1NB3I

Crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin H
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb3I00
3PS8A 1DVCA 1CYVA 1NB5I 5A0OB 4N6V0 3UL5A 1DVDA 3PYJA 3NX0A 1N5PA 1KWIA 3QRDA 5LC7A 4CCVA 1R4CA 3UL6A 1M9GA 3LH4A 1N5HA 1IV7A 2CH9A 4N6MA 1CYUA 1ROAA 1MNLA 1TIJA 3K9MC 2BO9B 3L0RA 4N6OB 3PXMA 1N9JA 4TX4A 1GD3A 1FUWA 1A67A 3KFQC 5ELUA 5ELJA 4EYCA 4N6LA 2OCTA 4LZIA 3IMAB 1MOLA 3S67A 2O9UX 1STFI 1LXEA 4ZM8A 3MWZA 1A90A 2KXGA 4N6TA 3SVAA 2W9PA 1YVBI 3GAXA 3Q2PA 1RN7A 1IV9A 4IT7A 1NB3I 1FA3A 4N6NB 2W9QA 1GD4A 4N6UA 1EQKA 1PFPA 1WNHA 5LC6A 1G96A 5EQLA 1CEWI 3KSED
chains in the Genus database with same CATH superfamily
1IQXA 3IJEB 3EQQB 2BHMA 3SOYA 4KT3B 4RZMA 4CDLA 4WYKB 1G02A 1JZDA 3B8LA 2LYXA 4K1VA 2CFWA 3GZRA 3Q90A 4XM4A 3AMOB 5IG0A 5G1LA 1DVDA 3CC73 2OQEC 1WMPA 2KAAA 2E2VA 3AHWA 1GMRA 1KWIA 3RDEA 2O3OA 3KN4A 1W6YA 5BXQA 3S29A 7RNTA 3EC9A 3FF2A 2SBLA 4XDVA 3DGYA 1EUIC 1VQP3 3X3YA 3LYGA 5AIFA 1FGQA 2F86B 3CCJ3 1OUNA 3I553 5I97A 2H0HA 4ILFA 3HI7A 3NV0A 3UL6A 3LZAA 1G0TA 1BIRA 3LH4A 1YNVX 3M8CA 1N5HA 1X1YA 5G1KA 1Q7Y4 3ZG5A 2ZA4A 1SIHA 2IYJA 3BU4A 3F14A 5RNTA 1BVIA 1VQ63 1VQ93 4BTWA 1YGEA 1TU5A 3LTDA 1CYUA 1R4YA 2FXTA 5CK6A 1BOXA 1BNIA 1ROAA 1RJOA 2F98A 1W2ZA 3B4PA 3EB8A 1PU4A 2RGQA 1JBSA 2IUJA 1UCJA 4RNTA 1NWWA 2F56A 3BNDA 3JUMA 1TIJA 3K9MC 2UGIA 4MMYB 2IMJA 1JB4A 1QJGA 2XGLA 3KE7A 1UI8A 3N54B 4LYLB 4HM5B 1O7PB 3WDGB 1QAKA 4J9AA 1W01A 4HM7B 5EVHA 2Z7AA 1A2KA 4HM8B 1IT8A 1LVNA 4BL3A 3FSDA 1D6ZA 1W00A 1DMQA 1EEJA 2GSPA 2P38A 1LOXA 1RN1A 1LQMB 1RGAA 1RNTA 1T2IA 2W56B 4TX4A 3WOFB 1LQGC 4BTYA 1UGIA 1RKYA 3DZLA 1TP6A 3FG4A 3NM2A 1V74A 4BL2A 1PY3A 4H61A 1ULIB 2ML6A 1B2SA 4JRFA 4MJDA 5ELUA 2HMLB 5STDA 3IPTA 4KFEA 1JV2B 1OHOA 2P0MA 4WWUC 3H51A 1I8VA 5AYSC 1K734 4N6LA 1O7NB 3UB1A 3I563 1Q814 1OHPA 4XBXA 2F5WA 4O3VA 3X3XA 4FMBA 3UJMA 1FGRA 3NHXA 1FW7A 4L8OA 1W7CA 1GOUA 2E2UA 4CJNA 1DMNA 2KF3A 1QALA 5AYRB 3MYTA 5AIIA 3MG3A 3U1WA 1SPUA 3DH2A 3Q1CA 2HMKB 4ZM8A 3G8ZA 2FNQA 2KXGA 4K61A 2QGUA 4N6TA 4EC6A 4XB5A 3WMDA 1IYYA 4J5GA 4NPBA 1BSEA 1GMQA 3EN8A 1UDII 1AR0A 2CG1A 2HMOB 1US1A 3CCU3 2CWVA 2XSOB 1BNJA 1LOWA 3FKAA 2RSXA 3KCHA 3OXAA 1BSDA 4FMCA 3CC23 1N8R4 4J8TA 3UNLA 4GL6A 1BRJA 2UUGC 1B27A 1I2FA 1GY7A 1V58A 2CFGA 2Z76A 2V1LA 1UCIA 4KFDA 4CPKA 3NBJA 1Q824 1IV9A 1VQQA 2MF7A 4R4KA 3V92A 2UX0A 1WMNA 2W9QA 2HMNB 5G2GA 4X2HA 1PFPA 5LC6A 3WODG 3RGAA 3WOEB 2QEX3 1TJDA 2HMMB 1Q42A 3ECFA 3AGNA 1CYVA 4KZ1A 4WP5A 1MWUA 3ALAA 4KVHA 1U8CB 5KP4A 1IVWA 2Z6BA 2XF3A 3LOYA 1OGZA 3RGRA 4OVMA 3HK4A 5A0OB 1RSNA 4N6V0 2CG0A 3NBRA 4HKVB 3BNCA 1OHSA 1JNQA 3NUVA 1B2XA 1JB2A 1LNIA 2OWPA 1ASKA 3QRDA 1N9EA 3TDGA 1J2BA 1BRHA 1HYFA 9RNTA 1K41A 1OACA 1VQN3 3QK9A 1T5YA 8CHOA 4WFOA 1IQ8A 3OWSA 1FZUA 3NQZA 4OUQA 3CCM3 1JJ22 1A2PA 1JRQA 1OF5B 2INXA 2CW9A 3F9SA 3FCSB 5KP3A 1CQSA 3NQYA 3CCR3 3SEDA 4IPBA 4DKIA 1BSAA 1BUJA 2W04A 2GU1A 3JUNA 1O7WB 1MGRA 1BRNL 1BRKA 1VQL3 2OTL3 3GRDA 4N6MA 1SJWA 1Q40B 4FCZA 2ML5A 4HZBB 3DXOA 4FMAA 3FH1A 1W5ZA 2XGNA 1GS3A 3ER7A 4HYZA 4FMDA 1MWSA 3K5TA 5JBSA 3FG1A 3LTCA 3G6E3 2BO9B 1RRHA 2IY2A 1JKGB 3K63A 1JBRA 3L0RA 2ZL8A 1GOYA 1JZOA 4LSOA 3HOHA 1UCLA 3F7XA 3X41A 3GZBA 1T2HA 1N9JA 1IDPA 3BIRA 1OCVA 1RRLA 2KF4A 5HOHA 1VQ43 2GXFA 4JF8A 1GD3A 1PYLA 1I0XA 1FUWA 2P0XA 4N3VA 3BB9A 4HZ9B 3CME3 4HJLB 1A67A 4FCMA 1F8NA 2E2TA 3O8YA 5AEUB 1DETA 7STDA 4WHAA 4I5QA 2GEXA 5FW5A 2XEPA 1FGTA 1RHLA 3E99A 2OQEA 1RGFA 1JN5B 3EX9A 3D9RA 2C11A 3IMAB 2MC8A 2L1SA 1Q9EA 4BTXA 1RTUA 1ISKA 2CWUA 3S67A 1CH0A 2F99A 2M7OA 1TRPA 4NREA 4O02B 1STFI 1SQWA 2IUKA 5AIHA 1MWTA 3MWZA 3FZWA 2B24B 4HM3B 2WGQA 2OTJ3 2JQ5A 5FGOA 3RNTA 5BU4A 5AEWB 1RGEA 1B20A 6GSPA 4H3UA 1LNHA 5CLKA 3CCE3 1RCLA 1RLSA 1NNVA 2OOVC 4FR9A 1M904 2YFLB 3G0KA 