1NAMA

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
116
structure length
116
Chain Sequence
b'QKVTQTQTSISVMEKTTVTMDCVYETQDSSYFLFWYKQTASGEIVFLIRQDSYKKENATVGHYSLNFQKPKSSIGLIITATQIEDSAVYFCAMRGDYGGSGNKLIFGTGTLLSVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM3.3 T Cell Receptor alpha-Chain
molecule tags Immune system
source organism Mus musculus
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
total genus 23
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2002-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namA00
4F7MB 4A6YH 3P9WB 2V2XA 4IBLT 1B0RA 2I60L 3UTOA 4GBXC 2EXWC 3TPUA 1QR1B 2EKSA 1QNZL 1MCEA 4QWWC 1J8KA 1JVKA 3L3KA 4J3VA 1T0MA 4FXGA 1NGXB 2Y7QA 3T0DA 4WI9A 2VZTA 4OLUH 1QBML 1MWAB 1MEXL 1ZOXA 4M6OH 3UJJL 3QNZA 3ZKND 1PZUB 2E7CA 4YPGA 4P2CG 2VSDA 3N1FC 5LGKA 3MOQA 5D7IA 1MHCA 4Y4HA 5EZIL 3C09C 1FG2A 1OAKH 2DL9A 1J11A 3UJTL 1MIMH 1OPGH 4OKVB 3KXFD 1YEDA 4I13B 3F5WA 1N7MH 4ELKB 2YMXH 4HX1B 2NR6C 1NMAH 4UBDC 4X7FC 3DHMA 2IPUG 2ZUYA 3RDTD 1NQBA 2VZUA 2Y5TB 7CGTA 5EOTA 4XVSH 2PXYA 4K3EH 2ICES 3SDXE 2P8MA 3IGAB 3CH1A 3LZFH 3SGKA 3WLWC 1IGJA 3MCLH 3V6FA 1BWMA 3DX6B 3KYNA 4N0FB 4JLRA 1BVKB 3ZDXF 3U48A 1F8TL 4LHQB 4CNIA 3FO1A 4R6UA 4L4VA 4KY1H 3DVFA 3EFFA 2YC1B 5KSAC 4OZIE 1R3JB 4O58L 4HPYL 1MHHB 2BY1A 3BKJL 4WEBL 4Z7UF 2NY6B 2Q8AL 3TYGL 1R3KA 4KDWA 5DEGB 4H1LB 4JQVA 1N6QH 1VHPA 3BP7B 1HHGA 2EIZB 3WIHA 1AGFA 3D87B 4LGSB 4OGAD 4HEME 2NW2A 1BD2A 5JQHC 4I1NB 1V3KA 4MJ6B 4PRPA 4JO2L 2A0LC 5FHAL 1MCCA 2XZAH 5F9WB 3IDNB 1CXLA 3PQYD 1A7NH 3QWOA 1CK0L 3MPCA 4FTVE 2FD6H 3FN0L 3WLWD 3PP3K 2Z8SA 2OTWB 5CEZH 2AQ2A 4QRPA 1IKFH 1FO0H 4NUJB 2E9WA 1BWWA 3D5OF 1JWMA 5F1KC 3MRQB 1JPGA 5I8CB 1F45A 1UWEH 1OAYH 3PP4L 4L8BB 3ZYJA 1KB5H 3QEGL 4FS0A 4WGWB 5DC9B 4U1GB 5SWSE 2F58H 3L6FA 1P7QB 2X4RA 4ZS6D 2CDFA 3TN0A 1WZ1L 5J12C 2OK0L 4GT7A 1JZ7A 4K94L 3CFDA 5IM7B 5IVXB 3MLRL 1JGVH 3KJ6L 1T83A 5EIIB 5T5NF 5KW9L 2DIJA 1F4XH 3CGTA 4JM2C 4X7SH 4OZFA 3VRIA 5CLTA 2PYFA 3R0NA 3QZWG 4HWBA 5SWQB 3ZT7A 1NUFA 2A2QT 3L5JA 3RVWD 2FHCA 4OQTL 5C0RL 3S37X 4ODSL 3TF7C 1MIEL 5DJZB 2NW3A 2FO4A 3DVNA 3UPRB 3MV9A 5TH2A 3IDYB 5EBLA 3U1SH 4ZNCD 2DWEA 3AB0B 2D9QB 2YPVL 2ZJSH 5C3TA 5C8JA 3DV4A 3SCMC 1FQ9C 4WWKA 1CL7I 5GGTL 1P69B 1P2CA 1NLBH 4HS8H 5HYJE 5FUCC 1S9XB 3WSQH 3REWB 1HCVA 4GLRH 1ZA6B 3PG2A 3O2VL 3OL2A 4CMHC 3OHXA 2E6JA 4TNWF 1I8KB 5C0IA 2A1WL 2EXWD 3QPQD 3LD8B 2ZG2A 3CDYA 4P9ML 3ZL4L 4MNQE 4LVOC 3MLZL 1HXMA 1ZS8B 4R2GB 2GITB 4OD1L 2R0KH 4NM4L 1OTSD 1DQQB 3U4BL 4EDXB 3SDCB 2W9EL 1H15B 4PJFA 5FYJL 4RAVB 3T77A 5EB9A 3QO1A 3F7VA 5DJ6B 43CAB 1WWCA 3GJEA 3HI5H 1AC0A 1GGIL 4YHNB 1RJCA 3TBTB 4ODSH 5DS8B 4ZUUA 4GAGH 5K59F 1CGUA 4JPWL 5GS1A 1PLGL 5GGSY 2CLZB 4E0RB 5DJDB 1BOGB 2NY5H 1HKLL 5HHOE 4XBEH 2HTLD 4UUJA 1BQLL 3PXHA 3S5LG 5I1LA 1EV2E 4HDIB 4CU7A 5E1HB 1AE6H 1KFAH 2E9JA 3QUMH 2YPLA 3F7VB 2I9TB 1OCWH 3V4VL 3DECA 1CDBA 5E6ID 4M00A 1F58H 2J8UA 2VJXA 2ESVE 4G80A 5LBSL 3V2AR 4P2QE 1HZHH 4CMMB 1J0ZA 1DP0A 4U4BA 2UWEE 4OT1L 5EWIL 1RAMA 1XIWA 3OAYH 4O4YH 3O3EB 4F7CB 4MA1C 1OGAD 4H88L 1YEFL 5HHNA 3TIEA 3T2QA 4KHTH 4KTYA 2ITDB 3NTCH 4PG2C 3LRSB 3OHXB 3BEWA 3NTCL 3HR6A 1DN0B 1OOAA 1KJMB 5H94A 5D1ZD 2QTEA 3S35L 4Y7MA 1OTSC 3CVHA 1FFPA 2CO7B 4B0MM 5ETUB 3VXPB 4YGAB 1TETH 1IGCL 1FPTH 5E2TL 5E8DL 3SKOB 2Y6SD 3OJDA 1GGTA 1TXKA 1BF8A 1AD0A 4E0RA 4LVNB 4JVWA 1OGAE 4L4JA 5BXFA 5ALCH 1P4LB 2XFXB 1OB1B 3VXRE 4LCCB 4KK9D 4LAJH 4XNZC 4KK8D 1BX2A 3EOAB 1KFAL 3QUML 4KUZL 2W9DH 2HJKA 4OFDA 1KYOK 4OLUL 1KPUA 1VADB 4UAOB 1HQRA 5GGSA 1ZVSB 1ACYL 4P4RB 3U82B 3J8F7 2EEBA 2WWMD 5CKAA 3V6OA 2VDRL 3T2NL 4BZ1H 1KJMA 4LSQH 5F3BA 5KAQG 2CJUH 4RFOL 2JCCA 3MYJA 4PGCA 5MI0B 5CSZA 3RX8A 5BZDB 3K80A 3C5ZD 5C0FA 1GHFL 2NX5A 1AGCA 5CZVL 2Y72A 1H3XA 5F9JB 1OVZA 1CXIA 1PY9A 4DN4H 2J8HA 5ITBL 2D7QA 1TJIL 5EU7C 3AM8A 3STLA 3FQWB 3ZHLA 1L7TH 3NAAH 5DZLA 4PJGF 2YPLE 3BKCH 4MCYB 4YDVB 1KGCE 1XZ0A 4NBXB 4I4WB 3BSZH 1BREA 4YAQB 4UNUA 4P4KA 2ZUQC 4CBPA 1I1CA 3PQYB 1GHFH 3TCXA 2W92A 2YD5A 5ADPH 2UUDK 2VLJE 4MQSB 5EBWB 4DKDC 1GC1C 3FFCE 4JFED 3SJVD 5TE7H 5F9DC 4YHZL 4NZTH 3FQXB 4S2SB 5KZCB 3PL6D 5B8CA 3MLYH 5CGYC 3C5JB 3IDXL 3OSKA 1T20A 4XB8A 4LPTA 3H3BC 3DMMA 4WFHD 4HKJA 2F8XC 2FSEA 1HH9B 1IAII 3RX5A 4BZ2L 3SJVB 2FWOB 3O3DA 1AJ7L 2OL3B 1I85C 3DV6B 5ELIA 3SE4C 4FQXC 1RK0A 4TPRH 5I74B 5CKGA 4MNQA 1A9BB 4WCYL 2C5DC 4ZNEA 5FYJU 5A2FA 5BV7H 1QFWM 1KJ3H 4PJXA 4ONOA 2J3SA 4F58H 1G0XA 2YK1L 4MCZA 5FO9A 3T08A 3HMWL 3B9DA 1TZHA 3HE6A 2EE3A 3HS0A 4HC1A 4KDTC 3D1MC 4O2FB 4Y19B 3D39B 3RBSA 4WTXA 4X8XA 5CCKH 5GSVB 1I8KA 4U6HB 3K0WA 3IJSB 2AJXL 2KZ1B 3RGVA 2HAZA 2Y23A 3FRPA 5C2BH 4G6KH 5T5FL 1IGML 5GGUA 2CIKA 5IBTL 3HNTL 3LEYH 5T5FH 3BN3B 5F1IB 5ID0A 3LN4A 1HDMA 2Q87A 3PWVB 2C9AA 5FYJE 3O9WC 4KHXH 1H8NA 5CJBA 4OCXL 4OB5H 1V3MA 2EC9T 4S0SD 2EDXA 1YUHB 3FQTB 3CZJA 1S7QB 1UCBH 3P9MA 4QO1A 1SYVA 4L8SA 3RAJH 3U7YL 5FFLA 4N0RA 3P0YL 3QDMB 5A3IC 5SWZA 4LPWA 2YD6A 1GIGH 4GQ9H 2DQCH 3VH8A 2ICEA 3QQ3A 3WEXB 4L4VB 1S9YB 5IHZB 2DRUA 5T1LB 2C7UA 5EU3B 5C9JB 5FOBB 5FB8B 1I3RB 1CDYA 2ZNXA 3MOAL 1NFIA 2GAZB 5E95B 2ED9A 4LVEA 5T1MB 