1NAMA

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
QKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRGDYGGSGNKLIFGTGTLLSVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM3.3 T Cell Receptor alpha-Chain
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2002-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namA00
4ZPVB 1R3LB 2MQCA 1KB5H 3WFZA 4GXVL 4WFEE 2QLVB 1VKXA 4XNZB 2QBWA 1CD0A 5C0BA 1RJCA 2E9WA 1NAMH 2JB5H 2P48B 3G04A 3HZKA 4MS8C 4X8JB 5I8CA 2FL5B 1KEMH 4NRZA 2APBA 3D3VD 1XGYH 3QCUL 1HEZA 2VDLH 4EZMA 1V5JA 3Q48A 4TOYH 1ULVA 4DVBB 3HI1B 1JVKA 2D7OA 3RGVB 2FLBT 3MRLB 1A7PH 2FJHB 4PP1C 5D1XB 1BD2E 3U36A 1WZLA 1X5YA 3CXHK 2CIKB 3U7AA 2R1WB 3NFNB 2ZCKH 5D70L 3O4LD 2NY2B 5SWZE 4XPHH 4E5XA 1NGXB 3QG7L 3V5HB 4Y5XC 2V5SA 2OQJB 5MI0C 1RUQL 1G9MC 3O2VH 1X5LA 3QDGD 4P59L 4FQJH 2HT2C 5DZNA 3QUML 5B3JF 4U3HA 2D7QA 1B2WL 3SJVD 5E9DB 3MRFB 5CEXB 4YHOH 5MHSD 4GXUM 2XXMB 5IB3B 1JI2A 1LDPL 2CDEA 2AJVL 4XNYL 4WFFD 3ARSA 3MLRL 1CICB 2HMID 5SWSE 3TH4T 1MFBL 4K9EL 4BUGA 1IAOB 1FGNL 1KCUL 5EBLA 4LDOB 5TPWL 2JK5B 5E8EB 2EO1A 1HXMB 2HLFD 4JZOA 1WWBX 1R5WB 4KMTH 3KPSB 2W9EH 1NGPL 4JY5L 1HI6A 5J6GB 4IRSA 2AJ3A 2P44B 4YFLI 1CCZA 1UG9A 1UFUA 4G8GA 2AQ2A 2BC4A 5JXEC 4OGAD 1IQDB 1IGCH 1ZEAL 3OJDA 1MCWM 1WSST 5TGBB 5CZXD 4J3OC 1YMMB 1TMCB 5K9OB 2BY3A 3ZTJG 4NP4L 3Q6FB 2VC2L 4O9HL 3HRZA 2P42B 5D7KD 2KPNA 12E8H 4M7JL 2J8UF 3REWB 5LXGH 3MNVB 5ICXB 3UC0L 4GRWB 4KXZH 4Y2DD 3B2UD 5C0ND 2D7MA 4HX1B 3VCLA 2NNAB 3MX0A 4F8TA 2HFFA 5IEHB 4MAYB 3HZVA 4PGDB 2XWBB 1WZ1L 5C0IA 4MQ7B 2Y07H 3BPOC 1NCAH 4MJ6B 1CDCA 4LLAA 4DKFL 4PRHB 2ORBH 1X5JA 3MFFA 3VJ6B 3QNXB 1IAIL 1FVEA 4Y1AE 3H7BB 4Y5VB 2DQFB 3D5OF 1DFBH 4J3SA 3MLPA 3EYUH 4QXUL 1WEJL 4WHDA 2YZ1A 3V4VL 1A1NA 4V1DA 3H9SA 1TVHB 1OTSD 3NOIA 4J8RB 2VLME 5D7LE 2WIIB 3GJFA 1QBLH 1QSFE 1VDGA 5ANMA 2NY6C 2CIIB 1J0YA 1HZHH 2ZUYA 4Z0BL 1YEJH 4JRXB 1UJ3B 5DXWA 3MPCA 3JVGC 1G0DA 2DMKA 2X4SA 4KRPC 4KTEL 4N1HB 4WI5A 3I6KA 1OAZL 1T4KA 1AHWA 2XZQH 3G6JA 5TQ2L 5L88L 4KXZI 3LD8B 4PS4L 4JO1H 2XWJB 4HIIB 5KSBF 3BHBB 2H41A 4UDUB 4P2OD 4ZUVB 4HGWB 3DX9B 4OQTH 2J5LB 4M62H 1I8LA 3C8HA 3WFCH 5B38G 4X0KB 4M48H 1X4ZA 4NN7B 1A7NH 4IRJD 3L9RB 1LVEA 3MV8D 2XZAH 3RL2B 3LKRB 4G5ZH 4JN2B 5EOCL 2BNQD 2IAMB 2NY0B 4IHOA 2XXCB 4ODVL 4L8SA 2FGWL 4L3ED 4ODTH 4WWKB 5DEGB 1ERNA 5I30L 1DQMH 5D1QC 2C5DC 1BQLH 4KZDH 4Z7WF 4KDTC 3KLAB 2EXYD 3IAQA 4DEPB 4OLUH 3ZKND 3QUZA 4GAYA 3HMXH 4Z18A 2KZWA 1GZQB 1SJEA 2RQ8A 4IDJH 4PRDB 4NZUL 2HLAB 5J12B 1G9ML 1H9VA 1M7IB 1T0MB 5DUBB 5DMKA 5C70A 4KJYB 2FJGA 3FO1B 3MYJB 2GTZB 4LSUH 5M94B 1R3KB 4M61B 1N8ZA 4FS0A 1JPGB 1T89C 1RUPL 4MA3B 5IR1B 5D4QA 3ZDYF 3X3FH 2RIKA 1I9EA 3TT3H 5TE7H 3SDDA 3QJFB 5CBAB 4JKWA 3MOQA 5F9OL 4L5FL 4OCWH 1FCCA 5E1HB 4G7YH 5JUEL 1JHTB 4XRCA 1LP9E 4YHZL 4Z7UB 4ZUWB 4NQDB 4J3VA 2CH8A 2YWZA 4NQCB 3K2UH 2YUWA 3NCYS 5T3ZL 3BKYL 5DRWB 5B8CB 3GSNL 4JKPL 1G6RL 3VDCA 3KYOB 2IALA 4EIZC 5I8EA 2FSEA 3RI5K 2GK0B 5J1TC 4I3RH 1SY6A 3MV7E 3D3VA 3HHRB 4OZFH 1UACH 4P49A 4XH2A 1UVQB 2DQEH 1G6RA 3GSRB 4GRLD 1M6OB 1MCOH 5TJWK 5DMIL 3QDJE 1V3LA 4JCLA 4P2QA 3RY6A 5INCA 3S3PA 2JIXB 5EUOE 3LH2L 1OPGH 3OHXB 1YECH 3DO7A 3LDBB 3MNWB 4WO4A 1RZ8A 5E8NB 3PWPB 2X4NA 5E08L 3VFMA 3DUUA 5A2IH 4YHPA 5ETUA 5DQ9B 4G9FE 3O6KH 4D9LH 3C5JA 3EDEA 1DL7H 1SYVA 3SDYH 3CVHB 5BMFH 2YOCA 3G08A 4DTGH 3HB3C 1NAKL 3RGVD 2R0ZL 5D1XD 2YD3A 1VGKA 2XWTA 4POYA 4UIMB 5A16A 1TTGA 3MRRB 2QEJA 3SDXA 4K3JL 2NY2D 1O7VA 3PDDA 4PJAA 1YMHA 3WNKA 4JFFD 1CIDA 3QG6B 1I9IH 3UYPA 3PHQA 4M93C 5DD3L 3FB8B 3IETB 3N1PC 4L1HA 1H8NA 4W4OC 3H3KA 2D9QB 3NIGF 4U6HA 2VQ1A 4NIKB 4CKVX 3P2TA 4DW2L 4IS6A 5DJXA 5E8PB 4JO3H 1EGJL 2WQ8A 5F6HI 5IK3B 3HC3H 1W8OA 5C0FA 2G5RA 1IGFH 3OKMA 1AO7E 3OB0H 4TUJA 2R15A 3VFWA 5IFJB 2VITA 5E9DD 2H1PL 3BGMA 3O9WB 2CGRL 5ITFA 2V7HA 1PYWA 1RHHB 4JZJC 4GKSA 4HDIA 1A4JA 4OCLC 1EGJA 5D72L 2VN4A 1F90L 3KDMA 3NTCH 4JRWA 1CDBA 3S34H 3BWAB 1V7MH 2H3NB 2F54B 4PD4K 1ORQA 2R29H 2OJZH 2YPKB 1IGTA 5B38A 3JVGA 1CQYA 5C0EA 5EOQH 1U91A 4MCYB 4Y7MA 3HC0A 3KLDA 5E2TL 3KPSD 2HA1A 3FN0L 1KTKE 3FO9A 4YQXL 3B83A 5HGAA 3U0WH 3C9NB 4FQLL 1PD6A 4M6NL 4PTUB 4Y16C 2B1HH 1N6VA 4K7PY 3VXUE 2XKNB 1HSBA 3VXMA 2D0HA 4PJBF 1MJ7L 1BHGA 3UP1A 2X9WA 5BV7C 4GXUN 4U6XA 4UILH 5CILH 1W0VB 4APQC 4Z5RA 1RIVH 3BW9B 2X1XR 1JE6A 5KS9F 1MFEL 3DNKA 3RTQC 1MWAH 3P4OB 4I8DA 3WJLC 1GAFH 3T2NL 3MODL 4PRPA 3D25A 4NN5C 3IKCA 4FHBD 4FP8H 4MNHB 1T21A 3VG0H 4HCRL 4QRPE 3P30H 1BAFH 1TXKA 4MAYD 1OWWA 3G6AB 2DLGA 1BOGA 1J7VR 1LWRA 1NJ9B 1JL8A 2ADFH 4MB5A 3V2AR 3K80A 1JJUA 2XQBL 4PRHD 2DIAA 3NFSH 4NSKA 4ORGA 1YPZB 2PCPA 3IU3A 3EYFA 4GJTB 1CFQA 2CRIA 1VSCA 3VFPB 1JN6B 1QSEE 3DGGA 2VLKE 3GIZL 4X7SL 3JV0A 4E0RA 2J3SA 2HJLA 3DRQA 2ZNXA 4YHIB 2VLRB 1T89A 2Z8WC 3QRFM 3BAEL 5EG6C 3U0TB 3Q1SL 4JRXD 4M7LL 1LO3L 1MEXH 3C6LB 1WWAX 4IRJA 2W1NA 1PZ5A 1ZA6A 5GGVY 3ARWA 2MPAL 3IS1X 3PWVA 3VWKC 1Z2KA 2R2BA 4R2GD 4NQVB 5EA0L 3VGBA 4L3EA 1U8HB 5I1CH 1IAKB 2FNBA 3WFHA 5TFSL 1NLDH 3CFJA 2OXGA 3MFGB 2VISA 3NCMA 3HPJB 4XVUC 4LLQB 4WHTA 3DMMC 3WD5H 2DBLH 1J1OH 2R56H 3GRWL 4ZAKB 4I77L 