1YVBI 3GSPA 3NM7A 3HX8A 1WMOA 1IU7A 3GAXA 3CPOA 1YGWA 1AQZA 2R41A 3F40A 4HM2B 1I3IA 1LOYA 2CHCA 3PZWA 1WQLB 5JPPA 2F5MA 4HM0B 4R9LA 1RGKA 1HU9A 4EBGA 1KC84 1MGWA 4STDA 3SX1A 1NO3A 3EN1B 1ZGXA 3S28A 1FGOA 1VQ83 3LTBA 1AY7A 3BNBA 3PGBA 1IT7A 3OV4A 4N6NB 5IF6A 1OPYA 2P05A 5AI1A 8RNTA 4WYKA 2ZDJA 1TFOA 1Q40A 5JPUA 1JB5A 3CC43 1IQYA 1I70A 2FGTA 4N6UA 1UUVB 1WNHA 3G4S3 3AMOA 3CXC2 2D42A 1OH0A 1O7GB 1IVXA 2WOHA 3KSED 1K28A 4KFFA 4PEJA 4ORLA 2F4YA 5D83A 1W02A 1YJ93 3MPHA 3EHCA 1O7MB 2YFJB 4EXRA 3N8BA 1Q864 4HAAA 3I0YA 3EF8A 2BNGA 5CF1A 1K8A4 5DRVA 3PYJA 1UGHI 4R1KA 1I3FA 3MG2A 1QVG2 6STDA 1N5PA 4MMZB 1VQM3 1A2VA 1W2B2 1Y4KA 1BRIA 4AEQA 1ZS7A 5TGNA 1RGHA 2IA7A 1I2EA 1QVF2 3D4AA 1M1K4 3CD63 4EV2A 1YIT3 1EKMA 2K0MA 3MHEA 2STDA 1NJI4 3KIIA 5LC7A 2CKFB 4CCVA 1M9GA 1NU3A 1YIJ3 1D6UA 3D5GA 3DGNA 5IENA 1BSCA 1U5OA 1OGXA 3EJVA 4QWTA 2CH9A 5GSPA 4IIAA 1D6YA 1BAOA 3G713 1KQS2 2BT3A 3BNEA 3FLJA 5M18A 1BNFA 4MMXB 1E3VA 1X1UA 1MNLA 3MG1A 2W6JH 2W0QA 5IEPA 1BUQA 2W56A 1HZ1A 1I0VA 1RMSA 2RNTA 4O2HA 3MKIA 2GU3A 4N6OB 2A15A 2CC3A 3JVCA 6RNTA 3F8HA 3AGOA 1RDSA 3A76A 3LMLA 4RNYA 5IEOA 1AVLA 1FUTA 4HOHA 1VQK3 3V98A 1DMMA 2R4IA 3HZPA 4HM6B 4EW5A 3SYUA 4BU4A 3SOAA 3KFQC 2P09A 2L4VA 1YI23 1BNSA 1STDA 1W4NA 2BMRB 3OWYA 5ELJA 3KKGA 4GB5A 4J5KA 1RGCA 3DGOA 1FUSA 3CCL3 2CWTA 4LEHA 2OCTA 4LZIA 1X1XA 2HMJB 1BGSA 2LQVA 3N9HA 2CX0A 3F7SA 1QAFA 2XRXB 1SARA 1T3BA 3HIGA 1VQ53 3CMA3 1MOLA 1E3RA 3WA3A 3D79A 1IVVA 5IG3A 5BIRA 5IW9A 4NHFA 3U97A 1S5AA 1O7HB 3CNXA 1UCKA 3HIIA 3V99A 1A90A 4GHOA 2Q07A 3B4OA 2RBIA 4G1MB 1UW1A 3DGMA 1VQO3 1EA2A 3FGYA 3AHSA 3SVAA 5HGRA 1GY6A 1KSIA 1B21A 3JUQA 3T8NA 5IERA 3Q2PA 4R80A 1Z1SA 1YJW3 2CFKA 4HM4B 3X3ZA 2D1WA 3LXUX 4LGQA 1ZO2A 4MEIA 3JUOA 2CIUA 2CK3H 3VSYA 1NB3I 3CCV3 1FA3A 1FYSA 2B1XB 3PCSA 5M19A 3LT9A 2PZVA 1AV4A 1GD4A 1LRAA 3GZYB 1UUGB 2GBWB 5DREA 1EQKA 3DMCA 4HBRA 1CEWI 3DUKA 1QMAA 3PS8A 1DVCA 2CX1A 2H0IA 3DY5A 2XFTA 3WHOA 1RGGA 1UUWB 1WTHA 2CFDA 4K90B 1NB5I 3GZXB 3A5EA 3CU3A 3PCRA 2W2CA 1RN4A 3UL5A 3CNMA 4I4KA 3ZG0A 2XFSA 3LTAA 1X1WA 5KP1A 1LOVA 1OF5A 4U13A 1GY5A 3NX0A 4R9KA 1TFKA 1W6GA 4Q53A 3T0UA 3CCS3 1JBTA 1Q7HA 3EE1A 3DM8A 1C7HA 1S723 2RCDA 3WA2X 4O8SA 2XR8B 3SXXA 3KZTA 3T8UA 1R4CA 1FGMA 4EV5A 2KF6A 3NXJA 3FF0A 3F8XA 4FCJA 5EEOA 2OOVA 1BRGA 1IVUA 4X2OA 1IV7A 1YHQ3 5BVBA 1RCKA 3BLZA 1YJN3 1JKGA 1UI7A 2AAEA 3J7Yd 1BNRA 2QIYA 1BNEA 1GSPA 2WOFA 4GSPA 3KSPA 3NBBA 3X40A 5CF2A 1TTOA 1BRSA 2PNCA 1BNGA 1I2GA 2RFRA 2WGOA 3D5IA 2JDIH 3DGLA 2BIRA 3Q3FA 5AIGA 1B3SA 5M1AA 2YX9A 2QA43 4BIRA 4L8PA 3PXMA 3S5CA 3VGNA 2GEYA 1B2UA 1EG9B 1N8QA 2J8XB 2XSHB 2Y73A 2KF5A 2CFLA 3X42A 3OX9A 2Z77A 1JN5A 3JUPA 2K3DA 1TUHA 4RBNA 1BANA 1M1XB 2XH9A 4HM1B 3NV0B 1HKXA 2HOHA 3LT8A 4EYCA 4XDWA 1NDOB 2Y74A 2BU4A 2C10A 3GWRA 1SIIA 4HVNA 1E97A 5D82A 1L5GB 2K54A 4K1UA 4L7KA 3FG3A 1DYUA 2KCDA 3URPA 1C54A 4LMIA 2I9WA 5CXOA 2O9UX 1VQ73 1MWRA 1LXEA 2BMQB 3MSOA 1TRQA 1GYBA 1DE3A 1BU4A 2BMOB 1ZX2A 3S27A 1RGLA 2KRTA 1AVKA 1KD14 2H0GA 2AADA 1RNBA 2W9PA 3G16A 1BSBA 2W03A 3EBTA 4OK0A 4RNZA 5IG5A 2C4BA 2YFIB 4XBTA 3ZFZA 3OW22 3K0ZA 5D81A 3CCQ3 1W6CA 1RN7A 1IK3A 3H3HA 3ROBA 3VF1A 1VZZA 4AKZA 3STDA 2ZHXB 3B7CA 1K9M4 3K7CA 2WO0A 4IT7A 4AKYA 2GBXB 2SARA 3D3LA 1B2ZA 1YVSA 3OWUA 1V57A 3CPW2 3EBYA 7GSPA 3WR2A 1B2MA 1ROVA 1ULJB 1GMPA 1GOVA 3SLUA 1G96A 4XBYA 5IG4A 5EQLA
chains in the Genus database with same CATH topology