3JTTB 5DMIL 4PJHF 5CMAB 2IADA 3WFEH 2QHRL 2OL3A 4X7EC 1Z0NA 1P7QA 3DO7A 2DLEA 2X4SA 3O8XB 3RKPA 3HPJA 4OUUB 1IC7L 3ZSTA 1QG3A 1CDCA 1HHKA 4L3CA 3TO2B 1RZIB 5T3ZD 4MA8L 2VB5A 4M6AA 4EN3A 3HI1A 4KY1L 5H37H 3ZT5A 5FYJD 4L5FL 4IMKA 1VKXA 1SVZA 3RWCA 5HYJD 5EU6A 3SDXB 1W72L 4JB9H 1T83C 5FHBL 4A2MA 3NFNA 2WUCH 3PWLA 2WV3A 5DJYB 2F5AH 3RU8L 1G1YA 1QACA 4AIXA 1BZ7A 5CJ8A 4RGND 4I3GA 5D2NA 4BFIB 3FB7B 4JDTH 4QRSA 3UTPE 2X41A 2JTDA 4C4KT 1MFBL 3HNSL 1ZT7A 1IGYB 3HZVB 2XA8L 4WO4C 5E9DD 3TP4A 4WI4A 2ATPB 2AK4A 1X5AA 4L8SB 1AY1H 3OAUH 4PJIF 5IEKB 3FO1B 4LRIC 5J8OA 1DCLA 4YDLB 4JN1H 4NT6A 5F70A 4Y5YC 2J2ZA 1MFBH 3HNSH 3P4NB 3J7HA 1YY8A 3IJHB 5K9QG 4GSDL 1S7SB 2I5YH 4WNQA 3T0BA 2J4WH 3B9KD 1UEMA 3F7PC 5EU6B 4OCLC 3L3JA 2Z31A 2RGSA 5EFIB 2XZQL 4HF5H 2BNUA 3B9KA 4MZ2A 4OCSH 1GL4B 5TE4H 4XBGB 3C60A 3MLRH 4Z0BH 2VDOH 1F4HA 4LSTL 3AMLA 2HTKC 3MCLL 4IOFD 4LSTH 5TDNB 1WZ1H 2VOTA 3E6FB 4PJBF 3SDYH 2XY1A 4K2UH 4ZD3H 4HS3B 4Z7VA 3ARQA 3ELAT 3T77B 4YFLI 1IGTA 1G9NC 2VWEC 3I02A 4K2UL 1UQSB 5HHMD 5J9PB 3FAXA 4NO0D 5AEAA 5K9JH 4P57B 1UH4A 1LE9B 4RGNE 4N9GA 2BFVH 4NZUL 1TVHB 2ENSA 3V5DB 3CK0L 4PGBA 3U9UA 4NC1C 1J18A 1FN4B 1T4KB 2ORBH 1I3VA 1BEYL 2AJSL 3NPSC 3WFBL 3GSQB 2WSKA 4NC0B 4XNYL 1AHWC 3TNNA 1UACL 2OI9B 3IF1A 4L3EA 3IETB 3HAEH 5FUCE 5TQ2H 3LV3B 1U93B 3NVQA 5D7KD 4FA8A 4ZPTB 2QHLA 1OM3H 2DBLL 4XP6H 3K46A 4XP4L 4PRHA 4CNIB 4DVRL 4WO4D 4NNPL 2ZUVA 2WBJC 4HKBB 4GW5A 4YO0A 4RFNC 7FABL 4ONFL 4M48H 2DIAA 1FE8H 1UM6L 4I3SH 3QFDA 4YLQT 4LDOB 4FNLH 2D7TH 4P2OB 1KXTB 5T3ZL 1EAPB 4BFEA 1S7RB 2CDGA 1KCVH 1IKNA 5HYJB 1SVCP 1TZHB 1FVEB 3ARDD 2ZSWA 5FA4A 4PGBB 5IMMA 3NAAL 3V6ZA 1A22B 1FO0A 2AXGB 4HT1L 2ICWA 4X5WA 3GSVB 4ODVL 4HBQA 2CQVA 5D2NE 5J1AA 1KYOJ 1KPVA 4NQTA 1MJ8L 5IMKB 3FTGA 4O5LH 1EGJA 3OKKB 5MEOB 4RIRB 4PJGE 1CE1L 3EUUA 4XWGL 1CR9L 1T0MB 2VZOA 4ZPVA 4O2CA 5C0GA 3HI6H 4XWOD 4Y4HC 3CMOH 5C0AA 1R5VA 1PZ5A 3OKMB 3H9YA 1MOEA 1OM3L 3KPRA 3OR7B 4KI5C 2GK2A 4CGTA 3VXMD 3QI9A 3BVNB 4HUNB 3V0WL 1QLFB 1A3RL 5GSRA 4ZAKB 4PGJA 3IFLH 2IAMA 1J1OL 3ARSA 4WFFD 4BSVB 4DK6A 1V8HA 3IFPB 4HBCH 1ZHBB 4YHOL 4FFYH 1HINH 3IFLL 3DYPA 3SJVE 2A6DB 3DX7B 2XTJD 1H3UA 1QRND 1NANI 1T1ZB 4OGXH 2VLLB 3SGEH 3F58L 4Y2DA 5J1SC 3MRCA 1MWAA 4OFYD 4Z95H 1WCBB 1EEYB 3P9LA 4PRPD 4RZCA 4UU9A 4NQDD 1KGCD 4IRSB 4PPTA 3OXRB 2H1PH 1TITA 3PWPA 3S88L 2R2EB 5CINH 5E6IA 4NQEA 4X5WB 4P5MB 3ROLA 4F9PC 3MUHL 1J1PL 4QNPE 2OTUA 4IS6B 1FLRL 3OKKA 3DBXB 2O26U 5MEOA 5MHSE 3KWWB 3MA7A 4HSQA 2H1PL 2F5BL 4TVPL 3FQNA 1CDGA 2YXFA 4PP2A 3ZE2F 3RWJB 3MYJB 3WO3B 2AXGA 5C6TL 4OJFL 4NUGL 1G7HA 3MFFB 3TA3B 2QSTA 2L7JA 5JXEC 1ED3B 1OWRM 4WEMB 2FYYA 3EJZC 3D69B 2AI0H 5FAAA 3ARGA 4JRXB 4NO0B 3KPLA 1Q1JL 1JMZA 4J4PD 4JANA 3QEQD 3ARGC 4TNVF 3HG1B 3UPAA 1D9KB 3H9HB 4G43A 3RWDB 1U8JA 4L8CB 1CXHA 4JFPA 1E28B 2F53D 4AK1A 2WBJA 3MJ7A 3VWKD 3H42L 1HKLH 2EDRA 5ABDE 4WI6A 2YA0A 4RGOL 3HFMH 2IPTL 1G7MA 1SJVA 3L7FA 4UNVA 4M5ZL 4X99A 3RA7H 1U91A 1EO8H 3CZFA 4XMPH 4HULB 2R29L 4IJ3C 5TF0A 1U8PA 2UZXB 4LCUB 4HMCA 3BYTA 4MJ6A 4PBWD 4PV9A 4QRUA 5C0CA 1AH1A 4YHPB 3C2AL 4QRQB 4PJXE 3QCVH 4TULH 2NY3B 1UH3A 3PHQB 2MFNA 3BDYH 5C09D 4EBQL 4ELMF 3Q0HA 2F74A 4YQXH 5JW4Q 1PKOA 3HE7D 3NIGF 1P84J 3H0TB 4NZRH 1YJDH 3KR3L 3QNXB 1X7QB 2BSTA 2F9BT 4OZ4A 2IH3B 4U6XB 3TNMB 4Z7WB 5B3JF 1Q94A 4AJ0A 3RVWC 1KACB 5D5ME 3HR5B 4Y16B 3E3QE 5J11B 3OAYK 1OTTC 4MAYA 1CFQA 4OZHE 3LZFL 1MJ7L 1JV5B 2ADFH 4EI5A 5JNYB 1YMMD 4G8EB 2P8LA 4DGYH 1FVCB 1FFNB 1OF2B 3SDDC 1CG9A 4EVNB 3G5ZB 5EU4B 4K8RH 3D18A 3WN5A 1MQ8A 2OI9C 3BIBX 4NQVA 2HYMA 1UG9A 3R06B 5DYOA 3RNQA 25C8H 3BH9A 1JP5A 3LKRB 4YDVA 1Z2KA 3MLUH 5GISH 5L8JB 1QLRA 1G7JA 3C08L 1L9NA 4XP9H 1T7WA 3C5ZC 2XZAL 5DI8B 3P73B 1UYWL 4KK8C 4JO2H 2AXFA 2JCCE 4JO1L 1KBGH 2EH8L 3X14B 1X4XA 3Q3GB 3RKDC 2A77L 3B5GA 4Z0XB 5JTWA 4OV5A 3QFJD 4X8JB 4YC2C 2HRPH 4LSSH 4XP9L 3ARBC 2DQFB 3CLEL 4XNQA 1Q9LB 4G6KL 5C0EA 4LSUL 1U3HA 4OAWA 2L7UA 3OKDB 2DLIA 3BKCL 1QEWB 3QHZL 3AS3A 4R3SB 1IGIL 2A0LD 4Q9CA 4RBPH 2CPCA 3MMEA 2B39A 1WAAE 4NKIH 5GGVL 1OGAA 2IH1A 1OTTD 1CGSH 1HK6A 1WZMA 1SJHA 1A0QL 4PRNB 4K8RD 1MI5E 3QUZD 1ORQA 3RDTA 2PTVA 4KKNA 4MWFA 3CD4A 4JDVA 5I1EL 2DM3A 2JJTC 3QXDB 4JKMA 1U8NA 5D6DA 5TH2B 1DN0A 2P5WE 1LNUA 1AJ7H 1ROWA 2GSGA 3FB8B 1PBYA 5SX5H 5I16B 4ZAKC 4WEUD 3MOAH 2VR5A 3OKNB 2PO6D 1A6UL 4NWUH 5K93A 4JHAH 2QQNL 5BS0D 3HC0A 4OD2B 4YNYB 1TQBB 4X4ME 3TWCL 4YUEL 3HB3D 4G9FD 2ZJSL 2C3VB 1FDLH 3RHWF 3PJSB 2UWEA 2GJZB 3F65A 4V1DE 3OV6A 5F93C 4XXCC 3SPVB 1FC2D 3UAJD 3TYFA 1P9MA 3KVQA 4NKQB 3T0EA 2J8UE 4DEPB 1MF2H 3T0EC 2AXJA 3BWUC 4DN3H 5HHPA 4BFBD 1ZA3A 4ENED 3KPSA 1CZ8H 4PY8J 4U6VL 2VKXA 2P5ED 4X9HA 2H26A 2MQ3A 5HHOA 5D7JC 4P9MH 3ULVE 2X70A 4MWFB 4NKIL 3MLZH 2IBBA 3REVB 1HILB 2VLKA 4M03A 2CKBL 4PG9B 1DVFC 4L5FH 3ZE0F 3H9ZA 4YFDB 2G9HB 2GQHA 2V9QA 4PRIA 2ZG3A 4P99A 4NQCD 1DZBA 4F9PA 3S7GA 2FEEL 2V2TB 1FNHA 1T22A 1WQVT 4PJDF 4Q6IA 3FT4A 3T4AB 4KHXL 3HNVL 3O6KL 1IEBB 5DRXB 4B7IA 3SE8L 1X5JA 4KKCD 5F1NA 5DR5H 1ZWIA 2RFXA 1JI2A 3ARXA 5D6CB 2DJ4A 2NW3B 3B9AA 2EO1A 4MXVF 3Q48A 5LBSH 4XBEL 5E2JA 4Y4HD 3VFSA 3LOWA 5CILL 4JDVB 2VC2L 1S7TB 3ARBD 3ZE1E 