4DUWA 4HG4J 4HKXB 1CQKA 5FKAA 1EEQA 4OKDA 2VERN 4YHYC 5T5NF 3RRQA 1NUFA 1I7ZB 2IAMD 3O2DH 5ACLA 4QYOA 4XVSL 3EJZD 3GRWA 4WWKD 2MTPA 4XCYA 2NXYC 5DTFA 3U4EB 1QLEL 2XQYG 2V5TA 4L8CA 3RIFF 1XGRA 4LCUB 2AV7A 1JPTL 2HFGL 3LN5A 1T1ZA 3HFML 3W39B 1FPTH 3NZHL 4R3SA 5EORL 1IAIM 2GFBA 1FRGH 3CXDL 3WKML 2WSKA 3VXRB 3ZO0A 1JZ3A 5EO9A 1QQDB 1FP5A 1ZT4A 4JFHE 1C12A 3B3IB 4XP4L 2W60B 4I4WB 4X8XA 5C7XL 3UO1H 2VXTH 4FQHB 2H2SD 2J12B 5D96C 3TO4B 3BXNA 4I3GA 1LE9A 5F6HJ 3MCKA 1MCLA 4ZYKA 1EMTH 3MRPA 4HMDA 1R0AH 2CQVA 4TTDD 5FHBH 4NQCD 4ZMAT 3BKMH 3CXHJ 3QHZL 1R3LA 4OFDA 4C83B 3ARGC 4JZJA 3MV01 2QSTA 4I2XB 3VD7A 4AM0B 2V2XB 1AGBB 4WI4A 2VZUA 4X80L 4X8JA 3D9AL 4YWGH 3UJJL 2A9NL 5FUZH 5CJ5A 1HIML 5D71L 5GZOC 3QIWC 4DVBA 2ED7A 3HI1A 4UT6H 4RZCB 2IANE 4OZGB 1BVLB 2JIXD 3MRLA 3HLAB 2FJHA 5D1XA 3S96A 1H3XA 5BV7L 3NFNA 5H94B 2WAHA 2PYEB 3CFCL 1NGXA 3PWPD 1A02N 3V5HA 5L7XH 1B4RA 2JJSC 2OQJA 3OR7B 1HDMA 2AJYL 4Y5YB 5EU3B 5AUMB 1ZGLB 5E6IC 4KZEH 1TZGL 1WBZB 2FX9H 4MGXA 1UKQA 2P8PB 3SN6N 5DI8B 2EYTB 4GH7B 4EUPH 2DBJA 1BJ8A 2F19L 1A9EA 1GL4B 2HTKC 3UBXB 4DK3A 3CPLB 4HIEB 3JZ7A 4FTVE 4KI5F 4KVNH 3GMNB 1CFNB 5F8QC 5E1AA 5E9DA 4MAUL 3MRFA 5CEXA 5H2BB 1HWGB 4UBDC 4K55A 5IB3A 4JFED 1T1WA 1PW3A 5DZLA 3BIKB 4K23L 1CICA 4LOUD 3PNWB 5D2LF 1IM3B 1BWWA 2CO7B 2W0FB 7CGTA 1IAOA 3LEYL 2X1QA 4JPKL 3OKOB 1KCRH 2JK5A 4JREB 5E8EA 2ZUXA 1HXMA 2CLVB 1NMCC 4FQXC 1IC5H 4O51B 1FIEA 3Q5OA 4S1SL 1U8OB 5J6GA 4KK8D 3FN3A 3S3SA 3RWHB 1IC4H 5C08B 4LQFH 1K3IA 5GISL 1E4WH 4HF5H 1DQLL 1TPXB 3VD9A 2VH5L 4F58L 2HN7B 2F54D 3OPZL 1YMMA 3X17A 3ZKMD 5K9OA 1FSKB 2AEPH 4H0GA 4X4ZA 3Q6FA 3QEQB 5I8OL 5FFLA 3NMEA 3G6DH 4GG6F 3REWA 3T3ME 1ZLSL 4QRQB 1DUZA 5ICXA 3HUJF 3GHEH 3SGKC 5KVDL 3IFPB 5E2WL 5D7IE 2NNAA 5IEHA 4MAYA 4PGDA 2XWBA 4RGMB 5GGSY 2G2RB 4R7DB 4MJ6A 3C60B 3QCTL 2AABH 4PRHA 3VJ6A 3C5ZC 3QNXA 4BYHA 1IBGL 5TF1H 2BX5A 1WIOA 3H7BA 4Y5VA 2DQFA 4JHAL 4HFWA 4PJ7B 1XF2A 2FEEL 1RU9L 3K8MA 5KSAC 2ICEB 3L6FA 1TVHA 1NCUA 1MJ8H 4LP4A 4J8RA 4Q6IC 3ZDZF 5GRJL 3RVTD 3ARPA 1ZHNB 5CGYD 2WIIA 4CU7A 2Y6SD 4JY4B 3RKDD 5JMRA 3MCG1 3VFRB 1TZHA 5FCUL 3WHE0 4ZXBB 3ZT5A 4JRXA 3RZCC 1JNNH 5CCKH 4M6MH 4ISVB 1YEKL 2BVEA 3ZKQD 3ULSA 3ULVD 4GMSH 3MLTB 4E41B 3QPXH 5LCVL 3UTSB 2HKFH 4I3SH 4TSBL 2VLRD 2X1OA 4PPTA 3PWUB 1KT2B 1CXEA 2HVKB 3CX5K 2XWJA 4HIIA 3AREB 3BHBA 4Z0XA 4RBPK 1NCBH 4UAOC 4UDUA 3LPGA 4ZUVA 3B4NA 3Q5TA 3QCVL 3B2VL 1N6UA 1JWMB 3O3BA 1MAKA 1MIML 4LRNL 1LO5A 4X0KA 5E2VH 5I73C 3AU1A 3OAUH 3L9RA 5H37G 5IUSA 3G5VA 3VE0B 3RL2A 5JOFB 3LKRA 2BERA 4KK6D 2IAMA 1FFNB 2DMBA 1MRDL 3ZL4L 2CLRB 4OZHE 5DEGA 2HWZL 2NX5E 4WWKA 3ULUE 1I3RA 1QEWB 1NCCL 2V9QA 5T1DH 3KLAA 4ONHB 1TJGL 3QIWA 4EN3B 1MJUL 1YY8A 5CEZD 3GSNB 3MV9B 4ZAKD 4X9BA 4F9LC 5TDPB 1JGLL 1GZQA 4PRDA 2IC2A 3SKNB 4P5KB 1M7IA 1T0MA 3LHPH 5ACZB 5DUBA 4M7ZB 4HJ0C 1Z0NA 2B4CH 4UI2A 1FC1A 1QFUH 2PTTB 3JV6B 3FO1A 4C4KO 3TF7C 3MYJA 2GTZA 4CVZB 3S8WA 1D5MA 4OFPA 5BS0B 4B7LA 4M61A 5D8JL 1MCEA 4KUCF 4P2YA 5JPMB 4DQOH 4HPYH 3GBLA 4MA3A 4WDIB 5IR1A 2XKSA 4IMLB 4LEXL 2DQGH 2IG2L 3QJFA 5EO1B 4IOIB 1NSNH 5DK2A 3KPRB 2CKBH 1KB5B 1IFHL 1OARL 2A6IB 2FBJL 5IB4B 1JHTA 4Z7UA 4NQDA 3SQOL 4NQCA 3VXRD 3CFEB 3UPAA 1QYGL 1PQZB 5DRWA 3BX7C 4PJCF 5FKPB 5AYUL 3HI6L 3O3AB 1KUMA 2IPUG 3B9EA 1GZPB 4HWBH 4NJ9L 4LGRB 4OZIE 3TO4D 5EU6E 3D69B 4JEGB 4WTZG 1C5BH 2GK0A 4QHLB 4XPBH 3BPOB 4PGJA 1UVQA 3DXAB 3GSRA 4JFQB 1K85A 1FH5H 2R23A 3OR6B 3GZKA 1M6OA 3O0RL 3ARBC 2JJWA 1SBBA 3WNOA 3CDGB 2JIXA 1A14L 2ESVE 2IPKA 3V5KB 3L3DB 1LP9F 3OHXA 1CTOA 1EO5A 3RWGB 5HPMB 2NXZC 5BVJB 3PWPA 4N9OB 1JGVL 2EKJA 1UH4A 1MLBB 3QIUC 1IQWH 3FN9A 3QDHA 1TVBB 2RCSH 1NFDB 3QDME 4JZNA 4WUUB 4MA1B 5DUMH 3CVHA 2EDRA 1BZ9B 1KYOK 3SCMC 3FTGA 1E28B 1JMXA 4YZFE 3SGKA 1A8JH 4BZ2L 2PYED 3LZFL 4O02H 1NCTA 2C1OB 1FZKA 1M05B 4TSAH 2D03L 3WS6C 1XIWD 2G75B 4PRIE 3QG6A 3VXPB 3IDGB 3C2AH 4G8IB 4QO1A 4P3DB 2A0LD 1EZVY 4QY8B 3FB8A 4F57H 2D7TH 2ERJB 3FHAA 3BYYA 4PD4J 1MPAH 2O26U 4DZBB 2E7CA 5J56B 3D39B 4MNGB 5DA4A 5E8PA 1GGIH 3RDTC 4G6KL 2ZCLH 5IB2B 1I85C 4XCCH 3SE9H 1HKLH 5IFJA 3O9WA 1DBAH 1U41A 4H88L 5IVXF 5JMOC 5KANI 1RHHA 1BJ1H 2YPLE 1S3KH 4OLWH 2Z9TA 2OS7A 3G5YB 4QNPE 3CDFA 3IFLL 3BWAA 2H3NA 4KI1A 3FQXB 2AEIT 2EIDA 3WBDA 4I0PB 5GGTL 4MSWB 3A0OA 4U05A 4KDWA 5FYJE 2YPKA 4P5MB 4D3CH 5CJ8A 2QSQA 2A83B 4LASH 4P9ML 2DQHL 1X5AA 4MCYA 2VXVH 2AV1B 1E6JL 3C8DA 1A9BB 3SPVB 4MNQE 3ROOB 2GKIA 1I8MB 3C9NA 4Z7QE 5C09E 1UH3A 3SE8L 3NAAL 4PTUA 1AGEB 2HYMA 4DOHE 2XKNA 4HC1L 2BVUA 5F6IB 4HH9A 5FO8B 1N5YL 2JELL 3WXVL 4KK5C 1W0VA 4HMEA 1YEHL 3GMRB 3WNNA 2EC8A 3ZE1E 4HWEH 1CT8B 4PJEE 3L1OH 3P4OA 3QIBB 4QHKI 3WJJC 1JCKA 4ERSL 3M1BB 4LCWE 1UM4L 4U1LB 1VCAA 4M7LT 1AY1H 5CINH 2DKUA 5FDYA 3M8OH 2M8XA 4ZG1A 4MXQC 2W65B 2WBJC 1NJ9A 5AG8A 3AS2A 1L9NA 1BWMA 2R1YB 5D9SB 3WSQL 5EFIB 1C5CH 4KQ4H 1YPZA 3UBXG 5I15H 4YDJA 1AI1H 5EZIH 2A9MH 5ITBH 2E6JA 3VFPA 1JN6A 1EPFA 4NQSB 1DEEA 3TCLB 2XTJB 4YHIA 3F7VB 3MRIB 5EO0B 3H42L 4XHJD 1JMZA 3U0TA 4YBQC 5CMAB 3RIFK 4WTZA 4ZXBD 4RBPH 4DGIH 3GB7B 5DHVA 2YXMA 4HT1L 3C6LA 2VZVA 1LO0H 1VGEL 2QSVA 2X05A 4K2UL 4Y4FB 1KJ3L 