 2WUBL 2XWJA 1R5WA 5HVGB 2IAMD 2V9TA 4HLJA 3X12A 1AXSB 5FYLD 2BNUA 3MV7B 4L3AA 3C2AH 3OJMB 5DUMH 4MSWB 4JFXA 3JZ7A 3PGCA 4LK4A 2HVJB 4X6DA 3S36H 1S9VB 3ZT7A 2X89D 4OD1H 3V0VB 1KLFA 4HUXB 4KTEL 3CFCH 1MEXH 4RCAA 3MRNA 2FHCA 2XFXA 4XPFL 1RK1B 2W9EH 3BUYA 2AERT 1BFTA 5CIPA 5I17B 1J18A 3CLEH 1U58B 1I7TA 5F7LB 4GUPB 1DN0B 5FA4A 4L1DA 1HSBB 4PREB 1ZHNB 5D93C 2XY2A 5D1XC 4LPVA 3VGAC 3BEVA 3PWVB 2BRRH 3CX2A 3LH2H 4XPAH 1U91A 1NMAH 5HYJD 1F4XL 1T2QH 2P5EB 4X4ME 3RZCD 3BAEL 3O6LL 1SM3H 3U79A 3O2WL 1FCGA 3JWDC 4JFZH 2W9EL 1U2HA 5GS1A 3WLWC 1R3JA 1G9EA 3CLEL 1Z5LA 1VADA 4Y4FC 3RY5A 3U7WH 1T1WB 1NKOA 1T04A 2MQCA 4X4ZA 4KK5D 12E8L 3ARSA 3VXQA 3NPSB 2Y6SD 2MWCA 5DR5L 5GS2D 1KLUA 3L1OH 4XTRD 4CNIA 1WZ1H 3OKNB 4YXHL 3LH2L 3LHPH 3R1GL 1E6JH 3ECBA 1OSZA 4QOKE 1EDQA 1L7IH 2WUCH 4LKXB 1RZKC 3ALWA 2ATKA 5T33H 3SQOH 1S7WB 3E3QE 1YNKL 1XGQA 4P5MB 1R3KA 4U1SA 1R3IL 1LDPH 4Y4KA 1F11B 2BSSA 2HLFD 3BH9B 4Y19B 1WBZB 1KIQA 3RA7L 4Y1AD 4RRPA 5EUOB 3HZKA 4YPGB 3WIFA 2I9TB 3QIWB 3QYCA 3VG0H 4I13B 1OW0C 2YA0A 5ICYA 5C7XH 2X9YA 3P4MA 4PTTB 2Q87A 2D9CA 1N4XH 2CKBH 4OZHB 2Y4SA 4IS6A 5CEYA 1L7IL 5IEKB 3GBNH 4Z7UE 3QO0B 3MLTA 5E2UH 5T33L 1D6VH 2VUOA 1EVUA 3MRRA 1HI6B 3O6MH 4FXGA 4IRSD 3HC3L 4DVRH 3OR7A 1RUPL 1FFPB 4G5ZH 5C0CD 3S5LG 4KKCC 3FO0H 1KNOB 5IFAH 5D1XD 5JLZA 5CD5C 2A9MH 3O8XC 3TBVB 2JKXA 3X13B 1H8OA 3VG0L 4O51A 5JW4N 4RRPG 1T22B 3FQNB 1CZ8L 4KVNH 1IAIH 1XF4A 2HJLB 4Y4HC 5CMAB 5ESAB 3O6ML 2DBLH 4DVRL 3QDMB 3WS3B 3GB7B 5E9DD 1NANH 3FOMB 4AENA 3G6JE 4G5ZL 2PCPB 2Y72A 5IFAL 3BVNA 3KPRB 5DYOA 4AMKL 1H3TA 1AP2A 1KB9K 1MJUH 4HFWB 2VERN 3WN5B 3H3PL 1P2CB 1JWMB 1SYVB 3UYRH 3H7BB 4JPWL 1JZ5A 3WO4C 1TNNA 5JW3L 1NBZA 1SEQL 3VXMB 2YMXL 3UXFA 2WANA 3L5XH 3MMEB 3P0YH 1UM4L 4HH8A 3I6GA 2AW2A 5IJVA 4UIKL 5E2TH 2AQ1A 4X6DF 4HJJH 5SX4I 3QULB 5DRWA 4D8PA 3V79C 1DEEB 4KI5C 1JL8A 1P53A 1E4XI 3KLSA 3FO9B 4K07A 5EOQH 2GJJA 3DV4B 2WBJA 1CD0A 1QSZA 1S8DB 2F8XC 1M7IB 3E1F1 4BUGA 2CIKA 4DN4L 4NZTL 1NCBL 5KANI 4KKCD 4C55A 1C16A 1PY9A 2XZCH 2XZZA 4F7CB 5DD1L 4AEIH 4IRZH 3TCLA 3PIQB 2QBWA 3RPKA 1FPTL 3NABH 4QRPB 5I2IA 3LN5A 3MLXL 4Y4KC 3LKSA 5F7MC 5GGUB 4M8QB 2FZ3A 1MFBL 1D5BA 1FP5A 5EIVA 5EC2A 5JDSA 4AH2B 