1C7SA 1DQTA 3V4VH 4NQCE 1M6OB 4XP5H 2X4UA 1FRGL 3LRHA 4GRWF 2JCCB 5T1LD 2FJFB 1AE6L 3MRHA 3NFNB 4X4XA 1IC5L 1LEGB 3QDGD 1CT8A 2BVEA 1MLCA 1K9TA 1MCPL 1OTUD 4LEXL 4D3CH 2APTA 5TQ0H 5GGQH 1F3JB 5E5UB 1ZHKA 2P5EE 1KN4H 4NHCH 1EHNA 4WI5A 2WUBH 1M7IA 3QDJD 3LQAH 2FNBA 4Q6IB 1G6RB 1K5NB 1RU9L 1KLUB 2ZUSA 3ILQD 4Z0BL 1W0WA 3WFHB 1OARL 1YEFH 4KHTL 4GFTB 3F6LA 4WWKB 2D31A 4G8GA 3SDYL 3FMGH 1IC4L 4ZFGH 4KXZI 2QEJA 3JTTA 1RU9H 3W2DH 5CMAA 1XZ0B 2IANE 2YZ8A 1SEQH 2HT2C 5IR1B 5SV3A 3QUZC 5DJ8B 1JYXA 1QVOA 3MBXL 5I15L 1MAJA 2A83B 4PJ7B 3VG9B 2EDBA 4PV8A 3VWJC 2ZCLL 4PJ5B 2R4SL 4WFFE 1ZLUH 2I25N 4YFLF 3JVGC 3JWNC 4M1DH 5I1AB 1KPUB 5KVFL 1TIUA 1DUYA 2NXZD 3WDHA 1QD0A 3N1MC 3MBEC 3BRDA 5GZOC 5FK9A 2IMNA 4RGOH 2IPTH 2NXZC 2H32H 4HUKB 5EOCL 4HGMA 1NEZA 1P84K 2JJWA 4KROB 1WZLA 4CMMA 5C0NC 3UTQA 1T04B 3CSYB 1NGZB 4LCWA 1BFTA 1T0NB 3W9EA 5E4EB 2FATH 3BP4A 1IFHL 3WD5H 5KTEH 2Y5EA 2L4OA 3T0VA 3WFHA 3TFKC 5HYSG 1JK8B 2Q3ZA 4ZPTA 4LARH 1BOYA 4MAUH 2VDOL 4LDEB 4QF1A 4ZDHB 4DN4L 2X7LB 3FMGL 1FL3B 2CO6B 4LOUC 4FZ8L 4RQQA 1QTYT 3U4EB 1ES0A 1QEWA 2MOVA 3S3SA 3LKNA 3GI9H 3KYKL 1TVHA 1AKJA 4FQ1H 4WY7H 1RFDH 5DJXA 3WUZA 3F6IA 3WYRA 3BGFC 4L4VE 1JN6B 3LIZL 1IILE 5J4MA 1XAUA 1IQWH 2ADIB 3PDDA 4XVJH 3BISA 2HKHH 2HFEB 2DQIL 4KMTH 4MDJB 2VXUL 3MRDA 4LK4A 3PABA 1T03H 2JK5A 3D85B 5L2KB 4JFFD 3CCHA 3D2UA 2WIIA 3L3KB 1N4XH 2D7OA 3L1OH 1Z9MA 3RDTC 4XP4H 4OQ1A 3F8UB 5BS0B 4UIMA 4ZTOH 4FP8L 1YEGH 4FFWC 4HUVA 5EBMA 3ILQC 4ELMA 3BE1L 3DROB 1ORSB 3QEHB 1Q72H 1URLA 2FJGA 2Y06L 4HXBL 4WCYH 1MHCB 4Y4HB 5C0GB 5L6YH 3L9RB 5J0BA 4HIEA 1FYTE 4ZQKB 3ZTNH 4E41A 1FVDA 3B83A 4DKEL 3UYRL 4YK4C 4PJFF 3BX7C 1DL7L 5HI3D 2OTPA 3ORJA 4XP1H 3S36X 5J3HD 2ZKHL 4AIOA 4N0UB 4OFYA 4QXUH 3PXJA 5ERWB 4G8EA 5IBUG 4MA3A 1ZMYA 2WWKO 5DTFB 2IPKB 4ODVH 4JG1L 5IBTH 3TC9A 4LKXB 3A67H 4XC1L 2AJXH 4OM1H 4YHPA 4UQ2B 4KTDH 3W5MA 1A6WL 4NQCB 3P40A 4N0FA 3EOBA 3GSUA 5FA3A 2X1OA 3FT2A 1QR4A 3NCBB 5HYQB 1E6JL 5B38A 5GGRB 3GNMH 3C5ZA 4H0IA 2CDGB 4X6CE 2VWEE 2P7TB 3ARFD 4JM2B 4X6FA 2OZ4H 4LL9A 3QPXL 1J8HA 2OLDA 2XRAH 5SX4I 1WTGT 3BWAB 3TJHC 5F7NC 4UIKH 3SDCC 3CMGA 3AS1A 1C08A 2BVPB 4KUCD 5BVJB 1UXSA 1P6AB 3STZA 1DQDH 2JJSC 2XTJE 1ITBB 3LS5L 4R4FL 3P4NA 2ZP0T 4Z5RB 4M02A 3U46B 1Q72L 1G7HB 1SEBB 4MHHG 4XMPL 2F53A 1Y18B 4LHUB 4OSUL 4UTBL 1MJUH 4G7VL 5IVNA 2HKFH 3IS0X 1RD6A 5BVPH 4YIQA 4LNRB 4LOUD 1TJGL 4JFZL 3DXAE 3GZKA 5L2JB 1IGYA 3OKDA 5F8QC 5IHBA 1YYLL 2HH0H 1BD2B 3WNMA 4YXLH 4NN5C 5EUKB 5GS0D 2UUDH 4U1KB 2H9GB 1Z0MA 3QUXA 4HKXA 4UT9H 2XG4A 1OP5K 2M26A 2N7BA 4KAQH 5JLZB 2YXMA 2GIYA 5EZOH 1F3DJ 4YBLC 5DJYA 4JM2F 1CICA 3V5DA 4JJ5B 1QRNB 1SJHB 3TIDB 4PV9B 4QRUB 5D5MB 5MEPA 3EFFB 4IDLA 5C0ND 1FVDB 2AEPL 4DUWA 3B9KB 4Q58C 4M7LH 1UJTA 4UT9L 4Z7VB 1BJMA 1DVFA 2QQLH 5I1GH 3RUGA 5FIEA 1EAJA 2BNRA 4FFWD 2OL3H 3S35X 1I7RB 2DD8H 2WBJB 3X3GL 3BDBA 3RUGF 1MLBB 4LRNH 4KZEL 4G9FE 4LU5L 3VFUA 2DKMA 1MVUA 4L8SC 5AUMA 1AY1L 3OAUL 3HFML 4E9LA 2IG2L 1U3HC 2DQGL 1OLLA 4FQ2H 1AGBA 2X4QB 2YD7A 1FRGH 3QO1B 1GC1L 5DJ6A 1OSZA 4F8TA 3D6GA 3TT1L 4OKVA 5I18H 4EUPA 4NNYB 4IRJC 5FYKE 5KOVC 2DOCA 3QO0A 4XAKD 4UV4L 1ZHNA 5DVOA 5JHDB 1TQCC 4JRXD 4X6EA 1W8OA 3C2SA 3V7AG 5ACMA 1JZ4A 1NCNA 1GOGA 4DQOL 4TNVK 3TN0C 5TDNA 3L3OB 4Y2OA 3SDDD 5D1ZC 4PJ8D 4LLMB 1K8DB 3IRZA 4A6YB 4HG4J 1EO5A 1VGKB 4KKLD 2ZUUA 4ERSH 43C9A 3QIUB 4ZD3L 4KDTA 1KG0B 1J0JA 3GGWB 1ZLVK 3X17A 3T4AA 3MTRA 4JRYD 4FFVC 5GJTL 4AEIL 3U4EA 4QRRE 1YEDB 5AUMB 2X4PA 1AGDA 4PJAE 4XHJD 2OM5A 3DVGA 3QXAA 1MPAL 4L1HA 2H6PA 1HHIA 2BNQD 5HHOB 1IE5A 4OD3H 32C2A 2Y07L 3Q6FA 4OZIB 2OZ4A 2EYRB 1K2DB 3EDFA 1I85A 2X2YA 4HKZA 1JPSH 1UACH 3U7AA 2GY7B 1D6EB 3QDJB 5AG9A 3MV7E 4JHAL 3HPLB 4L9DA 5FYLH 4UDUA 5C0BA 2I07A 3TA3A 1RY7B 3ULVD 4N9GB 2G60H 1FDLL 4GG6A 5A2IH 3RQ3A 3ULUC 5C3LD 3HUJE 3L3DA 1MFAH 1DN2A 1JGUL 2RB8A 3NACH 1YJDC 3MUZ1 5INDA 3Q1SL 1HH6B 1CI5A 3Q6GL 5DK3A 1YN6A 5F96L 1D5XA 2GSGB 4ODXB 1I75A 1BX2B 1MJ8H 4OZHB 4R96A 4UDUB 1MCDA 5C0BB 5C0CD 4OZHF 3HAEA 3QXAB 3AM8C 3GK8H 3HLAA 2OCFD 4RMWA 2O5YL 3P2TA 1RJYB 4RMTA 3GK8L 2WM0A 2VE6B 4OLWL 5LGJA 3OPZL 4XZUA 4PJIE 3FO0H 4OLWH 1X9QA 2V17H 4Y5VA 3ISWA 4NFBA 2OTWA 5GQBA 1UVQA 1ZLVH 4QRPB 4L29B 4OF0A 2I27N 1T5WA 1FFPB 3LS4H 1DBBL 1I7UB 5ISZA 3TBVB 3U1SL 4HV8A 3UJIL 3FT2B 5D1QD 3EJZD 4WUUD 1AXSB 4I2XB 1LP9A 3D9AL 1N0XL 6FABH 3QCTH 4HQQH 2EE9A 4OGXL 3OKOA 1K3IA 3EYFB 3EO0B 4FQQA 4UT6L 3CXHJ 3PHOB 5FYLL 3G6JB 2O5ZH 2QQNH 1N4XL 4OFIA 5DLMH 2NY0C 2VAAA 4KK5C 2A73B 3UTTA 4IHOB 3WE6B 2VERN 2BHYA 1DLHA 1WVZA 2HT3D 4WTWA 4PY7A 1ND0B 1LO2H 3L7EB 1JHTA 4LDLB 4OIIL 5J6HA 3VXNB 1PSKL 1L0QA 3GKWH 3LSOA 4NKDB 4XMKL 4QGYA 2NLJB 1ZVSA 5I1DA 4PJHA 5JORB 3RZCA 1H15A 4OF7A 4GRWB 3WLBA 4HIXL 2GJ6D 5D7KE 2Y25A 1PDKA 1F11B 2R1XA 3RNKA 1N59B 4BYHA 4NQSB 3DX6A 5E8EB 4AH2A 2BRQA 2HWZL 4J3UA 2FH6A 2O5YH 1UJ3A 4PB9H 2VLKB 4RDQG 4BQ8A 2Z91A 1GGCL 3QFJA 4S1RL 4HJJL 2Z31C 2P44B 1JF5A 3MBXH 3VXOB 2V17L 5JOPE 4MCYA 4ODWB 1LVEA 1A6WH 2AABH 4GW1B 2OJZH 2AV1A 1A6VL 3X13B 4QYOB 4URTB 5HI5C 3QEQB 1KN2L 3BGMA 5AD0B 3S9DB 4XCNB 1RZ7H 3ARDA 5I19L 4PJCE 4LAQH 5EOCH 3Q2CA 1DDHB 4X0KA 4WWKC 1HHJA 1VPOL 