1NB3I

Crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin H
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb3I00
1N9JA 2BO9B 1STFI 1MOLA 2W9QA 1R4CA 5ELJA 1ROAA 4ZM8A 1A90A 4N6TA 3LH4A 3NX0A 1IV9A 4TX4A 4N6LA 3PS8A 2CH9A 2KXGA 4N6OB 1PFPA 4N6NB 1G96A 1KWIA 5LC6A 1M9GA 1GD3A 2W9PA 3SVAA 4N6V0 1CEWI 4CCVA 1DVDA 1FA3A 3K9MC 3Q2PA 3KFQC 1WNHA 1YVBI 5ELUA 3UL6A 1FUWA 3UL5A 4IT7A 1NB5I 3L0RA 2O9UX 3KSED 1DVCA 4LZIA 1EQKA 1CYVA 3QRDA 3PXMA 1MNLA 1RN7A 3S67A 4EYCA 4N6MA 1CYUA 1N5HA 5EQLA 4N6UA 5A0OB 2OCTA 3GAXA 3MWZA 1N5PA 3PYJA 1NB3I 5LC7A 1A67A 3IMAB 1GD4A 1IV7A 1TIJA 1LXEA
chains in the Genus database with same CATH superfamily
2BO9B 1GOVA 2CWUA 1X1UA 3WOFB 3KIIA 1QVG2 3MG1A 1A90A 3FG4A 4RBNA 2UUGC 3X3ZA 4AKZA 1YJ93 1YGWA 1M1XB 2CH9A 4N6OB 1M904 1RTUA 2GEYA 3RDEA 3Q1CA 4N3VA 3MHEA 1RRHA 1IT7A 4CJNA 3CNXA 4RNYA 2H0GA 3ROBA 3BIRA 5CF2A 1C7HA 1QALA 2W04A 1Q824 1BNSA 2LQVA 3F14A 3G8ZA 3DZLA 4N6MA 3V99A 1GOUA 1UGHI 1GS3A 1NO3A 1BRJA 1ZGXA 1JBSA 1RHLA 2CFLA 3LZAA 3JUQA 4HVNA 1DMNA 5DRVA 3FH1A 4BL3A 2P09A 1UDII 3IMAB 4EYCA 1B2SA 4HAAA 1IV7A 1A2PA 3EN1B 4HM1B 3F9SA 3MG3A 4GHOA 3LOYA 4HZBB 5AYSC 4I5QA 4HM4B 2XEPA 5AIFA 3EC9A 1IVUA 1JNQA 2W2CA 1K41A 6RNTA 2OWPA 4N6NB 5IW9A 1OH0A 3STDA 2HMMB 2F98A 5M18A 1YVBI 2GBXB 3B4OA 1JBRA 3X3YA 4Q53A 3VSYA 2BIRA 4WWUC 2O9UX 2IY2A 5BVBA 3BB9A 2H0HA 3N9HA 4XBTA 5BIRA 3T8UA 1BNRA 2QEX3 1GY7A 3O8YA 3TDGA 2P0MA 4EV5A 3HIIA 3JUNA 4H3UA 1K9M4 1RMSA 3WMDA 1RNBA 1ROAA 2CX1A 8RNTA 1BNEA 3PCRA 5FGOA 5AEWB 4K61A 7STDA 2INXA 3EBTA 3CPW2 1Q7Y4 4EC6A 3IPTA 1Q40B 3H51A 1DVDA 3WR2A 3MG2A 3SYUA 3G0KA 1BSCA 1OUNA 3OW22 1BUJA 1BGSA 1WMPA 2CG0A 1BNIA 3PZWA 3QRDA 2CC3A 3WHOA 1CYUA 1G0TA 1B2MA 4BIRA 5BU4A 4HM8B 3AGOA 2XGLA 1YI23 1N9EA 1ROVA 1TRQA 2R4IA 4NREA 1CH0A 1N5PA 1NB3I 1KD14 4HBRA 2RNTA 3A76A 4MMYB 5KP4A 4R4KA 1BAOA 3GZBA 4HM0B 5ELJA 4FR9A 2CWVA 3FG3A 2GSPA 4HM3B 3G4S3 2C10A 4N6LA 4X2HA 5CXOA 5AIHA 1LNHA 4MJDA 4CDLA 4KVHA 1W02A 4GL6A 3SVAA 2I9WA 3FF2A 1T2IA 3CU3A 3GZRA 2WOHA 3CCS3 7RNTA 1BSBA 2SBLA 3X3XA 1YHQ3 4L8OA 1I8VA 1RN4A 4WYKB 2F56A 3NBRA 1GYBA 3D5IA 4LZIA 1W2B2 1EQKA 1W7CA 1LRAA 1DMMA 1UI7A 3NM7A 5HOHA 1X1YA 1N8R4 1YIT3 1SIHA 5HGRA 2MC8A 1QVF2 1LQGC 4MMZB 3UNLA 1Z1SA 1N9JA 2CFWA 1Q7HA 1BSAA 4BTXA 2B24B 3EHCA 4XDVA 1RGHA 4FMAA 3RGAA 4O2HA 4XBXA 1RNTA 1OGXA 1ZX2A 1KWIA 5D81A 2HMJB 1L5GB 3OX9A 3KSPA 4XDWA 5IG3A 5IG4A 5ELUA 4I4KA 4NHFA 1FUWA 4J9AA 4L7KA 1VQN3 1NB5I 3OV4A 1VQQA 1FGTA 3GWRA 4HM5B 3WODG 3GZXB 1MWTA 2RBIA 1ISKA 3AMOB 3B8LA 8CHOA 1VZZA 4GB5A 1KSIA 3B4PA 3LT9A 3Q90A 1LNIA 1OCVA 3BU4A 5EEOA 3I553 1DMQA 2GBWB 1U5OA 1LXEA 3FKAA 1MOLA 1QAFA 3WA3A 2Y74A 3VGNA 4EXRA 1JB4A 1VQ43 5I97A 2M7OA 5AEUB 3UB1A 3F40A 1VQ73 3LTDA 1GOYA 3HX8A 4FMCA 1G02A 3WDGB 1IQ8A 5DREA 3X42A 4HKVB 1BANA 3CCV3 2YFLB 3HZPA 1CEWI 1TU5A 1FA3A 3PCSA 1ASKA 1ULJB 5RNTA 1B2XA 3DUKA 1T2HA 1JBTA 1YIJ3 9RNTA 4CPKA 1OHPA 1YJW3 5D82A 4J8TA 3PXMA 1TFKA 3MPHA 2AADA 4O02B 3I0YA 1AQZA 3WOEB 1UCLA 1GY6A 1FUSA 2WGOA 4OVMA 3QK9A 1US1A 4FMBA 4AKYA 1K8A4 3I563 1Q42A 1UCIA 2F86B 3SOYA 3AGNA 1IK3A 3NQZA 3NV0A 2HMLB 3Q2PA 5D83A 3DGYA 1O7WB 1STDA 3UL5A 2YFIB 3IJEB 5IERA 2W0QA 1W4NA 4MEIA 5KP1A 2AAEA 2Z76A 2OTL3 5IF6A 4RNTA 4KFEA 4FCZA 2A15A 3DH2A 1I70A 5G2GA 1HYFA 1O7GB 1SQWA 3RGRA 1O7MB 5STDA 2UX0A 4HYZA 2BNGA 4KFFA 1UUWB 1GD4A 3MWZA 5JPPA 1JN5B 2RFRA 2J8XB 2W56B 2SARA 1A2KA 2HMKB 1YNVX 2BMOB 2CX0A 2KAAA 1B21A 2BHMA 1FGQA 3E99A 2GXFA 3VF1A 1UI8A 1UCKA 5IG0A 3ZFZA 1BNFA 2BT3A 3Q3FA 2F4YA 5AYRB 4LGQA 3RNTA 1FYSA 1OGZA 3G16A 3A5EA 2KF6A 4OK0A 3NXJA 5GSPA 2OOVA 3SOAA 4AEQA 3CCJ3 2RGQA 1MNLA 3CCM3 1PY3A 1TUHA 4K90B 1W5ZA 1OACA 1NWWA 1OHOA 5A0OB 5BXQA 1SARA 3ZG0A 1D6YA 3CCQ3 3EBYA 1Q40A 2XFSA 1UW1A 2WOFA 7GSPA 1GMPA 