1A6ZB 2WWMC 3BKML 4Y4HD 1CWVA 1UH4A 1Q0XH 3SDCC 4PG2C 2YZ1A 5LCVH 3G5ZA 5IVZA 5HDBF 4NQCD 3ZE1E 1IT9L 1ADQA 2XZCL 4S11A 3GGWA 4N0CD 5EPMB 4GS7B 5H37G 5CJ5A 1VFBA 2AJZB 4OM0L 1ZA6A 3VWJA 3DHJA 4KI5F 3MRCA 4HQQL 3O3AA 4M6NL 4G6FD 1BQLL 1IRAY 1AO7B 1UKQA 2EEAA 4KGJA 5E24E 4PJ8A 1HWGB 2APXA 3L6FB 5I30L 3K2MC 3L3DA 1BQHA 1V5JA 2EYTB 5LCVL 3BKJH 1JNHA 4LU5H 2QQNH 3S35H 3VXSD 3UTQB 1IZJA 1XR8A 3QXDB 4PV8B 4ONOA 1EHAA 1ZLVH 3V4VH 3CFBA 4OM1L 3TIDB 2VN7A 3ZLQC 2XACC 1ITBB 1G7LA 4ZXBA 4KI5D 2AJXL 3QFJE 4X9BA 5C08E 2VE6B 4IIQA 4LLDA 4MNGE 4HWEH 4G8IA 1QP1A 1FFNA 1UB5A 3IGAA 4V2CB 4JO2H 4XNMB 4JE4B 1G6RA 4FABH 1Y0LB 1D5XA 4RISH 1U8OB 4ODSH 1OCWH 2P8MA 5FYLH 1BZ9A 3O3DB 3HG1B 1BQHG 2BVQB 4QF1A 2UZYB 4X7SH 2BVPA 4JRWA 1B6DA 3T0EC 4MCZB 4PJ7A 1FQ9C 4Y4KD 1AD9B 3G5YA 4DVBB 5I1HH 1VKXA 5DC9B 4HDIB 5J1SC 4UV4H 4KJQC 1XEDA 1HHGA 5J13C 4ZODA 3JUYA 1F00I 4YHML 3FT2B 2ITDA 2WWMD 1KB5B 1C5CH 4M43L 3SDCD 2ZUQC 4TULH 4O9HH 3T1FA 4GKNA 1CVRA 5DJXA 3TH3T 2GAZA 4XCCL 4X7SL 2AVGA 2OS7A 4LCUB 5IVNA 2PO6A 4UINH 3EO0B 5D7IE 1OT2A 2A74A 4UV4L 2VXSL 3UYOD 3E8UL 4WI9A 1SMOA 2C5DC 3KDMB 2MCG1 2BNRE 1QVOB 3MNVA 2OL3B 4QHLB 3V0WL 1NBYB 1A3QA 3AC0A 3VXTA 4ZNEE 4YK4B 5SWZD 4NN6B 1J0ZA 1Y6MR 4YGAB 1KJMB 3SGJC 1Q38A 3KPQA 5DJ6B 2HG5A 3RPIB 3T0DA 3UJTL 3QIBA 1QA9B 4NQDE 4JFEB 2DI8A 2NXZB 2PYED 3LSOB 4POZC 4Y8AA 1Q9OA 3CXDL 3VGHA 4IHOA 2AK4A 25C8H 3I02A 1FG9C 4PJ9A 1FG2B 2ZUYA 2P44B 3FKUS 3G08B 1NMBL 2BRQA 5DURB 3B6SA 1TQBC 1MCLA 1JF1A 2R1YB 3KPMB 3HC4L 3T0ED 3FB8B 4FFZL 1DEDA 4WIQA 4X5LA 5HY9B 4UILL 3RWGA 2R1WA 1FLRH 1CGWA 3B83A 4YHIA 2Z4QA 3D48R 5E8EB 3NMEA 3VXRB 4NQDB 4KJQD 2WP3O 4X6BB 4RZCA 5ISZB 4OBRA 4RAUA 2B7DT 1C5BH 2VH5H 2XG4A 4BH8A 4NC0B 4LOUD 2NY7H 4G80A 4DAGL 1N5AB 1HXMA 2KPNA 4MXWH 5E5RB 3FHQA 4RWYL 4P59H 2E8ZA 5DDHA 3MOAH 4G9FE 4V1DB 2NY1B 3DHMA 4XB7A 1U92B 4J6RL 4G3YL 4M1DH 4WEBH 3SJVE 3U4BL 4LIQH 4URTB 3UZVB 5BZWB 1P4LB 3N50A 3QWOB 3KHQA 4QRSB 4KZEH 4GKZB 3HUJB 4MD0B 4TTGA 2D2OA 3C09C 3L3KA 3QA3B 4QCIA 4GRWB 3K4AA 1CDYA 3L3HB 4MXWL 5LG1A 4KPHL 2NYYC 3VE0B 3JWDH 1KUMA 3VMNA 1RUQH 1AQKL 1ND0B 3LCYA 3OKDB 4U05A 1Z0NA 3FB5A 5JR1L 3MV9E 1VFMA 1QSFB 1INQA 1CLYL 4LIQL 2X9WA 4POZD 