1NAML

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
100
structure length
100
Chain Sequence
b'MIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BM3.3 T Cell Receptor alpha-Chain
publication title CDR3 loop flexibility contributes to the degeneracy of TCR recognition
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 8
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1namL00
3UAJC 5SV3A 2HH0H 5EUOB 1VERA 1M71A 1VFOA 4YHLH 4NRYA 4HGWB 2Q8BH 3LAFA 2D2OA 3O2DA 3DRQB 4HJJL 1NCAL 3L3GB 1I1AD 4JCMA 4Z7WA 1MJ8H 4ZTPL 4Q9QH 4JRYA 4K8RD 4ZG1A 3V79C 2VDQH 2VR9A 5GISL 4U6VH 1QSEE 1WZKA 4GLRI 2Q8AH 5CZVL 2VXSH 2BOCB 3BOVA 1K5NB 2CIKB 3DVFA 5DRXA 4BA8A 4BELD 2R2HA 3OXRA 1BWMA 2AQ2A 3F6IA 3ZTJG 5MENB 1A6ZA 1J1PH 4TRPH 4FP8H 3MRMB 1FN4A 5BW7A 2X7LB 3ZKMD 1INQB 3FQWB 1YY9D 1QRKA 1PKQE 2VDRL 1U8NA 4ZFFA 5J8OA 2Y25A 2J8UB 4R96A 4ODUA 3FQTA 5CEYB 4RWYL 2AKRA 2UZXB 5DQ9B 1AD9B 1NAMB 3FZUC 3MFGB 3VFGL 1FIGL 4I9WE 4TSBH 3KS0J 3QRGH 1UWXK 1SBSL 3BQUA 4JQIL 2PO6D 5KAQG 5IHUH 4DFIA 3H9SE 1MFAL 1RULL 1XFPA 1RVFH 5C2BH 5JW4N 4KDTC 2MPAL 1JV5B 5CUSL 4DGVL 3SGJC 4JFXA 4OQTA 3WHXA 1JZ8A 3KPSB 4UAOB 3FO9B 1DLFL 3CZJA 4FQXB 3BH9A 5IB2B 4JLRB 1NFDF 1D5XB 4WVRA 2NY4D 4MNGB 4Y4HB 5KW9L 4FFVC 3DX6A 4IRSC 5KVDH 1I7TA 3LH2H 4WO4B 4LRIC 4JPIB 5GGVY 3CVHL 1NFKA 3F12B 3CH1B 2H1PH 3HE6C 5DJCB 3EYOB 2YA0A 4HIXH 5EORH 1NGZB 1GPOH 5DJYA 5TPWL 1CD0A 2B39A 3DGGA 4YDKL 5FCSH 1UKQA 3SDAA 3Q1SH 1ZWIB 5GGTH 5I17B 3T3MF 4RAVB 4XMPL 5DRZB 2ADIB 4GH7B 3EFDH 2VIRB 2HLFD 3ARBB 5DMIL 4YPJA 4N5ED 1JZ6A 4N1CA 1P9MA 5CSBA 3SQOH 1BVZA 1R5VB 2C4FU 2VLJD 4G8FB 5ERWA 1I8IA 2J7LA 4GXVL 4W70A 4M7ZC 3MNWA 4NZUH 1CGUA 4OGAD 4K8RH 5EWIH 2YSSB 1GGCH 1QFOA 3D18B 4IIQC 3ILQD 4NQDE 1JGLL 5J11B 4D0BA 4G9FA 2RFXB 4P5TB 1F4WH 1DBKL 4KI5E 3MYZA 1QQDA 1EJOH 2EH8H 1QP1A 4NKOA 2ZSVB 2XKSA 1IGYB 3RNKA 4HUXA 4EN3D 4JFEE 1X5IA 4NPYA 3T2NL 3CSGA 1E4XI 3BD4A 4Z7QE 1T6VN 4GKNB 3WIFA 5GGSA 1Q9KB 1K85A 3BW9B 3NH7H 3MUGA 4NKDB 1HHJB 2UVEA 4GW1A 5I9QB 3D25B 4QTHB 2AK4B 2HTKD 4PJCB 3INUH 3WNMA 2D4DA 4KHTL 2ESVA 4URTB 4PB9H 5DC9B 5I74C 3G6DL 5EBLA 1XGYL 2EIDA 3TWCH 5JR1L 1A7RL 1K4CA 1RU9L 2VL4A 3AU1B 2F74A 1OPGH 4IMLA 1N2RA 5HYIA 3CGTA 1KV3A 4NJAH 4D0DA 4UUJA 3UXFA 1F97A 3UBXI 3QDMA 2F53D 2AJVH 1LILA 1IGML 3SEPA 2X1QA 1NGWB 2LQRA 1W72L 4LSPH 5BZWA 1FZKB 4WI3A 1QFWM 3HNVL 3RA7H 5DHVB 5IOPA 1TETH 3TVMB 2BVTA 3IU3B 5C7XH 4I18A 5F9JB 3CDFA 4JQVC 1P4LB 3WXVL 3ZDXE 2H32H 3AREB 3QNXA 3QEHB 5DUML 5FDWB 3TGXA 4BQ8A 2DQFA 1QD0A 1ITBB 3SDDC 2WSKA 3AB0B 1JWMA 1CK0L 4OB5H 4NDMA 4HS6B 5I1IH 1RZJC 3DI2B 2QHRL 3QZWB 2ZOKB 2B5IC 2X5PA 3QDAA 4AQOA 4YHLL 1CI5A 4TTDC 3HMXA 2Q8BL 3LDBC 2H2PD 2W91A 4MD0B 2XTJE 4NQCA 4L8BB 1FJ1A 2HJKA 4LF3A 3TNNB 1MJ8L 1BF2A 4Q9QL 1QYGH 2CIIA 3SO5A 4LMQI 3RZCB 4YK4C 3K2UH 2VDQL 5TH2A 4U6VL 1V3LA 2VXSL 1F6AA 2Q76B 2E7LC 4RX4D 3C5SB 2MQCA 4PRBB 2C9AA 2BVEA 2PW2A 4YIQA 3MRLA 4TRPL 5JOFA 2PR4L 1HHGA 2ZG3A 3NVQA 4Y19A 5F6IB 3DHJA 4ZPTA 2L7JA 4WHTB 2KQMA 2YUWA 4X4MA 2IFGA 1NJ9B 4WDIA 4KY1H 3CC5A 2ZSWA 3G04A 4E5XB 3SDCC 4TSBL 4K7FA 1I85C 1XGPA 3MYJA 3H9HB 1GHFL 1T5XB 4OAWA 4HIEB 4G6MH 1AO7A 3LKNB 3QDHA 4P2OB 1KBGL 4X9BA 1SJEA 1RVFL 2BOBB 3MOBL 5C2BL 5F1SA 5IQ7H 1BZ9B 2FJGB 4NM4H 1LNUB 1BF8A 4PTTA 1OAXH 3QQ3B 4RIRA 2F19L 2XN9E 4MXVE 5JPNA 3N9GH 3T0EC 3BP7A 5JIPA 3U4BH 4DGYH 5KVDL 3QXTA 5T5FH 4L4TE 3HAEA 2P44B 3PL6C 3QIWA 4XMLH 3T09A 2J5LB 4WTWA 2CLVA 2R2BA 5IJVB 3CAFA 5KZCB 5KN5B 4HIXL 4X5WB 1MCQA 4Z9KB 5EORL 1ZHNA 1GPOL 5I30H 5EC1B 1G7QA 2XWJA 5EIIB 4KU1A 1AGCB 1FFNB 2N7BA 4HWBA 4DAGL 1FNGB 4F7TA 3SCMC 1WQVT 5GGTL 2XZAH 3MR9A 2GSGA 3NZ8B 1FC2D 5JPMB 4JFPB 3ARGC 4NNXA 1HHHB 15C8L 5EPMB 1B2WH 3EFDL 3WIHL 4LPUA 4QXUH 3VGAC 3MV8B 3RWEB 4Z8FH 2FD6H 2A6KB 3SQOL 5I1AA 5CJXA 3LKPB 5LVEA 2P43B 4KZEH 5BS0A 1P7KB 4NZUL 5EWIL 4GW4B 1JI1A 3KWWB 4APQB 5E1AB 1MWAA 2BRQA 5LGHH 4OQ1A 1PAMA 2GY7B 4WGWB 3OHXB 1WSST 3CFKB 3K7UA 2GJJA 3Q48A 4PYGA 3HE6B 5E2UH 4A2LA 4H1LH 4HFWB 1F4WL 4PJEB 5DMKB 1EJOL 2EH8L 5D7IF 1QPPA 2V9TA 4NCC1 1KCSH 1FNEA 3C9NA 2C7UB 5DS8A 2EYSA 4D0CB 2YPLA 4U3XA 3VXOB 1F3JB 1MCRA 1AGFB 3WEXB 3QXAA 4XCCL 5IKCA 2WBJA 3GMLB 3IDJB 4NFBA 1P53A 3C5ZA 4G8EA 2P47B 1S9WB 4JVPA 3ULVC 2ZNWA 1BD2B 4KTDH 2BX5A 1AH1A 3INUL 1KTKE 1L4IA 4PB9L 4ZDHA 3ECBB 2UUDH 3FN0H 2VLRA 4LFHG 1KPRB 2ZG2A 2JF1A 3TWCL 3GGWA 5D9SB 2DQUH 4FXKA 4LQFH 5IJKC 4JPWH 4YZFE 3KPLB 4OCYH 5IQ9A 3X14A 1P6FA 2A0LC 3NACH 4Y5YA 2GT9B 3PWPD 4P4RB 3TV3H 3VJ6B 4P5MB 2AJVL 1BLNA 2R1WB 2JJSC 2JCCF 4QRRB 5FM4A 1CE6A 2GJ6D 4HSQA 5MEND 4N90E 3UYOD 1EHNA 2D7QA 3BT2H 3UJJH 4PGCA 2EXYC 1S7RB 1TETL 2AJUH 3KGRA 5C7XL 4KJPD 3ARUA 3TF7C 5IG7B 3DV6A 3ULUF 4AIZA 5I1KH 4I0PD 5D93C 3MO1A 1UT9A 4PRHB 1L7TL 2I60L 2ZUUA 3LRSB 3WKNA 1UA6H 2PCPB 1KYOK 3UC0L 3IFPB 5I1IL 1BFVH 1P1ZB 4R4ND 5F21B 3X17A 2PYEA 1DN0B 4IJ3C 5I6XC 1FV1B 3SGKA 4ZO8A 5DK2B 3UTZA 3PWVB 1QNZL 2ERJB 1QYGL 1T1WA 4EQ2A 4FG6D 4NJ9H 2VUYA 2CKBH 3K2UL 2RAMA 2ZUXA 4LKCB 1GZQA 4FQXD 2VH5H 3Q5YA 2FGWH 4J3OC 3UDWA 2ATKA 3DROA 4Y4HD 4RFOL 3U1SH 1LEIB 1JWUB 4WO4D 2P8MB 3WS3A 4AT6B 1UH3A 