3C09C 5T1LB 3QXDB 3HKFA 3NZ8A 4NQVA 2HT4D 3ZE2E 4UB0H 3RJDA 5IFAH 5DUPH 3QAZC 1OP3K 2P46B 4RSVA 1WQVT 1U8HA 3SDAB 1IAKA 3ARED 3PXJA 3HNSH 5C0BE 5C0AA 1Y6MR 5FM5O 5LGHL 5E4IA 3HPJA 1KCVH 3QXWA 4LLQA 4WW2C 4ZAKA 4PJ8B 2X4QB 3DPBA 1MRCH 5F88B 2VO5A 4HKXA 3B9KB 3MUY1 1D6VL 3ZYIA 4X7CC 4JAMB 3VD5A 1OM3H 3FHQA 3IDJB 3CIQA 1I7ZA 4S0TD 5DC0A 1BIHA 5EN2B 4PJGF 2V9TA 2DL2A 2JKXA 3T4AA 1MCJA 1Z9OA 3MXWH 3U4EA 4LP5A 5L6YL 5GS2D 1RZJH 4EN3D 4LCUA 4CRPA 1F6FB 5I0DA 3MV9D 3R06B 3ZLQC 4JDTH 3TBWB 3UMTA 1DVFC 4GKOA 4Q0XL 2JF1A 3VXRA 1JZ8A 4JQVC 1Q0XH 1QQDA 3U4BH 3WO3B 3GBNH 2VZOA 2W60A 3QQ3B 5BS0D 2B8OT 3U1SL 2WK2A 2A1WL 1MCNA 5C0CB 5JXED 3ES6B 3UJIL 2F58L 3TO4A 3TJEH 5J9PB 3WV0A 25C8L 3KPRD 2IBGA 3V0WL 3ZHLA 4YUEL 2Y9RT 1P4IH 4NZTL 1KTRL 4B41A 4K8RH 4J3WA 2J6EH 2YKLH 4P46B 5JIPA 1I85A 5J8OA 4JPVH 1H5BB 2Z31B 3DTXB 5HJ3B 4C83A 3GSQB 1H15B 1MIEH 4OTXH 3TFKD 4AM0A 2V2XA 1AGBA 3ZHKA 4D94A 4G8GE 2J4WL 4KROB 1UC6A 1OLLA 1FJ1B 4Z95H 5JORB 4QGTA 3BPCA 5D6CB 5E99L 4RGOH 3O3DB 3DXAD 3WIHL 1J8KA 1MELA 4RZCA 4OZGA 2ZP0T 1BVLA 3FCTA 3HLAA 5EZOH 1K8IB 4S1RL 4ENEC 5C6WH 5EU7E 1CLYH 3WXWH 5FA3B 3ILQD 1PZUB 3STLB 3OXRB 5FM8A 1S5HA 1F4XL 4OUOA 5H94A 3TPUB 2PYEA 4BM7A 4QTIL 1UWEL 4P9HH 2NTSP 3MRJA 3OR7A 4F7PB 4Y5YA 5EU3A 1XF4B 3LRGA 5AUMA 1ZGLA 4Q97A 4PG2A 1WBZA 3GDBA 4H5SB 4WUUD 4QHKJ 4N8VB 2DRUA 3MLXH 5CJQL 5DI8A 2EYTA 3PL6C 4NKQB 1JRHL 1RURL 5HHME 3UBXA 5LWYH 4KRPD 3EHBD 3GMNA 1IEBB 1VEMA 1BJ1J 2NY7L 5J11C 3ZZ1A 3PDGA 5H2BA 4HAFA 4I5BB 5FV1L 4HIXH 4V1DE 4YBLC 3H9SE 3IB4A 3SHSA 2HT3C 3BT2H 4F7TB 2ARJQ 4ODWB 3KJ4B 3KR3L 1YC8A 4PB0H 4UUJB 4D8PB 3PNWA 1FFQA 1IM3A 1FV1B 2W0FA 1DLHB 1RUAL 4PUBL 4XXCC 4M5YL 3W2DH 1REIA 3BRDA 4LAJH 2F8VA 5I2IB 3MUHL 2PXYC 3D39D 4KKLD 2P8MB 4NUJB 1ZHBB 5EC2B 2OI9C 2CLVA 1C5DA 3MJ7A 4HMCA 4O51A 4J2XA 4NZDA 4AEIL 3QUXB 1QSZA 1IZKA 1CD8A 3G6JE 4PBVC 4ZFOL 4X6DF 5E5MB 5C08A 3SGDH 1MWAB 1SBSL 5F7HA 5D1QD 5F1IB 2HN7A 3LN9A 1MQKH 4I0PD 2H32B 1X7QB 5CP3A 2EO9A 5GHWL 3QEQA 1L7TH 3TA3B 5I74C 5T3XE 2I60L 3IFPA 5DFVD 3VDBA 4I18B 1FQ9C 3BEWB 2ZG1A 2QADC 2DMCA 2G2RA 3F6LA 4R7DA 1BZ7B 1CF8L 3C60A 5AAMA 3CSYB 2GUOA 1OAYH 3EGSA 3HAEB 3QPQD 4FXLA 5DQJB 5D1ZB 2AJSL 3TO2B 5F71A 1WWCA 4AMKL 2IJ0C 4M7KL 4JFYB 1ZVYA 4M3JA 5ISZB 2A6JB 1U3JA 2EE9A 4EJ1C 3T3MF 2K9UA 3BP4B 2O5XH 4LSPH 3CX5J 5E0QA 4F33B 2SEBB 5DS8B 1DLFL 4OI9A 5D7IF 3SGDI 3VFRA 4ZXBA 1IC7H 4G9DA 4PGEB 1LHZA 4V2BA 2MNUA 4XP9L 2PKDA 2YC1B 1DVFA 3NABH 1WWWX 2XG4A 3U79A 5JQ6L 5CD5C 1BVKB 4JQVA 3OKDB 1N64L 2IQ9H 4L4TA 4E41A 5I1AB 5KN5A 4TSCL 1YEDB 1CWVA 2ZCHH 3UTSA 4NO5B 4F2MB 2XTJD 2Y5TB 4RISH 2AKRB 3UTZB 3PWUA 4R9HA 2HVKA 4MXVF 1CZ8H 3AREA 3EOBA 3GKWH 1OP3H 3D2UA 1CR9H 2GT9A 5T3ZE 4HGKC 5BQ7B 1OSPH 1TENA 5HDLA 3D3VE 3IFNL 1JWMA 3R8QA 3O45B 2VABB 2E6PA 3FONB 5DJ0A 3HB3D 4CU8A 4P2QE 4LPUA 3VE0A 4J7RA 4PLJD 5DJYA 5HVHB 5HHQB 4AZ8A 1FFNA 2CMRL 1INDH 2FGZA 4LLYB 5HYQB 3SDAD 4ZUTB 1FORL 1QFWL 2E8ZA 1QEWA 3BKJL 4U1GB 2DQCH 4N0FB 4ONHA 5BOZG 3MROA 35C8H 4EN3A 3MV9A 4ZUSB 2VQUA 1A6PA 3B9KD 4P5KA 3K1DA 3SKNA 4EOWH 4KJQD 5ACZA 4QRUB 1NMCB 3BESR 5JXAL 3AY4C 1M1SA 4HBCL 4WW1B 2W0PA 2F53B 2IH1B 3X3GL 3JV6A 5I17B 2C3VB 2A6KB 4CVZA 2R1XB 1AXTH 3SDXE 4YDKH 5BS0A 3OQ3B 4PJAE 5JPMA 1NAML 2JB5L 4JRYD 2XIDA 5E8DH 5EO1A 4IOIA 5CBEB 4QOKB 5DJAA 2A38A 2VB5A 2VDLL 3KPRA 1Z9LA 3DO3A 1MREH 1KB5A 3LOWA 4TOYL 4PJ9B 3TESA 4LCCC 2LU7A 3MRBB 1MCKA 3CFEA 4GW4B 4MJIB 4NUGL 2C1PA 1PQZA 2EECA 3E8UH 5FKPA 3O3EA 3O3AA 4CU6A 2MOVA 2YBRB 4LSDA 1RVFL 4XPHL 4Y16D 5HYJA 2VDKL 4M1GH 4QHLA 3DXAA 2PXYA 1IM9B 2E5EA 2NYYC 3BE1H 3OR6A 4LVNC 3C5ZB 4U0RB 1WCBB 1KYOJ 5T1KB 3JWOH 4P46D 1CU4H 3CDGA 4ZO7A 2OM5A 1INEH 4R7NB 1AD9A 3V5KA 3V7MA 3L3DA 4TVPD 2Q86A 3F12B 4XWGL 4YHOL 1OP9A 1T20A 1UM6H 1JGUH 5EH1A 3RWGA 5HPMA 1SHMA 5BVJA 4EUPB 4K3EH 3R1GL 3UTTB 3T1FB 1VEPA 5I1EH 4KROD 1MLBA 4KQ3H 3VXME 4LNRB 2YEZB 4CVUA 3C8KB 1TVBA 1NFDA 1QNZH 4WUUA 4FFVD 2MHAA 3O8XC 1UQSB 1AH1A 2P5EE 1BZ9A 4RGNC 4LVHC 4H25A 4JM2C 1E28A 4LDLB 3A6BH 4KMTL 4M5ZH 2FIKA 2W9EL 1DQJA 4PRPE 4NPYB 4X6CE 4EIGB 1S7RB 1MFAL 2C1OA 1M05A 1MAML 4DAGH 2YS4A 2G75A 3P3YA 2XPGB 4NKIH 3IDGA 4G8IA 4P3DA 2B0SH 4QY8A 1BQHB 2UWEF 5FGCE 4YAQB 4KHTL 4K94C 2VLJD 1MI5A 5BXFA 1HHJB 5A2JH 3D39A 4H8WH 5IHZA 3B9AA 1VESA 5IB2A 5C6TL 5K9JH 1PY9A 4XNXL 2FATL 4BH7B 5GS0H 5HHXL 1TFHA 4WV1C 4OZFG 3ZYOA 1ZA3B 4DWHA 2GEEA 3WLBB 3P9MA 1RZ7L 4QRRE 1Q9LB 1VFAB 1P4LB 5IJVB 5EBGA 2HVJB 3BQUC 4KC3B 5KG9B 2YD5A 4NNPL 1JF5A 4I0PA 2HKHL 4P5MA 4XVUD 3DMMD 1F97A 4JB9L 4I48A 4XI5D 1A9BA 3SPVA 4HJJL 3QWRD 4BSVB 5CP7A 4U1NA 5LBSL 3ROOA 3JV4B 3QUXD 4PJIB 3ARVA 1P2CB 1AGEA 4ALAL 3PDOB 4FZEH 4RFEB 2UVFA 4ZS6C 1F58H 1F8TH 5FO8A 1FE8H 1RAMA 4PJHB 3KYMB 3F7PC 5J13C 1BQSA 4JDVB 2FX7H 1N0LA 5IB1B 1CT8A 2BZDA 2VDPH 3IF1B 2OBGA 3VW3L 3QIBA 4ZSOB 4TN9A 1MCHA 3M1BA 6CGTA 3ET9F 4U1LA 3QYCA 2XZQL 3WFDL 4YK4C 1UKSA 4AQ1B 4IMKA 5C0RL 4PTTB 2YD2A 4JO1L 2KUTA 2W65A 3RL1A 2NQCA 4N8VG 5D9SA 4OQTL 1PX4A 4H0HB 2V5YA 2Y72A 4M62L 3WFCL 1E6OH 4M48L 1KELH 5EFIA 5D1ZD 1YN7B 4HUUB 3CLFH 1FNSL 3ARBB 3K74B 5JIKA 4O2CB 4O4YH 2NY3C 3N1QC 