4Z78B 3RAJH 4OZFH 1UJ3B 3OXRA 4Z7VB 3VWJD 5I9QC 3PF2A 1T03H 1PFCA 2J8UF 3JUZA 5DUPH 4P2CG 3W9EB 5FOBA 2CIIB 4JFDE 4E41E 4Q9CA 2DQJH 1N7ML 4PJ8D 3P4LA 5H8DA 1RZKH 2FB4H 4L8BB 4X5WA 1KG0A 5EOTA 2CLVA 4MAYA 1RUQL 4K7PH 3HR6A 5F70A 3C6LA 4Z76B 1EJOH 1A0QH 3MLVL 1EGJL 1G7IB 1YJDH 1A6UH 5IHZB 4ZFZA 5F7DB 2XXCB 4PYHA 1LK3L 4LNRA 3STLB 1MFEH 1LDSA 5ITFB 5DVKA 2OYPA 1T03L 1FZJA 1CL7L 4HH9B 4HIHA 4YHZH 3CDGA 5ITBL 3VGDA 3IFPA 4NCC2 2NTFA 4QXGL 3VFSA 5I15H 1QRNA 3V5HA 4D94A 1MFDH 2G5BB 3KPSA 4GG6B 2NZIA 3B9AA 4XBPB 1FO0L 1VGEH 2DQIL 3DVIA 3DYPA 4M1GL 3DIFB 4FQHB 1CGVA 2DQEL 2FGWH 1QUNA 4DFIA 1DBAH 3SY0B 1RUKL 3RFZC 1UXSB 4P23B 4FQXC 1CLOH 2CLZA 3O6FB 4DEPB 1A6PA 1A1OA 3HNVL 4ODVH 2CK0H 2W92A 4M9OA 2F54E 5MERA 2X05A 1IVLA 5IB3B 4JRXD 4FTVA 1J1XL 5J6GA 1PVHA 4X0KB 5CEXA 3MJ8A 1TQCC 2HJFB 2NYYD 2ESVB 3EYQD 3G04A 4QRRD 4YHKH 3S98A 3NN8A 1F8TL 1X4XA 2RQ8A 1EEYA 1JGVL 4L9DA 4DZ8B 2IH3A 5DS8A 3GMPB 1T21A 1K5NA 4DGIL 4R4BA 3REVB 1KCVH 4OKDA 2A0LC 2WV3A 5GZNC 3HRPA 4LQFH 1ZLUH 5HTSA 4ZUVB 3D3VB 1FNFA 2CK0L 3PQYE 5GGVH 4JFYB 4Q2ZB 4OT1L 1C12A 2Z92A 3OHXB 2A9NH 5DMYA 3P4NB 1U93B 5H2BA 2V2XA 1XAUA 3PWUA 4G7VH 1QYGL 1XR9B 1U8LB 1HIML 2B1HL 4FS0A 4XMLH 3ZSTA 4X4XB 3TF7C 1CICB 1I8MB 1ACZA 3QAZC 4LLQB 2FBJH 3LEYL 4Y0GA 3QIBD 4U3HA 2X4RA 3RNKB 5AG9A 1RIUH 1NUNB 3W39B 3CVIH 1WZMA 1XGYL 4NQVB 2XWTB 1YN6B 4DZBA 5D96C 3QIUB 1XGPA 1MELA 4PJGA 4PRHB 4RGNC 5ANMA 5TFSH 3RWEB 1K8IA 1XGTB 2AK4D 2NY3C 2MHAA 5E95B 1V3JA 5EOCJ 4G7VL 4PJ9D 3WUWA 3VFNA 1YY9D 1I4FB 4R2GC 4PY7A 5GGRA 5HGAB 4ACPA 2VDLH 5IW1A 4G8EB 1NGZB 4FQXD 4XP4H 5I16B 1UH3A 2HMIC 1XCTA 1WIOA 4NO3A 4KDWA 4JPKH 4L8CB 3CVIL 3SCMA 4LPYA 3DSNA 2AK1L 2HWZH 4YWGL 3VXPB 1WK0A 3QH3A 2H3NB 5TFSL 3MO1B 5D1QA 1M05A 2W59A 4S1QL 4WY7H 4GG8B 4NQEB 5HI3C 1TVHB 2X41A 4NZRH 3FMGL 3AUVA 1H8NA 1I7RA 2I07B 4UTBH 5ADOH 5L6YL 3WUWG 4JCLA 3VCLA 3L5IA 5SX5H 1LMKA 2BMKB 5I1GL 2A0LD 2D0GA 5GZND 3F7YA 1HH9B 2I25N 3QWRA 1DCLA 2AV1B 1JGUL 3JXAA 4HXBH 5KSVA 1TMCB 4JRYE 2HWZL 4CJ0A 3WCYA 5IMMB 4ZFGL 3IS0X 2FHBA 4TTDC 5F7EH 3RWHB 5EIIB 1JRHL 5GIRB 3IFLH 3HNSL 4JKKA 3WKMH 1CFNA 1WSST 4ZD3L 5ADOL 2P5WD 2BVEA 1ZLUK 3FN3A 2NZ9C 4MMXC 1QNZL 1S5IL 3MRLA 2IG2H 