3KPPB 4GBXA 4JO2L 3T4YA 4PJHF 2VLME 1Q9OB 2EYTB 2NY7L 3D69B 2DWEB 3PWJB 5E7FA 4KY1L 3P11L 5TDNA 4CNIB 1TMCB 2HMID 3O4LA 4HIHA 1RJZA 4N8VG 3SE3C 3T65A 3TO2A 1UXWB 2X89A 3MRJB 1A7PH 4YK4B 4NP4H 3KYMA 3M8OH 3ARBD 3P4LA 5IBUG 5CEXA 5JORA 1YEEL 4TUOB 1JZ5A 3STLB 1DBAH 1QLRA 5IQ7L 3DJ9A 4NM4L 5JW5B 3KPOA 1OAXL 1U42A 1XH3A 3DRTA 2VXVH 4FQLH 1F02I 2MQ3A 5C0CB 3A6BH 2A1WH 1G7JB 3N9GL 3P0YH 3MLYH 4OKVA 4Z7UF 4G6JH 4BSWB 3FN3A 4P5TD 3U4BL 4DGYL 2IG2L 4X6BA 1P84K 3GMPB 4X8XA 3ZKXB 5IB5B 3NBNA 4XMLL 1GZPA 1XGUA 3OKMB 2NTSP 4NZRH 3TBSB 4HPOH 2P5WB 1I3RA 5I30L 4GOSA 3FL7A 2P8PB 5T3ZD 5ALBH 1ONQA 3L9RA 4ZFOA 5GGTA 1NAMH 3QIBB 4WI5A 3VFRA 3KYOA 2HKFH 5CILH 5KG9A 4D3CH 2AK4D 4PJGB 1B2WL 1RIHH 3QJFA 5TDPB 4OD1H 2AV7A 3UPCA 1QKZH 3T0EB 4Z8FL 1I1AA 1K3ZA 2FD6L 2G5BA 5F9OL 5JA9A 1JPST 3ZSSA 3FMGH 4KZEL 2YPVH 3KR3H 1K3IA 3PJSB 5KOVC 5LGHL 1A9BB 5DHXB 1PY9A 35C8H 5D1QB 1DP0A 1KCSL 2NZIA 5KBNC 3V4UH 3EDDA 4KK5D 3U9UA 4Y7MA 4HIIB 4LAJH 4OGXH 2M8XA 2C4XA 2YEZA 4H26B 1S78C 3TVMD 1EEQA 4P2RB 5B4MC 2XOTA 2QV2A 3GM0A 2BXZA 1J88A 1UVQB 4KK8D 2XPGA 3ARED 5IVXA 4YHOH 1IEHA 3QO1B 3QUZC 3V6OA 2FECL 1UGNA 3LN5A 3VGAB 1FNLA 5F93C 5D4QA 3BDBA 5E1HB 1HILB 4KTDL 3RWFA 5TGBB 2PO6A 2NX5D 1ACZA 1EEYB 3QSKB 3EO1B 5E2VH 2NYYC 1E6OH 3PXJA 4MJID 3PP4H 5SX4H 1UWXH 3EZ8A 4Z77B 4P46B 4O4YH 2DQUL 1JJUA 3UX9B 4EUPG 1IFHH 4LQFL 4JPWL 4NQSA 4OF8A 4PG9A 1RJLB 5EBMB 3FQXB 3UZEA 4OD3H 1S9KC 3KXFB 2VC2L 2WWMC 4G43B 1YC8A 3QXVA 1NGYA 1BAFL 5F7DA 4OZHF 1S7WA 4K94C 1CICC 1IM9A 3D0LA 4XNZC 4JKKA 4JZOA 1FZOB 4K71C 3BT2L 2FO4A 4XAWL 2AJUL 2HP4A 2XWTB 4ZNEA 2H32A 4QT5B 1YYLL 3T0DA 3P4OB 5CMAB 5TQ2H 5HHPB 4F33A 2HWZL 5T3ZH 4F7EA 2J6EH 3VFTA 1HKLH 1UA6L 4PJAA 5FOBB 4NZJA 4FHBD 4H20H 3EYUH 5DJ6A 1BFVL 2VRAA 4F8TA 2DL9A 5FA3A 2XIDA 1Q1JH 1JTOA 3B2VH 3ZDZF 5ISZB 3CUPB 2VLJA 2VE6B 2X41A 1MCNA 2DLTA 5ADPL 3B9VA 5ACLA 2YD3A 5B39A 3SKOA 1KCUL 5I8CB 5L9DH 4YLQT 1MHHB 3OKNB 4OKDA 1CLOH 2VH5L 5H37H 5GRVK 3C09C 2OLDA 4U6XB 4Z7WE 4JRYE 4XNYL 3OR6B 5TE7L 3V8CA 2BMKA 3U1SL 4EN3A 4J4PD 4NKMA 1QFUH 3PDGA 4WHYG 1DQJA 3FZUD 3LY6A 1BQHG 4LHUA 4WEUD 4OFDA 3T04D 3IJHA 2J88H 3DX8B 5KZCD 3FT2B 2FX7H 1VENA 4YO0A 1DBML 4IJ3B 5IGXL 1M6OB 5DUBA 1R3KA 4L3AA 5C2UB 2EYRA 1DQQB 3GIVA 3FO2A 4ZAKC 1KXQE 4DW2H 1FRGH 1OP3K 1PGRB 3L5HA 3FHAA 4JVWA 1FE8H 4NP4L 3UZVB 4QHUB 3SKNB 1F2QA 3M8OL 1VHPA 4PBXA 5K59F 1ZGLB 3FQRB 3U46A 3MV8D 4MNQB 5ID1A 5ITBH 2K1MA 4X7FC 3DXAD 1DBAL 2OBGA 4FFVD 2XFXB 1KIPA 3MBEC 4FQLL 2VXVL 3BD5A 5C0FB 4Q9BA 3A6BL 3P0YL 2F53A 4APQD 3MLYL 1JE6A 4HLZH 4WI6A 4G6JL 4PLJC 3HE6D 4HQQH 5ENWB 5A16A 4LHJB 1EBPA 3F7VB 3RIFF 1EHAA 4X98A 1VFBA 3WJJA 1G7HB 1KCRL 1G7LB 4NZRL 2QQLL 4HS8H 5DDHA 1OB1A 4M8VA 2YBRB 3NCFB 3LRHA 3CJJA 1BIHA 3CFEB 5ALBL 5F72S 5DD1H 1XGTA 3SHSA 4HLZG 1FL3B 4OF6A 3TZVA 1FCCA 2F54D 4WUKH 4M7JH 3TBVB 1BD2D 2RR3A 4F7PA 3HLAB 4U2ZA 5CILL 5C6WH 4ODBD 2WV3A 1A0QL 1RIHL 3GSRA 3BZDA 3IXTA 4YDIH 1NL0H 4RMWA 4YHIA 3QDGE 4A6YH 5D1ZA 3H0TA 2BNUA 2NW3A 4HS3B 1ZLWK 3K81A 3WL9B 3WO3B 3WJLC 3FT4A 3V0VB 5EO9A 2QR0B 4QF1A 1X5AA 4H1LA 3F5WB 3X3FL 4RX4A 4IMKA 35C8L 1KJVB 3O3EA 2BHUA 5J9PB 1DZBA 2R2EB 4QRRD 1UYWL 2GSIA 1NC4D 2R69H 3BMWA 5DEGA 5K9OA 2JB6B 1FP5A 3QNZA 2G75B 5E9DB 1FL6B 4OGXL 1KTDA 3WXWL 2OJZL 1YQ2A 3BIKA 2P5EB 4KTYA 3HB3C 3WNOA 3RFZC 4CJ0A 3W2DH 2OTWA 5FHAH 4PRHD 2YUVA 5ESQA 1DN2A 3QEUA 4ETYA 3FCTB 5ICZB 4ZPVA 5E2VL 3HC0B 1E6OL 3JWOC 1FAIH 2HVKA 2DAVA 3OV6A 1U91B 3E3QC 4O4YL 5BRZE 2BVOA 4KXZH 1IFHL 3G08B 5CAYB 4I4WA 5FYLE 2ESVE 5JOEA 4DCQB 4IOSD 5GGUA 4EQ3A 3QCUH 3DX9B 3OWEA 5HI4C 2ORBH 4X9GA 3W82A 4Y5XB 4D9RD 5C0AB 2ZCLL 1TZGH 3PE9A 4PP1C 5C8JB 3RAJL 3QDME 2C1OB 1I7UB 3JWDC 1UG9A 5E6IA 3S7GA 4L8SB 4RWHA 4QKXB 4UOJA 3OQ3B 5A2FA 4EBQL 1SEBA 5T3ZL 1WEJL 3D3VB 1U92A 2J6EL 4TTDD 4WFHD 1FH5L 1HKLL 2BSTB 3RUGF 3BH8B 4S1SH 2P7TB 4H20L 3EYUL 5FO7B 3BX7C 2O5YH 3DO7B 5HPMA 1WWWX 2VDOH 5HYQA 1NGPH 1Q1JL 3B2VL 4LCCC 4YHML 4FQ2L 1MI5D 5EOTB 5BXFB 2W0FA 4E0RB 2QADC 3L1OH 3BYTA 1CICB 2CKBA 2ZP0T 1NUDA 1T7YA 5IVZB 5L9DL 5JQ6H 3REWA 3MACH 4MZ2A 5F3BB 1C12B 5C0CD 4NQCE 4ZO9A 1NFDB 1ES0A 4OZIA 1WT5C 4GXUN 1I1YA 4OCRH 5L8JB 3O11A 1X9QA 5CSZA 3PDOB 3HRPA 1CFSA 4XH2B 3OJVC 2WBKA 1E27A 3EYVA 2IWGA 5IM7A 2J88L 5DD5H 2P5WD 1RZFL 1NDMA 2BY0A 1T20A 4ODXB 4ZUUA 4E9LA 3U6RB 1CIDA 4Y19E 4HXAH 2KBGA 1SYSA 4JHBA 5HHQA 3QIBD 3NCYS 2DKUA 4DW2L 1WBZB 4X4ME 1A4KB 3FONB 5EUOA 4KVNH 1FE8L 3HFMH 4PP2B 4PV8B 4HGWA 2B1HH 3DRQA 3GBLA 5CSGA 3WD5H 5ITBL 3L3GA 1F4AA 3PIQB 3T0ED 3GHBH 2D3VA 4CW1B 4O2EB 4UIMB 3VG0H 1AO7E 1EGJA 3BZ4A 3PWPA 3PL6D 2BOCA 5KVMC 5F8QC 5MI0C 1K5NA 2CIKA 4HQQL 5D1QD 5MENA 4GXUM 3FQNA 5D1XC 3MRMA 4MD5B 4KKCD 1L9NA 4LCUB 2X7LA 2DBJA 3SCMD 1INQA 1C5BH 1OGAB 3FQWA 4AG4H 4HS8L 4ISVB 1V05A 4ZAKB 4KI5C 3QUMH 1RZJH 4P2RD 2J8UA 4I0PA 2DOCA 1UEYA 4XC3L 5CEYA 3RY6A 1CU4H 5DD1L 5DQ9A 1NAMA 4QRSB 4KMQA 4BQCA 1MUJB 2OI9C 5AYQA 4M7JL 3O3DB 3HC3L 3TBWB 4G8GB 5A40E 1QHOA 3DI3B 4YDIL 1NL0L 1K4DB 4A6YL 4F7CB 4GLRH 4P46D 2OL3B 2Y06H 1JV5A 4JFOB 5ILTH 2GQHA 3S35H 3KPSA 3FO9A 2WUCH 4FQXA 3LKRB 4GJTB 5IV2B 5IB2A 4JLRA 1D5XA 