1ACYH 4XXDB 4NRYA 4WV1B 2H3NB 3LN5B 1KENL 2YMXL 1INDH 3W9DB 4ZOBA 4B50A 1DQLL 4G80B 4ZO9A 1KENH 3BZDA 4NQDE 1MJJA 2DQDL 5JW5A 3X11B 4ODHH 4OCMC 4KH2A 4XGZA 4FHBD 3RWIA 4OGAC 4ZUTB 3BEVA 4OLZL 5HVGB 2XA3A 3BDXA 3S34L 3VXUE 4JFFB 4ZFOB 1RZKC 1JRHL 4CAGA 5LAXB 5ANME 3G6AA 2QSCH 3OKLA 4N68A 35C8L 1RK1A 3L3GA 3UTQB 3NMEA 3MFFA 1NBQA 4OGZA 3LRSA 4L9LA 1F4WH 4KGLA 1QZ1A 3TO4A 3VFTA 4NGHL 1OAQH 3P11L 3ARRA 3K2MC 4J1UA 2P7TA 3T8XB 4AMKH 1CBVH 5CUSH 3MX0A 4W4OC 2YRLA 3KAAA 4JE4B 4M8QA 4QT5B 1QOKA 2VDQH 4QHNB 4K7FA 3W9DA 2PUQT 5C0DB 1NCWL 5JR1L 1KELL 4G3YH 1FYTD 4ZTOL 5J13B 1KPRB 3LB6C 2C3VA 3VMNA 4QRPD 5EU5A 1ORQB 1SYVB 5MP6L 3UZEA 1G9NH 4U1MB 3GSNL 4EUPG 3Q3GA 3MLUL 4HKZB 5GISL 5BW7C 2O5XH 1FNFA 5IMLA 4JFEB 5CZXC 2O5XL 1UKSA 3OWEA 2DS4A 3RWIB 4JKLA 3WNPA 4N90E 3MLVL 2LTQC 5JOPD 4P4KB 1TQBC 5KSBE 5HGDA 1T20B 2X4NA 3V6BR 2W60B 1QLEL 5D70H 3T2PA 5M7QA 1VEOA 3S96B 3HRZB 5KAQF 1ZLWK 2P8MB 3IGAA 4NC1E 1LEKB 4U7KA 1U95B 2ICCA 3DO7B 4ONGH 1L4IA 3HG1D 4PJFB 3SE3A 4DEPC 4YZFE 1NC4A 3IDXH 4GS7B 2IANB 3C6LC 2DDQH 4F9LA 1F4WL 1JMXA 1FFQA 3ARUA 5HYFA 4PJEA 3CU7A 3U9PH 4DFHA 1CGSL 5D93C 5GGVH 2YC1A 2DIBA 5L2KE 2PW2B 2YSSB 5EULV 1T1YB 3GMLA 5C0AD 1RK0B 3T65B 1AIFA 5BRZA 4GQ9L 1BVKA 3HZKA 4UV7L 4NPYA 3N9GL 3VXMA 1FNEB 3GSNA 5DWUL 1W0WB 4JHWL 1OTUC 4AL8H 2A6JB 3GSXB 1QP1A 3VCLA 4MVBC 3LS5H 2ZUXA 4QY8A 4WWKD 2APVA 4LPVA 5BV7L 1ADQL 4LSRL 2R9HD 1I9JH 3PUCA 4FTVB 4K7PX 5HVHB 1XIWC 3BUTA 3UTZB 2SEBB 1KXVC 4HKJB 3VWKC 5L9DL 2QHRH 1MJUL 3K3QA 3L5XL 5IB2B 1KEMH 1FZJB 3IDYC 4K55A 5DQ9A 1F4AA 4TUKH 1XF5B 5L8LB 4ELMB 2EKJA 3G9AB 3VFNA 2F54E 3FAWA 4DUXA 4PYHA 5EORH 2VISA 4FG6C 3UC0L 4OI8A 2XTJB 4YDLC 4R26L 3WKNA 1DLFL 3D0VA 4LSDA 3H3PH 4GRLB 5GHWH 3MRLA 3W5NA 1BFOA 5IGXL 1OQXA 1U93A 4U05A 5DJ0B 1W72H 3VI3F 4NM8H 4U2ZA 1Q9WA 1WISA 4PJ7E 3HE6B 3GSRB 4BKLB 5FDWA 2A6JA 4EDWL 4NKMA 5IB4A 3ZDZF 5DEFB 4PREB 5EZOL 4CN1A 2JIXB 5HXMA 1LE9A 4GAYB 1WEJL 4EQ3A 4U1GC 1BQUA 3RY4A 4TTGA 3MV8A 1IGTB 3DYMA 5C07D 1A3LL 4JEGB 5DJ0A 5HDBE 4LIQL 1BMGA 1KB9K 5DT1L 2HJFA 3DURA 1LNUB 2GSIB 2EDNA 3EOAA 4LSVH 4TN9A 5IWLA 5BW7A 3FHQA 2NTFB 1JWSA 5CILH 3MLTB 4ZSOB 1ACZA 4OZGE 4D3CL 5DQJA 2BXZA 1KJ2B 3SY0B 4Q6YA 4YHLH 4Z78A 1B4JH 1T7ZA 5J13C 1Z5LB 1PY4A 2OMNA 1B4JL 3BJLA 3MV9D 3UTZA 3C5ZB 2CUMA 3BIAX 3CAFA 5C07E 5IK3A 2ZOLB 3TGXA 1D5MA 4GAYA 3S4SA 3HCVB 5CGTA 3D3VD 2HLAA 2YN3A 1XGTB 1S5HB 2QR0A 1ZS8A 5K9JL 5KSVB 4ZFGL 1RMFL 3VFGL 1EA9C 3D3VA 1OP9A 3O3UN 1F4XL 3K4ZA 4JFDE 1I1AA 5ICYB 4RMRA 1ZLWH 4OLVL 1M71B 4HGWB 5I1JH 2DQTL 1F3DH 3SHSA 1HXMB 4KFZC 3DHJA 4HIEB 2F8OA 1C1EL 4LPXA 5F1NB 3JV4A 5HHMB 1VKXB 3MXVH 4L9LB 1QSFA 3RI5K 1MQKH 3QRFM 5B8CC 3IKKA 2Q3AA 3FONB 2D9CA 3OKEB 2W9DL 1XGYH 1SY6H 5JPNA 3N85L 5FO8A 1YQ2A 4Y5XC 3GMOA 1Q9OB 1FC1A 1U0QA 2R2CA 2VXVH 3EYUH 1A7NL 4QEGA 4O2CB 4OF8A 4LVHC 4W4OA 1UH2A 1QKZH 2IAMB 2X4TA 2I5YL 4GQPH 3ZHDA 4QOKE 2X44D 4M9OA 1S5HA 3QUYC 4PJ5D 1KTDA 1R5WA 4F7EB 4X7CC 2BNQA 3T4YA 5IFAL 1D5MB 3JV0A 5GGRY 3WNOA 2DI9A 4N0YL 1A7BA 4R4BA 3AREA 3PGFH 3U9UB 2DTML 4ZS7L 2FX8H 4N8VB 4WHTB 3ARED 4TSBH 3WL9A 1KB9J 4I9WE 5E5RB 2G75A 4L3EB 3OGOE 1LD9B 4M1GH 3ROOA 1ES0B 3HE7C 4EZMA 1PD6A 4NHUA 4M1GL 3MRMB 3MRKB 1QRNE 1QR1A 5DUMH 2XACC 1ERNA 3K8KA 2DQTH 1A7RH 2DKUA 3NIFE 1CCZA 35C8H 1LK3L 5EO1B 5J9PA 4ZXBC 2GEEA 4RWHA 3L6FB 1IMHC 1J1XH 3OX8A 5IW6A 3IXAA 1MWAL 2DQHL 5JA8B 3QCUL 3QDJE 1EFXA 1I9EA 4X4YB 1B0WA 4C56E 4JHZA 4M5YH 5MENA 2MQCA 1FZKB 2MJWA 4GW5B 5IHLB 2IH3A 4U6XA 5DMGD 3TNMA 1KC5H 3V79C 3BZ4A 1LP9F 1XR8A 1VGKA 4JREC 3HUJB 3ARGB 4J4PC 3NH7H 3CFBB 5JIPA 5IQ9B 1VGEH 4LPUA 5JPMB 5E08L 2MHAA 2RHEA 1GXEA 4HXBH 4Y4FD 3B6SA 2CIIA 3HE6D 1H3PH 1FSKB 4X5XA 3LV3A 1YEGL 1U8HB 2E27L 4M93C 4P57A 1PX3A 2D7MA 2EH7H 3BXNA 4N8VA 4N0YH 5DO2C 3IDMA 3C8KB 3LHPL 1MSPA 4PV8B 4I0PB 4K7PY 5CEXB 4WU5B 4IRSA 3GSWA 1CF8H 3LEVL 5TGBB 2VDKH 4YXHH 2X9YA 4YXKL 3Q6FB 4OD1H 3EYVB 3S3JA 1AFVL 1G7IA 1NLDL 4PJIB 2VXSH 4XWOC 3CSPA 4JFPB 3QPQC 4ZMAT 5DTFA 5KSAA 1MVUB 2CRMA 3FB5A 3QRGH 4XTRC 2WANA 4FQQB 3ARFC 4M43L 1ZT4A 2ICWJ 4MGXA 3L3IB 3JWDL 1C16A 1FJ1A 3RZWA 4HZLB 1A7RL 5KJRL 2NY4B 2JELL 4UOW0 1F00I 3WBDA 4WFHE 2DDQL 1UB6A 3KPRB 4N90D 3KPQA 4OM1L 1QFWI 2CUHA 1NGWB 4GRMB 4RGMC 3MRGB 4PJ8A 2CK0L 3V5HA 2OJZL 4L9LC 3FN9A 4Z77B 2VKWA 4FG6D 1GAFL 4EDXA 3G08A 4MJ5A 5EU6D 2R1XB 3OKMA 1FBIL 3JUYA 5CEXA 3QIUA 1AGFB 4YE4L 4JZJC 2B4CH 4KZDL 3V0VA 4HJGA 1ZGLA 4UTBH 3VFVA 2ICWB 3HC4L 2V5RA 4G7VH 1G7IB 1H3PL 3QDGA 1DBJL 1MCHA 1DANT 3H42H 3LY6A 4LSQL 1YPZB 4PY7B 4YWGL 1KEML 3UTSD 5FYKD 3S36L 2E8ZA 4Z77A 4LVHB 1PKQE 1DQDL 1JE6A 4NZJA 5HPMA 3R0MA 4Z7VF 4LRIA 4YE4H 4ZO8A 3VFUB 3T0XA 3KHQA 4EN3D 3UMTA 1OSPH 1EMTL 1SBSH 3F7QA 3FO9A 5D5MF 5JDSA 1G6VK 3EJYD 2VLRA 4X7TA 4YWGH 3CVIH 5HYEA 1OWWA 5KG9A 1E4XI 4GG8B 1XCQB 1ZT1A 3WKMH 4E5XA 3MJGX 3A6CL 3W0WA 4NYLB 3PE9A 4K8RL 1DBKL 2GTZA 3VGHA 4HS6B 1HDMB 3BKYL 3T0WA 1YPZE 5TGBA 1PQZB 5IBUB 6CGTA 4KAQL 3T09A 2DLFL 1CQYA 5F7DB 5JW5B 4W81A 1OAQL 3P11H 4ZFZA 3QDME 1ED3A 5FF6B 3K4DA 5TE6H 4ODXA 4P3WA 1I4FB 4M7JH 4MJIA 1F02I 4LCUA 1RZJH 1JGEA 1QFWH 5D2LA 1KIUA 4XBPB 1CK0H 4KRPB 1P1ZA 5EZIH 1I3GL 