4O8SA 1HKXA 1RSNA 2W9QA 3LTCA 3NQYA 1I2FA 3FG1A 3SX1A 3KZTA 1W2ZA 3KKGA 2CFGA 3NX0A 4QWTA 1VQK3 2Q07A 3DGLA 1MWUA 2PZVA 3CPOA 3HIGA 4FMDA 4JF8A 5AIGA 3NM2A 1VQP3 2ZA4A 3CC73 1BRNL 4NPBA 1VQM3 3H3HA 5M19A 3D79A 3WA2X 2ML6A 1WNHA 1GMQA 1ULIB 3NUVA 4WHAA 2XF3A 1B2ZA 3ALAA 1RCKA 1JV2B 3EF8A 3JUOA 3X41A 1RN7A 1IYYA 1RGLA 3JUMA 1S5AA 4KZ1A 2FNQA 2KF5A 4L8PA 4XBYA 2B1XB 4KFDA 1PYLA 1IQYA 1QAKA 3OWUA 3T0UA 1KQS2 1V58A 4WYKA 1JB2A 1I3IA 3MYTA 2L1SA 3V92A 1S723 2HMNB 3F7SA 3X40A 1EKMA 1Y4KA 4HJLB 1LOVA 2JQ5A 4H61A 1IDPA 1AR0A 2W9PA 1O7PB 3JVCA 1WQLB 4XM4A 3CXC2 4R9LA 3SLUA 2K3DA 1FGMA 1RGFA 4EV2A 2FXTA 3ER7A 4OUQA 1MGWA 1UCJA 4HM7B 4BU4A 5FW5A 3LMLA 2ML5A 3BNEA 3NHXA 3OXAA 5IEPA 4J5KA 3KSED 5IEOA 3CMA3 1E97A 3J7Yd 1RRLA 1SPUA 1CQSA 1N5HA 5CF1A 4N6UA 1V74A 5CK6A 1LQMB 1ZS7A 2QGUA 4KT3B 3CC43 3LT8A 1FUTA 1W6YA 2R41A 1DE3A 4DKIA 3LXUX 2K0MA 3HOHA 4BL2A 2KF3A 2RCDA 3DXOA 4K1UA 2XR8B 1IQXA 1VQO3 2F5WA 4FCMA 2IA7A 1F8NA 3FF0A 1TFOA 1Q814 4IIAA 4MMXB 1BRKA 1NU3A 4EW5A 1RDSA 2Z77A 4BTWA 1BIRA 1X1XA 4N6V0 1T3BA 3AHWA 3MKIA 1B2UA 4WFOA 4HOHA 2OQEA 1C54A 4LYLB 3D5GA 1BRHA 3PGBA 3GRDA 3CD63 1OHSA 3HI7A 4JRFA 3EB8A 1OF5B 2CFDA 3AHSA 2F99A 3EN8A 1YJN3 1JZOA 2OTJ3 1RGKA 1X1WA 3LYGA 1VQ83 1W6CA 1MWSA 3JUPA 3BNCA 1EEJA 1I0VA 3SXXA 1SIIA 2KF4A 2XGNA 4K1VA 4LMIA 1AVKA 3G713 1K28A 5IENA 1AVLA 1W00A 1ZO2A 2GEXA 2W6JH 3OWSA 2PNCA 5G1KA 1PU4A 2OOVC 1I3FA 1WMOA 3PS8A 2CK3H 4WP5A 4CCVA 1GD3A 3CCU3 1QJGA 1Q9EA 1YVSA 2Z6BA 3K9MC 3KFQC 3UL6A 2ZHXB 3L0RA 1HZ1A 2E2TA 4STDA 3B7CA 1TP6A 1FGRA 1N8QA 1D6UA 2CW9A 1JJ22 1RJOA 3F8XA 2D42A 3LTBA 1NNVA 1MWRA 1LOWA 1VQL3 1B20A 3HK4A 4RNZA 1OPYA 2O3OA 1NDOB 3F7XA 5KP3A 3U1WA 4ORLA 1STFI 3V98A 3CME3 2KRTA 1MGRA 1KC84 1BOXA 1IT8A 2STDA 1O7NB 1LOXA 1FZUA 1RN1A 3NBBA 1BVIA 2V1LA 3UJMA 2H0IA 1PFPA 3DM8A 3ZG5A 1A67A 1RGGA 3DGMA 3DY5A 2FGTA 2Z7AA 2XRXB 3EJVA 1TJDA 4IT7A 1WTHA 2C11A 5JBSA 1RGAA 3GSPA 5IG5A 2WGQA 1TRPA 1I2EA 1JKGA 4HM2B 1O7HB 1EA2A 3FSDA 3BLZA 2HOHA 2IUJA 5EQLA 3N54B 1R4YA 3CNMA 3GAXA 1T5YA 2P05A 2K54A 4ILFA 5JPUA 1TIJA 4IPBA 3G6E3 1M1K4 3K63A 3BNDA 1NJI4 1BSEA 1R4CA 4N6TA 3URPA 3LH4A 3CCR3 1OF5A 1K734 1JZDA 1IV9A 1JKGB 4TX4A 3U97A 1IU7A 3K7CA 1RKYA 4R1KA 2F5MA 1EG9B 1RGCA 1U8CB 2BMRB 2P38A 1RGEA 1TTOA 3K5TA 2KCDA 2GU3A 3S29A 1A2VA 1UGIA 3LTAA 4LEHA 4O3VA 3ECFA 3F8HA 1VQ53 3FGYA 1UUVB 1E3RA 3EE1A 1IVXA 1CYVA 1EUIC 2JDIH 1V57A 3BNBA 2IYJA 1JB5A 2BU4A 3D4AA 4RZMA 5EVHA 2P0XA 4EBGA 3CCL3 2OCTA 1B27A 2XSHB 4X2OA 1BRIA 1D6ZA 2IMJA 4HM6B 4U13A 4BTYA 1SJWA 5G1LA 2QA43 1VQ63 2QIYA 2MF7A 2BMQB 2C4BA 2CG1A 3SEDA 3KN4A 2ZL8A 4ZM8A 3EQQB 1FGOA 2L4VA 3FLJA 2OQEC 1IVWA 2E2UA 4XB5A 1BRGA 4J5GA 1Q864 2HMOB 3FZWA 5LC6A 1M9GA 3S5CA 6GSPA 2CIUA 4LSOA 2W03A 4GSPA 2CHCA 3CCE3 1W01A 1VQ93 1I2GA 3NBJA 3T8NA 4G1MB 2CWTA 1HU9A 1FW7A 1DYUA 3D3LA 1UUGB 2IUKA 1LOYA 2YFJB 2XFTA 2ZDJA 1DETA 5AIIA 5M1AA 1AY7A 2XH9A 3GZYB 3M8CA 1RLSA 3S28A 1J2BA 5LC7A 5TGNA 1DVCA 2WO0A 2XSOB 3MSOA 3CC23 1YGEA 2LYXA 2YX9A 3NV0B 1E3VA 1GSPA 1LVNA 3S27A 1BSDA 3AMOA 3D9RA 3DGOA 3FCSB 3OWYA 1BUQA 3KCHA 3N8BA 6STDA 1B3SA 2KXGA 2CKFB 1G96A 5CLKA 1BRSA 1AV4A 2RSXA 4R80A 1BU4A 2GU1A 3EX9A 2Y73A 3DGNA 4FCJA 3KE7A 1JN5A 4HZ9B 3K0ZA 1GMRA 2W56A 4R9KA 4PEJA 2E2VA 2UGIA 3S67A 1W6GA 2CFKA 1RCLA 1QMAA 1GY5A 1BNGA 1I0XA 1IVVA 3PYJA 1JRQA 1WMNA 2D1WA 5AI1A 3DMCA 1BNJA
chains in the Genus database with same CATH topology