1IQXA 3IJEB 3EQQB 2BHMA 3SOYA 4RZMA 4CDLA 4WYKB 3B8LA 2LYXA 4K1VA 2CFWA 3GZRA 3Q90A 4XM4A 3AMOB 5IG0A 1DVDA 3CC73 2OQEC 1WMPA 2E2VA 1KWIA 3RDEA 1JJ22 2O3OA 3KN4A 1W6YA 5BXQA 3S29A 3EC9A 3FF2A 2SBLA 4XDVA 1VQP3 3X3YA 3LYGA 5AIFA 1FGQA 2F86B 3CCJ3 1OUNA 3I553 5I97A 3HI7A 3NV0A 3UL6A 3LZAA 3LH4A 3M8CA 1Q7Y4 1N5HA 1SIHA 3F14A 1VQ63 1VQ93 4BTWA 1YGEA 1TU5A 3LTDA 1CYUA 2FXTA 5CK6A 1RJOA 1ROAA 3EB8A 2F98A 1W2ZA 3B4PA 1PU4A 2RGQA 2IUJA 1NWWA 3BNDA 3JUMA 1TIJA 3K9MC 4MMYB 2IMJA 1JB4A 1QJGA 2XGLA 3KE7A 1UI8A 3N54B 3WDGB 4HM5B 1O7PB 1QAKA 4J9AA 1W01A 4HM7B 5EVHA 2Z7AA 1A2KA 4HM8B 1IT8A 1LVNA 3FSDA 1D6ZA 1DMQA 1W00A 2P38A 1M1K4 1LOXA 4TX4A 1VQK3 4BTYA 2W56B 3WOFB 1RKYA 3DZLA 1TP6A 3FG4A 3NM2A 1V74A 4H61A 1ULIB 2ML6A 4JRFA 4MJDA 5ELUA 2HMLB 5STDA 3IPTA 4KFEA 1JV2B 1OHOA 2P0MA 4WWUC 3H51A 1K734 5AYSC 3CD63 4N6LA 1O7NB 3UB1A 3I563 1Q814 1OHPA 4XBXA 4O3VA 3X3XA 4FMBA 3UJMA 1FGRA 3NHXA 4L8OA 1W7CA 2E2UA 1DMNA 1QALA 5AYRB 3MYTA 5AIIA 3MG3A 3U1WA 1SPUA 3Q1CA 2HMKB 4ZM8A 3G8ZA 2FNQA 2KXGA 4K61A 2QGUA 4N6TA 4EC6A 4XB5A 3WMDA 3EN8A 2CG1A 1AR0A 2HMOB 1US1A 3CCU3 2CWVA 2XSOB 3FKAA 3OXAA 2RSXA 3CC23 4FMCA 1N8R4 4J8TA 3UNLA 4GL6A 2Z76A 1GY7A 2CFGA 2V1LA 4KFDA 1Q824 3NBJA 1IV9A 2MF7A 4R4KA 3V92A 2UX0A 1WMNA 2W9QA 2HMNB 5G2GA 4X2HA 1PFPA 5LC6A 3WODG 3RGAA 3WOEB 2QEX3 2HMMB 3ECFA 1Q42A 1VQ43 4KZ1A 1CYVA 4WP5A 3ALAA 4KVHA 1U8CB 5KP4A 1IVWA 2Z6BA 2XF3A 3LOYA 1OGZA 3RGRA 4OVMA 3HK4A 5A0OB 4N6V0 2CG0A 3NBRA 4HKVB 3BNCA 1OHSA 1JNQA 3NUVA 1JB2A 2OWPA 3TDGA 1ASKA 3QRDA 1N9EA 1J2BA 1K41A 1OACA 1VQN3 3QK9A 1T5YA 8CHOA 4WFOA 1IQ8A 3OWSA 3NQZA 4OUQA 3CCM3 1JRQA 2INXA 1OF5B 2CW9A 3F9SA 3FCSB 5KP3A 1CQSA 3NQYA 3CCR3 3SEDA 4IPBA 2W04A 2GU1A 3JUNA 1O7WB 1VQL3 2OTL3 3GRDA 4N6MA 1SJWA 1Q40B 4FCZA 2ML5A 4HZBB 3DXOA 4FMAA 3FH1A 1W5ZA 2XGNA 1GS3A 3ER7A 4HYZA 4FMDA 3K5TA 5JBSA 3G6E3 3FG1A 3LTCA 2BO9B 1RRHA 1JKGB 3K63A 3L0RA 2ZL8A 4LSOA 3F7XA 3X41A 3GZBA 1N9JA 1IDPA 1OCVA 1RRLA 2GXFA 4JF8A 1GD3A 1FUWA 2P0XA 4N3VA 3BB9A 4HZ9B 3CME3 4HJLB 1A67A 4FCMA 1F8NA 2E2TA 3O8YA 5AEUB 7STDA 4WHAA 2GEXA 5FW5A 2XEPA 1FGTA 3E99A 2OQEA 1JN5B 3EX9A 3D9RA 2C11A 3IMAB 2MC8A 4BTXA 1ISKA 2CWUA 3S67A 2F99A 2M7OA 4NREA 4O02B 1STFI 1SQWA 2IUKA 5AIHA 3MWZA 3FZWA 2B24B 4HM3B 2WGQA 2OTJ3 2JQ5A 5FGOA 5AEWB 4H3UA 1LNHA 5CLKA 3CCE3 2OOVC 4FR9A 1M904 2YFLB 3G0KA 1YVBI 3NM7A 3HX8A 1WMOA 1IU7A 3GAXA 3CPOA 3F40A 4HM2B 2CHCA 3PZWA 1WQLB 5JPPA 4HM0B 4R9LA 1HU9A 4EBGA 1KC84 4STDA 3SX1A 1NO3A 3EN1B 3S28A 1FGOA 1VQ83 3LTBA 3BNBA 3PGBA 1IT7A 3OV4A 4N6NB 5IF6A 1OPYA 2P05A 5AI1A 3CC43 4WYKA 2ZDJA 1TFOA 1Q40A 5JPUA 1JB5A 1IQYA 2FGTA 4N6UA 1UUVB 1WNHA 3G4S3 3AMOA 3CXC2 2D42A 1OH0A 1O7GB 1IVXA 2WOHA 3KSED 1K28A 4KFFA 4PEJA 4ORLA 5D83A 1W02A 1YJ93 3MPHA 3EHCA 1O7MB 2YFJB 4EXRA 3N8BA 1Q864 3I0YA 3EF8A 2BNGA 5CF1A 1K8A4 5DRVA 3PYJA 4R1KA 1QVG2 3MG2A 6STDA 1N5PA 4MMZB 1VQM3 1A2VA 1W2B2 1Y4KA 4AEQA 5TGNA 2IA7A 1QVF2 4EV2A 1YIT3 1EKMA 2K0MA 3MHEA 2STDA 1NJI4 3KIIA 5LC7A 2CKFB 4CCVA 1M9GA 1NU3A 1YIJ3 1D6UA 3DGNA 5IENA 1U5OA 1OGXA 3EJVA 4QWTA 2CH9A 4IIAA 1D6YA 3G713 1KQS2 2BT3A 3BNEA 3FLJA 4MMXB 1E3VA 1MNLA 3MG1A 2W6JH 2W0QA 5IEPA 1BUQA 2W56A 4O2HA 3MKIA 2GU3A 4N6OB 2A15A 2CC3A 3JVCA 3F8HA 3A76A 3LMLA 4RNYA 5IEOA 1AVLA 3V98A 1DMMA 2R4IA 3HZPA 4HM6B 3SOAA 3KFQC 2P09A 2L4VA 1YI23 1STDA 1W4NA 2BMRB 3OWYA 5ELJA 3KKGA 4GB5A 3CCL3 3DGOA 2CWTA 4LEHA 2OCTA 4LZIA 2HMJB 2LQVA 3N9HA 3F7SA 1QAFA 2XRXB 3HIGA 1VQ53 3CMA3 1MOLA 1E3RA 3WA3A 5IG3A 1IVVA 5IW9A 4NHFA 3U97A 1S5AA 1O7HB 3CNXA 3V99A 3HIIA 1A90A 2Q07A 3B4OA 4G1MB 1UW1A 3DGMA 1VQO3 1EA2A 3FGYA 3SVAA 5HGRA 1GY6A 1KSIA 3JUQA 3T8NA 5IERA 3Q2PA 4R80A 1Z1SA 1YJW3 2CFKA 4HM4B 3X3ZA 2D1WA 3LXUX 4LGQA 1ZO2A 4MEIA 3JUOA 2CIUA 2CK3H 3VSYA 1NB3I 3CCV3 1FA3A 2B1XB 3PCSA 3LT9A 2PZVA 1AV4A 1GD4A 3GZYB 2GBWB 5DREA 1EQKA 3DMCA 4HBRA 1CEWI 3DUKA 1QMAA 3PS8A 1DVCA 3DY5A 2XFTA 1UUWB 1WTHA 2CFDA 4K90B 1NB5I 3GZXB 3CU3A 3PCRA 2W2CA 3UL5A 3CNMA 4I4KA 2XFSA 3LTAA 5KP1A 1OF5A 4U13A 1GY5A 3NX0A 4R9KA 1TFKA 1W6GA 4Q53A 3T0UA 3CCS3 3EE1A 3DM8A 1C7HA 1S723 2RCDA 3WA2X 4O8SA 2XR8B 3SXXA 3KZTA 3T8UA 