3KXFD 2UY6A 3QULB 4Y4HA 4HKXB 4QEGA 2DQTH 3P2TA 1NKRA 4LVHC 3NPSC 5BS0E 5LKNA 4WO4A 2FEDC 1A1NB 4ESKA 1U8LB 4X99B 3F12A 3CH1A 2EDFA 5E5RB 1KJ2B 5DJCA 1V8HA 3EYOA 3ESUF 1FAKT 1NGZA 2Z8RA 3T2OA 4GMTH 4X7DC 1UZ6F 3MC0A 5HVGB 2YPLE 1WITA 4UOW1 5GHWL 5FHAL 4N0CC 5I17A 4RAVA 2EDKA 4IS6B 5CIPB 4AEIL 4NWTH 5DRZA 2ADIA 2VIRA 3ARBA 1FAIL 1JYNA 2A0LD 3ILPB 2XICA 1XF1A 1H8OA 4G9DB 1R5VA 5ISZD 4TVSa 1RI8A 4G8FA 3MLXH 5J12B 4PYHA 4KUZL 4WTZA 4RGOH 4OJFH 1NCTA 2YSSA 4Y8DC 5MERB 2VLRE 3QCUL 3C5JB 2RFXA 1T89C 2XTJC 2IPKB 4P5TA 4KK9C 4ALAL 3QRFM 2FGZA 1I8KB 1SVZA 1NBVL 2ZSVA 1D6EB 1QSVA 4YDJB 1IGYA 1TZGL 5CWSB 2EDQA 4NN6C 4U2YA 3RPKA 3FB5B 5BVPH 4UQ3B 4O2CA 3JZ7A 3SE9H 3QEQD 4F9PA 4GKNA 2J6EA 4K3GA 5HHMB 4XX1G 4F2MB 5I0ZA 1Q9KA 3BW9A 4NKDA 1HHJA 4JKWA 3D25A 4LPXA 4QTHA 2AK4A 1F3DJ 4PJCA 2O5YL 3FN9A 2VDOL 1X6LA 5LGKA 1NGPL 3MUHL 2W92A 4Y4FC 1B4JL 2AABH 4LSSH 4MNQD 3AU1A 3L1OL 2H8PA 3MRNB 4AYFA 1YN6B 2P45B 2PYEE 4WHDA 5JQ6L 3MACL 4U1SB 5FYJD 2XXCB 5KVEH 2OTPA 2R1XB 4LVNC 2X09A 3K80A 3TIEB 1E4XH 1FYHB 1LHZA 3QUKB 1NGWA 4OCRL 3MJ6A 2HFGL 5DA4A 4BH8B 4CAGA 4J12A 3PG2A 1FZKA 4NC2B 2D7NA 4P2CG 5DHVA 4C83B 3TVMA 1N59B 1J5OL 1LDPH 3ULVH 5KSUB 5F9JA 1P4LA 3S88H 3AREA 1WWBX 3QEHA 4R0LC 5FGSA 5FDWA 1YPZB 4ELMF 3ULSA 4HXAL 1DANT 5BOZG 4MZ3A 2NX5A 4WFFD 2W60B 4WV1C 4HS6A 3BZEB 4U7MA 2PUQT 4Y5VA 3QZWA 3L3HB 2ZOKA 4KVNL 1BZ7B 3HFML 2XI9A 2VABB 5HXMA 4MD0A 5TF1H 3O4LE 4L8BA 5HHOB 3GHBL 4CMHB 3TNNA 1ORSB 3KPNB 1WZLA 3LCYA 4MB5A 4UQ2B 3VG0L 1I3UA 1OAUH 4G80B 5IHZB 3HN3A 1LO2H 1G9NC 2Q76A 4ENED 3LQAL 3C5SA 1AGEA 4H0HB 4HCRA 5CEZH 5ALCH 5E9DD 4C55A 4K2UH 4LIQH 3FOLB 3FOMB 4WHTA 1EV2E 4AG4L 5FGCE 2YD6A 5HGGS 3BMVA 4FXLA 3QUML 3UROR 2E6JA 1RZJL 1T21B 4MCZB 1A22B 1NJ9A 1TVBB 4M5ZH 3VXTA 1CU4L 3RWJB 2P5ED 4E5XA 2LVEA 3BP4B 1I9RH 2H26B 5K9QG 5DMYA 1OWRM 2DDQH 2R29H 3H9HA 2IAND 4RNRB 1Z9MA 2QKIB 1ZLSL 3BPOC 1IQWH 1T5XA 4HIEA 1KIRA 1X5GA 1MVFA 1RZ7L 3LKNA 3QFJB 2E6PA 4YFDB 4P2OA 2ITCB 2BOBA 2JLLA 1AY1L 1BZ9A 2XZQH 4R2GB 2FJGA 1OW0C 1LNUA 1R5IB 2VQTA 4FQHB 4PJXF 5IFHH 3QQ3A 5ILTL 5D1XB 2Q7NA 3WLBB 2WUCL 1ZHKB 1PEWA 1GC1C 2OS7A 1WF5A 3BKJH 4UINH 2DQTL 2JCCB 4M6MH 1U41A 4J4PA 2GI7A 5E8DL 5C0AD 3TJHC 3RRQA 2CH8A 3WHE1 3LEVL 3B8SA 3KDMB 4DKEH 3QUZD 2OI9B 3OKLB 4IOIA 3OZ9H 2W0KA 5KN5A 4X5WA 4XTRC 2AJZB 5EC1A 4GMTL 4ZUVB 3OTTA 1AGCA 2NYYD 1NCCH 5HY9A 1VEPA 3D3VD 1DSFH 3NZ8A 5JPMA 3HKFA 4JFPA 2IPTH 1HHHA 4NWTL 3SGJA 5EPMA 5IVXE 4OZ4B 3QXUA 1OP5K 3V6OE 1TZHB 3MV8A 4GS7C 4LAQH 3RWEA 2EXWC 2WWMD 2A6KA 2FX9L 2LAGB 3LKPA 3MJGX 1NPUA 4LVHB 3MLXL 4LRIA 1JVKA 1P7KA 4RGOL 4HWUA 4GW4A 1CICD 1J9CT 4XGZB 3RVXC 3KWWA 4APQA 5E1AA 4QTIH 4RRPA 3VFPB 5D7KD 1H3PL 3OHXA 3CFKA 1T04B 5A3IC 4LDEB 3HE6A 2QEJA 3GUTB 4HFWA 1X5HA 5DMKA 3TBTB 3O6FC 1Z6JT 2C7UA 4HUVB 1IZJA 2Q20A 3IFLH 4NBXB 4D0CA 3VXOA 5M95B 5BVPL 3U0WH 1F3JA 1AGFA 1FCGA 3WEXA 1FNHA 3SE9L 5LGJB 4PJHB 5B38G 1EERB 1U8OB 1A6PA 3GMLA 3IDJA 3CXHJ 2R4RH 1D5ZB 2XWBB 1S9WA 3UO1L 1T80A 2R2CA 4NRXB 1BD2A 4ZNEE 1SYVB 1IC5H 1D5BB 2IAMC 5DFWH 4PY8J 3GJFH 5EG6C 5DVOA 1REIA 2EDNA 4WW2F 5GS2D 1NSNH 3QUYB 1KPRA 4PJAE 4NZTH 1INEL 3I2CH 4LSSL 5D9SA 1P4IH 1U36A 4BUGA 3S4SA 3KPLA 1B6UA 1X5LA 3DVGB 2GT9A 3WN5B 1B0WA 2VLJE 4P4RA 4Z7UB 1ZLWH 3VJ6A 4MQXC 4P5MA 2R1WA 1RZKC 4QRRA 3S5LB 1T6WA 2VDNH 3CDGB 2IQ9H 1S7RA 1KN2H 2P1YA 2VXUH 5CD5C 3ULVL 3BO8B 1OGAD 3S88L 3BAEH 3JV4B 4ZAKD 5IG7A 1LO5B 3N1MC 1I9IH 2GTZB 3L95B 4PRHA 3LRSA 5EBWA 3QHZL 3O8XC 2A6IB 1CLYH 1EAJA 2PCPA 3WUZA 3IFPA 1WVZA 2KH2B 4ZFZB 1P1ZA 3BVNB 4O02H 4G8GD 1DN0A 4MNHB 2BVYA 1JGVH 4LVNB 1FV1A 3DMMC 5DK2A 1E6JH 4PLJD 3LS5L 3PWVA 5DJZB 2WP3T 4K94H 1N6VA 1OAUL 4LKCA 5I71C 4MJ6B 1LO2L 3RQ3A 4ZOEA 4JQVA 5CGYC 4CU8A 1LEIA 4L8CB 1JWUA 4AY0A 1OAQH 1ETZB 2CRYA 4B5EA 2F53E 2P8MA 5CEZL 4AT6A 4UDUB 3KPPA 5JXEC 3MJ9L 4JN1H 4ONHB 1Q9OA 2W0PA 2DLFH 2EYTA 1DCLA 2DWEA 3D69A 3PWJA 4X6EB 1UCBL 1IILE 4HV8B 4EOWL 1UM5H 4CNIA 2EEAA 2H45A 3GIZL 2DDQL 1KCVH 2MWCA 1UXWA 4OIAA 4MD4B 3MRJA 1U58B 3K8KA 2UYLB 4ODVH 1OQXA 4BZ2L 2YN3A 1A2YB 4TUOA 4OD2B 1U3JA 3RWHB 1S5IH 1A5FH 2XZQL 3STLA 5C0BB 1DFBH 2AK1L 3V8OA 5JW5A 3RJDA 5IFHL 3L7FB 2AQ3A 4XCFH 5C0CA 2W07A 5C3TA 3KYKH 1FVDB 1B9ZA 1AXSB 1G7JA 5DFVD 3CX5K 2ADGA 4I2XB 4S1QH 1AQDB 4YX2H 1I8LC 4TPRH 3BKJL 4UINL 4M6ML 5EBGA 3MV7B 1LQSR 3GMPA 3VCLB 1OP9A 2JK5B 5IB5A 1MHEA 3HB3D 5ELIA 3U7WH 4C58B 3OKMA 5LCVL 1N8ZB 4NKQB 3OZ9L 3TBSA 3BPLC 2P5WA 4X4ZA 3MTRA 5BZDB 3A6OA 3BPOB 1MJ7L 2P8PA 2YA2A 1NCCL 4XP1H 5HHMD 3QIBA 4QY8B 5K33A 4M7LH 5BVJB 4NSKB 4U3CA 2IPTL 4PJGA 4M7LT 1MRFH 2XRAH 2J8HA 3D87B 3EOTH 2JJVA 5TDPA 3MCG1 4Z7QF 1FFPB 3KJ6L 4LAQL 3T0EA 3OKKB 5HI4D 1EA9C 4YDLC 1AIFB 4CDHA 5E5UB 1V7ML 3PJSA 4QTIL 1WFTA 1CBVH 2PXYC 2VDPH 1A9BA 1O7SA 3RIFK 5D1QA 4P4KB 1FSKC 3GO1H 3QI9C 5EU6D 4V1DB 5FYKD 4HG4K 1PX4A 4RGNB 5IMLB 4HIIA 1DR9A 1T5WB 3U0WL 1EX0A 4WNQB 3V9FA 4H26A 5D71H 3V5HB 4P2RA 5E99H 2YRLA 4OLVH 4LCYB 1YEKH 1KEGH 3NGBB 1UVQA 4YPGB 3QYCA 2GK2A 5IHBA 3QO1A 5HGAB 3D9AL 4JKPL 5F1OB 3EBAA 2A6DB 2PETA 4CADB 2UZIH 1HILA 2QLVB 5TGBA 1R3IH 2R1YB 2ICWJ 1EEYA 4OI8A 4N0UB 5KSBE 3EO1A 