2BO9B 2CWUA 3WOFB 3KIIA 1QVG2 3MG1A 1A90A 3FG4A 4RBNA 3X3ZA 4AKZA 1YJ93 1M1XB 2CH9A 4N6OB 1M904 2GEYA 3RDEA 3Q1CA 4N3VA 3MHEA 1RRHA 1IT7A 3CNXA 4RNYA 3ROBA 5CF2A 1C7HA 1QALA 2W04A 1Q824 2LQVA 3F14A 3G8ZA 3DZLA 4N6MA 3V99A 1GS3A 1NO3A 3LZAA 2CFLA 3JUQA 4HVNA 1DMNA 5DRVA 3FH1A 2P09A 3IMAB 4EYCA 1IV7A 3EN1B 4HM1B 3F9SA 3MG3A 4HZBB 3LOYA 5AYSC 4HM4B 2XEPA 5AIFA 3EC9A 1IVUA 1JNQA 2W2CA 1K41A 2OWPA 4N6NB 5IW9A 1OH0A 3STDA 2HMMB 2F98A 1YVBI 2GBXB 3B4OA 3X3YA 4Q53A 3VSYA 4WWUC 2O9UX 5BVBA 3BB9A 3N9HA 4XBTA 3T8UA 2QEX3 1GY7A 3O8YA 3TDGA 2P0MA 4EV5A 3HIIA 3JUNA 4H3UA 1K9M4 3WMDA 1ROAA 3PCRA 5FGOA 5AEWB 4K61A 2INXA 3EBTA 3CPW2 1Q7Y4 4EC6A 3IPTA 1Q40B 3H51A 1DVDA 3MG2A 3G0KA 1OUNA 3OW22 1WMPA 2CG0A 3PZWA 3QRDA 2CC3A 1CYUA 4HM8B 2XGLA 1YI23 1N9EA 1ROVA 2R4IA 4NREA 1KD14 1N5PA 1NB3I 4HBRA 3A76A 5KP4A 4MMYB 4R4KA 3GZBA 4HM0B 5ELJA 4FR9A 2CWVA 3FG3A 4HM3B 3G4S3 2C10A 4N6LA 4X2HA 5CXOA 5AIHA 1LNHA 4MJDA 4CDLA 4KVHA 1W02A 4GL6A 3SVAA 2I9WA 3FF2A 3GZRA 3CU3A 3CCS3 2WOHA 2SBLA 3X3XA 1YHQ3 4L8OA 4WYKB 3NBRA 1GYBA 4LZIA 1EQKA 1W2B2 1W7CA 1DMMA 1UI7A 3NM7A 1N8R4 1YIT3 1SIHA 5HGRA 2MC8A 1QVF2 3UNLA 4MMZB 1Z1SA 1N9JA 2CFWA 4BTXA 2B24B 3EHCA 4XDVA 4FMAA 3RGAA 4O2HA 4XBXA 1OGXA 1ZX2A 1KWIA 5D81A 2HMJB 1L5GB 3OX9A 3KSPA 4XDWA 5IG3A 5IG4A 5ELUA 4I4KA 4NHFA 1FUWA 4J9AA 4L7KA 1VQN3 1NB5I 3OV4A 1FGTA 3GWRA 4HM5B 3WODG 3GZXB 1ISKA 3AMOB 3B8LA 8CHOA 1VZZA 4GB5A 1KSIA 3B4PA 3LT9A 3Q90A 1OCVA 5EEOA 3I553 1DMQA 2GBWB 1U5OA 1LXEA 3FKAA 1MOLA 1QAFA 3WA3A 2Y74A 3VGNA 4EXRA 1JB4A 1VQ43 5I97A 2M7OA 5AEUB 3UB1A 3F40A 1VQ73 3LTDA 4FMCA 3HX8A 3WDGB 1IQ8A 5DREA 3X42A 4HKVB 3CCV3 2YFLB 3HZPA 1CEWI 1TU5A 1FA3A 3PCSA 1ASKA 1ULJB 3DUKA 1YIJ3 1OHPA 1YJW3 5D82A 4J8TA 3PXMA 1TFKA 3MPHA 4O02B 3I0YA 3WOEB 1GY6A 2WGOA 4OVMA 3QK9A 1US1A 4FMBA 4AKYA 1K8A4 3I563 1Q42A 2F86B 3SOYA 1IK3A 3NQZA 3NV0A 2HMLB 3Q2PA 5D83A 1O7WB 1STDA 3UL5A 2YFIB 3IJEB 5IERA 2W0QA 1W4NA 4MEIA 5KP1A 2Z76A 2OTL3 5IF6A 4KFEA 4FCZA 2A15A 5G2GA 1O7GB 1SQWA 3RGRA 1O7MB 5STDA 2UX0A 4HYZA 2BNGA 4KFFA 1UUWB 1GD4A 3MWZA 5JPPA 1JN5B 2RFRA 2W56B 1A2KA 2HMKB 2BMOB 2BHMA 1FGQA 3E99A 2GXFA 3VF1A 1UI8A 5IG0A 2BT3A 5AYRB 4LGQA 1OGZA 3G16A 4OK0A 2OOVA 3NXJA 3SOAA 4AEQA 3CCJ3 2RGQA 1MNLA 3CCM3 1TUHA 4K90B 1W5ZA 1OACA 1NWWA 1OHOA 5A0OB 5BXQA 1D6YA 3CCQ3 3EBYA 1Q40A 2XFSA 2WOFA 1UW1A 4O8SA 1HKXA 3LTCA 2W9QA 3NQYA 3FG1A 3SX1A 3KZTA 1W2ZA 3KKGA 2CFGA 3NX0A 4QWTA 1VQK3 2Q07A 3DGLA 4FMDA 2PZVA 3CPOA 3HIGA 4JF8A 5AIGA 1VQP3 3NM2A 3CC73 1VQM3 3H3HA 3WA2X 2ML6A 1WNHA 1ULIB 3NUVA 4WHAA 2XF3A 3ALAA 1JV2B 3EF8A 3JUOA 3X41A 1RN7A 3JUMA 1S5AA 4KZ1A 2FNQA 4L8PA 4XBYA 2B1XB 4KFDA 1QAKA 1IQYA 3OWUA 3T0UA 1KQS2 4WYKA 1JB2A 3MYTA 1S723 3V92A 2HMNB 3F7SA 3X40A 1EKMA 1Y4KA 4HJLB 2JQ5A 4H61A 1IDPA 1AR0A 2W9PA 1O7PB 3JVCA 1WQLB 4XM4A 3CXC2 4R9LA 3SLUA 1FGMA 4EV2A 2FXTA 3ER7A 4OUQA 4HM7B 5FW5A 3LMLA 2ML5A 3BNEA 3NHXA 3OXAA 5IEPA 3KSED 5IEOA 3CMA3 1E97A 3J7Yd 1RRLA 1SPUA 1CQSA 1N5HA 5CF1A 4N6UA 1V74A 5CK6A 2QGUA 3CC43 3LT8A 1W6YA 3LXUX 2K0MA 2RCDA 3DXOA 4K1UA 2XR8B 1IQXA 1VQO3 4FCMA 2IA7A 1F8NA 3FF0A 1TFOA 1Q814 4IIAA 4MMXB 1NU3A 2Z77A 4BTWA 4N6V0 3MKIA 4WFOA 2OQEA 3PGBA 3GRDA 3CD63 1OHSA 3HI7A 4JRFA 3EB8A 1OF5B 2CFDA 3EN8A 2F99A 1YJN3 2OTJ3 3LYGA 1VQ83 1W6CA 3JUPA 3BNCA 3SXXA 1SIIA 2XGNA 4K1VA 4LMIA 1AVKA 3G713 1K28A 5IENA 1AVLA 1W00A 1ZO2A 2GEXA 2W6JH 3OWSA 2PNCA 1PU4A 2OOVC 1WMOA 3PS8A 2CK3H 4WP5A 4CCVA 1GD3A 3CCU3 1QJGA 2Z6BA 3K9MC 3KFQC 3UL6A 3L0RA 2E2TA 4STDA 3B7CA 1TP6A 1FGRA 1N8QA 1D6UA 2CW9A 1JJ22 1RJOA 3F8XA 2D42A 3LTBA 1VQL3 3HK4A 4RNZA 1OPYA 2O3OA 1NDOB 3F7XA 5KP3A 3U1WA 4ORLA 1STFI 3V98A 3CME3 2KRTA 1KC84 1IT8A 2STDA 1O7NB 1LOXA 3NBBA 2V1LA 3UJMA 1PFPA 3DM8A 1A67A 3DGMA 3DY5A 2FGTA 2Z7AA 2XRXB 3EJVA 4IT7A 1WTHA 2C11A 5JBSA 5IG5A 2WGQA 1JKGA 4HM2B 1O7HB 1EA2A 3FSDA 3BLZA 2IUJA 5EQLA 3N54B 3CNMA 3GAXA 1T5YA 2P05A 2K54A 5JPUA 1TIJA 4IPBA 3G6E3 1M1K4 3K63A 3BNDA 1NJI4 1R4CA 4N6TA 3LH4A 3CCR3 1OF5A 1K734 1IV9A 1JKGB 4TX4A 3U97A 1IU7A 3K7CA 1RKYA 4R1KA 1EG9B 1U8CB 2BMRB 2P38A 3K5TA 2KCDA 2GU3A 3S29A 1A2VA 3LTAA 4LEHA 4O3VA 3ECFA 