5IM7B 1IGTB 1DSFH 3U82B 2G9HA 3D2UA 3KYKL 1OAKH 5IT2H 4NC1C 1HHJA 4P2YA 1KV3A 1T83A 4RGND 1T5XB 2NY3D 5CBEA 1IC5H 1J0HA 1A6AA 2IPUK 5K9QI 4ESKA 4KRLB 3BP4B 2F5AH 2XKNA 4R2GD 1BZ7A 1M7DB 2IQAB 1S7UB 1DUZB 4OFYD 2VLRE 5BMFH 1FDLL 3GRWA 1LP9F 4X5XA 5CILL 4R96B 3C6LD 4HK0B 2HMID 3VH8A 1R3LB 3NTCH 3EYFA 4BM7A 5HHOB 3BZ4A 4I77H 2QQKH 1OAKL 3HRZA 4XXCA 4OUUB 3KR3H 5KSBF 1G0YR 4AL8L 3MR9B 2BNQB 3W5NA 3RWDB 3FTGB 4MJ5A 5HYSB 4MA3A 4L3EE 3ZE2E 3GMLB 1N6QH 3HAEA 2VXVH 5HI3D 1QRND 2IF7A 1U3ZA 2VIRA 2GJZB 4IRJB 2I9LA 5IHBA 4JFHD 4Z8FL 3EOYG 3CK0H 4NDMA 3AAZA 1PYWB 5C0AD 3PV6A 3BT2H 3DVGB 3MRPA 1NAMB 4AEEA 3KPOB 3UTPE 1X4YA 4O2FA 4O58L 1A6TB 3RDTC 3T2NH 4EUPH 1L0YA 3U30B 2AGJL 3NIFE 4TTDD 3HE7A 4FZ8H 4FTVD 5GGTA 4WFHE 1N6QL 4NGHL 5GJTH 4LVOB 2UY6A 4MLSA 5J1AB 2BSTB 5SX5K 3DBXA 4TYUA 3HAEG 2J6EH 1DLFL 2NZ9D 4IMKC 1MHCA 1EV2E 5F9DC 1ACYH 2FJFB 1MHPH 1JWUA 1X5HA 1FGNH 5EO9A 1NLDH 3BO8B 4F15B 3TO4A 4JY5H 3TYFB 3ELAT 4M62H 3UPAA 1ZS8A 3F12B 2R0WL 1U2CA 4K3EH 1UQSB 4JO4L 1ZANH 2R4SL 5IB1B 4PJGF 4WHDA 2V5MA 3WIIH 5JOFB 1MCRA 1F2XK 3BQUB 2DMBA 2JJTA 1LO2L 1WCBB 2J6EL 4XBGB 1G6VK 3MCLH 5BV7C 1I1FB 1YMHB 4Y89A 3BEWA 3I6LD 2QSVA 4H20H 4X98B 4JGMA 4K94C 3OTTA 2A38A 3V6BR 1A7QH 5JIIA 3ARTA 4K3EL 5KSAA 1I9JH 1CGSL 1UFUA 2IBGA 4GW5A 3WIIL 1T1ZA 1OAUH 1F3JB 3BMWA 4I9WD 5EIQA 3SDAB 4GQ9H 3E0GA 3LKNA 1PG7X 3Q5TA 5EUKA 3ZKXC 4QXTA 4A6YL 3CH1A 1A7PH 1VSCA 5F9WB 5CJQL 4M7JH 4Z0XA 4UTAH 4HC1H 4H20L 1GRWA 1JUFB 5IVXE 3HB3C 4Z7OE 3RDTD 5HXMA 1DE4B 1N64H 2R0LL 1A7QL 1DTUA 1NGYA 2NXYB 4OCRH 4QNPF 2J12B 4ODUB 4FQLH 3QUYA 5D1QD 4D9RD 1INEL 3SDXB 2FECL 2R9HD 4LSSL 4U6HA 1ZT1A 5AZ2L 2XKSA 4XMKH 9CGTA 4MCYA 1OAXH 5F1SA 2IFGA 3GDBA 3T0BA 3EOAA 5KBNC 4RX4D 3X3GL 1A7PL 4DKEH 4LCWA 4XVTH 1NC2D 5F89B 4ZUUB 3ZYIA 4P5TC 1CF8H 2JCCB 2OK0L 4Z77B 2O61A 1MQKL 4NHCH 4IOFC 3MLZH 4JM2C 4K71B 4Z7WA 3ABZA 4WHCA 5DEFA 4OLYH 3QUMH 4JM4H 3OB8A 1X5GA 2EXWC 5FXCH 2WBWB 3LKRA 4JZNA 3GMQB 2CMRH 2AJUH 2EO1A 4HKBA 4CU8A 3U4EB 1MCWW 4MYWB 3Q0HA 4CKVX 2APBA 1BHGA 2KDGA 1HHHA 5DUBB 2W9DH 1CF8L 2IPKA 4Y8DC 4HUVA 3GK8L 1IKNC 2OJZH 3QQ3A 5C0BE 4AK1A 3ZTJG 3D2UD 1UZ6E 1AHWA 4WU5A 2X7LA 2IFFL 3CVHL 4OLYL 2YKLH 2D7TH 4PJEE 