1OW0C 2XZAL 3UZQA 4G5ZL 1U8PB 4OQTA 5ISZD 3D85B 3SKJH 3ARGD 1HQ4B 3E6FB 4NQSA 5J6HB 2D4DA 4X5WB 5DJCB 3TCLA 4ODTL 1DUYB 5L2KD 3W81A 1DQML 5T5FL 4Z78A 4L4VE 3MBEC 5CMAA 3QIUB 1IKFH 5FIEA 3GB7A 2AXFA 1QBMH 5JOPD 4YPGB 3RVVD 4OLUL 1I3UA 4PJXB 2EH7L 4G6FB 3EZ8A 4Y4FA 1CN4A 3MRKA 4QHNB 1VPOH 4ZOAA 2BVQB 4IDJL 5IG7B 1V7NL 2UUDK 5T1LA 2CJUL 3ARFB 2D31A 3DECA 1GGUA 1G7MB 1FO0H 3KPOA 4QT5B 5BO1H 1NLBH 5CUSH 5DO2C 1JV5B 4KH2A 4LSUL 2HFEB 3WL9B 3HMXA 1H3VA 1H3UA 4J6RL 3RWCB 3SDAA 3X14B 2ZJSL 1YQVH 1MNUH 1UCTA 3X3FL 4O58H 1X5HA 1SVCP 5E6ID 7FABH 1I1RA 5DK0A 5BOPA 1JUFB 1Q9OB 5CEYB 1A22B 2C3GA 3F8UB 4OCWL 4PJ8A 1UM5H 2X4QA 4G7YL 5F88A 2YD1A 3B9KA 3RDTB 2HTKD 4WVRA 4JAMA 1CTNA 3K2UL 2R4RH 3IDJA 4UV4L 4OLXH 3P0GB 3TJHC 3ZTJH 4HGMA 4RNRB 2EE2A 2CKBB 5EN2A 2Z4QB 1KENH 4F7MA 3TH3T 4UNVA 4FQQB 1JFQH 1T0NB 4MLSA 1T03H 3ZE2F 1S5IH 1GC1C 4I3RL 1EJ6A 2LE9A 4LMQE 2VAJA 2A73B 5F7EL 3R06A 1K4CB 3CZJA 3O81A 3TBWA 4JM2A 4Y8AA 4BSWB 1DDHB 4GW5A 4Y4KB 2F53D 5D7JC 3MNZB 4K94L 1JGDB 1OPGL 1YECL 4OZFA 3RVWC 3VD3A 2NY4C 1T7WA 3CD4A 4F7CB 5E9DE 5DC4B 3QQ3A 2ZSVB 2EDQA 5DT1L 4LLUB 4RFOH 5E00B 3RWFB 5C0CA 4Q9QL 3ES6A 3HS0B 3GMQB 4JO2L 4BELD 1I9JH 4YO0B 5J9PA 3BEVB 1T83C 1OHQA 4B0MM 4QOKD 4D9LL 2FECI 3SDYL 5KAQF 3N9GH 1XFPA 1EUUA 4PJ9D 5MP6H 3U9UB 1G9NC 4P46A 4S2SA 4MJID 1P6FA 4UTAL 1H5BA 2Z31A 1ITBB 3NFPA 1CGSH 4IJ3C 3NN8B 3WNPA 1H15A 4P5TC 3RFZC 1A6AB 1X5FA 3EJYD 1ZE3C 1I7TA 1YYLH 1I9IL 3ZKXC 3QO0B 4Z7OE 4NDMB 2XZZA 3RVUD 1FJ1A 4LKXB 3QWQB 4PREB 3RY4A 1FN4B 3GNML 2WBJB 5D6CA 4PBXA 3HE7C 3O3DA 2J8UB 5KVGH 1IM9D 3MRGB 3C5ZD 5T1KD 1YMME 3O6ML 2OXHA 4YHLH 2DWEB 5SV3A 3QFJA 5ICYB 1K8IA 4O5LH 3BZFB 5IHUH 2Y7QB 1QKZL 4N8CH 5FA3A 5KSAD 3STLA 4M00A 1W0YT 3S4SB 2BVYA 3FO2B 4ZTOH 3RA7H 1J0ZA 4DGYH 4HKZB 1AGDB 3UTTD 4OCRL 4G7VL 3OKLB 1DANU 1FLRL 4F7PA 3SDCB 5I8KL 3W11C 1FFOA 1QFWM 1XF4A 4OUUB 4XC3H 2MCPH 5K9QG 3S34L 2XRAL 4H5SA 4N8VA 3UPRB 1Q9KB 3ZDXF 3NCBB 4PRHE 2EH8H 4BZ1H 3P73B 4GO6B 3V8CA 2NY1C 5EDXA 3FOLB 4KTDL 2HTLC 4CBPA 4ZFOB 3VI4F 5FYLD 5DLMH 1AGCB 1P7QA 1IEBA 5J57B 1KEGL 2GJJA 3NCJH 4I5BA 1U3HC 4GAFB 3U0WL 1U8MA 3UJTL 3GBMH 1E0OB 2B1HL 4U49A 1J5OH 4F7TA 4ODWA 3LVEA 5F96L 3MACH 4X7FC 4UUJA 5DYOB 4C58B 2XT1B 4UILL 1FV1A 1DLHA 1ZK9A 4MWFA 1QRNB 4Y4HB 1BIIB 1FVDB 2X41A 4JRXE 2OYPA 5I2IA 4M3KB 4NUJA 1ZHBA 5EC2A 2VR9A 1JPSL 3V4UH 3X11A 2XICA 1BBDL 4KRLB 1AD0A 1OW0A 4RA3A 5AWNH 3QWRA 5KSBB 2Z93B 1QLFA 1XR9B 4RWHA 3PQYB 4C59B 3HZYB 2BNRD 5JHDE 2OL3H 4JFDD 1FC2D 5E5MA 5A43C 2BCKB 1MWAA 4MX7A 2XN9D 3NIFF 4HBQA 2ADFL 5F1IA 1RIHL 2H32A 4X4YB 1X7QA 1H3PH 3NFSL 1FZOB 4Q58C 2C3XA 1CXKA 2YA2A 4JHWH 3WMSA 3TA3A 4OB5H 2P5WD 1T2JA 2B39A 3LS5L 3CSBA 4Z7WB 2ADIB 3CCHB 4EUPG 4PJDA 1TJHL 1U8LB 4DKEH 4DGVL 2G9HB 2ATKB 3VG9C 4X7EC 2YA1A 2DDQL 3MLVH 3LRSA 4TUKL 1BZ7A 2VDQH 5CSBA 1NMBH 4XPFL 3CSYA 3MUJA 1MEXL 4MJ4A 5DQJA 4OF3A 5JHLH 5JW5A 1V3KA 1SMAA 3FB7B 1GC1L 1A7OL 4PJ7F 3V4PL 4JFYA 5DC9B 2YPVL 1T2XA 1L4IA 2LAAA 4NHCH 2A6JA 4JFPB 3IJSA 1M7XA 4P0DA 3JUZA 3BP4A 5FGRA 3S35X 4ODXB 3T09A 5I1CL 3KYKH 3DSFH 1BQHG 4JQXA 3KPLB 3THMH 3AVEA 3W9EB 4G80B 4PGEA 1X5GA 5DD1H 1ONQA 3WD5L 4U1HB 1DR9A 2YC1A 5I1LB 3ARBD 4Z7UE 1BVKA 4NQDE 2UUDH 4HWZB 5F9WC 5I1AA 5F89B 3U2SB 3D85D 5DSCB 5I18H 4WY7L 1YEDA 2W92A 2Y5TA 3BUTA 2RB8A 3UTZA 1G9NL 1T83A 1OQOA 4MD4B 3NGBB 3QIUD 2OX5A 5EU5B 5HY9B 2X1WL 5BQ7A 2PN5A 3VGGA 3UTOA 3O2DA 1N6QL 2ENYA 1FFPB 1H3TA 3OMZA 4G6FD 3O45A 3QQ9C 4C54A 3FONA 3VFSB 1UXSB 5HSFA 4L9DA 4GRMA 1RULL 3ARFD 4RQQB 4LNVA 2GCYB 1YYMH 5HHQA 4ZNEA 4LLYA 4YDIH 3UO1L 4ZUTA 3C87A 2VXTL 3PWPE 1BM3H 1EZVX 1ITCA 4OCXL 3HE6C 3AAZB 3GEWB 4N0FA 1BREA 1TNMA 4HK3N 1Z6JT 2ZG2A 4MHHI 3MRQA 2QQNH 1GXEA 1II4E 2QL1A 3L3HB 4ZUSA 1R0AL 3RDTD 4QRUA 1OCWH 3WNMA 2AK1H 3BKML 4WW1A 2IH1A 4Q9RH 5AZ2H 2C3VA 2A6KA 5F44A 2PO6B 1OAUL 2R1XA 3MCLL 4FMKA 2DOCA 5IW6B 5GXBB 4YWGL 5KTEL 1P7KB 5CBEA 3FT4A 3R4DA 1F00I 5C2BH 1QOKA 3U0PA 3FJTA 5I75B 4PJ9A 5LGKA 5E6YA 2X09A 3MRBA 2J88H 2EIZB 4MJIA 3AGVA 4Y4KD 2F5AL 4NNYB 4NQEB 1I7UB 2XFXB 2YBRA 3DX7A 3RU8H 3QT2A 4KHXH 1F42A 1NEZB 1YY9C 1C1EL 4HUWA 1DBKH 2X70B 3BZ4B 3PUCA 5KVFL 3B5HA 3E6HB 3HA0A 3TNNA 3FMGL 2Q7YB 2FX9L 3V6ZB 1IM9A 1NMAL 2FLRT 1WCBA 3EOTL 4K7PL 3A67H 4BJLA 1CL7H 4J4PA 4R7NA 5IBTH 4Q9CA 2EEBA 4PJBB 2E9BA 3F12A 1QACA 1IEHA 1YNKH 2XZCH 1QHOA 1YNLH 4EUPA 5IMLB 3UTTA 2N1KA 3S5LB 3SBWC 4XC1H 4HAGA 5KS9B 3U9PL 4LNRA 3RVXC 2WBJD 2YEZA 1U8IB 3C8KA 3WUWB 1YEGL 2QSCH 1UQSA 4J3UA 5ILTL 1J0HA 4BQ6A 4HUXB 4JFZH 5LQBL 2GJ6B 3ABZA 2ZKHL 5DQDH 1OOAA 3OKYA 4NPYA 2XKUA 4HIJB 1R3IL 2P8LB 3NA4A 1S7RA 1KIPB 4FABL 3VD4A 1X3DA 3SDCD 2O61A 1KTDB 1E4WL 4GRWH 4HF5L 2MKWA 1BQHA 3CH1A 3GJEB 3MRMA 4ORZC 3QO1B 6FABH 4YAQA 4LLWB 1LK3L 4GLRH 4OAWB 4Y89A 5L0QC 1HHJA 1KN2L 4IOFC 4OM1H 1ZV5A 4ZO8A 4D9RD 5I1JH 1UJTA 1A6UL 1YPZE 4BH7A 2IQAB 5GJTH 3WS3A 1CL7I 1PG7L 4HS8L 3DRTB 4L9LB 3WLBA 1SEQL 3FFCB 2DD8L 4X6CF 1S78D 5I1DB 1EK3A 1Q9LA 2AXHA 5GGVL 5KANG 5IJVA 1B6DA 2G60L 4DFHA 1PAMA 3S37X 5KG9A 1QRND 4Y4HD 3V8OA 5TF1L 4ONFL 4PLOB 1RV6X 4HXBL 3MZTA 1U6AL 4X9HA 4BSVA 4GS7C 3CDYA 2JJTC 