1KCSH 1HEZB 4YNYA 1NANH 4FABL 3VH8B 2JJUA 3B8YA 4L3ED 2FECL 1N7ML 4RFOH 5GRVK 3LKSA 3RPKA 4PB0H 3QDMA 3CZFB 3V0VB 5D7SL 3TBWA 3T2OA 3IJYA 3KPPA 4WW2C 4FQIH 3QDMD 1C5BL 2B2XH 4M3JA 4PRNA 1UENA 3DGGA 1G7MB 3MLVH 4HIHB 1WIUA 4FFVD 4J3WA 1U8MB 3BP6A 3SBWA 5LG1A 3WIHH 2XWBB 3RIAK 4U1LB 12E8L 3VXUD 3W0WB 1X4ZA 4LPYA 4YHKH 1A7PL 3H9HA 4G43B 3V8CA 4JHBA 4DKFL 1QFUH 1KTRL 3KJ6H 4HG4K 1GZPB 5EUOE 5KW9H 2P43B 5I0ZA 4BSJA 4H25A 5FYKU 5B8CB 1T7XA 2XT1B 5GGVY 3F12A 1SBBA 3MNWA 4UDTB 5DSCA 4DCQA 3FJTA 1ODAA 3QEUB 2X9WA 4Y0GA 5JORA 1NUNB 3JTSA 3WHXB 2G2RA 4PGDA 4WUKH 2DQJH 3RVXC 3QNZB 3RIFF 4HD9A 1QSEA 2HFTA 1KXQE 2RR3A 3BD4A 4PJCF 1IBGL 3RVVC 3GHBL 4KV5F 2QADC 4JZNB 4KK6C 1E4XH 1A5FH 1WIPA 2OX5A 3MLWH 2DM7A 3HPLA 3TWCH 3ABZA 2BMKA 2FD6L 3FN0H 4YDJB 5JIHA 3QISA 4GS7C 4HWUA 3RZCC 2VLJB 5EC2A 2HVKB 1S7WA 4GRLC 2E7HA 1FE8L 4PLNC 3O11A 1YC8A 2CR3A 2FRGP 4CDGC 1IAOB 4G7YH 1RIUL 4Y1AB 3RTQC 5GRJL 3WLBB 2J6EH 1IEBA 2AK4D 1F3RB 3WN5B 3S37L 3MV9B 1YN7B 2E7LC 1EFQA 3MR9A 1R0AL 5BMFH 5JOFA 1I7RA 1GZQA 1JGLH 3OR7A 3E2HC 5ETUA 1FGNH 1UC6A 3HAEG 3DGGB 1OAUL 2HTLC 3LEYL 5E9DE 43C9B 3X3FL 4P9HC 1N0LA 3CX5J 3IFOA 3HMXH 4P3DA 2R23B 1YDPB 4XCCL 2W9LA 4X9IA 1U2CA 4Y4FC 5F89B 3UJIH 1FFOB 3VWJA 5BOZG 1YMHA 4O2EB 3QNYA 3ALXA 1NAML 5DR5L 3WO4C 3D39E 5JHDA 4Z9KB 3I3DA 5H94B 5DO2D 4P5TB 2OQJA 5AZ2L 1NGWA 1FIGL 3SO3C 4DAGL 3QDHA 4O02L 3KPOB 3PJSA 5T1KA 4JPKH 4OV6F 5JHLL 1OLZA 2B0SH 3NCCB 5I73C 1D6EA 3B9VA 4NRXA 5GGTH 1IVLA 5FGBC 3PDOA 3KPMB 5DGQA 2X7LA 3OKNA 3MLSH 4ZXBD 1BBDH 2J5LB 4U6YA 3MRQA 3PWNB 2BHUA 4YHLL 1K8IB 2HN7A 1J87A 1Z9OA 1AGDB 3B4NA 4AENA 4NQXB 3MV8B 1JBJA 1XF4B 2FYYB 2VAJA 3LHPH 3UO1H 1MCSA 1PSKH 1HN1A 1RUKH 1KB5B 2GJZA 1FORL 4PJBB 1S7WB 5KS9F 1OAXL 3G6JE 1AQKL 4XH2A 1CFBA 1KIQB 3O6KH 1YYML 4I5BA 2EDKA 4WTZG 4UOW1 2HJLB 2JELH 3VJ6A 4CW1B 2W1NA 5D7JB 2JJSA 4HJJH 1MFCH 3IFOB 3U2SB 5DJXB 1V7MH 4BQ6A 4ORGA 1IQDA 1IM3A 2N4IA 3RVVD 2BDNH 3BJ91 4MQ7B 4F7TB 4WO4B 1ZSDB 3TZVA 1U3YA 3UCRA 3TA3C 4R7NA 3SKJH 3BN9D 4JO3L 1CDUA 1IRAY 5CJXA 3C6SB 4M5ZH 5KOMC 3DIFA 1KV3A 2WIIB 2YR3A 5DK0A 5IFAH 1WJ3A 1RSFA 4KDVA 1VACA 3OKYA 5HHQA 1N5AB 5C09A 4KMQA 1F13A 3V4UH 2VL4A 1PZ5B 4Z7WE 2MMXA 3A6OA 3STLB 1FV1A 4CVUA 2F8VA 5EU5B 4XNUL 3NIDE 1I1FB 5IW1B 3M8OH 5B38B 4C54A 2FZ3B 2HJLA 1DQLH 1VESA 5IVZA 3HCVA 1JTOA 3ZKMC 5FYKH 5DUBB 4CL7A 3QHFH 3ZKXC 2CKBA 4HFUH 1R3HA 4JFDA 5JQ6L 1VFMA 1JPTH 1AO7A 3VDBA 1GPOH 3I50H 3PHOA 1UM5H 1AD9A 1XF3B 4JFDD 5KN5A 1ZEAL 3VJ6B 4CW1A 1NCDH 2KZWA 4APQB 4P9HH 3TJEH 4PGCB 3VRJA 3ARPA 5D6DC 5DUML 1RJLA 1WC7A 2QSCL 3IT8D 5E7FA 3G5XA 2NY2D 2AK1H 4AQ1B 1KIQA 4AEEA 1OB1A 5F1IA 4FZ8H 1NAKH 1L7IL 3JV4B 1DBMH 1UZ8B 5GRYA 2LFGA 1C1EH 5D71L 5HGBA 5B4MC 3ZLQC 1CN4A 3NOIA 4RMVA 4ZUVA 1I9IH 2YUWA 3KXFA 3NA4A 3SDAB 5DMKB 1VFAB 1U8OA 1G7LB 2QSQA 1UWXK 2VR9A 2K7PA 2BVTA 1CQKA 1IQDB 1NUGA 2RCSH 4WI8A 1P9MC 1RZJC 5JXED 2NY5C 3KNBB 1JUFA 1RUQL 1PEZA 3QUXB 4HKXB 3QUZA 3KXFE 1VFBA 3ETBF 5HHVL 5ADOL 5D1XD 4JO1H 5F7UA 3RJQB 4F58L 2CJUL 5CBEA 3KLHD 2ARJQ 4K7PH 1NEZB 5GSVA 1TTUA 5A2KH 3TNNB 5KN5B 4RFEA 4TTDC 5F72S 1KNOA 2PO6A 4L4TA 5D7SH 4F37F 2QBWA 1GGBL 5HYQA 3FOMA 3HKFA 1U3HD 1R3HB 4UQ3A 8FABA 5DJ8A 3GSXA 2BOBB 4P59L 4F57L 1KJVA 3ARDB 1I7TA 5D4QA 3QH3A 2VQUA 3AS2A 1U91B 4K3DH 4WIQA 4BSWA 4HWEH 3MLTA 3RVUC 3QSKB 2F5BH 2FX9L 3V7AE 4KRMB 2AAVA 1RFDL 4U0QB 2ZKHH 3VFNB 2DWDA 1KTDB 1R5WB 1PJ9A 4WWID 4F7EA 4TSAH 2WLYA 4JFQB 1L7IH 4Z7UB 1OAZH 1TDQA 2FR4A 1LO4L 1YNLH 1UJ3C 1J1XL 4P3CH 2FJGB 1HWHB 5C09E 1T2QH 3WFCL 4WU7B 2JB5L 2BK8A 3KHOA 4QY8B 3DSNA 3LPWA 3FQXA 4S2SA 4LQFH 2AJVL 5DF0A 2R0LH 5BS0A 4D0BA 2P8LB 4V1DB 1MRFL 3I75A 3O4LB 5DQDL 5ACZA 5I1IH 5DD1H 2FO1A 2W07A 2SEBA 1UZ8A 2XNAB 4NP4H 2YUZA 3E1F1 2BSSB 1HINL 4NHUB 4D2NA 4MHHI 2UVFA 1Z3GH 2D03H 3CUPA 3IFNH 1MHEB 3HZVA 4ODBD 4JFEA 3VXSB 4MDJA 3V7MA 3UJTH 3H3PL 2GJJA 1VERA 4X6DA 4U33A 1GGBH 3RZCD 3TO4D 3D0VB 2XTJC 3O4LD 5D7LD 4MNGB 2OR8A 3SCMB 1U8IA 5IEHB 4IIQB 1HE7A 3MOBH 3O4LA 5D7LA 1EXUB 4FQCH 5J56B 1MRDL 2AJ3A 4R97C 3NFSL 2WINB 5E99L 4MVBD 3DX7A 4PRID 1J5OL 2X4TB 4NOBA 2CKBH 3HNTH 3CDCA 3BKYH 1TVDA 1WEJH 3GIZH 5ESVA 4JFQA 1BFVL 3MNWB 4GUPA 5I8OH 4D0BB 1OP3K 3TLRA 3JXAA 4GKZB 3WDIA 5I1GL 2BRRH 1ZANL 3QIBA 4GKSA 2AJUL 3MROA 5DMGC 1F3JA 3QJFB 2JE8A 4Y5YA 4YGVA 1QO3A 1XCTB 5LWYL 2LAAA 3FO9B 4GXVH 3QG7L 2DJUA 3DVNB 1BQHA 3UPRA 4ZUSB 4HGWA 4YHYB 1H5BC 1OGAB 2W59A 1F42A 3QUYB 4LMQE 1MCNA 3QIWC 1J9CT 1A2YA 4O51B 1CLOL 3OB0H 4E42A 2Z92B 1S9KC 4LFHG 1I1AB 4GKNB 5C0JB 5HI3C 3THML 2EIBA 5FK9B 4JCMA 1T89C 3KS0H 5ESQB 4RDQF 3B2UD 5FHAH 4PJ5E 3KLHC 1EJOH 2DQGH 2J88H 2CDEA 5DEFA 3HC4H 1AGEB 1DBJH 5I76B 2VH5L 1MIML 1OPGL 3QXDA 1KIPB 1NBZA 1MY7A 1U92B 4XRCB 4FMFA 3MOBL 1INEH 4J8RA 4F2MA 1F4YH 1QSVA 1FZKA 3FOLA 5BRZD 3QFDB 2ILLA 4Y4FA 1A14H 5SWZD 1Q9KB 3VFWB 2H6PB 5GJSL 5A2JH 1HOCB 4GKSB 1R3IH 3QWQB 2C4XA 3VRLE 4CRPA 2AJSH 2AS5M 4MA1B 2IAMD 1LEIA 5DD5L 4UI2A 1D5XB 1YYMH 2E5EA 4X7SL 1CGTA 2EDTA 2FLBT 5D7IF 4J3TA 1R3LB 1P4BL 1MCRA 4ALAH 4NQDA 4CUCA 4LLYA 3VFRA 3A0OA 3NCEB 5EIVA 1I4FA 1YECL 2JF1A 3O4LE 3CLFH 2IG2H 4HS8L 1FG9C 5HI5D 3CFCL 3IDJA 2X89D 