4KUZH 1TDQA 3K1KC 1JN6B 3UTSE 3SGEH 3EUUA 3CZJA 4HKXB 4OB5H 2H6PB 3SO3B 4WUKH 4HUUB 3SE3A 4NO2A 1JPFB 4PV9B 4EI6A 1C7TA 1PY4A 3IU3B 3HB3D 4MGXA 5MP6L 4WI7A 5EU7C 3KVQA 2LABA 4KRPB 4ZFFB 2A73A 4YLQT 4KMLB 4NIKB 4JFOB 3VA2C 2FBOJ 1K4DB 1CGUA 5EBLB 2E7LA 1QFOA 5DJ2B 4LPWA 1G7JB 5F9JA 5KSUA 1I1CA 2KQMA 1NGWB 2B5IC 4K7FB 1JYVA 4KK9C 4MJIA 4CDGC 4KXZI 4M7KH 3T65B 5IFJB 5C0DB 5BJTB 4OD3H 3LS4H 5I73C 4I2XA 4M03A 4S1RL 5MEPA 1DQLL 4P5TD 5C3LD 3VD3A 5C6TH 4IOFD 3EOBA 1KIPA 3OX8A 1MI5B 1U8JB 1VCAA 2QHLA 1FAIH 1W8OA 1P7KB 4NUGL 3NACL 3ULVC 1BEYL 1Q8MA 3VRIB 3E2HC 3MCKB 2EXWD 4WHYH 3GSWA 2EDQA 4IOIB 3GMNB 3HE7D 2X4UB 4LLYB 4WU7A 4DK6A 5EB9A 5T3ZE 2EDBA 4CW1A 4OLZH 3QXUA 1FBIL 3WFCH 5I1AB 5L8JB 4OV6F 1TLKA 1OWRM 3FRUA 4QYOA 4DN3L 1Q94A 1A7NL 5C6TL 5D2NA 1MPAL 1IC4L 2ZSVB 4MB3A 5DRZB 1CBVL 5E00B 1OF2A 2ICWI 3TO4D 5T1KD 5D8JL 3SKNA 4UDTB 1WWCA 1PJ9A 3PG2A 5F3BA 2FJGB 3PXJA 1KELH 4NUJA 5D2LF 3S36X 4OKVA 3UEZA 1JK8A 1GZPB 3IVKB 4PRPD 4HZLB 3QEGL 3U1SL 4JAMA 4XNXL 1JZ2A 1A7RH 1R5IB 2Z31A 5D1ZB 5AG8A 4E0RB 3BW9A 4N9OB 3IXAB 2APWA 4NOBA 3ARZA 1NGXA 1PLGH 4HBCL 1CE6B 2ENYA 3DX9A 2E7HA 3WE6A 2LVCA 3MQIA 1Y18A 4KK9D 5CINH 1F4YH 3HNTH 2A6JB 1AFVH 4ETYA 4Q6IA 3ZTNH 2GITA 2FEDC 4WI3A 5CD3B 1WFTA 2ICWB 4KV5F 1XGUB 3IDGA 4WFGE 3IDYC 1FFQA 4UT7L 2DI7A 4PJ5B 5BRZE 4JG0L 1XF5B 1VFUA 3QUXB 4XRCB 4NN7B 5C0IA 4M7ZB 4HV8A 4MHHG 4PPTA 3N85L 4NRZB 3VJ6B 1B4JH 2UWEE 4J12A 4N90E 2C1OA 3X14A 3TZVB 4QLRA 3QUYD 2YBRA 4GAJH 3QHFL 4LVEA 3GJFH 1UZ8B 5FGCE 2VLMD 5FAAA 3C8KA 3U48A 5T3ZH 1NC4B 3FHAA 4WUUB 4QRUA 5E8NB 4YE4L 5IBUB 3TN0A 1AI1H 3TNMA 2EDHA 3NIDE 5FHAL 5BQ7B 4A2MA 5F96L 1S5HA 2LTQC 3ZYJA 2X4OA 3O4LE 4HCRH 1JE6A 1YPZF 5E03A 1F42A 4PJHA 1A1NA 2HVKB 2VLKB 4M02A 2Q7YB 4TPRH 2F19L 1UCTA 4PJDA 1VFOA 3LKQB 5C0RH 3UBXI 3PJSB 3O3EB 3LKPA 1NCNA 1CFVL 1IEBB 1G1CA 1DANT 4N0UB 5EZJB 4POUB 5ADPH 5DHVA 3QUZA 1X7QB 1B4RA 3MOBH 2FD6H 3TYGH 5MHSE 1H0DB 3GJEB 5JHDA 3MFFA 1DVFC 2CSPA 5T3XD 5E94A 2FEDD 3CUPB 5DTFB 5KOVC 3PWPA 4YBHA 1QLFA 4HPYL 3MXWL 2K7QA 2MNUA 2Q1EA 2X09A 4PJIF 4OZGF 2XTJB 1F3DH 4LLAA 5FKPB 3NZHL 4U3XA 1TTFA 4U1LA 4TRPL 4J4PA 1IGIL 4MVBC 4UDUA 3GMOB 3GIZL 3T77A 5I75C 5ID0B 3RGVC 1E27A 