3Q6FB 4KK6C 3BYYA 5CIPH 1GRWA 4LPVA 1BREA 1JZ4A 2XZZA 1G6VK 2EDXA 3BI9X 1NSNL 5A43C 4Z77A 3ZDXF 4P46A 4KROB 5EB9A 1P4IL 1QBBA 3O6FB 2YD1A 4WI8A 1RJLA 5D96B 2XKNB 2K7QA 4EI5B 5EBMA 4CVUA 1GOGA 3I6GB 3FQXA 4HWZA 4UB0H 4XNMB 3KXFA 5C6PB 4G43A 2R4SH 1JF1B 5BV7B 3BQUC 2F8XC 2Y72A 2VDNL 1FZOA 2IQ9L 2FATH 5KTEL 3NOIA 1KN2L 2WUBH 2XWTA 2VXUL 5J7CC 4QT5A 4OZIE 2DLEA 2VWEC 3P4OA 5CMAA 5DVNA 2G2RB 5HHPA 1I9IL 3JWOH 4Y1AB 1CLYL 5FOBA 1R24B 5GZOC 1KB5B 4FQJH 4YE4L 4RBPK 1GGIH 4O02L 2OXHA 2Z93B 3FFCB 4NO3B 2FCBA 4YFLF 1RUQH 3UBXA 3ARDC 3QFJD 4R97C 5DYOB 5ISZA 3CUPA 2MTPA 2JJSA 2VE6A 3TJEH 4OV5B 5HJ3B 4R2GD 5EUOE 3TYGH 3EZJB 1XF5B 4K94L 2X4TB 4QHKI 4U1IB 4EZMA 2NY1B 1MHHA 5D1XD 5I8CA 3OKNA 3SDAC 4Q2ZB 4YHNB 4U6XA 4XPAH 3OR6A 4OM1H 3W0WB 1OAQL 4Z7OF 3PWPE 5I8KL 3ES6B 1A02N 1P9MC 2WBWB 3GSVB 2GJ6E 5I1LB 4JN1L 5MENE 3NFPB 3DX8A 4MXVF 1TQCC 3FT2A 3K74B 4BZ1H 1MY7A 4Q9RH 2D0GA 3ULUD 3MJ7B 2LTQC 5SX5H 3DMMB 1M6OA 1UM5L 4ZOBA 4JHZA 1KCVL 1DQQA 3H42H 2NXYC 2EDDA 2J8UE 4MA8H 4DZBB 4M8QB 4X6FB 4ODVL 4QHUA 3SKNA 3EFFB 1IGCL 2A2QT 4M9OA 1SJXA 5I71B 2Q3AA 3GI8H 1ZGLA 1MAJA 1A64A 1H3VA 3FQRA 4MNQA 4R7DB 1S5IL 1A5FL 1DFBL 5DJAB 2WQ8A 4M1CD 2XFXA 2FEDD 4XCFL 5DR5H 5F7LB 5C0FA 5CGMA 3GSNB 2AS5M 4S1QL 4JZJB 3GB7B 4TPRL 5ENWA 4IDLA 3I75B 1ZVYA 3F7VA 1Z2KA 5HGBB 1W8OA 1Y18B 2VNCA 1JCKA 5DJ0B 4F37F 3U7WL 1G7HA 5ESVB 1I9JL 3LMJH 3SE3A 1G7LA 4N0CD 2Y9RT 3EUUA 3D6GA 2YBRA 2DYPB 3CFEA 3DVNB 1DQDL 3K1DA 3Q5TA 4XP1L 1FL3A 2LVCA 2V6HA 1CS6A 1G7MB 3RUGB 3CD4A 3HG1B 3TBVA 4XCNB 3HLAA 3BRGC 1MFEH 4QRQB 4PJ8C 4R8WL 1MRFL 2XRAL 1NCNA 5L8KB 4JANB 5CJOH 3QUYD 2YMXH 2KPNA 4M5YL 5IROC 4I18C 4HS3A 2GEEA 3WL9A 4OLZH 4N0YH 4NHCL 5TFSH 3E2HC 43CAB 3V0VA 2QR0A 3T77B 2VDPL 2DL2A 1JIBA 4HXBH 3F5WA 4QHMB 4FNLL 1F90H 1KJVA 1YNKL 3GO1L 2YD9A 4P3WA 1M7XA 3RVWC 5ACZB 5J9PA 2R2EA 1E28B 3PGCB 4JO1H 3F58H 5CP7B 2JB6A 2Z31C 5EU4B 2G75A 5E9DA 1FL6A 4KKBC 4TQEH 4CKVX 4WFED 2V5SA 5D71L 4ACPA 5EU3B 2HFEB 1BEYL 1UCTA 5E99L 4OLVL 4JREB 1YEKL 1KEGL 2IF7A 2J4WH 4HPYH 2P5EA 2DQHH 3SGEI 4JR9H 2EH7L 2ARJB 2UZIL 2IANA 4GRWB 4Y4FD 2FH6A 2KUTA 5EIVA 4RFNB 1KB9K 5T3ZE 1JHKH 5CJ5A 3FCTA 3HE7B 1GGTA 5ICZA 2GAZB 1SY6H 1OSPL 3CSYB 5F7FA 3HC0A 3L3IB 1WFNA 4NCC2 4MA1B 3ZE1E 3C8DA 4XBPB 1U91A 3UTPD 3RWGB 1FSKB 2AK4E 3G08A 5FGRA 1N6QH 5L0QC 1KLFA 4M93C 2WIIB 4AH2B 4NNYB 4DCQA 3VGEA 3GI9H 1HHKB 4UB0L 4MDJB 1B0GB 3BEWB 3DX9A 3R0NA 2R4SL 1BQSA 4Y5XA 4JCLA 5C0AA 5J56B 4HK0B 4HJ0D 4N0RA 5C8JA 4UILH 5FIEA 2C1OA 1I7UA 1O5DT 5CJ8A 4U49A 2ADJB 3MOAH 1MEXH 2CJUL 4PGBB 3EYQD 5E2WL 1TVHB 2CO7B 3CCHB 5BMFL 3D3VA 3VDCA 3JWOL 5KSAC 3WV0A 2BSTA 4RMRA 4JDZB 4UV4H 3BH8A 2P7TA 5FO7A 4FQJL 5J3HC 3DSNA 5D70H 1GGIL 3DO7A 4M4PA 5E8EB 5E8NB 4MAYB 3QIWC 1ND0B 1NLDH 1RUQL 5L7XH 5EOTA 2NX5E 4MX7B 5BXFA 1MAMH 4E0RA 3TJEL 3N1GC 5C0BD 1CICA 4MJIE 1A1MB 2Q87A 3STBA 4JY6B 5CINH 5F3BA 1C12A 1FL5B 2FJFB 1NFDA 1YQVH 2FLRT 1JGUL 4Q6IB 3JWDL 5I1HL 3VFVB 4OM1L 3THML 2HG5B 1PBYA 1YNTB 2G60H 3LHPH 3PDOA 3MRIB 4MJ2A 4XH2A 2ED8A 3WO4C 3G5VB 3DGCR 5CJXC 2W9EH 3MRKA 4ODXA 1LEGB 1CDBA 5DURB 2DMKA 3GFUA 5FM5O 4F80A 3FB6A 4XNQB 4QWWC 3U6RA 3ARDB 4R97B 1NLBH 5J1AB 1DBBH 3H42L 1ERNA 5ID0B 4QRTB 1WBZA 4MA8L 1A4KA 3FONA 3RBGA 5CBEB 4ETQB 4PP2A 4PV8A 4K7PH 4PB0L 1AD0B 4JFYB 3JV6B 2CMRH 5BOPA 3PIQA 3VH8A 2ZUSA 4CW1A 1WCQA 3ZT7A 1NMCC 3ARQA 4XAKD 1JFQH 1YMMB 2WBJC 1VPOH 4O2EA 4UIMA 5DR5L 3TJHD 1BVLB 1NCDH 3C5ZC 4F9LA 1ZTXH 4FQ1H 4P0DA 5DF0A 1HN1A 3U2SB 2H41A 4FFZH 4P4KD 1TQCB 4XTRD 2VMFA 4V1DD 1OCWL 4Z7VB 4JKLA 4E41B 1O0VA 4MD5A 4H8WC 4ONGH 5C08B 5ESAB 4LCUA 1QLEH 1H3GA 1OGAA 4YC2B 4ISVA 5IK3B 4ZAKA 4JFZL 3O3AB 2UVFA 2NXYB 1ED3A 4CDGC 4XPFH 4MS8C 4KVCH 4XP5H 4QRSA 3QDJB 1N7ML 4Y5YC 5E2TH 1MUJA 2ED7A 1JNJA 1J0ZA 2EXWD 3O3DA 2OX5A 5EOCH 3TBWA 2WK2A 3HTLX 4G8GA 2PW1B 4LEXL 4U1JB 4PRPB 3OR7B 2KL6A 3RVXD 3BGFB 5CJOL 1IKNA 1K4DA 4F7CA 2YMXL 5A3ID 2DQDH 1UC6A 1G9NH 3OMZA 4KROD 4MGXA 4AK1A 4OLZL 3O6FD 2OL3A 3OKOA 3OX8B 4N0YL 5TFSL 4TVPD 2HRPL 4NCDA 4JFOA 3LKRA 4YBQC 4EI5D 3MV8E 4FRWA 5IV2A 3DXAE 5GS0C 3IJSB 4HXBL 3QULA 5FB8B 1BFTA 1JRHI 3ROLB 3UTQB 4O51B 1A6VH 4HMDA 4JO1L 3F58L 1IGTB 1A1NA 4OLEA 3GMOB 5I15H 1U3HC 4ZD3H 1U8LA 4X99A 3K4ZA 3HPJB 3SGKC 1T0PB 3VFMB 1KJ2A 3WE6B 2OQJB 3VD4A 2J4WL 4PJ8B 4NQXB 5IP4A 2DQHL 1Q38A 4LVOB 4NC1E 2Q86B 4ELMB 2OR9H 3NABH 1HNGA 3IF1B 1JHKL 3B9KB 4IS6A 5CIPA 3E2HB 4KRMB 3WJLA 1AHWB 5BQ7B 3KLSA 5K9JH 1J11A 1Q72L 3FFCD 3ILPA 4WENB 3O4OC 1BD2E 4GBXC 4KJYB 5AAWA 4LLDB 4G9DA 4I8DA 1GC1H 4MQXD 1J1OH 3DV4B 3RL2B 1Q0YH 5MERA 4TOYH 1FO0H 4NO5B 3MX0A 3C5JA 2IPKA 1AJ7H 4G5ZH 1IC7H 3QG6B 4XVJH 5C86A 4HKZB 1D6EA 4YDJA 3W0WD 1UJ3C 5CWSA 4NFCA 4UILL 3FB5A 4UT6H 1BM3H 4JPKH 1J87A 2N7AA 4UQ3A 4X80H 3MOAL 4QRRE 1MEXL 4AIOA 4JY4B 1NGXB 4F2MA 4DN3H 5LG1A 3W81A 1WAAA 2RB8A 3DMMD 4UV4L 1DDHB 5L0QB 2NXZB 2F58H 5JIKA 4XCYB 1YEIL 3ORJA 3PQYB 1JTPA 2GKIA 4PRHE 1NLDL 5L7XL 2IGFH 4QGYA 1MAML 2FHBA 2Z4QB 4LLWB 1LP9B 2IEPA 3MRNA 4PJXB 1CT8B 1T1ZB 1YN6A 1H3UA 1OT2A 4TVPH 1A7BA 5CINL 4KJQC 3WNNA 4U1SA 2R1XA 5JXED 5EU6A 25C8L 4L4VD 4UZGA 3TIEA 4ODHH 3VRIB 