3F8HA 1VQ53 3FGYA 1UUVB 1E3RA 3EE1A 1IVXA 1CYVA 2JDIH 3BNBA 4EBGA 7STDA 5EVHA 1JB5A 4RZMA 3CCL3 2P0XA 2OCTA 2XSHB 4X2OA 1D6ZA 2IMJA 4HM6B 4BTYA 1SJWA 2QA43 1VQ63 2QIYA 2MF7A 2BMQB 2CG1A 3SEDA 3KN4A 2ZL8A 4ZM8A 3EQQB 1FGOA 2L4VA 3FLJA 2OQEC 1IVWA 2E2UA 4XB5A 1Q864 2HMOB 3FZWA 5LC6A 1M9GA 3S5CA 2CIUA 4LSOA 2W03A 2CHCA 3CCE3 1W01A 1VQ93 3NBJA 3T8NA 4G1MB 2CWTA 1HU9A 1DYUA 3D3LA 2YFJB 2IUKA 2XFTA 2ZDJA 5AIIA 2XH9A 3GZYB 3M8CA 3S28A 1J2BA 5LC7A 5TGNA 1DVCA 2WO0A 2XSOB 3MSOA 3CC23 1YGEA 2LYXA 2YX9A 3NV0B 1E3VA 1LVNA 3S27A 3AMOA 3D9RA 3DGOA 3FCSB 3OWYA 1BUQA 3N8BA 6STDA 2KXGA 2CKFB 1G96A 5CLKA 1AV4A 2RSXA 4R80A 2GU1A 3EX9A 2Y73A 3DGNA 4FCJA 3KE7A 1JN5A 4HZ9B 3K0ZA 2W56A 4R9KA 4PEJA 2E2VA 3S67A 1W6GA 2CFKA 1QMAA 1GY5A 1IVVA 3PYJA 1JRQA 1WMNA 2D1WA 5AI1A 3DMCA 4U13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9J A;  2BO9 B;  1STF I;  1MOL A;  2W9Q A;  1R4C A;  5ELJ A;  1ROA A;  4ZM8 A;  1A90 A;  4N6T A;  3LH4 A;  3NX0 A;  1IV9 A;  4TX4 A;  4N6L A;  3PS8 A;  2CH9 A;  2KXG A;  4N6O B;  1PFP A;  4N6N B;  1G96 A;  1KWI A;  5LC6 A;  1M9G A;  1GD3 A;  2W9P A;  3SVA A;  4N6V 0;  1CEW I;  4CCV A;  1DVD A;  1FA3 A;  3K9M C;  3Q2P A;  3KFQ C;  1WNH A;  1YVB I;  5ELU A;  3UL6 A;  1FUW A;  3UL5 A;  4IT7 A;  1NB5 I;  3L0R A;  2O9U X;  3KSE D;  1DVC A;  4LZI A;  1EQK A;  1CYV A;  3QRD A;  3PXM A;  1MNL A;  1RN7 A;  3S67 A;  4EYC A;  4N6M A;  1CYU A;  1N5H A;  5EQL A;  4N6U A;  5A0O B;  2OCT A;  3GAX A;  3MWZ A;  1N5P A;  3PYJ A;  1NB3 I;  5LC7 A;  1A67 A;  3IMA B;  1GD4 A;  1IV7 A;  1TIJ A;  1LXE A; 
#chains in the Genus database with same CATH topology
 2BO9 B;  1GOV A;  2CWU A;  1X1U A;  3WOF B;  3KII A;  1QVG 2;  3MG1 A;  1A90 A;  3FG4 A;  4RBN A;  2UUG C;  3X3Z A;  4AKZ A;  1YJ9 3;  1YGW A;  1M1X B;  2CH9 A;  4N6O B;  1M90 4;  1RTU A;  2GEY A;  3RDE A;  3Q1C A;  4N3V A;  3MHE A;  1RRH A;  1IT7 A;  4CJN A;  3CNX A;  4RNY A;  2H0G A;  3ROB A;  3BIR A;  5CF2 A;  1C7H A;  1QAL A;  2W04 A;  1Q82 4;  1BNS A;  2LQV A;  3F14 A;  3G8Z A;  3DZL A;  4N6M A;  3V99 A;  1GOU A;  1UGH I;  1GS3 A;  1NO3 A;  1BRJ A;  1ZGX A;  1JBS A;  1RHL A;  2CFL A;  3LZA A;  3JUQ A;  4HVN A;  1DMN A;  5DRV A;  3FH1 A;  4BL3 A;  2P09 A;  1UDI I;  3IMA B;  4EYC A;  1B2S A;  4HAA A;  1IV7 A;  1A2P A;  3EN1 B;  4HM1 B;  3F9S A;  3MG3 A;  4GHO A;  3LOY A;  4HZB B;  5AYS C;  4I5Q A;  4HM4 B;  2XEP A;  5AIF A;  3EC9 A;  1IVU A;  1JNQ A;  2W2C A;  1K41 A;  6RNT A;  2OWP A;  4N6N B;  5IW9 A;  1OH0 A;  3STD A;  2HMM B;  2F98 A;  5M18 A;  1YVB I;  2GBX B;  3B4O A;  1JBR A;  3X3Y A;  4Q53 A;  3VSY A;  2BIR A;  4WWU C;  2O9U X;  2IY2 A;  5BVB A;  3BB9 A;  2H0H A;  3N9H A;  4XBT A;  5BIR A;  3T8U A;  1BNR A;  2QEX 3;  1GY7 A;  3O8Y A;  3TDG A;  2P0M A;  4EV5 A;  3HII A;  3JUN A;  4H3U A;  1K9M 4;  1RMS A;  3WMD A;  1RNB A;  1ROA A;  2CX1 A;  8RNT A;  1BNE A;  3PCR A;  5FGO A;  5AEW B;  4K61 A;  7STD A;  2INX A;  3EBT A;  3CPW 2;  1Q7Y 4;  4EC6 A;  3IPT A;  1Q40 B;  3H51 A;  1DVD A;  3WR2 A;  3MG2 A;  3SYU A;  3G0K A;  1BSC A;  1OUN A;  3OW2 2;  1BUJ A;  1BGS A;  1WMP A;  2CG0 A;  1BNI A;  3PZW A;  3QRD A;  2CC3 A;  3WHO A;  1CYU A;  1G0T A;  1B2M A;  4BIR A;  5BU4 A;  4HM8 B;  3AGO A;  2XGL A;  1YI2 3;  1N9E A;  1ROV A;  1TRQ A;  2R4I A;  4NRE A;  1CH0 A;  1N5P A;  1NB3 I;  1KD1 4;  4HBR A;  2RNT A;  3A76 A;  4MMY B;  5KP4 A;  4R4K A;  1BAO A;  3GZB A;  4HM0 B;  5ELJ A;  4FR9 A;  2CWV A;  3FG3 A;  2GSP A;  4HM3 B;  3G4S 3;  2C10 A;  4N6L A;  4X2H A;  5CXO A;  5AIH A;  1LNH A;  4MJD A;  4CDL A;  4KVH A;  1W02 A;  4GL6 A;  3SVA A;  2I9W A;  3FF2 A;  1T2I A;  3CU3 A;  3GZR A;  2WOH A;  3CCS 3;  7RNT A;  1BSB A;  2SBL A;  3X3X A;  1YHQ 3;  4L8O A;  