4KTYA 3UBXB 4CUCA 2Z31C 4I0PA 1WAAE 5AAWA 2A6IA 2I5YL 3ARGC 4JGJA 5IK3B 3WKNA 2JF1A 2EYSA 1ZWIB 1J5OL 1ES0A 1C1EH 4RQQB 4NQXA 4F7TB 4JLRA 4U1KA 5F72S 4LDEB 2UYLB 4YDLB 1V7MH 3FZUC 3V4PH 2E9JA 1AXSA 4YHLL 4KTDL 3R8BB 3WS6C 3MV7A 4MJ6B 1QD0A 2F53E 3HZYB 4MSWA 1VFAB 2QR0B 3OWEA 5KAQG 1OGAB 3U7YL 3FQRB 2HVJA 3NCBB 1DBKL 1TFHA 1G9ML 4MQ7B 3R8QA 1FN4B 3FT3A 3V5DB 4R8WH 3GJFK 3V0VA 2Q8AH 5E56A 3NGBB 3MRHB 5B39B 4HUXA 4DKAA 3T08A 1SYSB 1EBAA 1U3YA 2GIYA 3JV5A 3VI3F 2KQNA 3OJVC 3ISWA 2D31B 1RK1A 2L7JA 1CYGA 5I17A 5D7LE 5BV7H 2XN9B 1XMWA 3HC0B 2NY2B 1PGRB 1D5IL 4L5FL 4JANB 3KXFB 1VACB 3JWOH 4GUPA 3ZDYE 4YUEH 1DN0A 1AE6H 2VLJB 4K94H 4YDJB 4UQ3B 1KEGH 1FH5L 4PREA 3TC9A 1ZHNA 3OJDB 1P6FA 1DVFD 4FQCL 5EZIH 5BS0E 1PEWA 2VC2L 3ZDXE 5I8OH 2OTPA 2FX7H 1FE8H 4M6OH 1CDGA 2P5EA 1KJ3H 1KN2L 4KVCL 4NM8H 4Y16B 1T6WA 4OZIE 3ZYOA 4N9GB 1BAFL 3MC0A 1UC6A 2OX5A 5FHBH 5MI0C 2ORBH 3RGVD 3CFDA 1T1WA 1GOGA 2Z31D 4R3SB 4P5KB 4MNQB 1AE6L 4M48H 3ARGD 4J3TA 1KEGL 3NZ8B 1HILB 1CFBA 5B21A 2A1WH 3G6DH 5D7JB 5EZIL 3P2TA 1A6WH 2F5BH 2EE9A 3OKNA 4PJFF 1Z6JT 2BVYA 4MZ3A 1JZ3A 4AEHL 4MXVF 4JFQA 4LKXA 3VWKC 3L3JB 5F6HI 1G1YA 1PKQB 5EBWB 5FGRA 3VI4E 4LCIH 5CAYB 5DQDL 2ATPB 1S7WA 1H3WM 4P5MA 3GRWL 1F11A 2V5YA 3BH9A 1WBZA 3BJ91 3H9YA 4HS6A 4OCSH 5EUOA 3PDGA 1E4KA 3BDXA 3S35X 4YPGA 3X11B 4C59B 2I9TA 3ZSSA 3G6DL 3QIWA 3OG4B 1SJXA 4I0PC 4XH2B 5E7FA 3BZFB 4JN1L 3DX6B 4KKNA 4PTTA 4HG4J 4OZHA 2YUZA 4H25B 2I27N 4I48B 3VMOA 4G6AC 2FSEA 5IEKA 3QO0A 4Y5YB 4CJ1A 1DBJL 1WCQA 1B2WL 1HI6A 2IH1A 3O6KH 2C9AA 5F6HJ 3TN0D 3W5MA 3KHOA 4OLVH 1L7TH 1ONQB 1KNOA 2XZAH 5IBTH 2V7NA 1XIWB 3MRGB 3BPCB 3MNZB 5TH2A 3O2VH 3TBVA 4HBQA 3X13A 1S9XB 2ZJSH 2Q3ZA 4FFWD 1T22A 3FQNA 3F6IA 5GGTL 2IQ9H 5DF0A 1Q9WB 1P4BL 1ROWA 2HJLA 5CMAA 5ESAA 1JPSL 4U1GC 1OM3L 3WSQL 1KENH 1YECH 3I50H 3QDMA 4MA7H 3WS3A 4F9LA 3GB7A 3IKCA 3TIEB 1KCRH 1IILE 3FOMA 3D0VB 2PCPA 4OLVL 1IQWH 2JJVA 1BD2B 1MCKA 3TBTB 5LAXB 3WHXB 4EOWL 1EJ6A 5KAQF 1HKLL 2HAZA 2FHFA 2XZAL 3KPRA 5GGQH 5EBMB 2OZ4H 3NAAL 4HFWA 2V5RA 5E8OB 3WN5A 2ADGA 1P2CA 1JWMA 1NLBH 2ZJSL 1CR9H 1SYVA 5JHDD 3H7BA 5HHME 1FL5B 5IV2B 3LQAL 4NZUL 4M5ZL 5BOZG 3PWPD 3TFKC 4I3RL 2BZDA 3VXMA 2D7OA 4OGXL 