3QUKA 4KKLD 4LNRB 2SEBB 4BH8A 1OOAA 2G60L 1OHQA 3LHPL 4L9LC 5DQDL 3Q6GH 4J8RB 4R4BB 1N59A 4C83A 4D9RE 2F8VA 3V4PL 3NA4A 5KSUA 4S11A 4LL9A 4KGJA 4I3SL 2W9EL 3PHOB 1KELH 2J1KA 1YPZA 1TITA 5MEPB 2DYPD 1MRDL 5FGBA 1NLBL 2IMMA 1TPXC 4PREB 2W60A 2JJWA 3BZEA 3HG1D 1KB5H 4WFGD 3L3HA 1GGYA 1BZ7A 4WFHE 5J13C 2VABA 3IDMB 4LLMA 1JGEB 2CMRL 2FDBP 3E1F1 1ORSA 4NN7C 1RZKH 3KPNA 1VPOL 4UQ2A 1IMHC 2DLHA 1MI5E 4FOMA 4HBQA 1NGQH 1NCDL 1ZTXL 1ADQH 1F4HA 4G80A 5IHZA 1EHXA 2BRRL 5IB1B 3VRJB 1TCRB 4FQ1L 2G5RA 3WO4B 3UEZA 2PO6C 4MCYB 2CLZB 5C0CE 1XGRB 4ONGL 3MUY1 4P3CH 3D5OF 1QLEL 3FOLA 3FOMA 4OLYH 2ZKHL 1T21A 4NZDA 5D5MB 1TVBA 4L8DB 1V7NH 4XPFL 3RWJA 4KVCL 4XP5L 3BP4A 5E2TL 2NY4C 2H26A 1ZT1B 5C9JB 2P5WE 5IW1B 5EOCL 3MNVB 4RNRA 2QKIA 3N1FC 4HWNA 4ORGB 3HE7D 1SM3H 5TJWK 3QFJA 1T2QH 2CUMA 2ITCA 1ZGLM 5DSCB 4WUUB 5IHLB 2DQDL 1G9NL 1R5IA 3NFSH 3GRWA 4FQHA 4GAGL 4PJGE 1J05B 4ZOAA 5D1XA 4WJ5B 4FMKA 4JJHA 4WTXA 3WLBA 2E3VA 5FECB 1ZHKA 1EVTC 2BNRB 3T0EE 1INDH 4MWFB 2BERA 2QL1A 4I77H 1TTGA 1PLGH 3WFDL 2VZUA 4M7KH 2Y1VA 2JCCA 1A6VL 1MCIA 4PJ7E 2DKSA 3F7YB 1B90A 1YDPB 3O41B 3KDMA 3OKLA 1CGXA 3GSWB 5J06A 5C1MB 4PRDB 1HE7A 1QSEB 2AJZA 3WMSA 1LD9A 1B6DA 4ZUVA 4KK6D 3VWKC 3MRHA 2UWEF 2OR9L 3NABL 4X5XB 1MELA 4P2RE 5CGTA 4DUXA 1SY6A 2X1WL 1BJMA 5HDBF 3T0BA 4OZ4A 5I1EH 5K9JL 3C2AH 5GRWA 3OJ2C 1TZHA 4MAYD 4NQUA 1GC1L 1J1OL 3EYFB 5C9KA 1MNUH 2DM4A 3LRGA 1A8JH 1Q0YL 4OCMC 4XGZA 2AQ1A 4TOYL 1U3HB 1FO0L 1L7IL 4HGMA 4X83A 8CGTA 2L4OA 3RU8H 1T04A 1IGJB 3VMNA 5DGRA 3GUTA 1AJ7L 4G5ZL 2HTKC 3CFDB 3TBTA 4GRLC 5AZEH 4XVJL 3LOWA 4BUHA 4HUVA 4LSUH 2DS4A 3A0OA 3KXFE 4R4FH 3V0AC 4UT6L 1G6RB 1BM3L 2W38A 5ACMA 4X80L 4UT9L 1EO8H 4U1GC 4PJHA 1T0NB 3MRPA 1U8OA 4NBZB 1W0WB 4TNWF 1D5ZA 2XWBA 5DURD 4FFWC 4NRXA 1SYVA 3ARDD 4J3WA 1D5BA 4GRWH 1MJUH 2F58L 1B0RB 5JUEH 4ZXBB 1G0YR 4H5SB 3MLSH 3QUYA 3WJJC 1T89A 1EEZB 4M61B 4FN0A 4N8CH 5IMMB 4NKIH 4TVPL 1UJ3B 2H2SC 1OM3H 1YMMD 3DVGA 4MVBD 1R3JB 3WN5A 5ISZE 4Z7UA 3TZVC 1QA9B 2MNUA 4TNVF 3H3KA 2RQ8A 4ODHL 3S5LA 5CZKA 4RMSA 1IQDB 3CDGA 3Q6GL 1EMTL 5D1ZC 5C08D 1OTSD 4G9FD 3SKMB 5IMOB 3BO8A 3JV4A 2NXYD 1KELL 4PTUB 4GQPH 1LO5A 1A7OH 4JFFB 1DBJH 1RIUH 2GTZA 3L95A 4GO6B 4LIQE 3H3PH 3QDJD 2DQCH 2FIRT 2A6IA 1KLGB 2HYMA 2B2XH 3CU1A 3QEQE 1X5ZA 3C87A 3BVNA 1KB5L 4NHUB 1CG9B 2E8ZA 2FNBA 1D3CA 4M48L 2V17L 4FS0A 4JM2C 4MNHA 1JN6B 2EDYA 4XPTH 3TT3H 1TJGH 4M1GH 5DJZA 2DICA 4NO0B 1RZKL 4GAYB 4LMQE 5EO0B 2IBBA 2I26N 1K9TA 2VISB 5EOQL 1H8SA 1N0LA 1NGQL 5I1GH 4L9LB 1RQ5A 4JHAH 3VI4E 4MNQE 5FDYA 4OCLC 4L8CA 4X7EC 1HXMB 2XY2A 5FYJE 1UH4A 2EEDA 1ETZA 4J1UA 4LGSB 4QRUB 2EIEA 5HI3C 5D72H 4UDUA 3OJDB 5KVGH 5BCAA 2GCYA 3A6CH 4ONHA 4P9HC 4OLWH 4ZS7H 3WLWC 1CTNA 4X6EA 4MJ4A 4PJ8D 5J13B 2EE6A 1V7NL 3IGAB 4HV8A 3TIDB 3ZSTA 3MA9L 1MREH 3CX2A 1BFOB 1GIGL 1MCLA 4MD4A 4NN7B 1U58A 2UYLA 4B0MM 1CE1H 5DXWA 2ILLA 4L3EB 4KRLB 1SM3L 4U1HB 1TQBC 3ARFB 4WFFE 1CXIA 4OD2A 4Y4KB 2PYFB 4ZFGL 4G42B 3HUJA 1OARH 5E6IC 2FYYB 3RWHA 5C0BA 3NFSL 3RVWD 5I1JH 5JZ7C 3O6MH 1D6VH 3L7FA 1ZK9A 1FVDA 4H0GA 1AXSA 2Z31D 1NMBH 5FAAA 1INDL 5IESL 4I2XA 1AQDA 1QOKA 4I77L 1PLGL 3F7RA 5K93A 3I3DA 4HJGB 4M7KL 3BJ91 3PP3H 2I27N 5I8OH 2PF6A 3VCLA 2JK5A 3GKWL 4MLIA 4KRNA 3RKDC 4MAUH 2AAVA 1N8ZA 3MLTB 43C9B 5BZDA 5E9DE 3CLFL 3NIDE 3L5WB 5DZOA 3GBNH 4CBPA 4ZSOB 2FWOB 3MODH 4QY8A 3BGMB 2ED9A 1OW0A 3TC9A 4BQBA 5BVJA 5IMKB 4NSKA 2P5EE 5I1EL 4X5LA 2X4UB 3LD8B 4Z95H 1FFPA 2IANE 2AI0H 3ETBF 3BPCB 3RX5A 3OKKA 4XHJC 2DIJA 1MNUL 2LU4A 1AIFA 1FO0A 3MXVH 2DJ4A 2HLAB 3LIZL 5D7JC 2HN7B 4LPWA 3RU8L 4XI5C 1FFOB 4P4KA 2E27L 5AZEL 1D5MB 1IL1B 4V1DA 2VKXA 4XB8A 3N1PC 5GSRA 1RMFH 4F37K 1SEQH 5HGDB 3VWKB 5IMLA 4R4FL 4X7SH 1T5WA 3BP5B 5KSAD 4WNQA 4S10A 3DYPA 1VFMA 4GMSH 5C0IB 3V5HA 1EO8L 5C0AE 5F7KC 4LCYA 4OUOA 3ARZA 5J3HD 4OZFB 4YPGA 5HGAA 3QIWD 5AD0B 2A6DA 3MRRB 1N4XH 3ZTNL 1U93A 2R1YA 1MJUL 3R4DA 4N0UA 3AC0A 1GVIA 3Q6FA 3D3VE 2AJYH 2FZ3B 5F7NC 3MLSL 5LBSH 4GRLB 3O6FA 1QRNB 4PJFB 3LKQB 4NKIL 1DEEB 4NWUH 2XKNA 4EI5A 3I6GA 3RY6C 4FABH 2X4NB 4L9DA 5CLTA 4XNMA 2E9JA 2DI9A 2OK0L 2VSCA 3CDCA 1JF1A 4U1GB 3MREB 5D7KE 1S7TB 1GAFL 2VDLH 3BE1H 1YEJH 1LMKA 4U3HA 4QWWD 1NFDE 3B8YA 3FO1B 1AXTH 3IS1X 5HGHB 3GMNB 2G2RA 2D03L 4XVUC 1DBJL 4Y1AA 3H3PL 3BPNB 2DQCL 4Z7NF 4WCYH 3T0WA 2B2XL 1R24A 4XBEL 1KB5A 4IEFB 1C1EH 1CXKA 1ZANH 3L5JA 3QAZB 5B22A 2Z93A 4MLSA 2WBJD 1P69B 3FFCA 4NO3A 3J7HA 3IJYB 1V5JA 3GMMB 5DYOA 4XPTL 3TT3L 3H6JA 3MRDB 3OBAA 4M1GL 2HVJB 4OV5A 4WUUD 5HJ3A 4ERSH 5F96L 3O81A 1CVSC 1XF5A 2X4TA 2VYRE 1ADQA 1TTUA 4U1IA 5I1GL 4Y2DC 5AZ2H 3L3DB 3BP6B 4LDOB 1FVEB 4JHAL 3FJTA 1MLBB 3T2PA 4Q2ZA 4YHNA 1PW3A 3VD9A 3BIBX 3W0WA 2ZJSH 5TE4H 1M05B 4MS8D 5D72L 1CDYA 1U8PB 5B8CC 3ES6A 2FR4B 5C6TH 5KVGL 5IWLA 1UFUA 3GSVA 5I1LA 3A6CL 3NFPA 1R3HB 4OLWL 2A9NH 2HKHH 1RPQA 2NY6B 4CVZB 5D6DC 4JM2B 3VD3A 3MJ7A 1A9EB 3DMMA 5J11C 1MREL 3P4MB 1OGAE 3R0MA 3ZKQD 4NO2B 4KV5E 1QR4A 1UXSB 3HZKA 1CE1L 3BDXA 1X5JA 4DZBA 3Q2CA 1FZMB 4X6FA 2IH3B 3EFFA 4BJLA 4YXHH 4YBLB 4QRPB 5GS0D 4R7DA 4GUPB 5T1LB 5DJAA 3MMEB 4DVBB 4G8GE 4JRWA 2XV6B 5I1JL 1D6VL 1RUKH 5FEBA 3HAEG 5FA4B 