5F7FA 4HUMB 4OBRA 1A4JB 4XP6L 3PV6B 3BD5A 2CIIB 3IS1X 2BNQB 4Y2DC 4DZ8A 1QSEE 5F89A 4M6ML 4OGYH 1KBGL 4HS6A 1OD9A 1UM6H 3WHE1 3OGCA 3S37H 1RULH 4DGVH 2EICA 1KEGH 1T1XA 1BVZA 1CFSB 3BMWA 1RIUH 4ODTH 1KB5A 4MX7B 4XI5C 1IM9D 5I1LB 2NY4C 4FFZL 2QKIA 3MJ9A 2CMRH 4NN5B 4G8IB 3FKUS 2BMKB 3RZCB 3QQNA 1B90A 4F15B 3CCHB 3NIDF 5F6IB 5E2WH 2X40A 1XR9A 2BCKB 5K59E 2RQ8A 1MCOH 4I0PA 1P4BH 3FB7A 2CRYA 4ORGB 2AGJH 4PJHE 1A4JA 3O2DL 1IEAB 4HPOH 2Z31D 1F5WA 1VEPA 1UM4L 1UA6H 1CFNB 4G8GD 1YECH 1LK3H 2VABA 1CE6B 1LE5A 2H8PA 2AXHA 2NY2B 2YRPA 3DI2B 2E7BA 3I9GL 5EO9B 4EXPX 2DM4A 1A1OA 1NFDB 3P77A 1R3LA 4WU7A 3I6LD 2C4FU 4L4TE 1CVSC 4Y1AE 5KBNC 3VH8G 1A9EB 3U30B 3WIIH 3MCKA 1FGVL 5ID1A 4F3FB 2YPVH 4IMLA 4WW1B 4F7MA 5T3XD 4M62H 3IU3A 4ZO7A 1ZA6A 1U3ZA 3WSQL 2P48B 4HIXH 5F6HI 3RDTB 2OP4H 4XAWH 4X99B 3OX8B 5HDLA 4IOIB 4JRYE 5DHVB 1G0YR 3IXTA 1WK0A 2XKSA 1P6FA 1QPXA 3I6KA 5I1DB 1U8LA 1QQDA 4PJIA 4PBXA 1P5UA 3GKWL 4POZD 1I8LA 3KPOA 3W0WE 3KLAB 2NXYD 5C6TH 3RIFK 5LGJB 4YXKH 2NYYD 1HEZA 4NRXB 3CVHB 4KJQD 5EIIA 4S1QH 1WFTA 3MGOA 3S35H 3UZQA 3CXDL 3WNLA 1BLNB 2LE9A 3OAZK 4NUGH 1B0RB 2PW1B 3O0RL 4PJBE 4XCCH 4I2XA 5T3XL 1WV7T 1GAFH 1F2QA 4S1RH 3IF1B 2VDNH 4ZFZB 2AI0L 4H1LA 1A6TB 3WXVH 5JXAH 3VD7A 2AV1B 1MFCL 4JQXA 2IMMA 4M7KL 4MNQD 3I9GH 2BCKA 2OTUB 2ZPKL 1IAIM 1UFUA 4GAFB 2YPLD 1AP2A 2XN9A 4OLYL 4U1NA 5F1SA 3QJFA 5KVEH 1HYRC 4U0RC 4AIZB 2W65A 3C5SA 4HK0B 2A6DA 4HWBL 4E5XB 1WWAX 3EDDA 3KLDA 1AR1D 1XIWD 2LAGB 2VC2H 4FFYL 4X6CF 4DW2H 1VFUA 3SQBA 1IZKA 4NCC2 1LWRA 2DQCL 4DFIA 4UDTA 4XPHL 1T6VN 2NY2C 3TZVC 1EGJL 4UUJB 4P2RA 1IC5H 2H2SD 3F58H 4M6OL 2OJEA 4TYUA 5J11C 5DYOB 3RNQB 3RTQA 5B4MD 4PJAA 2E9IA 5KTEL 4JFHE 4ODHL 3TBTA 4JFZH 4EEEA 1E4JA 5DS8A 3QEHA 3RTQD 4LLVB 4KROC 4OT1H 5EWIH 3DUSA 2XPGA 1S9WB 2YWYA 2DI7A 4OTXH 3NN8B 2BNRB 2ITCB 4R90H 3LKQB 5GRUH 1EJ6A 3SDXF 1YEIH 4Q9RH 4QCIA 1CFTA 1MJ7H 2ADFL 2IQ9L 4MNGE 4X98B 2DYPD 5D1XC 1RJZB 4H5SB 3N50A 3AGVA 3M45A 1T7YA 5LVEA 1YNKL 5GS0H 4L8DA 5ECJE 1QLRB 5DZNA 3CVHH 2WWMC 1ZHLB 3MV11 5D71H 4JB9L 1L9MA 3FB6B 2R2EA 1S7QA 2FSEB 3QJHB 1GZPA 1BAFH 2GK0B 4MXVE 1DQJB 2DLFH 4RMSA 5CAYB 3BPCB 4KJYA 2YPKB 5MHSD 3F12B 3NABL 4JGJA 2UY6A 3S96A 5J89A 1JGDB 2EYTA 1BAFL 1RZGB 3L3HA 2R8SL 4ORZC 1NMAL 1T04A 4L8CA 3LKSB 5KSUA 1E28A 2EH8H 4P5TD 4D0DB 3LMJL 1I8LC 1J10A 3C8DA 4JRXA 5E4EC 1KJ3L 5EOQH 3E2HB 3HS0B 2RIKA 4AEFA 3L3DB 2HTKD 4YHKL 2W65B 3C5SB 4HK0A 1TLKA 3LKOB 5IKCB 3NA9H 4ZXBA 2YEZB 3BMVA 3HZKB 3P0VH 5C0BD 5C0CB 2H3NA 2B1HH 1ETZA 5KS9E 5IIEA 1V05A 5CEYB 4LLVA 3G6DL 1IAIH 2R0ZH 5IJKA 2X5PA 3U36A 5GGSB 4IDJH 3U9PL 1KCRH 5IFJB 5C2BL 3FB8A 3C9NA 5D1ZB 2D3VA 4KTDL 2HN7B 3PHSA 1XMWA 5GJTH 3DMMD 1T2QL 4ONGL 1U8NB 5TE7L 5E9DA 2R56L 3BESR 1RQ5A 4G9DB 5DQDH 1GZQB 2OR9L 4M6NL 4H1LH 2R0WL 4EKXA 3KXFB 3QXTA 2GT9B 5ILTH 5B38G 1FNSH 1NLBL 5CEZL 4JGMA 5ALBH 3TA3D 4YAQA 3ILPB 5T5NG 3QA3B 5GGUB 4LCIL 3QWOB 1MLCB 5IHUH 2FL5B 4G6AC 3JWOL 1OGTB 4FZEH 4MA7L 4Y5XA 1FFOA 3G04A 2LQRA 1QSFE 2NZ9D 4WUUA 3LEXA 2X4OB 5ID1B 3QAZB 2WW8A 5J6GB 4NO5A 1Q9LA 4LSSL 3UC0H 5SV4A 1U8QA 3KPNB 4G7YL 4DGIL 5FCUL 1QSEB 1TJHL 2PR4L 5INCA 2AXFB 3VG0H 4LP4A 5D8JH 3C60C 3O9WA 2RFXB 3UZVB 3EIFA 3D3VE 3PQYE 3WEXA 3OKOB 1EBPA 1S3KL 3DETD 4LLWB 2VO5A 5B3JE 3HI5L 4XPBL 4BA8A 1RZKH 1PGRB 1KJ2A 3SY0A 4RRPG 3C6LD 2V5SA 4Q0XH 4O5LL 5IB2A 5ISZD 2XG5A 2WP3O 5EUOA 4FQHB 1T89A 4ZUUB 3I85A 2BRRL 3DMMB 1LDPL 4Q2ZB 4PJDA 1OAZL 3U83A 4WO4A 4ELME 3H9SE 3PIQA 1M71A 3BKMH 3MGTB 2J6EA 3WS3A 5HGDB 4HAFA 1M6OA 2FCBA 5J7CC 1F58L 4JRYA 3TVMB 3O6LL 3D3VB 5HHXH 4BQ9A 3G5VB 4AIZA 3JSSA 1ZGLM 5TFSL 1BQLH 1SMAA 2AEQL 2LU4A 4J7RA 1LO2L 1IAKA 4OIIH 1WSST 4PRDA 3BO8A 1G7PB 4K8RC 4G6AD 1DTUA 1LO5B 1IARB 1V3JA 2DLGA 4PD4K 4P46B 4XAWL 3VGDA 1BPVA 3HTLX 1NGPL 4POUB 1U41A 4CJ1A 2ID5A 4KJPC 3CSGA 3UTSB 2NY1C 1XGQA 2FL5A 4CVWA 1QBBA 3DUSB 1WFUA 5HI4D 5DD3H 4JFFA 2VMFA 3C09B 5I17B 5CJOH 2I9LA 4Y4KD 4OLVH 4GMTH 4EN3B 5TDOB 1NGQL 1T80A 4XHJC 2ZG1A 4M1CD 1P4LA 4WNQB 3CDGA 2VDNL 4LBEB 3KG5A 3CX5K 4LSVL 3LQMA 3CSYA 1X5LA 3SGEI 4E41D 1FH5H 1KSRA 3SCMD 1LK2A 2J1KA 4GMTL 3WL9B 2BDNL 2Y36H 3SKUD 2GFBA 2HMID 5CZKA 5JLZA 2PTTB 4PS4H 4RMQA 4BK4A 4I18B 2FATL 1G9MC 4HS3A 1HCFX 1IGFH 3PWPD 4I3SL 4LHUG 1XF1A 5IR1A 3LH2L 5IP4A 5L0QC 2G60L 3V52L 1RK1B 3L3GB 4NNPH 1FSKC 3AREC 5ICYA 1EO8L 4BKLA 2DTMH 1QA9A 4ZS7H 1RUPL 3FL7A 1I1FA 4X6EB 4PJ9B 3OXRA 3VWJD 3WD5L 3NACL 3PWPB 4DGVL 1F6AB 4HWZA 4PJEE 2D0GA 5JHDD 4RNRA 1WIOA 3V4UL 4YHIB 3QWRA 2ICWI 4ZUSA 3LH2H 2W60A 3G5YA 3QQ9D 3LB6D 4ZQKA 1RIVH 4G8GE 4E41B 3IFPA 4FQJH 4GXUM 2R4RH 3QQ9C 5JO5B 5CWSB 5DDHB 4K94C 5E8PA 3GMOB 1BP3B 4HH9A 4BH8B 1N5AA 3GI9L 1NGYB 4AEIH 1SJXA 5CHNA 4ZSOA 4DGYL 2ZOKA 2VZ3A 4EOWH 1NUDA 4IIQA 4OUOA 1A6PA 1PW3A 5ADPL 2AK1L 3GMQB 5E8EA 3ZDYF 2MPAL 5I66A 4JR9L 3UPCA 2DWDB 4PJCB 2VQ1B 1OT1A 1Y0LB 2Y9RT 1K6QH 3CPLA 1U6AH 2AJYL 1DBML 2XZCH 4XVUD 2RBLA 5IHZA 4MLSA 5T1DL 4IOFC 2ESVB 1LO0H 3V5HB 1HQRB 1INQA 1U95A 5T1DH 2P1YA 2DBLH 1KCUL 4B5EA 5KSVA 3I2CH 4IOSD 3R1GH 5CBEB 2XQBL 3U6RA 4U1SA 5I6XB 3H6JA 4M93B 5E5MB 1ZKAA 3S88H 5CWSA 1NMCC 1M7IB 4QTHB 4XPGH 4PJDE 3P9MB 1JGUH 2OP4L 5BXFB 