1R4CA 1FGMA 4EV5A 3NXJA 3FF0A 3F8XA 4FCJA 5EEOA 2OOVA 1IVUA 4X2OA 1IV7A 1YHQ3 5BVBA 3BLZA 1YJN3 1JKGA 1UI7A 3J7Yd 2QIYA 2WOFA 3KSPA 3NBBA 3X40A 5CF2A 2PNCA 2WGOA 2RFRA 3DGLA 2QA43 2JDIH 5AIGA 2YX9A 4L8PA 3PXMA 3S5CA 3VGNA 2GEYA 2XSHB 1EG9B 1N8QA 2Y73A 2CFLA 3X42A 3OX9A 2Z77A 1JN5A 3JUPA 1TUHA 4RBNA 1M1XB 2XH9A 4HM1B 3NV0B 1HKXA 3LT8A 4EYCA 4XDWA 1NDOB 2Y74A 2C10A 3GWRA 1SIIA 4HVNA 1E97A 5D82A 1L5GB 2K54A 4K1UA 4L7KA 3FG3A 1DYUA 2KCDA 4LMIA 2I9WA 5CXOA 2O9UX 1VQ73 1LXEA 2BMQB 3MSOA 1GYBA 2BMOB 1ZX2A 3S27A 2KRTA 1AVKA 1KD14 2W9PA 3G16A 2W03A 3EBTA 4OK0A 4RNZA 5IG5A 2YFIB 4XBTA 3OW22 3K0ZA 5D81A 3CCQ3 1W6CA 1RN7A 1IK3A 3H3HA 3ROBA 3VF1A 1VZZA 4AKZA 3STDA 3B7CA 1K9M4 3K7CA 2WO0A 4IT7A 4AKYA 2GBXB 3D3LA 3OWUA 3CPW2 3EBYA 1ROVA 1ULJB 3SLUA 1G96A 4XBYA 5IG4A 5EQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS8 A;  1DVC A;  1CYV A;  1NB5 I;  5A0O B;  4N6V 0;  3UL5 A;  1DVD A;  3PYJ A;  3NX0 A;  1N5P A;  1KWI A;  3QRD A;  5LC7 A;  4CCV A;  1R4C A;  3UL6 A;  1M9G A;  3LH4 A;  1N5H A;  1IV7 A;  2CH9 A;  4N6M A;  1CYU A;  1ROA A;  1MNL A;  1TIJ A;  3K9M C;  2BO9 B;  3L0R A;  4N6O B;  3PXM A;  1N9J A;  4TX4 A;  1GD3 A;  1FUW A;  1A67 A;  3KFQ C;  5ELU A;  5ELJ A;  4EYC A;  4N6L A;  2OCT A;  4LZI A;  3IMA B;  1MOL A;  3S67 A;  2O9U X;  1STF I;  1LXE A;  4ZM8 A;  3MWZ A;  1A90 A;  2KXG A;  4N6T A;  3SVA A;  2W9P A;  1YVB I;  3GAX A;  3Q2P A;  1RN7 A;  1IV9 A;  4IT7 A;  1NB3 I;  1FA3 A;  4N6N B;  2W9Q A;  1GD4 A;  4N6U A;  1EQK A;  1PFP A;  1WNH A;  5LC6 A;  1G96 A;  5EQL A;  1CEW I;  3KSE D; 
#chains in the Genus database with same CATH topology
 1IQX A;  3IJE B;  3EQQ B;  2BHM A;  3SOY A;  4KT3 B;  4RZM A;  4CDL A;  4WYK B;  1G02 A;  1JZD A;  3B8L A;  2LYX A;  4K1V A;  2CFW A;  3GZR A;  3Q90 A;  4XM4 A;  3AMO B;  5IG0 A;  5G1L A;  1DVD A;  3CC7 3;  2OQE C;  1WMP A;  2KAA A;  2E2V A;  3AHW A;  1GMR A;  1KWI A;  3RDE A;  2O3O A;  3KN4 A;  1W6Y A;  5BXQ A;  3S29 A;  7RNT A;  3EC9 A;  3FF2 A;  2SBL A;  4XDV A;  3DGY A;  1EUI C;  1VQP 3;  3X3Y A;  3LYG A;  5AIF A;  1FGQ A;  2F86 B;  3CCJ 3;  1OUN A;  3I55 3;  5I97 A;  2H0H A;  4ILF A;  3HI7 A;  3NV0 A;  3UL6 A;  3LZA A;  1G0T A;  1BIR A;  3LH4 A;  1YNV X;  3M8C A;  1N5H A;  1X1Y A;  5G1K A;  1Q7Y 4;  3ZG5 A;  2ZA4 A;  1SIH A;  2IYJ A;  3BU4 A;  3F14 A;  5RNT A;  1BVI A;  1VQ6 3;  1VQ9 3;  4BTW A;  1YGE A;  1TU5 A;  3LTD A;  1CYU A;  1R4Y A;  2FXT A;  5CK6 A;  1BOX A;  1BNI A;  1ROA A;  1RJO A;  2F98 A;  1W2Z A;  3B4P A;  3EB8 A;  1PU4 A;  2RGQ A;  1JBS A;  2IUJ A;  1UCJ A;  4RNT A;  1NWW A;  2F56 A;  3BND A;  3JUM A;  1TIJ A;  3K9M C;  2UGI A;  4MMY B;  2IMJ A;  1JB4 A;  1QJG A;  2XGL A;  3KE7 A;  1UI8 A;  3N54 B;  4LYL B;  4HM5 B;  1O7P B;  3WDG B;  1QAK A;  4J9A A;  1W01 A;  4HM7 B;  5EVH A;  2Z7A A;  1A2K A;  4HM8 B;  1IT8 A;  1LVN A;  4BL3 A;  3FSD A;  1D6Z A;  1W00 A;  1DMQ A;  1EEJ A;  2GSP A;  2P38 A;  1LOX A;  1RN1 A;  1LQM B;  1RGA A;  1RNT A;  1T2I A;  2W56 B;  4TX4 A;  3WOF B;  1LQG C;  4BTY A;  1UGI A;  1RKY A;  3DZL A;  1TP6 A;  3FG4 A;  3NM2 A;  1V74 A;  4BL2 A;  1PY3 A;  4H61 A;  1ULI B;  2ML6 A;  1B2S A;  4JRF A;  4MJD A;  5ELU A;  2HML B;  5STD A;  3IPT A;  4KFE A;  1JV2 B;  1OHO A;  2P0M A;  4WWU C;  3H51 A;  1I8V A;  5AYS C;  1K73 4;  4N6L A;  1O7N B;  3UB1 A;  3I56 3;  1Q81 4;  1OHP A;  4XBX A;  2F5W A;  4O3V A;  3X3X A;  4FMB A;  3UJM A;  1FGR A;  3NHX A;  1FW7 A;  4L8O A;  1W7C A;  1GOU A;  2E2U A;  4CJN A;  1DMN A;  2KF3 A;  1QAL A;  5AYR B;  3MYT A;  5AII A;  3MG3 A;  3U1W A;  1SPU A;  3DH2 A;  3Q1C A;  2HMK B;  4ZM8 A;  3G8Z A;  2FNQ A;  2KXG A;  4K61 A;  2QGU A;  4N6T A;  4EC6 A;  4XB5 A;  3WMD A;  1IYY A;  4J5G A;  4NPB A;  