3GSNA 5AUMA 1NMBL 1F4XH 1U3HD 2D7TH 1DEDA 2VJXA 2APFA 1AXIB 3JVGA 4JZJA 5I9QC 3GB7A 3LKOB 1BIIB 4ZYKB 1R3LB 2X4RB 3I75A 5E8PB 2RGSA 5HGBA 1T2JA 1Y18A 1RIVH 4TULH 5DJ0A 2IQAB 4Z5RB 3DURB 5ESVA 4MAUL 3EYSL 5J57B 5C0JB 2YXMA 3M07A 5SWZB 1T7ZA 2DYPA 3DVNA 1CZ8H 3D85B 3K4AA 1UM6H 3GBNL 4MHHG 2R39A 1YEDB 1G7MA 4GBXD 3RUGA 3HG1A 4XCNA 1EO7A 2Q6WB 1ITCA 5FK9B 1QBML 4N9GB 4QRQA 3KVQA 2H9GB 4ZXBD 4JANA 4Z95L 2AI0L 5I8EB 4PLOB 4HBCH 2X89D 3MRQB 4L4JA 43CAA 1HYRC 5DWUH 3T77A 2VN4A 3AB0C 4H8WH 1U8QB 4QHMA 3OAYH 5ACZA 1I3VA 5B21A 5DO2C 4ORZC 1E28A 1J12A 3PGCA 3PWUB 1M7IB 1RMFL 5CP7A 1SEQL 2I25N 5EU4A 5I18H 4X7SL 1A21A 1JHLH 4X7CC 1PZ5B 5EZOH 4J6RH 2FSEB 5EU3A 2HFEA 4GMSL 4PJDF 1IARB 1QFHA 3RZCC 1I1RA 2AEWA 4JFFD 4PJBF 2ARJA 4BKLB 1F42A 1I1FB 3HE7A 2GAZA 3CSYA 4S1RH 5HHME 1BBJB 3L3IA 5D7JB 4BSVB 2EE2A 4KJQD 4XBPA 1WAAE 4XPBH 1JTTA 3RWGA 5LBSL 5GS0H 3I84A 2CD0A 4PRNB 2ZUYA 3HNSH 4U1MB 5EU7C 2WIIA 4NO0D 4AH2A 4NNYA 4NWUL 4XXDB 5DT1H 4WWID 1HHKA 4MDJA 1B0GA 3BEWA 4OT1H 3HMXL 3I3BA 1CD8A 3IDNB 2EDBA 2C3VB 2ZPKH 4EIZC 1IBGH 4JFDB 2GITB 4L3CB 1NCBH 4HK0A 1OAYH 2VDLL 3BE1L 3KYAA 4B53A 4NQVB 5GGVH 4P2OC 4JM4H 4F3FB 5EU6E 4W4NA 5FYKE 2J8OA 3ESVF 2ADJA 3SGEH 4RAHA 4MB3A 4PGBA 1AXTL 2VZOA 3BDYH 3CFJB 1TVHA 4DN4H 3VG9B 3CCHA 1I8MA 4PLKD 4U7KA 3VWJB 2X9XA 4JDZA 4WCYL 4LSRH 5DD0H 1C1EL 4DJMA 1UENA 1MCOH 4J4PC 1RZGB 3DECA 1YPZE 5E8EA 1ZANL 1DJSA 5E8NA 4MAYA 1HK6A 4L3ED 3DIFB 1MH5A 3ARFD 4MX7A 1OD9A 2J5LC 2VZTA 2X70B 3RWCB 4ERSL 1G0DA 1ZEAH 1A1MA 2RHEA 2V7NB 3EJJX 3VD7A 5AZ2L 8FABB 1FL5A 1WZMA 4JPVH 2FJFA 4X0KB 2JIXB 2X4PB 4Q6IA 2XT1B 2M26A 3VFVA 1JPFB 2HG5A 3TA3C 1YNTA 3KLAB 3SJVB 1EFQA 1H0DB 4L29B 3MRIA 1MJJB 3VXRB 5C6TL 1ZT7A 3G5VA 3W39B 3MLVH 2EDHA 1XT5A 2A9NL 3ZHLA 2HKHL 3KPRB 1LEGA 1OTTC 1IM9D 4APQC 4XNQA 3ARDA 1ZLVK 2IFFH 5E56A 4WRLA 5J1AA 1U8HB 3LZFH 3O6KH 3P9WB 5ID0A 4QRTA 1W2KT 3E6HB 3VXNB 5CBEA 4ETQA 5CFHA 4YH6A 3T1FB 4Y2DB 4YXHL 1AD0A 4NC1C 4JFYA 3JV6A 4HWBL 4N1HB 2X40A 4OGZA 4ZUWB 3LPGA 3VXPB 1TFHA 1MIEH 3B3IB 1RUKL 1YMMA 4KDVA 1FZJB 3QFJE 1BVLA 4WI7A 5DHYB 5ITFB 1F4XL 2D7TL 5B8CB 2FBOJ 1K8DB 4F7MB 4YGAB 4P2QB 5JW4M 2Y5TB 2MKWA 3U2SA 3SDXF 3ME0A 1QEWB 1JUFB 1LO4L 3SE8H 3WFZA 1XGQB 1VADB 3W11C 4E41A 4Z7VA 4TULL 2R8SL 3VWKD 5C08A 4V2BA 1MWAL 5ESAA 1TCMA 5F6HI 2JCCE 4K3JL 5IK3A 3O3AA 5E24E 3ARVA 1CZ8L 1CXFA 1UM6L 3QDJA 5MHSD 3OAZK 1KGCD 1WIOA 5GS3A 3M1BB 3QWOB 4LHUD 5IW3A 1TTFA 4GG8B 2PW1A 3ULUE 4U1JA 4RMVA 4BSJA 3I85A 4PRPA 1ACYH 3OR7A 5SV4A 4Q58C 5D2NC 2VERN 3WUWB 1UM4L 1RUAL 4JHWL 3TBYB 1N3NB 2NMSA 4HBCL 1AP2B 4GRLD 3OX8A 1NUNB 5GGRY 1QRND 1YECL 2R15A 1P7QD 4YUEH 3NIGE 7FABH 4XNXH 5KSBF 2NLJB 4HMEA 5FB8A 3EO9H 5HI5C 2AKRB 3ROLA 3UTQA 4O51A 3TN0C 3B83A 1IGTA 3QPXH 1JHTB 1NCWH 3RGVC 5C0NC 3GMOA 4IHOB 2AEPH 1JHLL 3HPJA 4FFWD 5EZOL 3VFMA 4J6RL 5IBTH 3WE6A 4PJ9C 5T3XD 2ERJC 1IAKB 4PJ8A 4NQXA 3G9AB 1KLUB 1G84A 5H8DA 2BJMH 5IROA 3OKYA 4PJHE 3EJZC 5FKAB 1ZXQA 3B9KA 3QH3B 2YC1B 1NQBA 1AHWA 5BQ7A 3LN4B 2FB4H 3VI3F 3ZLQC 2H2SD 4XPBL 4KJYA 4JQXC 4LLDA 5GS0L 3TZVD 4PJIB 3IAQA 3DV4A 3RL2A 2HH0L 2R0WH 1KPUA 1JRHH 5FKPB 2Z31A 3EHBC 4NO5A 1WBYB 2JTDA 4YHZH 4OT1L 4N9OB 3D39B 5D1ZD 2ZPKL 5HBBA 4NN5B 1IBGL 1XZ0B 3QG6A 1AGDB 4PGEB 3FO0H 4HKZA 1NCBL 3QDGB 1OAYL 4LNVA 4C54A 3VMOA 2GK0B 2Q8AL 3DETC 5GGVL 4JM4L 1MCWW 1VEMA 3VA2C 2CR3A 4JY4A 3BDYL 4KH2A 1FLTX 2VLLB 3F62A 1J1PL 4DN4L 2I5YH 1NGXA 4LKXB 4FP8L 2NY6D 4OZFH 4WFEE 4JM2D 5H94B 1LO3H 2NQCA 5JOPD 1DDHA 2AXFB 1ZOXA 3CVIH 4PS4H 4LBEB 3EIFA 1MCOL 4XCYA 4LSVH 4OGYH 3WBDA 5B39G 3ZKXC 5F7YC 1KTRL 4QRPD 3QRGL 4NQTA 2Z4QA 4LLWA 1LP9A 2FL5B 4PJXA 5T1LD 1CT8A 1T1ZA 1ZEAL 5IHUL 3UTPE 4C56B 4DVRH 3BEVB 4JPVL 5HI3D 2I07B 2J8UF 4W6XB 2V2TB 3QIBC 3L3JB 3OAUH 3VRIA 2Y36H 4LNRA 2SEBA 5GS1B 3WLWD 1BPVA 1ZLUK 3RY5A 5BRZB 1Y6MR 5KSAA 2OR8A 4J8RA 2OP4H 4R4BA 4YXKH 2R56H 3S6CA 4TNWK 3PHOA 3LH2L 5T3XH 3MLVL 5SWZD 3IXAB 2AJ3B 5MEPA 2QHLA 3AS3A 2F74B 2ZOLB 3BGAA 2UWEB 2IFFL 4PREA 2H1PL 1SHMA 3VFUB 4FQCH 5D1QC 3V5DB 5E6ID 3VXSD 3S36H 3VGHA 2Z92B 5JZ7D 2XQBH 3WFHB 4KKCC 3IDMA 3Q1SL 1JGEA 4ZFOL 3R1GH 4HF5H 2N56A 5DC0A 1BJ1H 4PG2A 4LCWB 5IOPB 2ZZUT 3TA3B 3VXUB 4HX1B 4XZUB 4TNVK 5IB1A 3VRJA 3HUJE 1TCRA 3RKDD 2BSED 5C0BE 5CCKH 4GG6B 1QSFD 4QNPE 2YZ8A 4PGDB 4MCYA 4K8RL 2CLZA 3SE8L 1GGCL 1QHPA 2OZ4A 1XGRA 4RSVA 1U8MB 4I2XE 4P46C 4HUUB 1N5YH 2NTFB 4OI7A 2WQRA 3HZVB 5D5MA 1FJ1B 4L8DA 2OCFD 4X9HA 2YS4A 2ICWI 1CGWA 1ZHLB 4AENB 1ZT1A 5C9JA 5IW1A 3MNVA 4XHJD 1M1SA 4ORGA 3PHSA 1ACYL 3G5XB 4HK3J 5D7JD 3NH7L 5DSCA 4H1LG 2ENYA 4XI5D 4WUUA 3U0PB 3BHBB 1OGTB 3LPWA 1J05A 4JN2B 3O3UN 4WJ5A 1GYAA 2O5XH 5DC4B 5FECA 3SDYH 3ZDZE 2BNRA 7FABL 4G3YH 4XNXL 4MWFA 3E6FB 1NDGB 3EO9L 4XAKE 3RTQC 1CXLA 5C0RH 1OPGL 5B3JE 4K7FB 4JFDD 4K23H 4P9HH 3T3PE 1NCWL 2BVQB 4LU5H 4NJAL 2VDMH 3R8QA 4F58H 1ZHBB 2AEPL 1YDPA 3O41A 2XZCH 1X5YA 3B9EA 3GSWA 5IBTL 3S8WA 1CL7I 4V1DE 4PRDA 1IAMA 4LSPL 1ZVSB 3OB8A 4AJ0A 2COQA 4FXGB 5D2NB 3RA7L 1FGNH 1TDQA 5JHDB 3VWJD 2BJML 4X5XA 4WI2A 4HEME 5SWQB 4RA0C 4OTXH 3CVHB 4OB5L 4BFEA 3EYFA 2W9DH 4N0UE 3TN0B 3FRPA 2NY2C 2R0WL 1JRHL 