1S7RA 2NQCA 4XTRD 4WW2A 3TCLB 2A77H 2X4OA 1MFEH 1FZMB 2DICA 4R0LB 1LILA 15C8L 1YEEH 3TO4C 3O2DA 2R1WB 1MCFA 5DZOA 4F7TA 4C56A 4UTAH 3NA9L 2BNRD 4P23C 4OLXL 2IQAA 3JZ7A 4M7ZC 2WQRA 1RV6X 1WT5A 4XPGL 4EI5B 1CR9H 3EDKA 5I1KH 5KSBF 1I3RA 3TJHD 4PRHB 3PQYA 4PLJC 1YQVL 3GB7A 1J88A 1NBYA 4P5KB 5I76A 2RJMA 4POZC 4Z76A 3TT3H 3RY5A 1C12A 1H9VA 4G42B 3FO0L 3MRKA 1FCGA 3A67L 4RNRB 4XC1H 4N1HB 3QJHA 1XCQA 1MVFA 1KLFA 2F74B 4L4TB 1MCOL 1T4KA 2NCMA 3GSQA 2NX5B 1R3KB 1MRFH 2EKSB 5H35A 5I75C 1WBXA 4V1DA 4XNMA 1I7TB 2X09A 3VD4A 1FIEA 1VENA 3IU4L 4QHNA 1YEKL 1NBYB 4X98A 2DMCA 1CLCA 3BGAA 1A1NB 4F80A 3MNVA 1IEHA 5D1QC 5BVPL 4JFYB 2F53B 3V0WH 3VFTB 3MNZA 3C2AH 4JFEE 3OXSA 1FNGA 1XR9B 1CD8A 1BQHB 3SGJA 5HGHB 5JDJA 5L0QB 3O4OB 2HFFA 1JWUA 3WJJA 3RA7L 4R0LA 1NKRA 1PG7W 1B0GB 1TNNA 1ZHBA 5E2VH 5DHVA 4X6BA 3OF6A 3CJJA 1I8MA 4RZCB 2BNUB 4UU9B 1HHHB 1SJEA 4O2FA 2YPLB 4TULL 1Q0XL 1RVFH 1UB5A 1O0VA 3O6FB 4OLZH 3RY6A 2Z35B 5I1HL 3DLQR 2VDML 2IJ0C 1BZ9A 1RURH 3CXHK 3EYSH 5MI0C 4HHAB 1TVBB 1W0YT 5IEKA 1KLGA 5E2VL 3NZ8A 4M7LL 1RZ8A 3VFOB 5CGYD 3VXSD 3KJ4C 4OB5L 4LLUB 2F5AL 3T3MF 2Q8AH 3TYGH 1E27A 3G5ZA 4MA8H 1YPZF 3RVXD 3VXSA 3X14A 2GY5A 2E9BA 5EC1A 2Y7QB 3VFVB 1CDJA 2W0PA 2ITDA 5A40E 1NDMB 2A9ML 3QEQA 3ULVC 4Z7OE 3W11C 4MA3B 4AMKL 1CBVL 4NN7C 1VEMA 3NIGE 1ZANH 5D96C 3TM6A 3HE6C 1QBAA 1U36A 1QYGL 4FQXD 1A7QL 2CK2A 5CIPH 3QUYA 5HDQH 3MZGB 1QYGH 3GSWB 1RZ8B 3VFOA 1LO3L 3SEPA 3ILPA 1EK3A 1OAKL 3NPSB 5DHYB 3PGDB 3P30H 3DROA 5DJ2A 4GSDH 3SDAC 5CZXD 4AT6B 3SO3B 5HDQL 3AXLA 4OIAA 5ISZE 4EVNA 1SJEB 2HLFD 1IGJB 3WO4B 3CLEH 4K9EC 1I3GH 2LVCA 5BVJA 3HE7A 3ULUD 3L7FB 4PJAB 4YDJA 2BVQB 2JIXD 3TT1H 3KYMA 4N0CD 1QA9B 3UX9B 3QUMA 5HY9A 1B88A 2IFGA 5JOEA 4ODUA 5HSFA 3RWDA 1J8HD 4OZ4B 4JFYA 2BSRB 4CVZB 3EOYG 1JHKL 3NGBC 5IROA 1C5BH 2B2XL 3RWEB 5K9OA 4WDIA 4LKCB 1KPVB 1AHWA 1CFQB 2AV7B 4PUBL 3P4LA 3OMZA 5D5MA 5MEPB 3BKJH 4WEBH 1W0VB 2P5WB 2VQTA 2VZSA 3MLYL 4WUUB 5KVMC 5F88B 3RWJA 25C8L 1MCJA 5GS1C 2GITA 2Y07H 1J12A 1WWWX 4M6NH 3ULUE 5TE6L 4M8QB 4QT5A 3KPNA 2EC9U 4NCC1 1YNTA 1UT9A 1ZWIB 5D2NC 3PHQA 3BZEB 4EUPH 4NO3A 4PTUA 2R56H 3SDAD 1RHHB 2DMBA 3D48R 1TZGL 3PWUA 4OF5A 3KLAA 4Y5VB 5FO7B 3I3BA 3W11D 2FGZA 2DD8L 5DJCB 5L7XH 1ZK9A 1YN7A 2ZUQB 2R0WH 2EE6A 5GXBB 4P2RE 1PVHA 3MV7A 3AY4C 3SOBH 3ARZA 3BP5B 1O7SA 3MMEB 1PX4A 2HRPL 4I77H 1U2HA 1DFBH 2WK2A 2XKUA 5C8JB 3IU3B 4PRPB 4Y16C 4FQ2L 5JW4N 4TUKL 5C70A 4NT6B 1BOGA 3CH1B 1RHHA 4JPIA 5INDB 2F58L 2J6EL 1ZHKB 3GO1H 4ZUWB 1RULL 2LTQB 3GJEB 3QIBD 1KEGL 1JGLL 2VITA 3PWJB 3AXLB 1XEDA 2ZUTA 1XIWB 2YPKA 3FZUD 4I2XE 4IMLB 4ONFH 1HKFA 5F96H 4P2RD 4YEFA 1NFDF 3Q1SH 5BRZE 1C5CL 4C4KO 2IBGA 1M7XA 4TQEH 4UMGA 5C0JA 1S7TA 3WFDL 3GO1L 3JTSB 3WHXA 5A3ID 1LDSA 1RIHL 1PG7L 2C26A 2BC4B 3ARBB 3OJMB 2CD0A 4RIRA 3OPZH 4YBLB 4RSVA 1AR1C 4WUKL 3HI6L 5DFWH 1DQML 3QUMB 3G6JA 5HY9B 3DVIA 3RFZC 3O9WD 2EDQA 1NAMH 1EEZB 1JZ5A 2E8YA 4JANB 1CL7L 2Z31B 2AGJL 1BJ1J 4FQ1L 4N8PA 4WY7L 5L7XL 1K2DA 2WIMA 1JPGB 3AC0A 4HCRA 4HIHA 1QSFB 2YUVA 3NZHH 4HPOL 4XCEB 4G9FA 4LCWD 1BM3L 5I8KL 5I73B 4G8IA 2NMSA 5D7JD 3FB5B 3REVA 4Y1AA 3T3PE 3C6SA 3ZE0E 4JPVH 1J7VR 4R0LC 4Y5VC 2Z8VC 1N59A 4WI7A 1LEGA 5M94B 1TTFA 1QSFD 4K3HA 1CT8B 3KPSD 4HLZG 2CR6A 5DJZA 3VRLF 3IXTB 4FP8H 4XP5L 3SDCD 2GK0A 1CDHA 4GH7B 4I0CC 2A1WH 3QEQE 2PYFB 4LEXH 1FGNL 4KVNL 5I1AA 1YY9D 1T5XA 2BY0A 4DGIH 3L5HA 5KS9B 4OZFB 5L88L 4FQXB 4JFOA 4OI7A 2PXYC 1X5GA 1RJZA 4LNVA 3RVUD 4ZAKD 3HC0B 1JI1A 1MCWM 4K3JL 4JPIB 3TO4B 3VXTB 1KOAA 5HHME 3MRRA 4NN6C 3K2UH 5EBLB 2R2BA 3ES6A 4KK6D 5F9WC 3DXAA 3QQ4B 1WBZA 4MS8C 3CMOL 4JQVC 4XX1E 2CK0H 4GRLD 2AABL 1AD0B 3HNVH 3DETC 3UXFA 5T3XH 2ZZUT 3SKNB 2ZUWA 5CGMA 5TPWH 4D9LH 4Y4KA 2QL1A 2VL5A 3T04D 1T21B 1H8SA 2BC4A 3ARBA 3X11A 1CU4H 1RJYA 3I3EA 4MB3A 5JNYA 4MXQC 3ZYIA 5GRZA 4HIJA 5TQ0L 1DEEB 1WBZB 1MJJB 4WJ5A 1BBJB 1AXTH 2GYSA 1HNGA 5E8NA 3GKZA 1TNMA 1NEUA 5BO1H 2AKRA 1VFOA 4LLQB 1IKNC 4P46A 1A6TA 2DQDH 4XNUH 3FQUB 4NO2B 2YD9A 2DQEL 1MCPH 4HAGA 5IROC 3GMNA 2XOTA 5ESAB 2VUOA 4PLKC 1VA9A 2H8PB 3WIFA 5FECB 4LEOB 1NGPH 1JZ6A 2FWOA 1U8MA 3BP6B 3O3DB 3AB0C 4P23B 4QTIL 1I1YB 3W0WD 1RZGA 4KKAD 4Z7VE 4OCRH 3TVMA 5ACZB 2FGWH 4BSVA 2FJHA 4NQXA 2NY4D 5IMOB 3TBSB 2BFVL 4NZUH 3JV6A 5HJ3B 4IRSD 4N9OB 2QV2A 1FPTL 2X6MA 4LASL 1NCWH 4Z18A 3WUWA 2YA1A 4NZTL 5JR1H 4HZLA 3DTXB 4EIGB 4NFCA 4BZ2H 2EDYA 3QFJE 3DUUA 2D31B 1IQWL 4WW2B 2A6KA 3TCLA 2Z91B 1TCRB 2A9MH 4PJ8C 4HUXA 3RJDA 3D69A 2BOCB 3W82A 1S9VB 3N1QC 1MHPH 2A9NH 5BV7B 3P3YA 3QQ4A 3T3ME 3FRUB 2AERT 3MRDB 1D5ZA 1RZ7L 4JR9H 5HYSB 1JFQL 2VLME 4U1IB 1KCUH 5IMOA 3U4AA 5I6XC 2G5BA 1AIFB 1P4IH 5BRZB 2VXTH 2WAHA 3QB7C 4J12A 4Q9QL 1X5IA 4PLKD 3VXNA 2O61B 1T1WB 3OTTA 1IKFL 1FO0L 1MHEA 4PRHD 3GSNH 1LGVA 4FXGB 4PJ9A 4FXKB 3HHRB 1QUNA 1A8JH 5I18L 2G5BB 2LU3A 4C83B 5JQ6H 3DX9B 4K7PL 4AH2B 1K4DB 5JOFB 4JAMB 2VITB 3PWJA 5EH1A 1QFPA 4XT1C 5EU6E 3VG9C 1WLHA 3NZ8B 5EA0L 1NDGA 5JMOC 1CTNA 4KRLB 1JGVL 3GBNH 1NCCL 5LCVL 4M4PA 4OCXH 4XPAL 3BN9C 5H2BB 4APQD 2OJEB 3N9GH 4V2CB 3TO2A 4KMTL 5EU4A 4KJQC 1XF2A 2XXCB 2OR9H 3FQWA 3IXAB 3DX9A 3WFCH 1TZIB 5D7LE 3SGKC 3CFKA 2OZ4L 1AQDB 3QIWD 