1BSE A;  1GMQ A;  3EN8 A;  1UDI I;  1AR0 A;  2CG1 A;  2HMO B;  1US1 A;  3CCU 3;  2CWV A;  2XSO B;  1BNJ A;  1LOW A;  3FKA A;  2RSX A;  3KCH A;  3OXA A;  1BSD A;  4FMC A;  3CC2 3;  1N8R 4;  4J8T A;  3UNL A;  4GL6 A;  1BRJ A;  2UUG C;  1B27 A;  1I2F A;  1GY7 A;  1V58 A;  2CFG A;  2Z76 A;  2V1L A;  1UCI A;  4KFD A;  4CPK A;  3NBJ A;  1Q82 4;  1IV9 A;  1VQQ A;  2MF7 A;  4R4K A;  3V92 A;  2UX0 A;  1WMN A;  2W9Q A;  2HMN B;  5G2G A;  4X2H A;  1PFP A;  5LC6 A;  3WOD G;  3RGA A;  3WOE B;  2QEX 3;  1TJD A;  2HMM B;  1Q42 A;  3ECF A;  3AGN A;  1CYV A;  4KZ1 A;  4WP5 A;  1MWU A;  3ALA A;  4KVH A;  1U8C B;  5KP4 A;  1IVW A;  2Z6B A;  2XF3 A;  3LOY A;  1OGZ A;  3RGR A;  4OVM A;  3HK4 A;  5A0O B;  1RSN A;  4N6V 0;  2CG0 A;  3NBR A;  4HKV B;  3BNC A;  1OHS A;  1JNQ A;  3NUV A;  1B2X A;  1JB2 A;  1LNI A;  2OWP A;  1ASK A;  3QRD A;  1N9E A;  3TDG A;  1J2B A;  1BRH A;  1HYF A;  9RNT A;  1K41 A;  1OAC A;  1VQN 3;  3QK9 A;  1T5Y A;  8CHO A;  4WFO A;  1IQ8 A;  3OWS A;  1FZU A;  3NQZ A;  4OUQ A;  3CCM 3;  1JJ2 2;  1A2P A;  1JRQ A;  1OF5 B;  2INX A;  2CW9 A;  3F9S A;  3FCS B;  5KP3 A;  1CQS A;  3NQY A;  3CCR 3;  3SED A;  4IPB A;  4DKI A;  1BSA A;  1BUJ A;  2W04 A;  2GU1 A;  3JUN A;  1O7W B;  1MGR A;  1BRN L;  1BRK A;  1VQL 3;  2OTL 3;  3GRD A;  4N6M A;  1SJW A;  1Q40 B;  4FCZ A;  2ML5 A;  4HZB B;  3DXO A;  4FMA A;  3FH1 A;  1W5Z A;  2XGN A;  1GS3 A;  3ER7 A;  4HYZ A;  4FMD A;  1MWS A;  3K5T A;  5JBS A;  3FG1 A;  3LTC A;  3G6E 3;  2BO9 B;  1RRH A;  2IY2 A;  1JKG B;  3K63 A;  1JBR A;  3L0R A;  2ZL8 A;  1GOY A;  1JZO A;  4LSO A;  3HOH A;  1UCL A;  3F7X A;  3X41 A;  3GZB A;  1T2H A;  1N9J A;  1IDP A;  3BIR A;  1OCV A;  1RRL A;  2KF4 A;  5HOH A;  1VQ4 3;  2GXF A;  4JF8 A;  1GD3 A;  1PYL A;  1I0X A;  1FUW A;  2P0X A;  4N3V A;  3BB9 A;  4HZ9 B;  3CME 3;  4HJL B;  1A67 A;  4FCM A;  1F8N A;  2E2T A;  3O8Y A;  5AEU B;  1DET A;  7STD A;  4WHA A;  4I5Q A;  2GEX A;  5FW5 A;  2XEP A;  1FGT A;  1RHL A;  3E99 A;  2OQE A;  1RGF A;  1JN5 B;  3EX9 A;  3D9R A;  2C11 A;  3IMA B;  2MC8 A;  2L1S A;  1Q9E A;  4BTX A;  1RTU A;  1ISK A;  2CWU A;  3S67 A;  1CH0 A;  2F99 A;  2M7O A;  1TRP A;  4NRE A;  4O02 B;  1STF I;  1SQW A;  2IUK A;  5AIH A;  1MWT A;  3MWZ A;  3FZW A;  2B24 B;  4HM3 B;  2WGQ A;  2OTJ 3;  2JQ5 A;  5FGO A;  3RNT A;  5BU4 A;  5AEW B;  1RGE A;  1B20 A;  6GSP A;  4H3U A;  1LNH A;  5CLK A;  3CCE 3;  1RCL A;  1RLS A;  1NNV A;  2OOV C;  4FR9 A;  1M90 4;  2YFL B;  3G0K A;  1YVB I;  3GSP A;  3NM7 A;  3HX8 A;  1WMO A;  1IU7 A;  3GAX A;  3CPO A;  1YGW A;  1AQZ A;  2R41 A;  3F40 A;  4HM2 B;  1I3I A;  1LOY A;  2CHC A;  3PZW A;  1WQL B;  5JPP A;  2F5M A;  4HM0 B;  4R9L A;  1RGK A;  1HU9 A;  4EBG A;  1KC8 4;  1MGW A;  4STD A;  3SX1 A;  1NO3 A;  3EN1 B;  1ZGX A;  3S28 A;  1FGO A;  1VQ8 3;  3LTB A;  1AY7 A;  3BNB A;  3PGB A;  1IT7 A;  3OV4 A;  4N6N B;  5IF6 A;  1OPY A;  2P05 A;  5AI1 A;  8RNT A;  4WYK A;  2ZDJ A;  1TFO A;  1Q40 A;  5JPU A;  1JB5 A;  3CC4 3;  1IQY A;  1I70 A;  2FGT A;  4N6U A;  1UUV B;  1WNH A;  3G4S 3;  3AMO A;  3CXC 2;  2D42 A;  1OH0 A;  1O7G B;  1IVX A;  2WOH A;  3KSE D;  1K28 A;  4KFF A;  4PEJ A;  4ORL A;  2F4Y A;  5D83 A;  1W02 A;  1YJ9 3;  3MPH A;  3EHC A;  1O7M B;  2YFJ B;  4EXR A;  3N8B A;  1Q86 4;  4HAA A;  3I0Y A;  3EF8 A;  2BNG A;  5CF1 A;  1K8A 4;  5DRV A;  3PYJ A;  1UGH I;  4R1K A;  1I3F A;  3MG2 A;  1QVG 2;  6STD A;  1N5P A;  4MMZ B;  1VQM 3;  1A2V A;  1W2B 2;  1Y4K A;  1BRI A;  4AEQ A;  1ZS7 A;  5TGN A;  1RGH A;  2IA7 A;  1I2E A;  1QVF 2;  3D4A A;  1M1K 4;  3CD6 3;  4EV2 A;  1YIT 3;  1EKM A;  2K0M A;  3MHE A;  2STD A;  1NJI 4;  3KII A;  5LC7 A;  2CKF B;  4CCV A;  1M9G A;  1NU3 A;  1YIJ 3;  1D6U A;  3D5G