2CLVB 5FXCH 3RGVB 5GRJH 4AL8H 1U3HA 1C5DB 5K59E 1P5VA 4YHZL 5K9KB 2GTWB 2XTLA 4RA3A 1IGJA 3CFDA 2JIXD 4TVPE 4PJ9B 5F7HA 2YRPA 3FO0L 5DK3A 3SE4C 4XVUD 3SJVD 2YK1H 2IH1B 2R0ZH 3KPSD 4TYUA 1G6RA 5F7MC 4FZ8H 2DI8A 2FECI 4P99A 3VXRD 1T7VA 1T0NA 5I1DB 1W0WA 5F44A 3TO4B 3KPRD 3C8KB 1LO3L 5EOCJ 4DKDC 1A6TB 1JL8A 1WIUA 1XF4B 1MFDH 4EDXB 3CVIL 4PS4L 4LSTH 4LSVL 3AM8A 1B0RA 4ZXBA 4OGYL 4H5SA 3BFOA 4Y1AE 4Y2DD 4Z78B 3RDTB 1EEZA 4M61A 4NC0B 4ZUSB 2APBA 2CDEB 5KANG 4M4RA 2MJWA 3I50H 4DKFH 5IMMA 4LP5A 1UJ3A 3FFCE 4G6ML 3U9PH 3ISWA 4LSDA 4DVRL 1CGYA 4UTBH 1R3JA 4NM8H 5E0QA 1U0QA 5B3NA 1QA9A 4P2QD 1FPTH 3OAUL 2Y36L 4KAQH 4LGRB 1IQDA 1EGJH 4IM8A 5DGQA 2OP4L 3CIQA 2BDNH 3C6LB 5DZLA 3SKMA 5IMOA 4OBRA 2YD4A 4I3RH 3W0WE 1ZS8B 5T3XL 5T5FL 2F5BH 1F3RB 4X6DB 4PFEA 4PTUA 4JFFA 5JNYB 1FLRH 5INDA 1ZE3C 2BP3A 4YAQB 1KLGA 2XA3A 4YWGH 3WFBH 4ENEC 4FQCL 3OB0H 4MJ5B 5JTWA 2MFNA 1OLZA 1WLHA 3S36L 4MMZC 4NHUA 3VW3H 1CG9A 3O6LH 2ZG1A 2XQBL 1JN6A 1W72B 1DUYB 5MP6H 1AC0A 3R1GL 4HF5L 2XZAL 3PABB 1IJ9A 4JEGB 4NO0A 3CFBB 2CO6B 1EPFA 4GAYA 3U4EB 3WNLA 3QHTC 1Z5LB 5EO0A 1NEZA 2VISA 4PIRF 1KPVB 5EU5B 4L9LA 4XP6H 1UH2A 4QXUL 3CXHK 1FYTB 1JPSH 1P2CB 3CSBA 4G8IB 5CCKL 4YQXH 1G1CA 1J18A 1HXMA 4QRUA 4PBVC 3OJDA 4NNPH 3H7LA 1U6AH 4L4VE 5E2UL 1N5YL 2YWYA 1OF2B 3ZE2F 5CJBA 4C59B 5D2LF 5I75B 5JHLH 5KS9F 1FORH 3FRUB 1LEKB 4P23B 2WM0A 3TIDA 5IW6B 1BFOA 1JP5A 1NBYB 2IBGA 4Y5XC 2RBLA 4L3EA 3OGCB 4U1HA 3ARFA 3DX7B 3MCLH 3QIUB 1CFTB 5LWYH 4PGZA 2PYFA 4Y4KA 3BJLA 3HG1E 4G42A 4FZEH 3RUGE 2FYYA 1IGFH 2VQ1B 4WFGE 4L8SC 4W81A 5DO2D 1F6LL 4Y0GA 1EHLH 2NCMA 2O5XL 1V3MA 3FN0L 3SDYL 2GJZB 4G3YL 3AROA 5DFTA 3D39D 4HJGA 3IDIB 5C0RL 4OCYL 4K23L 4P9HL 4LU5L 2VDML 3RZCD 3NACL 3VXMB 3U30B 4F58L 3TV3L 4NUGH 3MLTA 43C9A 5IFJB 1HCVA 4Q0XH 4OM0H 3KLHC 1KFAH 4P48A 3L5WA 3UJJL 1FGNL 4HT1H 4ZSOA 2FWOA 1XH3B 3BGMA 1YJDC 1EFXB 3C08H 4C57C 1ORQB 3P9MB 4WTZG 5I1KL 1XIWB 5EZIH 4RAUB 4HUMB 2X4UA 4OTXL 2VO5A 4GRWE 3BPCA 4X6BB 3UJTH 1ZV5A 1T83A 3RTQB 4S2SB 2W9DL 4HC1A 5GQBA 3NCYP 3OG6B 3JBG7 2HLAA 5GRJL 2EEBA 4AL8L 4LLAA 2IADB 1O7VA 2VXQH 1MFNA 4C56D 1CFVH 4KHXH 4P2OD 4P57B 4UOW0 5IVOA 1FFOA 4U33A 2GFBB 1D5MA 2CRIA 1IL1A 1JMXA 1YNLH 4WY7H 5GRUH 4NJ9L 2X4OB 5HGDA 3VWKA 2CKBL 3MFFB 3FT3B 2YK1L 4I0CC 5KG9B 3BP5A 2FGWL 4FZ8L 4NRZB 3ZE0F 5SWSB 5C0IA 2AJSH 1P6AB 4OZFA 4MSWB 1MF2H 3IDGB 1I1AB 4LARH 5CS7A 4U0RB 2IBZX 4F9LC 5AD0A 3MRRA 5SX4I 4PRIB 1MFDL 1NUGA 5DHVH 3VGGA 3AS0A 2APXA 2NY2B 2R0LH 5HYJB 3OPZH 3DOSA 2FZ3A 3S3SA 5D6CB 3AS2A 3UMTA 3HI5H 5H37G 3T0XA 5IB3B 5KOMC 4GRLA 1QRNA 4DKFL 4PJFA 3LKQA 3F7PC 1Q94B 5EUKB 1P7QA 1A7PL 1DEEA 4CL7A 5FO9B 3U9PL 4LCWD 3TA3D 3IVKB 2Z35B 3VXUD 2X4NA 4RISH 4PBWD 4UTBL 4NM8L 1CTOA 3G5YB 1FPTL 3MREA 3T08A 3LN5B 4HWEH 3ARYA 1S7TA 1OTTD 1B3JA 2A1WL 1EGJL 3V5KA 1IKNC 1RFDH 5FM5M 1WZ1H 3T4AB 2BDNL 3FO1A 2VWEE 4JG0H 4GAJH 4R3SA 5HGHA 4GKSA 3GMNA 2DLGA 2F5BL 1FLRL 4QXGH 2WAHA 4ONOA 4KZDH 5IB4B 2A9MH 4HCRH 3WFBL 4HH9B 4HPOL 2EC9U 4LLUB 4LP4A 2F8OA 3VW3L 5HVHC 3H8NA 4JVUA 4XBGB 1UZ6E 5L2KB 2EIZA 5DZNA 3IJYA 3GMMA 4JE4B 1MCJA 5MP6L 5D7SH 1NAML 4J3TA 1T3FB 3LS4H 1TXKA 2ZCHH 3MRDA 1TJHH 1RUPH 2HVJA 2HKFL 5HDOA 2Z8WC 2ITDB 2P4AB 3UJIH 4D3CL 4OD1L 3W11D 3JUYA 3L3DA 3BP6A 1FVEA 1QKZL 4OF3A 1MLBA 1JPSL 4OFYD 2YD5A 3AY4A 4F7EB 4YQXL 4Z18A 3UYPA 3FMGL 1YMME 2YPVL 1CDJA 3KR3L 1UZ8B 5C09B 3QQ4B 1M05A 3GKZA 1U8PA 1U6AL 2FR4A 3V7MA 3G6AB 3GBMH 1U3YA 1R3HA 4PJDB 1X7QB 5J12C 3V4UL 1B4RA 4Z7VE 1XF3B 4CVZA 1DL7H 1EO5A 4E41E 4JM2A 5DFVC 3DWTA 5C08E 1A9EA 4G9FE 4PJBB 3P4MA 1FFRA 1FC1A 2RCSH 5CKGA 1RUMH 2E7HA 5JHDD 4PJ7F 3SKOB 4NO2A 1FVCB 5CJQH 1EDQA 4OLXH 5LAXB 1FZMA 4XNUH 1WBXB 4K55A 2IH3A 4YHOL 1Q8MA 3QDJE 4QRPA 1JZ2A 1T03H 1YY8B 3L3KB 3MCLL 2BMKB 5LWYL 4EN3B 5IEHB 4RQQB 1IGFL 4GUPA 3BIAX 5T1LA 3MMEA 4DVBA 5HI5D 4FQQB 2BC4B 3M17B 3WFCH 3ZYOA 3TN0D 3O45B 1QACA 1EHLL 5E95B 5FA4A 3PP4L 3RGVD 5C0ND 2Y6SD 1OWWA 1DQLH 1HQ4B 5GJSH 3MLPA 3LKOA 1BIIA 4ZYKA 5J0BA 1R3LA 2X4RA 4PJ9D 5E8PA 1XCTB 3GHEH 4OD3L 4Z5RA 1YZZA 2OM5A 4WEBH 2ICWB 3DURA 4S1DC 4NUGL 3AXLA 1TNMA 5C0JA 5SWZA 3SKJH 4OM0L 3EJZD 3SKUD 1IEAB 5D7LB 4HJJH 1NCAH 1KFAL 3D85A 1BZQK 1T66C 1QPXA 4HT1L 1YEDA 4PD4J 3OGOE 1U8JB 2Y07H 3VXSA 2Q6WA 2VITB 3PHQB 5FK9A 3C08L 3IAGC 2PTVA 2YA1A 4N9GA 5CZVH 3LKSB 5TQ2L 1QLFB 5EZIL 1T7XA 2QQQA 2H9GA 3EHBD 3KPMB 3ARSA 3VGFA 3WHE0 1DE4B 5F8RC 3RDTD 3UJTL 3DUUA 4ZODA 5I8EA 2LAAA 3VDBA 3ULVF 3MRQA 1J7VR 1FDLH 3SQBA 4OF5A 3DUSB 1NANH 5TQ0H 2EICA 3AAZB 3E0GA 3DETD 1U8QA 4KHXL 3QNYB 5FGBC 2OYPA 1MFCH 4NBYB 3SOBH 4UBDD 1QSFA 1YNLL 1IC1A 3PWUA 5GRUL 1M7IA 2XNAB 1MIMH 1NKOA 2UUDK 4HW6A 3FHQA 1CLOL 1PZ5A 1JYVA 2FSEA 3C6LD 4CMHC 2AJSL 1NUFA 1MFAH 4UV7H 1MF2L 2HT3D 1QFUL 3JV5A 4I5BB 1MHCB 1XF2B 2R9HC 4CJ1A 5CUSH 5L2JB 4BKLA 4K9EC 1I1FA 2R0LL 2FX7L 3S4SG 1BBJA 3WNPA 5D7JA 4BSVA 5HHNB 4Z0XB 2EDOA 5DEFB 5DEGB 3E8UH 1KSRA 3S98A 4PRNA 3VFNB 3CVHH 1FRGL 4U1MA 1RJCA 1CGVA 4G6AD 4LRNH 4XXDA 4RISL 4I0KA 3MGOB 3RVUD 5TPWH 1FYTD 3IDNA 2C3VA 1LP9E 3MV9B 4YDKH 4PJXE 4JFDA 3SDXB 4M3KB 2GITA 4HWEL 5JXAH 5F97E 1E4KC 3RZWA 2LU3A 1E4WH 