1I8V A;  1RN4 A;  4WYK B;  2F56 A;  3NBR A;  1GYB A;  3D5I A;  4LZI A;  1W2B 2;  1EQK A;  1W7C A;  1LRA A;  1DMM A;  1UI7 A;  3NM7 A;  5HOH A;  1X1Y A;  1N8R 4;  1YIT 3;  1SIH A;  5HGR A;  2MC8 A;  1QVF 2;  1LQG C;  4MMZ B;  3UNL A;  1Z1S A;  1N9J A;  2CFW A;  1Q7H A;  1BSA A;  4BTX A;  2B24 B;  3EHC A;  4XDV A;  1RGH A;  4FMA A;  3RGA A;  4O2H A;  4XBX A;  1RNT A;  1OGX A;  1ZX2 A;  1KWI A;  5D81 A;  2HMJ B;  1L5G B;  3OX9 A;  3KSP A;  4XDW A;  5IG3 A;  5IG4 A;  5ELU A;  4I4K A;  4NHF A;  1FUW A;  4J9A A;  4L7K A;  1VQN 3;  1NB5 I;  3OV4 A;  1VQQ A;  1FGT A;  3GWR A;  4HM5 B;  3WOD G;  3GZX B;  1MWT A;  2RBI A;  1ISK A;  3AMO B;  3B8L A;  8CHO A;  1VZZ A;  4GB5 A;  1KSI A;  3B4P A;  3LT9 A;  3Q90 A;  1LNI A;  1OCV A;  3BU4 A;  5EEO A;  3I55 3;  1DMQ A;  2GBW B;  1U5O A;  1LXE A;  3FKA A;  1MOL A;  1QAF A;  3WA3 A;  2Y74 A;  3VGN A;  4EXR A;  1JB4 A;  1VQ4 3;  5I97 A;  2M7O A;  5AEU B;  3UB1 A;  3F40 A;  1VQ7 3;  3LTD A;  1GOY A;  3HX8 A;  4FMC A;  1G02 A;  3WDG B;  1IQ8 A;  5DRE A;  3X42 A;  4HKV B;  1BAN A;  3CCV 3;  2YFL B;  3HZP A;  1CEW I;  1TU5 A;  1FA3 A;  3PCS A;  1ASK A;  1ULJ B;  5RNT A;  1B2X A;  3DUK A;  1T2H A;  1JBT A;  1YIJ 3;  9RNT A;  4CPK A;  1OHP A;  1YJW 3;  5D82 A;  4J8T A;  3PXM A;  1TFK A;  3MPH A;  2AAD A;  4O02 B;  3I0Y A;  1AQZ A;  3WOE B;  1UCL A;  1GY6 A;  1FUS A;  2WGO A;  4OVM A;  3QK9 A;  1US1 A;  4FMB A;  4AKY A;  1K8A 4;  3I56 3;  1Q42 A;  1UCI A;  2F86 B;  3SOY A;  3AGN A;  1IK3 A;  3NQZ A;  3NV0 A;  2HML B;  3Q2P A;  5D83 A;  3DGY A;  1O7W B;  1STD A;  3UL5 A;  2YFI B;  3IJE B;  5IER A;  2W0Q A;  1W4N A;  4MEI A;  5KP1 A;  2AAE A;  2Z76 A;  2OTL 3;  5IF6 A;  4RNT A;  4KFE A;  4FCZ A;  2A15 A;  3DH2 A;  1I70 A;  5G2G A;  1HYF A;  1O7G B;  1SQW A;  3RGR A;  1O7M B;  5STD A;  2UX0 A;  4HYZ A;  2BNG A;  4KFF A;  1UUW B;  1GD4 A;  3MWZ A;  5JPP A;  1JN5 B;  2RFR A;  2J8X B;  2W56 B;  2SAR A;  1A2K A;  2HMK B;  1YNV X;  2BMO B;  2CX0 A;  2KAA A;  1B21 A;  2BHM A;  1FGQ A;  3E99 A;  2GXF A;  3VF1 A;  1UI8 A;  1UCK A;  5IG0 A;  3ZFZ A;  1BNF A;  2BT3 A;  3Q3F A;  2F4Y A;  5AYR B;  4LGQ A;  3RNT A;  1FYS A;  1OGZ A;  3G16 A;  3A5E A;  2KF6 A;  4OK0 A;  3NXJ A;  5GSP A;  2OOV A;  3SOA A;  4AEQ A;  3CCJ 3;  2RGQ A;  1MNL A;  3CCM 3;  1PY3 A;  1TUH A;  4K90 B;  1W5Z A;  1OAC A;  1NWW A;  1OHO A;  5A0O B;  5BXQ A;  1SAR A;  3ZG0 A;  1D6Y A;  3CCQ 3;  3EBY A;  1Q40 A;  2XFS A;  1UW1 A;  2WOF A;  7GSP A;  1GMP A;  4O8S A;  1HKX A;  1RSN A;  2W9Q A;  3LTC A;  3NQY A;  1I2F A;  3FG1 A;  3SX1 A;  3KZT A;  1W2Z A;  3KKG A;  2CFG A;  3NX0 A;  4QWT A;  1VQK 3;  2Q07 A;  3DGL A;  1MWU A;  2PZV A;  3CPO A;  3HIG A;  4FMD A;  4JF8 A;  5AIG A;  3NM2 A;  1VQP 3;  2ZA4 A;  3CC7 3;  1BRN L;  4NPB A;  1VQM 3;  3H3H A;  5M19 A;  3D79 A;  3WA2 X;  2ML6 A;  1WNH A;  1GMQ A;  1ULI B;  3NUV A;  4WHA A;  2XF3 A;  1B2Z A;  3ALA A;  1RCK A;  1JV2 B;  3EF8 A;  3JUO A;  3X41 A;  1RN7 A;  1IYY A;  1RGL A;  3JUM A;  1S5A A;  4KZ1 A;  2FNQ A;  2KF5 A;  4L8P A;  4XBY A;  2B1X B;  4KFD A;  1PYL A;  1IQY A;  1QAK A;  3OWU A;  3T0U A;  1KQS 2;  1V58 A;  4WYK A;  1JB2 A;  1I3I A;  3MYT A;  2L1S A;  3V92 A;  1S72 3;  2HMN B;  3F7S A;  3X40 A;  1EKM A;  1Y4K A;  4HJL B;  1LOV A;  2JQ5 A;  4H61 A;  1IDP A;  1AR0 A;  2W9P A;  1O7P B;  3JVC A;  1WQL B;  4XM4 A;  3CXC 2;  4R9L A;  3SLU A;  2K3D A;  1FGM A;  1RGF A;  4EV2 A;  2FXT A;  3ER7 A;  4OUQ A;  1MGW A;  1UCJ A;  4HM7 B;  4BU4 A;  5FW5 A;  3LML A;  2ML5 A;  3BNE A;  3NHX A;  3OXA A;  5IEP A;  4J5K A;  3KSE D;  5IEO A;  3CMA 3;  1E97 A;  3J7Y d;  1RRL A;  1SPU A;  1CQS A;  1N5H A;  5CF1 A;  4N6U A;  1V74 A;  5CK6 A;  1LQM B;  1ZS7 A;  2QGU A;  4KT3 