1WZKA 3JV4A 4PJIA 3PQYD 2VDRH 1RUMH 1P2CA 4GAGL 3VWJB 1QUNA 2LU4A 3PDOA 4XBPB 4RFEA 3OAYK 4ZS7H 2AGJH 3GHBL 1NDGA 5CJXC 5IIEB 4IOSD 4FFZH 2QQKL 3NIDE 4MA8H 3WIIL 5C0AE 2Q20A 3QA3B 4KMLB 5IB1A 2DQDH 5CEZE 1JNNL 4GLRI 4XCNB 4ZSOA 3WHE1 3VFVB 5DD6B 2R0WL 2FHBA 4S1DD 2FR4B 1E27B 4UT9H 1JHLH 5GJSH 2D9CA 5HI5D 2Q8AL 5J1AB 1KJ2H 4PTTA 5KJRL 3QEUB 1N3NB 4AIOA 4RRPG 5KVEH 4JLRB 4XNUH 1XAUA 3MXVL 4OF7A 4HS6B 4U1SA 2I25N 1S7WB 2IGFL 3OAUL 1YN7A 1YUHA 4A6YL 1HYSC 3S35H 2D7NA 4O2CA 5AAWA 3VXRE 3H2WA 4OJFH 1U8PA 1OAXH 3GI8H 5J6HA 1HHIA 1HQ4A 3E6FA 4G6JL 5DJCA 2LV4A 1N0XH 1DUYA 1IGIH 4G43A 4PR5B 4J1UB 5HHOA 4WEBL 5T1DL 5ENWB 4YGVB 1T7ZA 4YPGA 3QNYB 4PJXA 4JANB 2FHFA 3W9DB 4HIHB 4QHNA 2YD9A 5BRZA 5IG7A 3V5DB 5C0GB 3D0LB 2X4TB 3MRNB 3LHPL 4JVWA 1S9WB 2V17H 5I1KH 1NH6A 1G7MA 4QT5A 3WO4C 1QFUL 2BOCB 5GS1B 1JV5A 1KGCE 3U83A 3WL9A 1ZMYA 4HKBB 3RWCA 3X14A 2EC9U 4R97C 5GGQL 4AL8H 4NOFA 1L7IH 3CSGA 3R8BB 5A1AA 4LIQE 1JUFA 1GPOH 1Q9OA 4BKLB 1KN4H 5CEYA 3HZMB 2P49B 2X89D 1R5IB 4OZGE 1RZIB 2JCCE 1S7SB 3I50H 2YUVA 3RY5A 1B4JH 2CKNA 4X83A 4Z76A 4RNRA 1KC5L 2CKBA 2Z4QA 4ODUB 4OF0A 1A5FL 2JB6B 3T0EC 2PYEE 2OSLB 2IFGA 1W2KT 1T0NA 4U1IB 3ARDC 2NR6D 4LCYA 3IVKB 5D6DA 4DVRL 3Q2CA 5T33L 5GGRY 3IU4H 2A73A 1O7SA 4HWBA 2CPCA 3L3KB 4R0LC 3T2QA 4XAKD 1DDHA 1NUGA 4Y4KA 5SWZB 4U31A 1ADQH 4JPWH 4K07A 5D2LB 5E95B 3SO3C 4B5EA 5GZNC 2PO6D 2ZSVA 2W9LA 5HI4D 1GIGH 4LLUA 3MRHB 5EC1A 3RWFA 4AEFA 5I16B 3HS0A 3GMQA 4RMTA 3ZSSA 4C56E 4YO0A 1FLTX 2UZIL 3U46B 1BBJB 3L5XL 1EO8H 2UYLB 5EZLB 4J12A 2E9JA 5TQ0L 4KPHL 3L95A 1V05A 1VHPA 4JM4H 5CJOH 4GBXB 1IGYA 3U9UA 2ZUUA 3RWDB 3TN0C 2VXUH 4XNMB 5FXCH 3HG1D 5DMYA 5D2NB 2QR0A 2ZSWB 5IROC 3IDXH 3NN8A 1RZJC 4LQ1A 1A6AA 3H9HA 4K3HA 4TSAL 4O2FB 1A7RH 2OZ4L 2IPTL 2W38A 5HHPB 5SWSB 3RGHA 4NDMA 3X13A 5C08E 1ZLVK 3PJSA 4LKXA 2CXKA 4KMQA 1LO4L 4LLMA 3FO0L 2H45A 5DJZB 1D5XA 3AS0A 1A6ZB 4NFBA 4GG6B 2J8UA 2R4SL 1OP5K 1MPAL 3MRGA 3HUJB 1TJIH 3ZE0E 1J9CT 4MDJA 1GGIL 4KKAC 2ZCLL 2N4IA 5ICYA 1J1PH 2A2QT 3MJ9L 3NACH 3QEQE 5GS3A 2Y7QA 4LHUG 2YK1H 1HKLL 3O6FC 2WUCH 1RFDH 4FXKA 1AGDA 4HKZA 1S3KL 3ALPA 3OKLA 3OZ9L 1JPST 3G5ZA 4L8DB 4QEGA 3SDCA 1TTFA 3UTPE 4K8RC 5CJXA 1MHEA 1P53A 4RRPA 5I9QB 3HI5L 2E6QA 4RMVA 4H0IA 4Z7OF 2X5PA 3GI9H 1Q9KA 4L3CB 3P73A 4LASL 3FOLA 5DRZB 2GJ6D 2EE3A 3T1WA 3MBXH 1QTYT 1AGCA 1C08B 2H8PA 1NBQA 1RIUL 3ECBB 1EEUA 1NBVL 2Y1VA 3V79C 4H20L 1PEZA 3L7FB 1PBYA 4W70A 4NYLB 4JJ5B 4AG4H 2WMPA 4F15B 5HDBF 1QRNA 1FVDA 4P23C 1CD9B 5IKCB 4HWEL 3L1OL 4P9HC 1HXYA 4YX2L 5IMOB 3DSNA 3KLHC 4LPVA 2W9DH 5IBUB 2Z93A 5KSBA 3QWOB 1XR9A 1MY5A 5D7LB 5F7DB 3U6RB 3PQYA 4L4TE 3LCYA 2FIRT 5ALCL 4E41E 1UZ8B 3S37H 1NEZG 4Q6YA 3BVNB 3UTSE 3ULVH 4C57C 2BCKA 4Z8FL 1G7JB 3QEHB 2HJKA 3OAYH 1C7SA 2CUMA 3QR2A 2XY1A 3P0YL 4RAHA 4NT6B 4OGYL 3MGAA 4X4YA 2DQJL 4HWUA 1FG2B 4UV7H 5JZ7D 3CUPB 2EDYA 1BEYH 1EXUB 1MH5B 3T65B 4ZNCD 4ZOBA 2A9ML 4KY1L 4YFDB 5ITBL 2Q8BH 1JNLH 1A6TB 2ADGB 1CBVL 2BSTB 2ADIA 2NY4B 1JYWA 3VWJD 5JPNB 4N68A 3TYGL 2LTQB 3TGXA 2G9HA 4DN3L 3HNVL 5DF0A 1KXVC 1RZKC 1ZLUK 1BFVL 2AJZB 3TVMC 4DGIL 3QRGH 1D5BA 2EXWD 2E27L 3AS1A 3MV9E 1RZGB 5SWQB 2J7LA 3WKNA 4DN4H 1EHLH 5KW9H 4KU1A 2QQLL 1FL3B 4CGTA 3V6BR 3FB7A 4N0YL 2BVPB 3FKUS 4IIQC 5FOJA 3SE4C 2PF6A 3T0EA 4JFPA 4P5TB 4LVOC 5BS0E 4ODXA 4Z6AT 3PWLB 4H26B 4D2NA 4XMKH 3BZEB 3K8KA 5LGJB 3W9EA 1FAKT 3SE3C 4G80A 1FO0B 1HWHB 1A3QA 1KXQE 1LNUB 1Y18B 1KCVL 4PJCB 4OSUH 4R0LA 4U1HA 4HHAB 2KZ1B 1EBAA 1ZWIA 5I1LA 3CZFB 4P3CL 4PGBB 5FYKH 4X4MA 3V7AG 5JA8B 1DTUA 4M8VA 1OM3L 4HWZA 5F89A 3U2SA 1LO2L 5DSCA 4HUVB 4GXVH 4NBYB 4CDHA 1T04B 4LSRL 4TULH 1P6AB 2GAZA 1HNFA 3WE6B 3MXWL 5HYJE 3GSUA 4MD4A 3ULUL 4P57A 1DBML 5FO7B 3QCUH 3CK0L 5HY9A 3FB6B 3GMLA 1FFPA 1A6VL 1LP9B 4JDTL 2X89A 4RGND 1UXSA 3AMLA 2YD8A 4MQXC 4EDXB 4LHUA 3U4BL 3QULB 5D70H 2GCYA 3VFNA 1IKNA 3U7WL 5CWSB 3MLUL 2X44D 1A3RH 4KK9C 1RUQH 1K2DB 3DBXA 4FQCH 5EUKA 3MV7B 4CJ1A 1FYTA 3B43A 4P59H 4WI9A 1RMFH 4U6YA 3TZVC 5T5NG 1NFDE 4KKCC 3QDJB 4WENB 4X6BB 1UZ6E 3L3HA 3SJVB 1CFTA 1A1MB 3NH7H 4K8RL 4L8BB 2DJSA 2FO1A 2YKLL 3OXSA 5ID0B 2QQQA 2I5YL 4OCYL 4OIBA 4WFED 2OR9L 5IHLB 3EUUA 1LDPH 3RWJB 1EFQA 1MF2L 3BPNC 2AJVH 4Z7VE 2NMSA 3O2WL 4G9FB 4XNYH 2J6EA 3MLRH 4W6YB 5HI3D 1QR1A 1JWUB 4Z95L 5F1NB 4K9EH 5F97E 5JIHA 1P7KA 2ICCA 4XXDA 4KI5D 4X6FB 1JK8B 5TPWH 1MCQA 1MI5E 1BD2D 5IVXB 1KJMA 3BPLC 3RPIA 1HINH 3C08L 1KPRB 2EIZA 3W5MA 1NGPH 4JY5H 1ZT1A 1BMGA 5SWZD 4NNYA 5TF0A 3WXWL 1N4XL 4NQEA 5FGBA 2XFXA 3SOBL 2UY6A 1MHPL 2OJEB 4G3YL 4YIQB 1NEZA 4P9HL 4U7SA 2WWKT 1ZEAH 1U8KB 2X70A 1W72L 3MLZL 1ZLVH 1G0YR 3E6HA 2Q7YA 3E2HC 4U1MB 4Y0GA 3U30C 1G7PA 1A47A 3GSVB 5DHYB 3FT3B 3MLXL 3V6ZA 2XI9A 4PRAB 1OP5H 4ZFFA 2CDFB 2APWA 4GBXD 2I9TA 2VC2H 5DJ6B 3H8NA 1XCQB 1WICA 4PJBA 3TIDA 3RWIB 4MXWH 5IMLA 4OF8A 3UAJD 5SWSD 3BT2L 1WZ1H 2QKIB 4PYHA 5KS9A 5GSRA 4PB0L 1U8IA 3JTTA 3QH3B 4DKFH 5C3LD 1RZFL 3NPSC 1IAIH 1JNHA 1H8OA 1U36A 4HUXA 2JJUA 2GJ6A 1IEAB 1AE6H 2OR7A 1RZKL 1MHHB 1DE4B 3BP7B 2DS4A 1WEJH 4MJ2A 4LPWA 2NY3D 4HIJA 2P8LA 5F9WB 1KIPA 4V2CB 4J23A 2R2HB 5A3IC 1T66C 2R69L 3JWOC 2FRGP 3TVMA 