4NQVA 1RFDL 1WZ1L 4JG0L 4GAJL 4Y89A 4R2GC 3RBSA 3CFJA 4XWGH 4ODTH 3VI4F 1RK0B 1WUNT 2MOVA 3DARA 2MCG1 4KZDL 3VWJA 2A9ML 4HCRL 1ZA3B 3SPVB 4OZGF 3OL2A 2VXTH 1U95B 4OUUB 1RZGA 2FIKB 2ID5A 1AD9A 1DBKH 3PV6B 5ETUB 1A1OB 4X8JB 4Y2OA 1T7WA 3BUTA 5D7SL 3LS4L 2ZCHL 4WUKL 1TJHL 4UMGA 1RUPL 5I16B 1ROWA 2X70A 3UJIL 3RWCA 3T2NH 3GSQB 4XRCB 1QFWI 2V7NA 4UNTA 3ULUC 5A2IH 5AAMA 8FABA 3CK0H 1VESA 3HCVB 4X0KA 2JIXA 5KSBB 2X4PA 1NH6A 1JPFA 5GIRB 4P49A 3KLAA 3SJVA 4IRJB 4L29A 1H0DA 3VXMD 5HDLA 1MJJA 4KHTH 4MNGA 3VXRA 4M1CC 3W39A 1GXEA 1EJ6A 1CD9B 3NIFE 1QZ1A 1PG7H 1XGYH 4JPIA 2W9LA 2R69L 4V2CB 5HVHB 1DL7L 5CD3B 3KPRA 3K8LA 1ODAA 4UI2A 2RCSL 1S9VB 4O00A 4XWOD 1U8HA 1RUML 3U82B 3ZT5A 3E6HA 4X4XB 4JFQB 5D5ME 3TP4A 1EFXD 3VXNA 1DTUA 4N8VB 4XNUL 3T1FA 2BSSB 4Y2DA 1H15B 1XIWD 2OMNA 3W2DL 4P59H 1T03L 3NFNB 3MZGB 1ZWIA 4LSQH 4ZUWA 1G9MC 3VXPA 3HZYB 4QHLB 5IBUB 3RTQD 3NIDF 1CLCA 3B3IA 4JGUA 2Z8VC 3MROB 4MXWH 5T1KB 1FZJA 5DHYA 3EYVB 1PDKA 5ITFA 5T5NF 5B8CA 7CGTA 1DQLL 1EAPB 5GJSL 1K8DA 4GKZB 4WUUE 2IMNA 4P2QA 4F7MA 2Y5TA 1HEZB 1L0QA 4LDLB 1VEOA 1QEWA 3ET9F 4HK3N 2CGRH 4W4OC 2I9TB 1JUFA 4I13B 1CK0H 5D6DA 1XGQA 1VADA 3D18A 3IT8D 5DMJB 3GHEL 5GRYA 5KSVB 3QUYC 5DK0B 4WEBL 2BNQB 5M94B 3ZTJH 5AG9A 2ORBL 1A6AB 4LK4A 3C8HA 2JKXA 3SKJL 5SWSD 3H3BC 2Z91B 3WN5C 3M1BA 2Y07L 3QWOA 2EO9A 3BZ4B 3PWPB 4PRID 4WGVB 4GG8A 2NY2D 2UV3A 3D0VB 5HYJD 2AV1B 4I3GA 2GJ6B 3WUWA 1S8DB 3TBYA 4S1SL 1TIUA 1N3NA 3FQNB 2P24B 1AP2A 2PR4H 5C70A 5J6GB 1FDLL 3IS0X 1RHFA 5TQ0L 1F8TH 4EI6B 3EDEA 2NLJA 3SOBL 1MFCL 4I0PB 1WISA 2CPCA 2O26U 3KAAA 5DRNB 3QISA 1DLHB 1MIML 1JHTA 3IFOB 4IHOA 4RFEB 1GHFH 1BQUA 3GMRB 1TENA 2CK0H 2IJ0C 4BK4A 1IAKA 2VR4A 1KBGH 3MOBH 4UV7L 5GRXG 1IC4H 1KLUA 3U4AA 2F19H 3IU3A 1JNHB 1MY5A 3BWAB 5FKAA 1UWEH 5DD5L 3QH3A 2YC1A 4HJ0C 3G6JF 3ZDYE 3LN4A 4QHKJ 5L2KD 3E8UL 4CN4A 1A7QH 3EYQC 4PJIA 4M6AA 1S7VB 2LV4A 4LRNL 5CHNB 5FKPA 4EUPB 1SQ2N 2KDGA 3OF6D 4TUKH 1WBYA 3QQ9D 2B1HL 3WD5L 3D39A 1KACB 4OIIH 4PR5B 4DAGH 4FFYH 1VSCA 1XZ0A 1AGDA 3Q0HA 4PGEA 1BFSA 5JXAL 3BZFB 1C8PA 4U4BA 3RZCA 3QDGA 1CQYA 1A3QA 1NAKH 5C09D 1E4WL 2DBLH 2GK0A 2HJLB 4CRPA 4WEMB 1EXUB 2QSQA 15C8H 1MCCA 3WIHH 4KI1A 3EGSB 4JAMB 4UIKH 5D7IB 4PRBA 4PUBH 4XWGL 2VLLA 4QOKB 4ODTL 3OKDB 3V7AE 4LKXA 5H94A 1VGKB 4XPGH 4UTAH 3UBXG 1C5BL 2AXFA 2E6QA 3S3JA 4LBEA 2VXTL 1E4JA 5BJTB 5CKAA 4JFFE 2M2DA 4LVEA 2DIBA 1T2XA 3EOAB 3HS0B 4M9PA 4HKBB 2FL5A 2YXFA 3JTTB 4O2CB 1F13A 4C56A 3BEVA 3CK0L 4KV5F 2I07A 4XCCH 4B7LA 4HZLB 1J0IA 4YDVB 1XAUA 2V2TA 3HI1B 1T1XB 5ANMB 3RWIB 1AGBB 3L3JA 2DTMH 2Y06L 5IF0B 4J3UA 5GS1A 1R0AH 4R9HA 3S35L 1J8HB 4EXKA 3QT2A 5BRZA 3RNQB 5FYJH 2HFTA 4ODSH 4Q74A 1BQHB 1PG7L 2OTUB 3IXAA 2DJUA 2AJ3A 2D9QB 5D7LD 4UDTB 2ZOLA 2H8PB 2UWEA 3J8F7 3L7EB 4P3DB 5TDOB 1YA5A 3QR2A 3V5DA 3VFUA 5IJVA 4P4KC 2Z8SA 1X6NA 4LLVB 3QJHB 1S7UB 2Z92A 4RGNC 3UTTB 2OMBA 2EKJA 5EIIA 2EKSB 1FFNA 3WFHA 1FNGA 5J89A 3ARPA 4P59L 5GPRA 2ENSA 1RD6A 4LSQL 2VB5A 1UB6B 3EJYC 3F6LA 5HDQH 2YKLH 5K9QI 4NFDA 4D94A 4LCWA 4L3EE 4MXWL 3NGBC 3TA3A 1CXEA 3VXUA 2CR6A 3LQAC 4HX1A 4XZUA 5IR1B 2PNDA 2P46B 1OP3H 2Q1EA 3CLEH 1YC7A 3P0VH 4GG6A 4HULB 5I0DA 4PGDA 1L7TH 2I60H 3ULSB 4JB9H 2CGRL 3KPTA 4OJFL 2NX5B 3KLHD 1S5HB 4G6FB 3UC0H 2C3WA 1U8MA 1CD1B 4Y5VB 4HUUA 4MJIB 4PJEA 4KROC 3FTGB 1OAKH 2NTFA 1QFPA 4X6CF 4U6YB 4JDVB 3QHFH 3HZVA 1KJ3H 2X44D 5D96C 4EI5C 1QNZH 4WHCA 1ZHLA 4M43H 4AENA 5IT2H 1KC5H 2APWA 3K46A 1KENH 1EH9A 5BV7C 4O2FB 3WDJA 5E7BA 4HDIB 3G5XA 3VA6A 1A3LH 3CFCH 4RFOH 1AGEB 4ZSOE 3B9AA 3BXNB 3MSPA 3IDYB 2CK2A 3U0PA 3BHBA 1OGTA 1ZA6B 5I66B 4LFHD 5DJ8B 1WTLA 1WICA 4JN2A 4JO2H 3EAKA 3ECBA 4OFYA 1F8TL 1HHIB 2NY7H 4XXCC 2B8OT 3E6FA 2YPKB 1NDGA 2AABL 3GJEB 3VXTB 3ZKNC 3P11H 3P30H 4Y88A 3MV9D 4EVNB 1KIQB 1EUUA 2HTLC 4TSAH 1WAAF 5T5NG 3RX7A 2BVQA 3QXWA 1ZHBA 3BRFA 1YYMH 5KVEL 3LEYH 3L6FB 2C1PB 1KIRB 2ICCA 2CK0L 4A6YB 1E4XL 2DMCA 4OCXH 1YEEH 1IAIM 4Z7OE 1ZVSA 1BOGB 1IC4L 1TZIB 2NY1C 5D2NA 4FXGA 4XMKH 3JV0A 3QQNA 5JHDA 3AS1A 3RIAF 4UNUA 5IBLC 1LDPL 3NMEA 4GRMB 5EULV 4G7VH 1FNSH 1UWEL 2I24N 3S37H 2LABA 5MHSE 5SWQA 5JO5B 4D2NA 1KGCE 3KPQB 2IG2H 3CVHA 1ZT4B 5IWLC 3I3EA 1A7QL 3TN0A 4IOIB 3RGVA 4Y8AA 2DTSA 1C5DA 4TUKL 5K9KA 6CGTA 5TF1L 2GTWA 1YPZF 5FUZH 4OIIL 1LE5B 1QRNE 4PJ9A 4M6OH 4FFYL 5HY9B 4PJFE 2YOCA 1CL7H 2E9BA 2GIYA 1NAKL 4WU5B 2DBLL 2IH1A 4IRJD 2VLKB 3U0TB 5JMRA 4ZMAT 3CXDH 4UIKL 2DM3A 5D2LB 4PUBL 1YJDH 5KS9B 5I1DA 3DXAB 5FO8B 5F9OH 1RJYB 3K2MC 4PV9B 3TO4A 3C8KA 4IRSB 4NT6B 5ALCL 3LSOB 4XPGL 4UTAL 3NCBB 1A6TA 4JQXA 1XF4A 4K2UL 4LIQL 3JVGC 3RHWF 4JZJC 4BFIB 4EDXA 5T3XE 3ZYIA 1AR2A 4KKLC 4D9LH 4QXTB 12E8H 4M5ZL 4KWUA 3ZHKA 2NY5C 2V5TA 4YXLH 1I9RL 4Z78A 3RDTA 2FH8A 1N6UA 2R29L 4ZUSA 2CDEA 1IQWL 1JWSB 4I1NB 1SVCP 1YUHB 1B88A 3G5ZB 5GS2H 5T1KD 2CRMA 5GXBB 3KHOA 1D9KC 2WNGA 3PWNB 2DTML 2F54B 1R0AL 3PV7A 2YD2A 5FYJL 1IKFH 2DLIA 4M7ZB 4BSWA 1G9EA 1N64H 3C6LA 4ODSL 2BNQD 1G0XA 1D5IH 3C6SB 4IIQB 1ZS8A 4OZHB 4X6DA 5JNYA 2XQYG 1EK3A 2D31B 2KQNA 5EDXA 5GRVL 1NCUA 1T22B 4DKEL 4YAQA 3S4SB 3QPQD 4B50A 5DMGD 2X1PA 4MJ5A 3VH8G 2VC2H 4NQEB 3AVEA 2UZYB 3O3BB 2YD8A