5CUSL 3D2UD 2H2PD 4M1CC 1KIPA 1NBZB 2EDOA 3K1KC 4Q6IC 2VLRE 4RMUA 5HD8D 2B4CC 4KGJA 3JWOH 4XVJL 3MRMA 1LO4H 2Q8BH 1YNLL 4Q9QH 1PKQA 3WXWH 4Q74A 4RFEB 5A1AA 2Y06H 2Z92A 1P7HL 3VE0A 3B2VH 5EG6C 3QI9D 2VDLL 5CSBA 1BFOB 1U8HA 1C12B 2J8OA 1T22B 1L6XA 5DURD 3BH8B 5DK2B 3H7BA 2CLRB 2FEEI 3EHBC 3L5XH 2LU7A 3CU1A 5FF6A 2NY1B 4LBEA 3UDWC 4YBQC 5GRJH 5IUSA 3QULA 1IC7H 1FL5A 4PP1D 4YIQB 4X6DB 4ESKA 3BIKB 4DWHA 4LGPB 4GXUN 1GSMA 5F3HA 1KLUA 3FO2B 4Y5YB 4YGVB 1YEEL 4BQCA 1J8HB 1Q0XH 1RVFL 1TJHH 4ZOAA 5HGBB 4H8WL 1AI1H 3KYOB 4MSWB 3PGDA 2H2PC 4JFFE 2OMBA 4G6MH 1MF2L 2NXZB 3U36B 1E6JH 3B3IB 2Y1VA 4MMZC 4Z7QF 1X6LA 3GIVA 3H8NA 1A0QH 4ISVB 5E94B 1QBMH 4RRPA 3E3QC 4O58H 4C83A 3VXTA 5SWZB 1NEZG 3BP7A 4HJ0C 1A9BA 4PRAB 1JPST 2K3TA 4M9PA 1U92A 4M3KB 1UCBL 4XRCA 2QR0B 2AEPH 4OCWH 3RL1B 1FN4A 3EO1A 3QG7H 1CLZH 5DWUH 4AL8L 4DK3A 3AROA 1DUYB 2HFEA 4MDIB 1CLZL 5I2IA 2NY6C 4JRWA 5MERB 4XVSL 4XVUC 1CS6A 1F90L 2WBJD 2K9UA 4PJEB 3E6FA 3KPQB 3EDJA 5F7MC 1IAMA 2PYEB 1AGBB 2X4QA 3MLXH 2GUOA 4XI5D 1HZHL 5JIKA 3QUYD 4HIIB 1QSED 3QZWB 4BM7A 1F4YL 4UZGA 4MJ2A 3IDGB 5IT2H 4OCSL 1RMFH 1EO7A 3E0GA 3VFGH 4O4YL 1S7VB 3QUXD 2XZQH 4HF5L 1MH5A 4JKPL 3TV3H 3O6FA 2VYRE 5AWNH 5GZOD 4MX7A 3MLPA 1CICC 3SE9H 1Q8MA 2HVKA 5TF1H 2Q7YB 1BFVH 4FQLH 4XNXL 4B41A 4EIZC 3EYQC 1IL1B 1CFSA 1N6QL 1C7TA 4FQLL 4C55A 4P2QB 2V5TA 3EOTL 4KQ4L 3KPSE 1DR9A 4M61A 2UWEB 3UP1A 1QRNA 5JW4R 4YHYC 2NY3D 2COQA 3QIBC 2HT2D 3T0EE 4CDHA 2R4SH 3G6JF 1V7ML 1MI5D 3GSVA 4LRNL 1BEYH 1Z6JT 2X05A 5I2IB 2ICEB 3DMMC 3QQ3B 4PRBB 2DTSA 5KZCD 3RGVD 1XGTA 4WUUE 3W2DL 5I75B 1CD1B 4ZFFA 1G9EA 1SEQL 5J06A 1IBGH 1LP9B 1TZGH 3HN3A 2MHAB 3QUKB 3GSRA 2ZSWB 4KPHH 2YUXA 2CRIA 5F7WC 1S5IH 4GKOA 3MBED 5DD6B 1J0KA 4RWYH 1DVFB 4KI1A 4P2OA 3SOBL 4RAUA 4JM4H 4OF6A 1G7QA 4NNXA 3MRPB 4QOKA 4JN1L 1QO3B 4DQOH 2VDRH 5F44A 4NRZB 3T2NH 4V1DD 4BZ1L 7FABH 3TIDA 5EOCJ 4XBGA 2MWCA 4TUJA 3VXRA 1HHKB 5LXGL 4MXQD 3C6LA 4GG6F 4HWZB 1F6AA 1UZ6F 1T2XA 3RKDD 2A74B 5GJSH 5CZVH 3MV8D 5KSAB 1YY8B 2GSIA 4U1SB 1J8HE 2D0HA 1OY3B 4JZOB 4R97B 4XCFH 5H37G 3KDMB 1NJ9A 3GDBA 3O3BA 4R7DA 4JFXA 4HIIA 3IKCB 2H45A 2NPLX 1TQCB 3MODH 3N1PC 3QR2A 3GGWA 4JY4A 2I07B 1KT2B 2MPAH 1MFDL 1UA6L 3GMQA 4Z7OF 3LS4L 3QHTC 3O2DH 3CDGB 3IDIA 3MRBB 3KWWA 1U6AL 3K81A 4IOIA 1XF2B 4PLOB 1EUTA 2NY0D 4JRXE 2W0FB 3BZ4B 4OBSA 4R4NC 4H0GA 3QCTL 4Y4KB 3KYKH 2CLVA 3ECBB 4P0DA 3SGJC 2BVUA 32C2B 4KJPD 1FGVH 1I8IB 4E41E 2Z93A 3DPBA 4RWYL 1IT9H 2UV3A 2KUTA 3BAEH 4ENEC 4R7NB 1NMBL 4M48L 1YEJL 2Z4QA 4F7PA 5JW3H 1A6ZB 1W72A 2JB6B 2Q6WB 1E4WH 1NGYA 4HUVB 3VW3L 2HRLA 3Q6GH 5DK0B 1UWGL 4ODTL 4NJAH 5JZ7D 2IBZX 1C16B 3QUXC 4DN3L 1J0HA 1EEZA 1PFCA 1KTLA 5JHDE 3ZKNC 5L88H 5EZLB 4UILL 2H2SC 2FO4B 4JQIL 1R0AH 3MJ9L 3RY6C 3T0ED 15C8H 4JQIH 5E6IB 1EHLH 1FYHB 1N64H 3DARA 4Z8FL 5L6YL 3VGFA 5EA0H 2GCYB 4JCLA 1N64L 5IW3A 4MLIA 4JFDB 1MAKA 1SM3L 4OCNC 4JJ5A 4UILH 4ODWA 3MJ9H 5EPMA 3LKNB 1TETL 3LVEA 5E2TH 1KN2H 2VN7A 4D0CA 3KYMB 2DKSA 3EHBD 1CIDA 2P5EB 4ZAKA 5KVEL 2GTZB 2PYED 1VSCA 4XZUB 2YZ1A 2R9HC 5CD3A 1T0PB 2G9HA 4PRIB 5CFHA 2Z4QB 1TPXC 4F7PB 2P8PA 3BPOB 3PDOB 4P23D 3O2WH 4K23L 5JXAL 2AVGA 2HFGL 5FUOH 4NWTH 4H88H 4APQC 5J57B 3HAEB 3O2WL 4K23H 1OP5H 4U2YA 5FUOL 5I8KH 2AJZA 4G6JL 2BJML 4BUHA 4WFGD 5MERA 2O93L 2HFFB 3LN5A 3MA9H 2VE6A 1KULA 5DMIH 1HI6B 4QHMB 1FVCA 4YQXL 1GGUA 4WU5A 1NGXA 4TUOA 2EDJA 5HHNB 2UZYB 3QCVL 1UCTA 3L5WA 4EBQH 2G75B 2P46B 1HSBA 4PJBA 1MRDH 3BUYA 3BEWB 3F7RA 3BPLC 3LKOA 5IKCA 3N1GC 4KVNH 4R26H 5D1XA 4S1DD 3QUZB 1AHWB 5DMYA 1BF2A 3CFBA 1XGPB 2AV7A 1R24A 4I3RL 1A2YB 1WZKA 4O51A 2Q1EA 3H2WA 4QTIH 5K9KA 1HI6A 1JRHI 1EEYA 2ZSVA 1QNZH 4WFGE 3IAGC 4GJTB 4TTDD 1MHHA 3I6LE 4L4TD 2VDMH 2IWGA 2N1KA 4G42A 1FCCA 1QQDB 4OJFH 2G2RB 4OZFH 4WRLA 3K7UA 3P73A 2BVQA 3MBEB 1P5VA 4G8FA 5ICXA 2HP4A 3NGBB 2AJUH 1HHHA 4Y8AA 3LD8C 1JFQH 1U42A 1LO3H 1QLFA 5EDXA 4J8RB 2P8PB 3FT3A 5KG9B 3IJSA 2NTSP 4Z7NF 1X3DA 3KLSA 3RGVB 3SKNA 5CEZD 1MCKA 4N5EC 4OCWL 4C56B 3T1FB 3P30L 1MHPL 2A9NL 3QDAA 4PP2B 4NWTL 3ESVF 2P5EA 3VE0B 1OAYL 1BJ1H 1CGVA 2IAMC 1D6VL 4NSKA 4MCZB 5HJ3A 3F5WB 1FAIL 3ES6B 2CSPA 1PAMA 3UTTB 5C0AE 3ULSB 3T0AA 4NQCA 1G84A 5B22A 4NQEB 2HVJA 1HHGB 2EIZA 5IW1A 4NZRL 4LU5H 1GRWA 1II4E 2J4WL 4NKDA 4OF3A 1CDIA 3QWRD 3DBXA 5T3ZE 4YXLL 2CKBB 4PGZA 4MD5A 1YPZA 1D5ZB 3P0VL 4OZIA 3CVIL 1GC1H 3TN0D 3VGAB 4B7LA 5F7KC 4ZUTA 3GRWA 1P1ZB 1EUUA 3H9SA 4HJGB 3ZZ1A 1WICA 3NCJH 1WTLA 4KKLC 4JKKA 1H0DA 2B5IB 2D4DA 1UB6B 2B1HL 4HX1A 2YRZA 1NAMB 5IMLB 4KJYB 4POYA 1JZ2A 3F62A 2QQLL 1EXUA 2MQ0A 3LIZH 5GS1B 2A6KB 1T5WB 1NAKL 4KKAC 1I8MB 1A21A 5GRVL 2DBJA 3MLWL 1Z9SA 1FNLA 3S4SG 4Y4KC 4MAYB 4XC3H 5DJCA 4NGHH 5J1TC 3O11B 1I9RH 1YN6B 2FDBP 3VCLB 2FX7L 1JHLH 4L8DB 3B2VL 1FFNA 1OF2A 2C3HA 3DXAD 3QDGE 4M7LT 4U0RB 5ALBL 4KROD 5D7IE 2C3XA 2H9GA 3DRQA 1S5IL 3PP4H 4W4NA 5IV2B 5FGCE 2HVJB 3DYOA 3MYZA 5F3BB 1I9RL 3INUL 1E6OH 5B39G 4L3EE 3MO1A 4PGDB 4XBPA 2D7TL 2PXYB 5IIEB 5T3ZH 3STBA 2Q20A 3U0TB 5GGTA 3E8UH 3DV6A 3GMPA 3HUJF 5A2LH 3WIHL 5E6IC 2E7MA 2FX8L 4MJID 2AW2A 3VI4F 4FTVD 2J8UB 1JUFB 3NFPA 1S9XA 4MNHA 1D9KC 4LIQE 3WMSA 3U7YH 2IALB 4N1CA 4JRYB 3AVEA