B;  3CC4 3;  3LT8 A;  1FUT A;  1W6Y A;  2R41 A;  1DE3 A;  4DKI A;  3LXU X;  2K0M A;  3HOH A;  4BL2 A;  2KF3 A;  2RCD A;  3DXO A;  4K1U A;  2XR8 B;  1IQX A;  1VQO 3;  2F5W A;  4FCM A;  2IA7 A;  1F8N A;  3FF0 A;  1TFO A;  1Q81 4;  4IIA A;  4MMX B;  1BRK A;  1NU3 A;  4EW5 A;  1RDS A;  2Z77 A;  4BTW A;  1BIR A;  1X1X A;  4N6V 0;  1T3B A;  3AHW A;  3MKI A;  1B2U A;  4WFO A;  4HOH A;  2OQE A;  1C54 A;  4LYL B;  3D5G A;  1BRH A;  3PGB A;  3GRD A;  3CD6 3;  1OHS A;  3HI7 A;  4JRF A;  3EB8 A;  1OF5 B;  2CFD A;  3AHS A;  2F99 A;  3EN8 A;  1YJN 3;  1JZO A;  2OTJ 3;  1RGK A;  1X1W A;  3LYG A;  1VQ8 3;  1W6C A;  1MWS A;  3JUP A;  3BNC A;  1EEJ A;  1I0V A;  3SXX A;  1SII A;  2KF4 A;  2XGN A;  4K1V A;  4LMI A;  1AVK A;  3G71 3;  1K28 A;  5IEN A;  1AVL A;  1W00 A;  1ZO2 A;  2GEX A;  2W6J H;  3OWS A;  2PNC A;  5G1K A;  1PU4 A;  2OOV C;  1I3F A;  1WMO A;  3PS8 A;  2CK3 H;  4WP5 A;  4CCV A;  1GD3 A;  3CCU 3;  1QJG A;  1Q9E A;  1YVS A;  2Z6B A;  3K9M C;  3KFQ C;  3UL6 A;  2ZHX B;  3L0R A;  1HZ1 A;  2E2T A;  4STD A;  3B7C A;  1TP6 A;  1FGR A;  1N8Q A;  1D6U A;  2CW9 A;  1JJ2 2;  1RJO A;  3F8X A;  2D42 A;  3LTB A;  1NNV A;  1MWR A;  1LOW A;  1VQL 3;  1B20 A;  3HK4 A;  4RNZ A;  1OPY A;  2O3O A;  1NDO B;  3F7X A;  5KP3 A;  3U1W A;  4ORL A;  1STF I;  3V98 A;  3CME 3;  2KRT A;  1MGR A;  1KC8 4;  1BOX A;  1IT8 A;  2STD A;  1O7N B;  1LOX A;  1FZU A;  1RN1 A;  3NBB A;  1BVI A;  2V1L A;  3UJM A;  2H0I A;  1PFP A;  3DM8 A;  3ZG5 A;  1A67 A;  1RGG A;  3DGM A;  3DY5 A;  2FGT A;  2Z7A A;  2XRX B;  3EJV A;  1TJD A;  4IT7 A;  1WTH A;  2C11 A;  5JBS A;  1RGA A;  3GSP A;  5IG5 A;  2WGQ A;  1TRP A;  1I2E A;  1JKG A;  4HM2 B;  1O7H B;  1EA2 A;  3FSD A;  3BLZ A;  2HOH A;  2IUJ A;  5EQL A;  3N54 B;  1R4Y A;  3CNM A;  3GAX A;  1T5Y A;  2P05 A;  2K54 A;  4ILF A;  5JPU A;  1TIJ A;  4IPB A;  3G6E 3;  1M1K 4;  3K63 A;  3BND A;  1NJI 4;  1BSE A;  1R4C A;  4N6T A;  3URP A;  3LH4 A;  3CCR 3;  1OF5 A;  1K73 4;  1JZD A;  1IV9 A;  1JKG B;  4TX4 A;  3U97 A;  1IU7 A;  3K7C A;  1RKY A;  4R1K A;  2F5M A;  1EG9 B;  1RGC A;  1U8C B;  2BMR B;  2P38 A;  1RGE A;  1TTO A;  3K5T A;  2KCD A;  2GU3 A;  3S29 A;  1A2V A;  1UGI A;  3LTA A;  4LEH A;  4O3V A;  3ECF A;  3F8H A;  1VQ5 3;  3FGY A;  1UUV B;  1E3R A;  3EE1 A;  1IVX A;  1CYV A;  1EUI C;  2JDI H;  1V57 A;  3BNB A;  2IYJ A;  1JB5 A;  2BU4 A;  3D4A A;  4RZM A;  5EVH A;  2P0X A;  4EBG A;  3CCL 3;  2OCT A;  1B27 A;  2XSH B;  4X2O A;  1BRI A;  1D6Z A;  2IMJ A;  4HM6 B;  4U13 A;  4BTY A;  1SJW A;  5G1L A;  2QA4 3;  1VQ6 3;  2QIY A;  2MF7 A;  2BMQ B;  2C4B A;  2CG1 A;  3SED A;  3KN4 A;  2ZL8 A;  4ZM8 A;  3EQQ B;  1FGO A;  2L4V A;  3FLJ A;  2OQE C;  1IVW A;  2E2U A;  4XB5 A;  1BRG A;  4J5G A;  1Q86 4;  2HMO B;  3FZW A;  5LC6 A;  1M9G A;  3S5C A;  6GSP A;  2CIU A;  4LSO A;  2W03 A;  4GSP A;  2CHC A;  3CCE 3;  1W01 A;  1VQ9 3;  1I2G A;  3NBJ A;  3T8N A;  4G1M B;  2CWT A;  1HU9 A;  1FW7 A;  1DYU A;  3D3L A;  1UUG B;  2IUK A;  1LOY A;  2YFJ B;  2XFT A;  2ZDJ A;  1DET A;  5AII A;  5M1A A;  1AY7 A;  2XH9 A;  3GZY B;  3M8C A;  1RLS A;  3S28 A;  1J2B A;  5LC7 A;  5TGN A;  1DVC A;  2WO0 A;  2XSO B;  3MSO A;  3CC2 3;  1YGE A;  2LYX A;  2YX9 A;  3NV0 B;  1E3V A;  1GSP A;  1LVN A;  3S27 A;  1BSD A;  3AMO A;  3D9R A;  3DGO A;  3FCS B;  3OWY A;  1BUQ A;  3KCH A;  3N8B A;  6STD A;  1B3S A;  2KXG A;  2CKF B;  1G96 A;  5CLK A;  1BRS A;  1AV4 A;  2RSX A;  4R80 A;  1BU4 A;  2GU1 A;  3EX9 A;  2Y73 A;  3DGN A;  4FCJ A;  3KE7 A;  1JN5 A;  4HZ9 B;  3K0Z A;  1GMR A;  2W56 A;  4R9K A;  4PEJ A;  2E2V A;  2UGI A;  3S67 A;  1W6G A;  2CFK A;  1RCL A;  1QMA A;  1GY5 A;  1BNG A;  1I0X A;  1IVV A;  3PYJ A;  1JRQ A;  1WMN A;  2D1W A;  5AI1 A;  3DMC A;  1BNJ A; 