A;  3DGN A;  5IEN A;  1BSC A;  1U5O A;  1OGX A;  3EJV A;  4QWT A;  2CH9 A;  5GSP A;  4IIA A;  1D6Y A;  1BAO A;  3G71 3;  1KQS 2;  2BT3 A;  3BNE A;  3FLJ A;  5M18 A;  1BNF A;  4MMX B;  1E3V A;  1X1U A;  1MNL A;  3MG1 A;  2W6J H;  2W0Q A;  5IEP A;  1BUQ A;  2W56 A;  1HZ1 A;  1I0V A;  1RMS A;  2RNT A;  4O2H A;  3MKI A;  2GU3 A;  4N6O B;  2A15 A;  2CC3 A;  3JVC A;  6RNT A;  3F8H A;  3AGO A;  1RDS A;  3A76 A;  3LML A;  4RNY A;  5IEO A;  1AVL A;  1FUT A;  4HOH A;  1VQK 3;  3V98 A;  1DMM A;  2R4I A;  3HZP A;  4HM6 B;  4EW5 A;  3SYU A;  4BU4 A;  3SOA A;  3KFQ C;  2P09 A;  2L4V A;  1YI2 3;  1BNS A;  1STD A;  1W4N A;  2BMR B;  3OWY A;  5ELJ A;  3KKG A;  4GB5 A;  4J5K A;  1RGC A;  3DGO A;  1FUS A;  3CCL 3;  2CWT A;  4LEH A;  2OCT A;  4LZI A;  1X1X A;  2HMJ B;  1BGS A;  2LQV A;  3N9H A;  2CX0 A;  3F7S A;  1QAF A;  2XRX B;  1SAR A;  1T3B A;  3HIG A;  1VQ5 3;  3CMA 3;  1MOL A;  1E3R A;  3WA3 A;  3D79 A;  1IVV A;  5IG3 A;  5BIR A;  5IW9 A;  4NHF A;  3U97 A;  1S5A A;  1O7H B;  3CNX A;  1UCK A;  3HII A;  3V99 A;  1A90 A;  4GHO A;  2Q07 A;  3B4O A;  2RBI A;  4G1M B;  1UW1 A;  3DGM A;  1VQO 3;  1EA2 A;  3FGY A;  3AHS A;  3SVA A;  5HGR A;  1GY6 A;  1KSI A;  1B21 A;  3JUQ A;  3T8N A;  5IER A;  3Q2P A;  4R80 A;  1Z1S A;  1YJW 3;  2CFK A;  4HM4 B;  3X3Z A;  2D1W A;  3LXU X;  4LGQ A;  1ZO2 A;  4MEI A;  3JUO A;  2CIU A;  2CK3 H;  3VSY A;  1NB3 I;  3CCV 3;  1FA3 A;  1FYS A;  2B1X B;  3PCS A;  5M19 A;  3LT9 A;  2PZV A;  1AV4 A;  1GD4 A;  1LRA A;  3GZY B;  1UUG B;  2GBW B;  5DRE A;  1EQK A;  3DMC A;  4HBR A;  1CEW I;  3DUK A;  1QMA A;  3PS8 A;  1DVC A;  2CX1 A;  2H0I A;  3DY5 A;  2XFT A;  3WHO A;  1RGG A;  1UUW B;  1WTH A;  2CFD A;  4K90 B;  1NB5 I;  3GZX B;  3A5E A;  3CU3 A;  3PCR A;  2W2C A;  1RN4 A;  3UL5 A;  3CNM A;  4I4K A;  3ZG0 A;  2XFS A;  3LTA A;  1X1W A;  5KP1 A;  1LOV A;  1OF5 A;  4U13 A;  1GY5 A;  3NX0 A;  4R9K A;  1TFK A;  1W6G A;  4Q53 A;  3T0U A;  3CCS 3;  1JBT A;  1Q7H A;  3EE1 A;  3DM8 A;  1C7H A;  1S72 3;  2RCD A;  3WA2 X;  4O8S A;  2XR8 B;  3SXX A;  3KZT A;  3T8U A;  1R4C A;  1FGM A;  4EV5 A;  2KF6 A;  3NXJ A;  3FF0 A;  3F8X A;  4FCJ A;  5EEO A;  2OOV A;  1BRG A;  1IVU A;  4X2O A;  1IV7 A;  1YHQ 3;  5BVB A;  1RCK A;  3BLZ A;  1YJN 3;  1JKG A;  1UI7 A;  2AAE A;  3J7Y d;  1BNR A;  2QIY A;  1BNE A;  1GSP A;  2WOF A;  4GSP A;  3KSP A;  3NBB A;  3X40 A;  5CF2 A;  1TTO A;  1BRS A;  2PNC A;  1BNG A;  1I2G A;  2RFR A;  2WGO A;  3D5I A;  2JDI H;  3DGL A;  2BIR A;  3Q3F A;  5AIG A;  1B3S A;  5M1A A;  2YX9 A;  2QA4 3;  4BIR A;  4L8P A;  3PXM A;  3S5C A;  3VGN A;  2GEY A;  1B2U A;  1EG9 B;  1N8Q A;  2J8X B;  2XSH B;  2Y73 A;  2KF5 A;  2CFL A;  3X42 A;  3OX9 A;  2Z77 A;  1JN5 A;  3JUP A;  2K3D A;  1TUH A;  4RBN A;  1BAN A;  1M1X B;  2XH9 A;  4HM1 B;  3NV0 B;  1HKX A;  2HOH A;  3LT8 A;  4EYC A;  4XDW A;  1NDO B;  2Y74 A;  2BU4 A;  2C10 A;  3GWR A;  1SII A;  4HVN A;  1E97 A;  5D82 A;  1L5G B;  2K54 A;  4K1U A;  4L7K A;  3FG3 A;  1DYU A;  2KCD A;  3URP A;  1C54 A;  4LMI A;  2I9W A;  5CXO A;  2O9U X;  1VQ7 3;  1MWR A;  1LXE A;  2BMQ B;  3MSO A;  1TRQ A;  1GYB A;  1DE3 A;  1BU4 A;  2BMO B;  1ZX2 A;  3S27 A;  1RGL A;  2KRT A;  1AVK A;  1KD1 4;  2H0G A;  2AAD A;  1RNB A;  2W9P A;  3G16 A;  1BSB A;  2W03 A;  3EBT A;  4OK0 A;  4RNZ A;  5IG5 A;  2C4B A;  2YFI B;  4XBT A;  3ZFZ A;  3OW2 2;  3K0Z A;  5D81 A;  3CCQ 3;  1W6C A;  1RN7 A;  1IK3 A;  3H3H A;  3ROB A;  3VF1 A;  1VZZ A;  4AKZ A;  3STD A;  2ZHX B;  3B7C A;  1K9M 4;  3K7C A;  2WO0 A;  4IT7 A;  4AKY A;  2GBX B;  2SAR A;  3D3L A;  1B2Z A;  1YVS A;  3OWU A;  1V57 A;  3CPW 2;  3EBY A;  7GSP A;  3WR2 A;  1B2M A;  1ROV A;  1ULJ B;  1GMP A;  1GOV A;  3SLU A;  1G96 A;  4XBY A;  5IG4 A;  5EQL A; 