3GJEA 4Z0BH 3QO1A 4AIZB 3F65A 1K8DB 4OAWA 4FXGB 4LSTL 5ERWB 2BRRL 2OL3B 4HXAL 4OF6A 4KTEH 3V0VB 5FYJL 1L7TL 3I9GH 1OAZH 4GOSA 1A1OB 4IRSC 2HRPL 4QRPB 1TIUA 4W81A 3Q5YA 1ODAA 3FFCA 3BP6B 1I4FB 5I1DA 4QRTB 5D7SL 4GAJL 1PEWA 3P4MA 5IBLC 5CKGA 2GYSA 4Z7NE 3HE6B 4Y1AD 3FFDB 1FDLH 3MSPA 4XBGB 5EU7C 2J8HA 3MV8B 1IAII 1ZTXL 1HQRB 1QSEB 2VLKB 3BDYL 1NDMA 2VLMD 5D7LD 1P84K 2PYFB 2FGWH 1D6EB 5I30H 3VWJA 4XBPA 3OKNA 3PP4L 3TV3L 1WTGT 2AQ1A 2Z91B 3KWWB 2B20A 3WDIA 1RJZA 2DWDB 5IIEA 1N5AB 2PNDA 1VERA 3X12B 4J3TA 1ZLUH 5TE6L 4NZUH 2EDKA 4OFVA 1G9MH 2EE6A 4G6AC 4XCNA 1HHKB 4ODSL 3BGFC 5B3NA 5DD6A 4JG1L 3CFKB 3PHOA 4POZC 5JLZA 3AC0A 2FR4A 1E27A 1U2HA 2NY4D 1HH6B 4Y19A 5DMJB 4XPAL 2W91A 1Z0MA 5J1AA 3QEUA 1CZ8L 1N3NA 3GKWL 5CIPH 4AEEA 1P4BH 4JLRA 3SO5A 2N7AA 1AXSB 2IFFL 5JZ7C 1DQDH 1KLGB 2BXZA 1CFSB 5JUEH 3BDXA 4YHZH 1S7WA 3EDDA 2EC9T 3OSKA 3SGEH 4XP5L 3DWTA 1AHWC 3DI3B 2AK4B 4KUCD 3GSNH 4HUKB 4KUZH 2YXFA 4JKPH 4MQSB 5C2UB 1WISA 4P5TD 1F3DH 2FYYB 4URTB 1DSFL 3C6SA 3VRLF 4YDLC 4NNXB 3SKMB 4PR5A 5C0CE 4J1UA 1XZ0B 1JGEB 2DQCL 5ENWA 3MO1B 4P99A 1I8LC 3MLYH 4MCZB 4YGVA 4HZLB 2X4PB 1WZMA 3HE7D 5F8RC 3QNYA 4JANA 4CADB 1A64A 3W9DA 3V5DA 5DR5H 5E4EC 5C0GA 3D0LA 2X4TA 2OTWB 3LH2H 1S9WA 5DWUH 2O93L 3P40A 1S9YB 2VQTA 5I76B 2ZUQB 2BOCA 4L8SC 5GS1A 2EICA 2AP2A 5E08H 4M6OL 3LPWA 3BD5A 1OF2B 1LEGB 4EI5B 5KSVB 3KJ6H 5ESQB 1JHKL 2NZ9C 3QUZC 1IAMA 4BKLA 4U1KB 4MA7L 1U95B 3PG2A 1CDHA 5C07A 3MA7A 3KXFB 1NAKH 5MEPA 3EDJA 4DFIA 1R5IA 1RZIA 4D0CA 3OB8A 1Q72H 3QFJE 1S7SA 1NFIA 3E8UL 3CU1A 3SGEI 4K3JH 3F7QA 1KPVB 4NHUB 3VXSA 2IMNA 3P9LB 1I9RL 4JFFB 4AH2B 1MJJB 4ODUA 4XWOC 3K3QA 1MCRA 4U1IA 3RJQB 3MV7D 2FZ3B 3EBAA 3SDDC 5MENE 3BIBX 3TYFB 3G5XA 3BIAX 1ES0B 3QDJD 2IANB 2YMXL 3PXHA 2L4OA 4WU7B 3ZT7A 3JWOL 4FFYL 1P1ZB 4XZUB 4HV8B 3BDBA 4GMTH 2CGRH 5SWZA 3P77B 3MJ8A 5D2LA 2JCCF 1XR8B 3FRPG 2D0FA 4K3EL 3MRHA 1Y0LB 5D72H 4G9FD 5I16A 4UIKH 1F90H 1KIRB 2VL5A 3TBSB 5GGSB 1BBJA 3WN5B 1FG9C 2UYLA 5EZLA 3QEGL 2VKXA 3GIVA 3VGHA 3RY6C 2ARJB 4GBXA 5IGXL 2B1AL 2B5IC 4FTVB 5E2TH 3RWDA 4X6DB 4XNMA 3A6BL 4YQXH 5D2NA 4WO4C 3T04D 4KKBC 5I6XC 3BN9D 4M6NH 2YSSA 2VMFA 1EVTC 4DAGL 4O2FA 4RMRA 3FZUC 4NKIL 5HHPA 4I0CC 1MJ7H 5SWSA 5HDQL 5AZEL 2ZZUT 3QI9B 2AVGA 1GCFA 5DJZA 2ID5A 1A6ZA 4GG6A 4R4ND 2OK0L 4ONGH 3HUJA 3QP3A 1RK0B 4U7MA 3T2NH 1SJHB 2BVTA 3MODH 4QLRA 1TCRA 2VLLA 1JIBA 3UCRA 1CLZL 2Q6WB 2CR6A 3S36L 1MCPL 4HCRH 1G9EA 3K4ZA 1KULA 43C9B 3P0VL 4WIQA 4L8DA 4PJDE 2HMIC 4BFIA 1TQCC 1CE1L 1EAJA 2XQBH 4LFHD 2YD6A 3PGDB 2MFNA 3O4OC 4RFNC 4L3CA 2HLFC 2NLJB 4BSJA 3ISWA 5DRZA 3LKOA 2YRZA 1AR1C 5EIIB 3GIZH 4X7SH 4Y2OA 5D7IB 3VXUD 4HPOH 4OGAC 5FF6B 4GKZA 2R8SL 1F58L 4QRSA 1T2QH 1FE8L 4NYLA 4JJ5A 5CZXC 2ZUSA 4M7LH 1C8PA 4FQIL 1LO3H 2FX7L 5IKCA 3QQ9D 2VDPL 1KB9K 5IMOA 4NO0B 4LHQB 5IWLC 4WW2F 3S97C 4R2GB 2DM3A 5HHVL 3QWOA 5DJDA 1QPXA 3U6RA 4QRPD 4WFGD 3B2UC 5F7DA 1QFHA 5C0NC 4W68A 1UZ8A 4UQ2B 2J2ZA 5BVPH 3BVNA 4U3XA 1G7JA 1FNFA 3QEHA 1EFXD 5T3XL 5TFSH 3ARDB 3S3JA 3JWDC 1VEOA 3HE6D 2OTPA 4NT6A 3P4NB 3MTRA 4XCEB 5EWIL 1M7DB 5DVKA 4YXKL 4I77H 1D9KB 2E7LA 4ZTPH 4HS3B 3CUPA 3T0VA 5FUCE 2ZG3A 4G8FA 1EXUA 1KJ2B 1Q1JL 1MH5A 4JKKA 4L1DA 1QSED 2VLKD 1ZXQA 3H0TB 1A6TA 2ADGA 2H9GA 2UVEA 5D5MA 4WCYL 2DTMH 4XVSH 2V2WB 4PGCB 4DKAA 5JPNA 1UH2A 1NGZB 1YEIL 5C1MB 1QLEH 4ZNEE 4LPCA 2VWEE 4EXPX 4K71B 5ICZB 4BQ9A 3M45A 2AJZA 2GSIB 2QV2A 2HFGH 3BMWA 3HFMH 5L8JB 3BI9X 1QBML 1QRKA 3EO1B 5EORH 3RUGE 1RZGA 5SWQA 4X98B 1J8HB 4OV5B 2BVOB 1FL3A 2BMKB 4NBZB 2BVPA 5I19L 1F3DJ 1NLBL 4XP4H 2GSGB 1BFTA 5C7XH 1PKOA 4OD1L 3FRPA 3IAPA 5I0ZA 3T0DA 1YY9D 3WLWC 4YEEA 1QLRB 3PWLA 4H26A 3BZEA 1J88A 2EKSB 4MD0B 5LGJA 1I3VA 1FO0A 3D1MC 4AY0A 5ADPL 5CZVL 4PJCA 2BJML 5C9JA 4IRJC 1CDIA 1Y6NR 3EO0B 4CW1B 4HHAA 3CZFA 4PGBA 1SY6L 1OB1B 3SY0B 1V3MA 2AK4D 5IT2L 3QHZH 4MJIE 4FQ1L 4OLXL 4DKDC 1MRFL 1I1CA 1UB5B 1MCWW 1T04A 1J0JA 1E4JA 4RIRB 1KENL 1XF3B 4WUKL 4OGXL 1GVIA 4PRBB 1JFQL 3WE6A 4X80H 4X7TB 2K7PA 3D9AH 3GSOB 1KCKA 1B9ZA 1DJSA 3DVIA 3AXLA 2A9NH 3UJJH 5FEBA 5FO7A 1HIMH 5D71H 3ZKNC 3FB6A 3BN3B 2Z0BA 5D93B 3VGAC 5ID1A 1JZ4A 2G5BB 3RAJL 3L5WB 1BQUA 4JFHD 3O4LA 2FD6L 43CAB 5ESVA 4ETQB 3CFCH 5CWSA 4NM8L 1VFUA 3QUYB 3QDGA 5HGDB 1HSAA 5B22A 4TVPH 4EI5D 4UINL 1UEYA 1KG0B 3T4YB 3W0WE 4NM4L 3QHTC 3OGOE 3UROR 5CSZA 4YEFA 4KV5F 3QDJA 3WFBL 4OD3L 1SYSA 4X6BA 3KXFD 5F1OB 5MP6L 2FJFB 4IOFD 3SJVA 1Q9WB 4L8BA 3D87B 2BDNL 1CG9B 5C71A 4MHHG 3AB0B 3DIFB 1A7BA 2XYCA 4MAUH 5FYLE 1CGSL 3O11B 1ED3B 4JFEB 2H26A 1DBBL 1EJOL 2UWEB 2FBOJ 1HHHB 4JFXB 5FECB 1MCDA 3EZJB 4XVJL 1H0DB 1YYLL 5B39B 1OVZA 4K23H 4CMHC 3QDMB 4XTRC 1JWUA 1RUKL 1QFPA 4GRLC 3LEYH 1MVUB 1WFOA 3KG5A 4R4FH 4X6FA 1JK8A 3K4AA 4JPKH 2IAND 5KVGL 5IVXA 5HBBA 1HE7A 4YHLL 5F9AC 4X4XA 3KPPB 1UZ6F 4S1SH 3RNKB 1M71B 4TUOB 1K3ZA 3PGCB 4PRIB 4XNZC 2OJEA 2GI7A 4DGYL 4YIQA 4NO3B 4RAUB 3FQRB 5DRNB 1U8KA 5GISH 3MA9L 3QXAA 5BJTB 1DQLH 2VXQH 2VH5H 4XC3L 4Z7VF 3OPZH 4U1MA 1QBBA 1VENA 3GSVA 3FT3A 5DHYA 3VXOB 3T3PF 3OG6B 4S0SD 4PRAA 1CDJA 3RGVC 2EH8L 2CDFA 3FT2B 3GO1L 5D1XC 4FTVD 5DJ6A 5IWLA 1T6WA 2Y5EA 1S7QB 4EQ3A 