#chains in the Genus database with same CATH homology
 2BO9 B;  2CWU A;  3WOF B;  3KII A;  1QVG 2;  3MG1 A;  1A90 A;  3FG4 A;  4RBN A;  3X3Z A;  4AKZ A;  1YJ9 3;  1M1X B;  2CH9 A;  4N6O B;  1M90 4;  2GEY A;  3RDE A;  3Q1C A;  4N3V A;  3MHE A;  1RRH A;  1IT7 A;  3CNX A;  4RNY A;  3ROB A;  5CF2 A;  1C7H A;  1QAL A;  2W04 A;  1Q82 4;  2LQV A;  3F14 A;  3G8Z A;  3DZL A;  4N6M A;  3V99 A;  1GS3 A;  1NO3 A;  3LZA A;  2CFL A;  3JUQ A;  4HVN A;  1DMN A;  5DRV A;  3FH1 A;  2P09 A;  3IMA B;  4EYC A;  1IV7 A;  3EN1 B;  4HM1 B;  3F9S A;  3MG3 A;  4HZB B;  3LOY A;  5AYS C;  4HM4 B;  2XEP A;  5AIF A;  3EC9 A;  1IVU A;  1JNQ A;  2W2C A;  1K41 A;  2OWP A;  4N6N B;  5IW9 A;  1OH0 A;  3STD A;  2HMM B;  2F98 A;  1YVB I;  2GBX B;  3B4O A;  3X3Y A;  4Q53 A;  3VSY A;  4WWU C;  2O9U X;  5BVB A;  3BB9 A;  3N9H A;  4XBT A;  3T8U A;  2QEX 3;  1GY7 A;  3O8Y A;  3TDG A;  2P0M A;  4EV5 A;  3HII A;  3JUN A;  4H3U A;  1K9M 4;  3WMD A;  1ROA A;  3PCR A;  5FGO A;  5AEW B;  4K61 A;  2INX A;  3EBT A;  3CPW 2;  1Q7Y 4;  4EC6 A;  3IPT A;  1Q40 B;  3H51 A;  1DVD A;  3MG2 A;  3G0K A;  1OUN A;  3OW2 2;  1WMP A;  2CG0 A;  3PZW A;  3QRD A;  2CC3 A;  1CYU A;  4HM8 B;  2XGL A;  1YI2 3;  1N9E A;  1ROV A;  2R4I A;  4NRE A;  1KD1 4;  1N5P A;  1NB3 I;  4HBR A;  3A76 A;  5KP4 A;  4MMY B;  4R4K A;  3GZB A;  4HM0 B;  5ELJ A;  4FR9 A;  2CWV A;  3FG3 A;  4HM3 B;  3G4S 3;  2C10 A;  4N6L A;  4X2H A;  5CXO A;  5AIH A;  1LNH A;  4MJD A;  4CDL A;  4KVH A;  1W02 A;  4GL6 A;  3SVA A;  2I9W A;  3FF2 A;  3GZR A;  3CU3 A;  3CCS 3;  2WOH A;  2SBL A;  3X3X A;  1YHQ 3;  4L8O A;  4WYK B;  3NBR A;  1GYB A;  4LZI A;  1EQK A;  1W2B 2;  1W7C A;  1DMM A;  1UI7 A;  3NM7 A;  1N8R 4;  1YIT 3;  1SIH A;  5HGR A;  2MC8 A;  1QVF 2;  3UNL A;  4MMZ B;  1Z1S A;  1N9J A;  2CFW A;  4BTX A;  2B24 B;  3EHC A;  4XDV A;  4FMA A;  3RGA A;  4O2H A;  4XBX A;  1OGX A;  1ZX2 A;  1KWI A;  5D81 A;  2HMJ B;  1L5G B;  3OX9 A;  3KSP A;  4XDW A;  5IG3 A;  5IG4 A;  5ELU A;  4I4K A;  4NHF A;  1FUW A;  4J9A A;  4L7K A;  1VQN 3;  1NB5 I;  3OV4 A;  1FGT A;  3GWR A;  4HM5 B;  3WOD G;  3GZX B;  1ISK A;  3AMO B;  3B8L A;  8CHO A;  1VZZ A;  4GB5 A;  1KSI A;  3B4P A;  3LT9 A;  3Q90 A;  1OCV A;  5EEO A;  3I55 3;  1DMQ A;  2GBW B;  1U5O A;  1LXE A;  3FKA A;  1MOL A;  1QAF A;  3WA3 A;  2Y74 A;  3VGN A;  4EXR A;  1JB4 A;  1VQ4 3;  5I97 A;  2M7O A;  5AEU B;  3UB1 A;  3F40 A;  1VQ7 3;  3LTD A;  4FMC A;  3HX8 A;  3WDG B;  1IQ8 A;  5DRE A;  3X42 A;  4HKV B;  3CCV 3;  2YFL B;  3HZP A;  1CEW I;  1TU5 A;  1FA3 A;  3PCS A;  1ASK A;  1ULJ B;  3DUK A;  1YIJ 3;  1OHP A;  1YJW 3;  5D82 A;  4J8T A;  3PXM A;  1TFK A;  3MPH A;  4O02 B;  3I0Y A;  3WOE B;  1GY6 A;  2WGO A;  4OVM A;  3QK9 A;  1US1 A;  4FMB A;  4AKY A;  1K8A 4;  3I56 3;  1Q42 A;  2F86 B;  3SOY A;  1IK3 A;  3NQZ A;  3NV0 A;  2HML B;  3Q2P A;  5D83 A;  1O7W B;  1STD A;  3UL5 A;  2YFI B;  3IJE B;  5IER A;  2W0Q A;  1W4N A;  4MEI A;  5KP1 A;  2Z76 A;  2OTL 3;  5IF6 A;  4KFE A;  4FCZ A;  2A15 A;  5G2G A;  1O7G B;  1SQW A;  3RGR A;  1O7M B;  5STD A;  2UX0 A;  4HYZ A;  2BNG A;  4KFF A;  1UUW B;  1GD4 A;  3MWZ A;  5JPP A;  1JN5 B;  2RFR A;  2W56 B;  1A2K A;  2HMK B;  2BMO B;  2BHM A;  1FGQ A;  3E99 A;  2GXF A;  3VF1 A;  1UI8 A;  5IG0 A;  2BT3 A;  5AYR B;  4LGQ A;  1OGZ A;  3G16 A;  4OK0 A;  2OOV A;  3NXJ A;  3SOA A;  4AEQ A;  3CCJ 3;  2RGQ A;  1MNL A;  3CCM 3;  1TUH A;  4K90 B;  1W5Z A;  1OAC A;  1NWW A;  1OHO A;  5A0O B;  5BXQ A;  1D6Y A;  3CCQ 3;  3EBY A;  1Q40 A;  2XFS A;  2WOF A;  1UW1 A;  4O8S A;  1HKX A;  3LTC A;  2W9Q A;  3NQY A;  3FG1 A;  3SX1 A;  3KZT A;  1W2Z A;  3KKG A;  2CFG A;  3NX0 A;  4QWT A;  1VQK 3;  2Q07 A;  3DGL A;  