#chains in the Genus database with same CATH homology
 1IQX A;  3IJE B;  3EQQ B;  2BHM A;  3SOY A;  4RZM A;  4CDL A;  4WYK B;  3B8L A;  2LYX A;  4K1V A;  2CFW A;  3GZR A;  3Q90 A;  4XM4 A;  3AMO B;  5IG0 A;  1DVD A;  3CC7 3;  2OQE C;  1WMP A;  2E2V A;  1KWI A;  3RDE A;  1JJ2 2;  2O3O A;  3KN4 A;  1W6Y A;  5BXQ A;  3S29 A;  3EC9 A;  3FF2 A;  2SBL A;  4XDV A;  1VQP 3;  3X3Y A;  3LYG A;  5AIF A;  1FGQ A;  2F86 B;  3CCJ 3;  1OUN A;  3I55 3;  5I97 A;  3HI7 A;  3NV0 A;  3UL6 A;  3LZA A;  3LH4 A;  3M8C A;  1Q7Y 4;  1N5H A;  1SIH A;  3F14 A;  1VQ6 3;  1VQ9 3;  4BTW A;  1YGE A;  1TU5 A;  3LTD A;  1CYU A;  2FXT A;  5CK6 A;  1RJO A;  1ROA A;  3EB8 A;  2F98 A;  1W2Z A;  3B4P A;  1PU4 A;  2RGQ A;  2IUJ A;  1NWW A;  3BND A;  3JUM A;  1TIJ A;  3K9M C;  4MMY B;  2IMJ A;  1JB4 A;  1QJG A;  2XGL A;  3KE7 A;  1UI8 A;  3N54 B;  3WDG B;  4HM5 B;  1O7P B;  1QAK A;  4J9A A;  1W01 A;  4HM7 B;  5EVH A;  2Z7A A;  1A2K A;  4HM8 B;  1IT8 A;  1LVN A;  3FSD A;  1D6Z A;  1DMQ A;  1W00 A;  2P38 A;  1M1K 4;  1LOX A;  4TX4 A;  1VQK 3;  4BTY A;  2W56 B;  3WOF B;  1RKY A;  3DZL A;  1TP6 A;  3FG4 A;  3NM2 A;  1V74 A;  4H61 A;  1ULI B;  2ML6 A;  4JRF A;  4MJD A;  5ELU A;  2HML B;  5STD A;  3IPT A;  4KFE A;  1JV2 B;  1OHO A;  2P0M A;  4WWU C;  3H51 A;  1K73 4;  5AYS C;  3CD6 3;  4N6L A;  1O7N B;  3UB1 A;  3I56 3;  1Q81 4;  1OHP A;  4XBX A;  4O3V A;  3X3X A;  4FMB A;  3UJM A;  1FGR A;  3NHX A;  4L8O A;  1W7C A;  2E2U A;  1DMN A;  1QAL A;  5AYR B;  3MYT A;  5AII A;  3MG3 A;  3U1W A;  1SPU A;  3Q1C A;  2HMK B;  4ZM8 A;  3G8Z A;  2FNQ A;  2KXG A;  4K61 A;  2QGU A;  4N6T A;  4EC6 A;  4XB5 A;  3WMD A;  3EN8 A;  2CG1 A;  1AR0 A;  2HMO B;  1US1 A;  3CCU 3;  2CWV A;  2XSO B;  3FKA A;  3OXA A;  2RSX A;  3CC2 3;  4FMC A;  1N8R 4;  4J8T A;  3UNL A;  4GL6 A;  2Z76 A;  1GY7 A;  2CFG A;  2V1L A;  4KFD A;  1Q82 4;  3NBJ A;  1IV9 A;  2MF7 A;  4R4K A;  3V92 A;  2UX0 A;  1WMN A;  2W9Q A;  2HMN B;  5G2G A;  4X2H A;  1PFP A;  5LC6 A;  3WOD G;  3RGA A;  3WOE B;  2QEX 3;  2HMM B;  3ECF A;  1Q42 A;  1VQ4 3;  4KZ1 A;  1CYV A;  4WP5 A;  3ALA A;  4KVH A;  1U8C B;  5KP4 A;  1IVW A;  2Z6B A;  2XF3 A;  3LOY A;  1OGZ A;  3RGR A;  4OVM A;  3HK4 A;  5A0O B;  4N6V 0;  2CG0 A;  3NBR A;  4HKV B;  3BNC A;  1OHS A;  1JNQ A;  3NUV A;  1JB2 A;  2OWP A;  3TDG A;  1ASK A;  3QRD A;  1N9E A;  1J2B A;  1K41 A;  1OAC A;  1VQN 3;  3QK9 A;  1T5Y A;  8CHO A;  4WFO A;  1IQ8 A;  3OWS A;  3NQZ A;  4OUQ A;  3CCM 3;  1JRQ A;  2INX A;  1OF5 B;  2CW9 A;  3F9S A;  3FCS B;  5KP3 A;  1CQS A;  3NQY A;  3CCR 3;  3SED A;  4IPB A;  2W04 A;  2GU1 A;  3JUN A;  1O7W B;  1VQL 3;  2OTL 3;  3GRD A;  4N6M A;  1SJW A;  1Q40 B;  4FCZ A;  2ML5 A;  4HZB B;  3DXO A;  4FMA A;  3FH1 A;  1W5Z A;  2XGN A;  1GS3 A;  3ER7 A;  4HYZ A;  4FMD A;  3K5T A;  5JBS A;  3G6E 3;  3FG1 A;  3LTC A;  2BO9 B;  1RRH A;  1JKG B;  3K63 A;  3L0R A;  2ZL8 A;  4LSO A;  3F7X A;  3X41 A;  3GZB A;  1N9J A;  1IDP A;  1OCV A;  1RRL A;  2GXF A;  4JF8 A;  1GD3 A;  1FUW A;  2P0X A;  4N3V A;  3BB9 A;  4HZ9 B;  3CME 3;  4HJL B;  1A67 A;  4FCM A;  1F8N A;  2E2T A;  3O8Y A;  5AEU B;  7STD A;  4WHA A;  2GEX A;  5FW5 A;  2XEP A;  1FGT A;  3E99 A;  2OQE A;  1JN5 B;  3EX9 A;  3D9R A;  2C11 A;  3IMA B;  2MC8 A;  4BTX A;  1ISK A;  2CWU A;  3S67 A;  2F99 A;  2M7O A;  4NRE A;  4O02 B;  1STF I;  1SQW A;  2IUK A;  5AIH A;  3MWZ A;  3FZW A;  2B24 B;  4HM3 B;  2WGQ A;  2OTJ 3;  2JQ5 A;  5FGO A;  5AEW B;  4H3U A;  1LNH A;  5CLK A;  3CCE 3;  2OOV C;  4FR9 A;  1M90 4;  2YFL B;  3G0K A;  1YVB I;  3NM7 A;  3HX8 A;  1WMO A;  1IU7 A;  3GAX A;  3CPO A;  3F40 A;  4HM2 B;  2CHC A;  3PZW A;  1WQL B;  5JPP A;  4HM0 B;  4R9L A;  1HU9 A;  