3HMWL 1XCQA 3JWDL 4Y2DA 5DK3A 5C8JA 1I1AB 1PLGH 2NY2C 2YPLB 2ED9A 1MQ8A 2H6PB 3RWIA 4P4RB 1L0QA 2X9XA 2L7JA 3NCJL 5E2WH 4PJIE 3H9ZA 4JY6B 3JTSB 4FFWD 2QKIA 3MACL 3FQTB 3QI9D 1ACYL 1IBGH 1UWGL 4QTHB 1EHNA 1F4WH 4JHAH 5F70A 1IEAA 2H32H 5AWNL 1FBIL 1F6AB 5FM4A 5HTSA 4HJGB 2Y4SA 4DOHB 3QFDB 5F9DC 1X44A 1CICC 2R2HA 1KNOB 5K59E 1L6ZA 3LN4B 4DZ8B 1OSZB 1HILB 5I66B 2BSRA 2C7UB 4PJEB 1PSKL 4FXGA 1S7TA 3I2CL 5ERWA 1X4YA 1FNGB 2OL3A 4YC2B 1YEKH 3V0VA 3RKPA 4JHWL 4PRNB 1A1OA 5F7UA 2Z8RA 4LEOB 3HAEH 1P84J 4DUVA 1S7XA 2F15A 1GGCL 5LCVH 1BPVA 4TSBH 4WJ5B 3BP6A 1I4FA 3MQIA 4P2OA 4DKEL 4QRTA 5E5UB 5EBMB 1S7UB 4HUNB 3QCVH 4LSSL 5HHOE 5DJ2B 3B2VH 1NMBL 2IBBA 3FFDA 3L7EB 2XA8L 1MIMH 3K46A 3QJHB 4XBGA 4P3WA 4PJXE 3MV8A 4NO0D 4U6VH 1MFDH 1DQQB 4HLJA 4LU5L 5BRZE 1HQRA 2BNQA 5CD3A 1MHCB 1Z5LA 2YD7A 2Q7NA 4OLVL 1YNTB 1MRDH 3ZL4H 1F2XK 3KPQB 4P4KB 2GY7B 2HWZH 2ICWI 2M26A 2NTFA 4MAYC 5KZCD 4F7EA 5F9JA 5A2LH 2Z91A 1R5VB 3KWWA 2E8YA 1NCCH 3DSFL 1X5XA 2DWDA 3ARDD 1N5AA 3GMOB 5FA4B 4OFYD 1TJGH 3QQ4A 1MJUH 1INQB 4N0CD 3IXAB 4Y5VC 5DD1L 1B0GB 1D9KD 1JGLH 4Z7NF 1AC0A 3BOVA 4PJGA 1F45A 5SX4H 3DOSA 4U0QB 1HHKA 1A4KA 1JF6A 2VZ1A 3CFKA 1NGQL 3F7RA 5I18L 1HH6A 3CX2A 4JE4B 5GZND 3LIZH 5D8JH 3DETD 4ZOCA 3G04B 2A77H 5I8CB 3MC0A 2RAMA 1S9VB 4LRIA 5B3JE 2APXA 1UGNA 1UJ3C 1HEZB 1AXSA 1KLGA 3IDYB 1CFSA 1OARH 2FBJH 1FCGA 1NCWL 4GQ9L 1J8HD 1QYGH 2WV3A 4AQOA 2AK4A 1OGTB 3TN0D 5AYUH 3BSZL 3ULUD 3TP4A 4E5XB 2WZPD 2BHYA 3LD8C 2FYYA 3VFTB 4YDIL 4NNXA 3RWEB 3SKMA 2JJVA 1JGEA 3LKNB 4GRLA 1YEFL 2J5LC 3MO1A 3M17A 4MCZA 4HZLA 1F4YH 4NN7C 1Z3GH 1FIGL 2QQNL 2VZSA 4CADA 3I6GB 3LQAC 4ZPVA 2OTWA 1OCWL 2AK1L 1B90A 1S9YA 2IAMC 2NY0C 5SX4I 5I76A 5JW3L 4Q9RL 5DRXB 3QUMB 3O6FD 5AZ2L 3EJZC 4LPXA 4WWKC 3CMOL 1JGVH 5AG9A 1SJXA 2FL5A 3LPFA 1OF2A 1LEGA 1LEKB 1FGVL 4EI5A 1G6VK 5KSVA 4LSVL 4DEPC 5ESQA 2DLEA 4U1KA 4KDVA 5C2BL 1U95A 3RGVA 5J12C 2J8UE 4XP6L 3KXFA 1CXFA 1SVZA 5MEOB 2CIKA 1A0QL 4JZOB 2Z8VC 2VYRE 2R1WA 2J88L 1XIWB 5K9QI 2MMXA 1D7FA 3LZFH 4R8WL 1G7QB 4BZ2H 1XH3B 3P9LA 5E03A 4JFFA 2D03H 4AH2A 1MJJA 1KCLA 2H2SC 5EU6D 3QUYD 1K4DB 2GJZB 4OIIL 1DBKL 3OJDB 3TYFA 5FUOL 4F80A 1RD6A 1ES0A 1MAJA 2R0LL 2IANA 3T0XA 4TTDC 3Q6GL 4WU7A 4G6KH 4KJWC 5B21A 4XZUA 4MJ5B 5B8CC 1CYGA 1K5NB 4JFOB 3LS4L 5HYFA 1HH9B 2Y06L 4H88H 1XR8A 1YNLL 5FYLH 1Y0LA 3VGDA 3HZVB 4JQIL 1KIRA 3QDMD 3TBSA 2LAGB 3WN5A 2W07A 4BQCA 4OI7A 5GGTH 3LQMA 3DYPA 2QSCL 1R5WA 1QRNE 3KPSA 2DQHH 2ARJA 4JFZL 1WAAE 5DVOA 2NY5H 4X6DA 3LDBC 4TRPL 1IQDA 4PRID 3NAAH 3SE8H 5KSBE 1J1XL 2VUOA 3KPMB 1PGRB 4HC1H 1YDPB 5TGBA 3GJFB 4RMSA 1N5YH 2JELH 1IL1B 1KXTB 3WXVH 4XPGH 1CGXA 3QI9A 1YEHH 4LAQL 3T0AA 5DVMA 3VFUB 1WTLA 2AJUH 4NOBA 1RK0A 3MNVA 3KLSA 1SJHA 2ICWJ 4ERSH 3I6KB 3A6CL 2VAAB 3TEUA 1I1AD 2Q6WA 5FDWB 2YPLD 4HX1A 3GM0A 4PJFE 4MQ7A 4PGZA 1J12A 1GHFL 3WCYA 3LQZB 4JO4L 3VRJB 2CRZA 5FYJD 4YGAB 4FZ8L 4R6UA 2ED8A 3WSQH 1XGUB 2NLJA 2CK0H 1KB9J 2EDHA 4Q7DA 4ELME 1EIBA 1MCIA 1R3HB 3O9WC 5C09D 5EIIA 4KK8C 3ZDYE 5FOBB 3UPCA 1RUML 3T0EE 3H42H 5B39G 3MOAL 1TNNA 3ZT6A 4ZS7L 2AGJL 2CIIA 5CS7A 1YA5A 5F3BB 2CD0A 3DARA 1UJ3A 2EZ0C 2CK2A 4HT1H 1VGEH 5GRUL 4GAYB 2AEQH 3ETBF 1F13A 3GSWB 1KLFA 4LCWD 5DMKB 5C9KA 3VRIB 3OL2A 2BRQA 4X4ME 4MQXD 2FJGB 3HNTH 3DYMA 1NCDH 4EKXA 4LARL 2V5MA 4UT9L 4Y5XB 4UQ2A 5MI0B 4KTYA 3LQAL 1FNHA 4HGWA 3DX9A 2IWGA 5KVEL 5LGHH 4QHUB 3P4NA 3MRCB 4XCEA 2BXYA 1QVOB 1KFAH 4HS3A 3PWNB 1MFCL 3ZYZA 1KJ2A 4JN2A 4LCIL 5CIPB 4N1EA 4G6ML 5HVGB 1OAXL 3GI8L 3Q3GB 4P4KD 2XNAB 3RVTC 2V2WA 4PGCA 1NGZA 5DGRA 2Y6SC 1WVZA 1UA6L 1ZHKB 5GRZA 5L6YH 1FYTE 2GSIA 2YRLA 2BK8A 1G6RB 2HLAA 3DX8B 4KJYA 3ALXA 3ULVC 1J8HA 4Q0XH 4OV5A 5INDB 2BMKA 3DX6B 5I1KL 3DO7B 1R3KA 1JPGA 2GSGA 1E4KA 4XVTH 3U1SH 2A1WH 4AEHH 2F58H 4X5XB 4YHPB 5FYKD 5CBAA 5ETUB 1QLRA 3S88H 4AL8L 3EOAB 4MD0A 3C6LC 1O0VA 1GPOL 4YUEH 4ZUWA 3SQBA 3G08B 1DEDA 3EO0A 4KGJA 4QXWA 2IADB 1KLUB 5B8CA 1OB1A 2X6MA 3SY0A 1YZZA 3VXTB 2VKWA 4JDZB 1I7RB 4KK6C 3KYOA 2Q1EA 3RUGF 1B4JL 1G1YA 3SDXB 2R9HC 5HYSB 4YJZL 1UB5A 4NQEE 4RX4D 4PRBA 4ZDHB 2J4WH 4X7TA 3V6OA 3GSOA 3PHQB 2OP4L 3OJVC 3U7YL 5E99H 3WIHH 3DVFA 4U6HB 3IU4L 4ZAKC 1FHGA 4IS6B 4RFNB 3IDNB 3L5WA 1AFVL 2A74B 5C0FB 4S1RH 3MNWA 1OL0A 3R0NA 5LVEA 3CVHL 1WFUA 3VFWB 43CAA 2VITB 4N5ED 5E8NA 5ITFB 2V7HB 4R26L 1I3GL 4PJBE 4QTIH 2AJXL 4GKSB 5B4MD 1A4JB 4U6TA 5DQ9A 1GIGL 4KKNA 5HGDA 2ZNWA 1T66D 3CAFA 2NY6B 4XNQB 2O5YH 1KG0A 3T4YA 5IQ9B 5KS9E 1ADQA 4MDIB 5CJQH 1B6UA 3ARTA 1K6QL 3HR6A 2H2PC 5C0EB 1JRHH 4KRPB 1RURH 4JM4L 1Q9WA 4UIMA 2XOTA 1CG9A 3MRRA 3MLWL 1ZHLB 2VXUL 2AERT 5EUOF 3DIFA 3AM8A 2NY7H 3FO9B 2ADJB 3TH2T 5HGAB 4JFEA 2UWEA 4G8GD 2OMBA 4JFXA 3TO4C 1CD1B 3ZYJA 1A7RL 1H0DA 3IETA 5B39A 3VXMB 3KR3H 1KTLB 4FQ2L 4U6XB 2V7NB 2YD4A 1RUAH 4PUBH 1QPPA 2P5EB 5IK3A 1LE5B 1CK0L 1TJIL 4UT7L 3QHFL 3SKOB 3FB5B 4PRPB 3KPPA 4ELKB 4X6CB 3V7AE 1M71A 4TUOA 3IKCB 3PGCA 2C26A 1RFDL 4PY8I 5C0JB 5D1QB 4NO3A 4RAUA 3FQRA 5KAQG 5DRNA 1SBSH 3TM6A 2DLFH 3FFCE 5BJTA 4KGLA 2F54A 4NC1E 4ODHH 4CL7A 4N0UB 2QHRL 3VXOA 4G42B 4M1DL 1VFBB 5GHWH 5HHMD 5I1HH 3K1KC 3PGFL 4JG0L 1HOCB 1S7QA 4XP1H 