3BXNA 1YECL 3MMEA 4MA7L 1KEML 3BKYH 4EVNB 4EDXA 4AY0A 4UU9B 1ZXQA 1KTRL 4M1CC 2Z8RA 5HYJB 1ED3B 3CH8A 3RZCB 3DXAD 1SY6L 4KHXL 3ULVH 4I0PD 4OF6A 5CCKL 3QULA 4L4VE 3VRLE 4C56E 2DTML 3FO9A 1R24B 4G6AD 4Y1AE 3V6OE 3DV4A 2WQ8A 4IMLA 3WFEL 1PZUB 2DJUA 3S4SB 1FC1A 1M7IA 2ZNWA 2XRAL 5DMIH 1SJEB 5FUZL 32C2B 3HI1B 3MV7D 1XCQB 4F7CA 5LBSH 3UTTD 3OKKB 4RMTA 3IYLW 1CGTA 4QRPA 4XI5C 3DARA 1I8KB 1J8KA 2APTA 5GGUA 2JJWA 1J8HD 5CSBA 2DMKA 4HJ0C 5C0CE 1FIEA 2XA8L 1E4KC 3C5ZC 1QSED 3WDIA 2YD6A 2ED9A 4AH2A 1A6ZA 1NFIA 3KPLA 3DJ9A 5HI5C 5DMIL 3RHWK 2BXZA 3E6HB 4M6MH 4QHKI 5J06A 3S3SA 4HMEA 1GVIA 5EPMA 3MZGB 2EDRA 4EN3C 1N3NB 2YK1H 1PG7W 1INDH 2AJZA 2FEEL 2ZSWB 2R2BA 3C8HA 3D9AH 3U2SB 1KACB 3BKCH 1P4IL 1T20B 3GMMB 1CL7I 1AO7A 2JK5B 3MA9H 3FQTB 3TFKD 1TVBB 1VPOL 4EDWL 4C57C 2EYTA 5D1XB 1Q72H 5DFTA 2HFTA 4NJAL 4CADB 3I75B 3VGAB 3GBML 3UTQA 4CMHC 5A2JH 4M1CD 5DHXB 1ETZB 3QXDA 4PV8A 1EFXD 4QHKJ 3LPFA 3TIDA 1IE5A 4YFEA 3D9AL 5C09D 1OLLA 3QJFB 3QPXH 4UAOC 3MV8E 2E6PA 2VE6A 2GK0B 5E9DB 1I9RH 5KANG 5T3XL 3DUUB 4RMVA 2YC1B 2H26B 4XNMA 4OSUL 4X7TB 1I75A 1Y0LA 1YEEH 3O3DA 3DGCR 1IGFH 1KJ2H 3HG1A 2BVQA 3LQZB 4HPOH 4XI5D 1XGRB 4MCZA 5DC4B 1AD9A 1IBGL 4BJLA 4HJ0D 4K7PX 1UYWH 4ZQKB 1OLZA 3C5ZD 3IDJB 4Q9QL 5EZOH 3RVWD 4ZFOB 3QIWD 2MQ3A 1B0GA 4RAVB 2E27L 3FT2A 3O2DA 1UA6H 5HI5D 4JB9H 1KB5A 4X6DE 1CDIA 2BY2A 1IGCH 2MPAH 4D0CB 2OQJB 4HPOL 4EN3D 1U3HC 4JFFA 5HHVH 2VDKL 4LCUA 3EO0A 1MCSA 3RY4A 1NSNL 1AGFB 2EIBA 1CI5A 4NWTH 2G60L 1CLCA 4LVHC 3OAUH 3RI5K 1UA6L 5CP3A 1IM3B 1QVOA 4QHLA 2OL3A 1NBYA 3O8XB 5ID1A 1X5LA 2MPAL 2DN7A 5KVDH 3H9SD 1A9BA 2X6MA 3MLYH 4Y5XA 3RPIA 3U9UB 2BJMH 3D69B 4JFEA 4XXDB 4B0MM 4Y4HB 2BFVH 3LSOA 1CQKA 5F9AC 1JZ8A 1FL6B 4ZTOL 4Z7QE 2YPLD 2VDOL 3MRNB 4NQCB 4HIEB 1WIUA 5CIPB 4HSQA 4RGOL 1EXUB 4ODHH 4D9QD 5IB5B 1FG2A 4Z18A 3G08A 3T1WA 5F3HA 3IAQA 3WIHA 3KPMA 3B2UD 4HFUL 4NCC1 5C92A 4G6FB 1R6VA 4IJ3C 3FB8A 2B1AL 1JI2A 2R56L 3MLYL 4JY4A 1F02I 2Q86B 2BJML 3WO4B 5HY9A 5D5ME 3BEVB 4YHYC 1RUAH 2VDRL 4M7LH 4NO0D 3V7AG 1U8PB 1GC1C 3K74B 4YX2L 4X6BA 5ISZA 2ZCKH 2DLTA 5ALCL 4CN1A 3VXSB 2ID5A 3HMWL 2YD2A 5I1KL 4ODHL 1EVTC 3HI5L 1N5AA 4PGEB 4G43B 4X7EC 4K23H 1T0NB 3TGXA 3KJ6H 2VZOA 