4EBG A;  1KC8 4;  4STD A;  3SX1 A;  1NO3 A;  3EN1 B;  3S28 A;  1FGO A;  1VQ8 3;  3LTB A;  3BNB A;  3PGB A;  1IT7 A;  3OV4 A;  4N6N B;  5IF6 A;  1OPY A;  2P05 A;  5AI1 A;  3CC4 3;  4WYK A;  2ZDJ A;  1TFO A;  1Q40 A;  5JPU A;  1JB5 A;  1IQY A;  2FGT A;  4N6U A;  1UUV B;  1WNH A;  3G4S 3;  3AMO A;  3CXC 2;  2D42 A;  1OH0 A;  1O7G B;  1IVX A;  2WOH A;  3KSE D;  1K28 A;  4KFF A;  4PEJ A;  4ORL A;  5D83 A;  1W02 A;  1YJ9 3;  3MPH A;  3EHC A;  1O7M B;  2YFJ B;  4EXR A;  3N8B A;  1Q86 4;  3I0Y A;  3EF8 A;  2BNG A;  5CF1 A;  1K8A 4;  5DRV A;  3PYJ A;  4R1K A;  1QVG 2;  3MG2 A;  6STD A;  1N5P A;  4MMZ B;  1VQM 3;  1A2V A;  1W2B 2;  1Y4K A;  4AEQ A;  5TGN A;  2IA7 A;  1QVF 2;  4EV2 A;  1YIT 3;  1EKM A;  2K0M A;  3MHE A;  2STD A;  1NJI 4;  3KII A;  5LC7 A;  2CKF B;  4CCV A;  1M9G A;  1NU3 A;  1YIJ 3;  1D6U A;  3DGN A;  5IEN A;  1U5O A;  1OGX A;  3EJV A;  4QWT A;  2CH9 A;  4IIA A;  1D6Y A;  3G71 3;  1KQS 2;  2BT3 A;  3BNE A;  3FLJ A;  4MMX B;  1E3V A;  1MNL A;  3MG1 A;  2W6J H;  2W0Q A;  5IEP A;  1BUQ A;  2W56 A;  4O2H A;  3MKI A;  2GU3 A;  4N6O B;  2A15 A;  2CC3 A;  3JVC A;  3F8H A;  3A76 A;  3LML A;  4RNY A;  5IEO A;  1AVL A;  3V98 A;  1DMM A;  2R4I A;  3HZP A;  4HM6 B;  3SOA A;  3KFQ C;  2P09 A;  2L4V A;  1YI2 3;  1STD A;  1W4N A;  2BMR B;  3OWY A;  5ELJ A;  3KKG A;  4GB5 A;  3CCL 3;  3DGO A;  2CWT A;  4LEH A;  2OCT A;  4LZI A;  2HMJ B;  2LQV A;  3N9H A;  3F7S A;  1QAF A;  2XRX B;  3HIG A;  1VQ5 3;  3CMA 3;  1MOL A;  1E3R A;  3WA3 A;  5IG3 A;  1IVV A;  5IW9 A;  4NHF A;  3U97 A;  1S5A A;  1O7H B;  3CNX A;  3V99 A;  3HII A;  1A90 A;  2Q07 A;  3B4O A;  4G1M B;  1UW1 A;  3DGM A;  1VQO 3;  1EA2 A;  3FGY A;  3SVA A;  5HGR A;  1GY6 A;  1KSI A;  3JUQ A;  3T8N A;  5IER A;  3Q2P A;  4R80 A;  1Z1S A;  1YJW 3;  2CFK A;  4HM4 B;  3X3Z A;  2D1W A;  3LXU X;  4LGQ A;  1ZO2 A;  4MEI A;  3JUO A;  2CIU A;  2CK3 H;  3VSY A;  1NB3 I;  3CCV 3;  1FA3 A;  2B1X B;  3PCS A;  3LT9 A;  2PZV A;  1AV4 A;  1GD4 A;  3GZY B;  2GBW B;  5DRE A;  1EQK A;  3DMC A;  4HBR A;  1CEW I;  3DUK A;  1QMA A;  3PS8 A;  1DVC A;  3DY5 A;  2XFT A;  1UUW B;  1WTH A;  2CFD A;  4K90 B;  1NB5 I;  3GZX B;  3CU3 A;  3PCR A;  2W2C A;  3UL5 A;  3CNM A;  4I4K A;  2XFS A;  3LTA A;  5KP1 A;  1OF5 A;  4U13 A;  1GY5 A;  3NX0 A;  4R9K A;  1TFK A;  1W6G A;  4Q53 A;  3T0U A;  3CCS 3;  3EE1 A;  3DM8 A;  1C7H A;  1S72 3;  2RCD A;  3WA2 X;  4O8S A;  2XR8 B;  3SXX A;  3KZT A;  3T8U A;  1R4C A;  1FGM A;  4EV5 A;  3NXJ A;  3FF0 A;  3F8X A;  4FCJ A;  5EEO A;  2OOV A;  1IVU A;  4X2O A;  1IV7 A;  1YHQ 3;  5BVB A;  3BLZ A;  1YJN 3;  1JKG A;  1UI7 A;  3J7Y d;  2QIY A;  2WOF A;  3KSP A;  3NBB A;  3X40 A;  5CF2 A;  2PNC A;  2WGO A;  2RFR A;  3DGL A;  2QA4 3;  2JDI H;  5AIG A;  2YX9 A;  4L8P A;  3PXM A;  3S5C A;  3VGN A;  2GEY A;  2XSH B;  1EG9 B;  1N8Q A;  2Y73 A;  2CFL A;  3X42 A;  3OX9 A;  2Z77 A;  1JN5 A;  3JUP A;  1TUH A;  4RBN A;  1M1X B;  2XH9 A;  4HM1 B;  3NV0 B;  1HKX A;  3LT8 A;  4EYC A;  4XDW A;  1NDO B;  2Y74 A;  2C10 A;  3GWR A;  1SII A;  4HVN A;  1E97 A;  5D82 A;  1L5G B;  2K54 A;  4K1U A;  4L7K A;  3FG3 A;  1DYU A;  2KCD A;  4LMI A;  2I9W A;  5CXO A;  2O9U X;  1VQ7 3;  1LXE A;  2BMQ B;  3MSO A;  1GYB A;  2BMO B;  1ZX2 A;  3S27 A;  2KRT A;  1AVK A;  1KD1 4;  2W9P A;  3G16 A;  2W03 A;  3EBT A;  4OK0 A;  4RNZ A;  5IG5 A;  2YFI B;  4XBT A;  3OW2 2;  3K0Z A;  5D81 A;  3CCQ 3;  1W6C A;  1RN7 A;  1IK3 A;  3H3H A;  3ROB A;  3VF1 A;  1VZZ A;  4AKZ A;  3STD A;  3B7C A;  1K9M 4;  3K7C A;  2WO0 A;  4IT7 A;  4AKY A;  2GBX B;  3D3L A;  3OWU A;  3CPW 2;  3EBY A;  1ROV A;  1ULJ B;  3SLU A;  1G96 A;  4XBY A;  5IG4 A;  5EQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...