1JRHI 3N0PB 3JSSA 3RHWF 1UT9A 1QO3B 1I1AA 3INUL 3STZB 2H6PA 4V1DD 3H9SD 4P4RA 3ZKSD 4E0RB 4QRRB 4Y5YC 4JY6A 2BNUB 4O00A 3JTSA 2VDOL 4PG2C 1J10A 1RSFA 2X4RB 3IKKA 3FQTA 4JGUA 1CF8H 3BW9A 2WWMC 3AFLA 4NQXB 2WBWB 1OAKL 3S98A 1V8HA 4JR9L 3MMEB 1MUJB 1WC7B 2AJSH 1CXIA 4AMKH 3WDHA 4MNHA 3BZDA 1F6AA 4M7KH 4HJGA 2R2BB 3G6AA 1V3JA 3S37L 1G7IB 3ULVL 4Y19E 4KAQH 1FNAA 1KNOA 1DLFH 3CFJB 4DZ8A 1IGMH 1OSZA 1HILA 1MY7A 2VISB 5I66A 4JREC 3OKEB 4WHTB 5SV4A 4XP9H 1NL0H 3V52L 4OLYL 2QTEA 4TQEH 5ABDE 5LG1A 1XEDA 4PRNA 4WI2A 1N64H 3QBTB 4LEOA 5T3XD 2Q8BL 5IFHL 2OLDA 2NCMA 2VLRA 4TSCH 4WJ5A 4EEEA 2DIJA 4MS8D 1TPXC 2L0DA 1CE6B 3EAKA 4M03A 4L8CB 5CLTA 3CDCA 1S7UA 4XBEL 4O2EB 3BH8B 5DJ2A 2AV7B 2NZIA 3IFNH 1FSKC 2NZ9D 3QUZD 4U33A 4I9WD 3UZEA 1WT5A 3SEPA 4PP1D 3RPKA 4YHKH 1E4XL 4XAWH 1EHLL 2DKMA 1DQQA 5EO9B 5CEZL 2J1KA 5HGGS 3PHSA 1YNTA 3BKCL 3KPQA 4P4KA 4RGMC 4WHCA 1FORH 4L4VB 1O5DT 1QFWH 1R5VA 4M93B 2YA0A 1L0YA 2HT2D 3C60C 3SDDD 3D18B 3DYOA 4M9PA 1INQA 3IXAA 3H6JA 1BX2B 4OSUL 3H3PH 3UDWA 1KPUB 5C07E 4J3XA 5JXAH 2A6DB 4YHML 3HC4H 1MOEA 4JZJB 2DQUH 4K7FB 4NJAL 3VXSE 3RBSA 3QXUA 4TULL 4OT1L 4XHJC 1A6WL 4JRYB 4QXGL 1FAIL 5CJBA 5T3ZD 1S9VA 4ZXBC 3W39A 4IRZL 4NQUA 2XV6B 3CU7A 4KI5E 4P2QD 1BLNB 3F7YB 4NUGH 3S96B 1OGTA 3B3IA 4I4WA 4CJ0A 2HT4C 1I1YB 3OJMB 4WO4D 4Y16B 4FQHA 4KKBD 1RVFH 1GOGA 5D2LE 3VFTA 4RX4A 2VDKH 3AREC 1HDMB 4HKJB 1A3RL 3FZUD 3RWEA 5BV7B 4FQCL 1WJ3A 3LKNA 4RWYH 1QFWI 1RMFL 4APQB 1JBJA 3NCCB 4N0RA 2X4OB 4S1QL 2EEAA 3RTQB 4LIQL 3I6GA 4BK4A 1A9EB 3NH7L 2WIMA 3ZMRA 4PY8J 4P48A 1ZSDB 1JZ5A 4I2XA 2GHWB 1TETH 4G8EB 5E1AB 4NN5B 5DRXA 3QUMA 4XWGH 5D2NE 1NC2B 2RBLA 3R1GH 3QUKB 1T1WB 4CDGC 1LEKA 4D9QE 1R24B 4EN3C 2FH8A 4ZD3L 3NA9L 1NUDA 4GG6E 3GFUA 3A6OA 1CFVL 1DZBA 5HXMA 5MEOA 3OB0K 3HUJE 1HINL 4M7ZC 1KOAA 4AENB 3H3BC 1MLCB 4HK3J 1AR1D 1XIWA 1G7QA 1MFAH 1XH3A 1MAMH 4IM8A 4I13B 3OKKB 4XB8A 5IESL 1K4DA 2GJZA 4KVCH 4LVEA 2P8PA 2NY6D 2VLJB 4M43L 3BJLA 4KHTH 1GGBL 3TWCH 4NGHH 3V6FB 5IJKA 1ZGLP 3CPLA 3LKQB 4HIEA 1UCBL 5DGQA 5C6TH 1CFNA 4XNXH 4NFCA 2FATH 4MJ5A 3VWKB 5HHXH 3ZDZE 1K5NA 4JFOA 4GSDH 1DUZB 1HH9A 4NZRH 3TFKC 4MXWL 2DB8A 3VMNA 1KACB 3BIKA 1FFRA 3QSKB 1RZ7H 3VXMD 5ANME 3VGEA 5AYQA 1GOHA 3OKOA 3EO9L 4NNPH 2CDGB 1CVRA 2P5ED 4KFZC 3DMMB 5IW1B 5L9DL 2HKHH 2X7LB 5DD0L 5BCAA 2WANA 3KHOA 4JB9H 4HFWB 1U8OA 1XF2B 4PRPD 4YHYB 4HJJH 1AE6L 3ILQC 4HQQL 5LBSH 4K3DH 2XY2A 3F58H 5HYSG 3L6FB 3N85H 3RWHA 2BOBB 2NXYB 4ALAH 2AI0L 3KPMA 1YDPA 2Y36H 4JPIB 4ZFGH 1IL1A 2EIEA 3IRPX 4MA1C 1TZHB 2ICWB 1F2QA 3IDMB 3VFUA 4YDVB 4D0DB 3VW3H 4QRQA 3EHBC 3ULSB 4BFBD 3I9GL 2VAAA 3EFDL 4B53A 5FDWA 1BECA 3WFDH 5JHDB 1WAAF 3EYSL 4QRRD 1UYWH 5TDNB 5C0RH 3GUTB 5D5ME 4EI6B 2WUBL 4TPRL 5D96B 3NCFB 4RDQF 3LQZA 1CDUA 4Z0XB 3VRJA 3WLWD 2F9BT 2ERJC 2E7HA 1D5IL 4CVWA 2EEDA 2O5ZL 3I3EA 4KKLC 4NCC1 3O3BB 1FDLL 4PJ7A 1LO5B 1XGUA 5DDHB 3AU1B 2VSCA 5CGMA 1Q0YH 2ICEA 1FNSH 3K2MC 2BY0A 1R3HA 1Q94B 3G5VB 1YEEL 3AROA 3ARGB 4NWTH 3GMPB 4N90E 1ZHNA 5L2KB 5FOBA 5F7LB 4JY4A 5JDSB 1I3RB 4LLVB 5T5FH 5F3BA 4PJFF 4U4BA 4QF1B 4I0PC 3WFEL 3QIWB 3BP5B 1YY8B 4ISVA 2EH7H 4PJCE 2COQA 3GSWA 1W0WB 1V7NH 3MLTA 4D0BB 5E24E 3I6LE 1QA9B 2CJUH 3L3IB 4XMPH 3VRIA 5ALBH 4ELMF 3ARRA 1KT2A 5DFVC 5DFTA 4Y5XA 3BMVA 1D5MB 4NKOB 4J6RH 4JN1L 5F6IC 2ZJSH 4KRMB 5E6IB 1WCQA 4WNQB 4YHNB 2RFXB 1P4BL 5DK2B 4QHUA 1DQDL 3MRCA 3QPQC 4EDWL 1OAQH 1QVOA 3QIBC 3PWNA 5JOFA 4X9IA 4OLZL 5CIPA 1BP3B 4UV4H 2CLRA 4LKCB 4KUZL 3O4LE 5FO9B 3HCVB 3Q3GA 4IMKC 2XNAA 4L4VD 5BW7C 3UZVB 1ZHKA 1LGVA 3QDGE 1F4AA 3GSNA 4XTRD 2L7UA 5TDPA 5F7EH 5H35B 3GKZA 3V0AC 3MLYL 4PY7B 4OKVB 2R23B 4FQXB 3DX8A 1GOFA 2DL9A 3E1F1 5DR5L 5INDA 2PTTA 3SJVE 1U92B 2IPKB 4UTBH 3DX6A 4K94H 5DWUL 1KB5L 2X40A 5MHSE 1YN6B 2XTJC 4X6EB 5BZWB 5JXEA 4WDIA 5DT1H 3CGTA 3HR5B 2FX8H 4IMLA 4Q9QH 4OZHF 3TT1H 4JO2H 3ULUF 1PY4A 1KEML 4NFDA 4WFFE 4X5XA 1XGYL 1CLOH 3EOAA 3KJ6L 4JZNB 2A6IA 2HG5B 5IB4A 5T1MB 2EDFA 5ESAB 4Y4FC 5JNYB 1A7PL 2ITCB 4UOW0 2IADA 1CGVA 1KLUA 3FTGB 4UTAH 3QXVA 5IVXE 3VXTA 4PLJC 4JDZA 2ZCKL 1GZPA 1I7RA 1Q72L 4K7PX 5HYSA 2CR3A 3VH8B 1FZKB 3SDAC 3D69A 3LAFA 4ZDHA 3O2VL 2CUHA 2DQIH 1OTUC 3L3JB 3EFFB 4FQJL 1IT9H 5GRVL 3GNMH 4JFQA 5DMGC 4APQD 2YZ8A 5F7FA 4CMMB 4PJ8C 5I1GH 2PR4H 3RTQD 3B9KC 3O6MH 4KJQC 3IDNA 2A74A 2PUQT 5D7KE 5KSAB 2P7TB 3MOBH 1QKZH 5IMKB 1SM3H 2DF3A 4GMTL 2VDNH 5M95B 1NC2D 4Q6IB 4NO2B 4GT7A 1JTPA 1AIFB 4OCRH 4G7VH 1GSMA 1GRWA 1FLRH 5I8KH 4UIKL 4OZIF 1CICD 4NKMB 4XNQA 2XRAH 5IQ9A 1NUNB 1EEYB 4MDIA 3RZCB 3OBAA 1JYVA 2BHUA 4KTDH 5FAAA 1U8JB 2EDWA 1ZHLA 2Z35B 3MUGB 2ADJA 3RHWK 1KEGH 3RNQB 3UJTH 3VXPA 1IGCL 4JGJA 3DUSB 3LB6C 1CD1A 1IC1A 3DLQR 1AQKH 2Z92B 1YJDH 5F96H 1KTLA 2YUXA 4HH9B 1PG7X 4UAOB 1TVDA 2V7NA 1QD0A 4DZBA 5GPRA 4ACPA 4MNGA 3LRHA 1YMMD 2P5EA 5I73B 1LE5A 3VFGH 4ONGL 4P46C 1JPSH 2CXGA 12E8L 2JLLA 1BBDH 2M1KA 3SKOA 1H5BC 2Z31C 3FB5A 2VR5A 3VWKD 5LXGL 4ELKA 4X6CA 2VN7A 3D6GA 4YZFF 4U3CA 1J86A 2BNRB 3N50A 4JFDB 3G5YA 5TH2B 3KNBB 4KROC 5C0JA 2VDMH 4WFGE 5D1QA 2XN9B 4PBWD 1U0QA 2ITDB 2Y07L 1NCAL 4KDTA 3FQXA 5IF0B 2APTA 2ORBL 4MSWA 1RIHH 4FFVC 4N0UA