4V1DA 1U3HD 4L4TB 2Z91B 4FQ1L 1X5IA 4HIIB 5GISL 2VXQL 1U92A 1ULVA 2CRZA 3TA3C 1R5VB 1HOCA 5DEGB 4QRPD 2XOTA 4DGVH 5BZWA 4WTZA 1P4LA 3QWOA 4LRIC 2B2XH 4GKZA 3CX5J 3MRIB 1BREA 3HUJA 4K8RC 1YDPB 4MD0A 3S5LB 4FQ2L 2UY7A 3EO9L 3QA3A 2EDEA 3UPCA 1R3KB 4G6KH 4Y4KB 3L3HA 5C2BH 2BSSB 3LS5H 3QDGD 4Q6YA 4NZJA 3V0AC 5ICZA 3BH8B 4Z0BL 3VE0A 5JQHC 1KIQB 5DVOA 3KJ6L 5DD5H 3HMXA 5EWIL 5TQ2H 3U0WH 1YEIL 1ITCA 3OKDA 4TQEL 5C0JB 1QSFA 2QQLH 4I1NB 4PJXF 1IAOA 4Z78A 3SDCB 3D39D 4OFKA 1Y6KR 5DFWH 4P2QD 1S7QB 1UJ3A 5FO9B 4O2CA 2V5TA 4Z7VA 6CGTA 1FVDB 3JSSA 4S2SB 4FXGB 4QHNB 4WTZG 3W9EA 3OR7B 3QJHB 2P43B 4U0RC 2CIIA 2AEPL 4L8BA 3NCYS 2VDQH 2DQCL 5JLZB 1JPTH 3WD5L 4Z76A 4ZOCA 3WXVL 1G7IA 4FQIH 5IHZA 5F7DA 2QQLL 2WM0A 1X5JA 4JHAH 4Y5XC 3STLA 4HX1B 5ITFA 4CVXB 1NUDA 5SWZB 4HH9A 1MWAH 3TPUB 1RULL 2VDNH 5F1NB 2MJWA 4HS3A 4X8JB 1BF8A 1D5MB 1YC7A 1ZHLB 4PGCB 3RKDC 2G5BA 3AB0C 4GG6A 2PYEB 4XBPA 1HZHH 1OARH 2FX8L 4B7LA 1A6VL 5KS9F 4OV5B 1D9KC 4FQHA 3MUGB 3TA3D 3VXUD 5GRXG 1K3IA 4LQ1A 1J1PH 3LOWA 4KGLA 2VR9A 2RIKA 3SY0A 2IPTL 1UXSA 4P23A 1U95B 3S37L 3UTOA 1F6AB 3OJ2C 2LFGA 4K8RD 5IB3A 1MJ7H 1MWAL 2H1PL 5AYUL 5FYJD 3T0EB 4X0KA 4J8RB 3EKCA 1QHPA 2L0DA 3RNQA 1OARL 1JYXA 1U8KB 3NCFB 4R7DA 2EYRA 5J13B 4DZ8A 3GMPA 4JG1H 3N06B 3FCTA 4OGAD 4XCFL 3N9GH 1OP5H 4JFFD 2ZUQB 3REVA 3OL2A 5KVGL 1RU9H 4YC2C 1MRFH 4HWBL 1KCLA 1FFOB 3MOQA 4U1MB 5DC0A 4ZSOA 5TE6H 4ZUVA 3D3VA 1VESA 4HJGB 4FNLL 2HFGH 3SGDI 4H1LH 4JFYA 4Q2ZA 4WTWA 3OHXA 4S1DC 5CJOL 1JGDB 1HWHB 3P4NA 1U93A 4GLRH 2EIEA 5I1CH 3VD7A 2YZ8A 5I2IB 1CFQB 1XR9A 5C70A 1U8LA 5KW9L 2Y5EA 4P4KC 3I2CH 4X4XA 1CICA 5ACLA 1I8MA 1FZOB 4LLQA 1RU9L 2EDYA 1TZGH 1MRFL 3RNKA 4JJHA 2NXZD 3VXOB 3ZDZE 1GPOL 3QDHA 4NQVA 3G5ZB 2XWTA 5IVZB 2D7NA 1YN6A 1NFKA 1ZVHA 3QIUA 4RDQG 4PRHA 5CZVL 5E2VH 1XGTA 3X3FH 3RKDD 2DDQL 2CD0A 4NRXB 5AWNH 3WJLA 1BIIB 1I4FA 2FECI 3TLRA 4BFGA 4BSWB 5FK9B 5HGAA 2C3VA 4G8EA 1YN7B 1NGZA 3O3AB 5I16A 4OIAA 4BQ6A 2FX9L 2ADIA 1TQBB 4KWUA 4PD4K 2X4TB 3RVTD 2EO9A 4L8CA 3L3DB 4G42A 1WTGT 4N0YL 1JYNA 5JXAH 2XYCA 3CX5K 5EORH 3VXPA 2H3NA 2X1QA 2ZKHL 4W68A 4A6YB 3MO1A 2OBGA 3HUJF 4PJ7E 2FDBP 3BIBX 3X3FL 4GRWF 4Q97A 3ULUC 4GG8A 4NQEA 5LKNA 8FABB 2VZSA