4FMD A;  2PZV A;  3CPO A;  3HIG A;  4JF8 A;  5AIG A;  1VQP 3;  3NM2 A;  3CC7 3;  1VQM 3;  3H3H A;  3WA2 X;  2ML6 A;  1WNH A;  1ULI B;  3NUV A;  4WHA A;  2XF3 A;  3ALA A;  1JV2 B;  3EF8 A;  3JUO A;  3X41 A;  1RN7 A;  3JUM A;  1S5A A;  4KZ1 A;  2FNQ A;  4L8P A;  4XBY A;  2B1X B;  4KFD A;  1QAK A;  1IQY A;  3OWU A;  3T0U A;  1KQS 2;  4WYK A;  1JB2 A;  3MYT A;  1S72 3;  3V92 A;  2HMN B;  3F7S A;  3X40 A;  1EKM A;  1Y4K A;  4HJL B;  2JQ5 A;  4H61 A;  1IDP A;  1AR0 A;  2W9P A;  1O7P B;  3JVC A;  1WQL B;  4XM4 A;  3CXC 2;  4R9L A;  3SLU A;  1FGM A;  4EV2 A;  2FXT A;  3ER7 A;  4OUQ A;  4HM7 B;  5FW5 A;  3LML A;  2ML5 A;  3BNE A;  3NHX A;  3OXA A;  5IEP A;  3KSE D;  5IEO A;  3CMA 3;  1E97 A;  3J7Y d;  1RRL A;  1SPU A;  1CQS A;  1N5H A;  5CF1 A;  4N6U A;  1V74 A;  5CK6 A;  2QGU A;  3CC4 3;  3LT8 A;  1W6Y A;  3LXU X;  2K0M A;  2RCD A;  3DXO A;  4K1U A;  2XR8 B;  1IQX A;  1VQO 3;  4FCM A;  2IA7 A;  1F8N A;  3FF0 A;  1TFO A;  1Q81 4;  4IIA A;  4MMX B;  1NU3 A;  2Z77 A;  4BTW A;  4N6V 0;  3MKI A;  4WFO A;  2OQE A;  3PGB A;  3GRD A;  3CD6 3;  1OHS A;  3HI7 A;  4JRF A;  3EB8 A;  1OF5 B;  2CFD A;  3EN8 A;  2F99 A;  1YJN 3;  2OTJ 3;  3LYG A;  1VQ8 3;  1W6C A;  3JUP A;  3BNC A;  3SXX A;  1SII A;  2XGN A;  4K1V A;  4LMI A;  1AVK A;  3G71 3;  1K28 A;  5IEN A;  1AVL A;  1W00 A;  1ZO2 A;  2GEX A;  2W6J H;  3OWS A;  2PNC A;  1PU4 A;  2OOV C;  1WMO A;  3PS8 A;  2CK3 H;  4WP5 A;  4CCV A;  1GD3 A;  3CCU 3;  1QJG A;  2Z6B A;  3K9M C;  3KFQ C;  3UL6 A;  3L0R A;  2E2T A;  4STD A;  3B7C A;  1TP6 A;  1FGR A;  1N8Q A;  1D6U A;  2CW9 A;  1JJ2 2;  1RJO A;  3F8X A;  2D42 A;  3LTB A;  1VQL 3;  3HK4 A;  4RNZ A;  1OPY A;  2O3O A;  1NDO B;  3F7X A;  5KP3 A;  3U1W A;  4ORL A;  1STF I;  3V98 A;  3CME 3;  2KRT A;  1KC8 4;  1IT8 A;  2STD A;  1O7N B;  1LOX A;  3NBB A;  2V1L A;  3UJM A;  1PFP A;  3DM8 A;  1A67 A;  3DGM A;  3DY5 A;  2FGT A;  2Z7A A;  2XRX B;  3EJV A;  4IT7 A;  1WTH A;  2C11 A;  5JBS A;  5IG5 A;  2WGQ A;  1JKG A;  4HM2 B;  1O7H B;  1EA2 A;  3FSD A;  3BLZ A;  2IUJ A;  5EQL A;  3N54 B;  3CNM A;  3GAX A;  1T5Y A;  2P05 A;  2K54 A;  5JPU A;  1TIJ A;  4IPB A;  3G6E 3;  1M1K 4;  3K63 A;  3BND A;  1NJI 4;  1R4C A;  4N6T A;  3LH4 A;  3CCR 3;  1OF5 A;  1K73 4;  1IV9 A;  1JKG B;  4TX4 A;  3U97 A;  1IU7 A;  3K7C A;  1RKY A;  4R1K A;  1EG9 B;  1U8C B;  2BMR B;  2P38 A;  3K5T A;  2KCD A;  2GU3 A;  3S29 A;  1A2V A;  3LTA A;  4LEH A;  4O3V A;  3ECF A;  3F8H A;  1VQ5 3;  3FGY A;  1UUV B;  1E3R A;  3EE1 A;  1IVX A;  1CYV A;  2JDI H;  3BNB A;  4EBG A;  7STD A;  5EVH A;  1JB5 A;  4RZM A;  3CCL 3;  2P0X A;  2OCT A;  2XSH B;  4X2O A;  1D6Z A;  2IMJ A;  4HM6 B;  4BTY A;  1SJW A;  2QA4 3;  1VQ6 3;  2QIY A;  2MF7 A;  2BMQ B;  2CG1 A;  3SED A;  3KN4 A;  2ZL8 A;  4ZM8 A;  3EQQ B;  1FGO A;  2L4V A;  3FLJ A;  2OQE C;  1IVW A;  2E2U A;  4XB5 A;  1Q86 4;  2HMO B;  3FZW A;  5LC6 A;  1M9G A;  3S5C A;  2CIU A;  4LSO A;  2W03 A;  2CHC A;  3CCE 3;  1W01 A;  1VQ9 3;  3NBJ A;  3T8N A;  4G1M B;  2CWT A;  1HU9 A;  1DYU A;  3D3L A;  2YFJ B;  2IUK A;  2XFT A;  2ZDJ A;  5AII A;  2XH9 A;  3GZY B;  3M8C A;  3S28 A;  1J2B A;  5LC7 A;  5TGN A;  1DVC A;  2WO0 A;  2XSO B;  3MSO A;  3CC2 3;  1YGE A;  2LYX A;  2YX9 A;  3NV0 B;  1E3V A;  1LVN A;  3S27 A;  3AMO A;  3D9R A;  3DGO A;  3FCS B;  3OWY A;  1BUQ A;  3N8B A;  6STD A;  2KXG A;  2CKF B;  1G96 A;  5CLK A;  1AV4 A;  2RSX A;  4R80 A;  2GU1 A;  3EX9 A;  2Y73 A;  3DGN A;  4FCJ A;  3KE7 A;  1JN5 A;  4HZ9 B;  3K0Z A;  2W56 A;  4R9K A;  4PEJ A;  2E2V A;  3S67 A;  1W6G A;  2CFK A;  1QMA A;  1GY5 A;  1IVV A;  3PYJ A;  1JRQ A;  1WMN A;  2D1W A;  5AI1 A;  3DMC A;  4U13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...