1NB3I

Crystal structure of stefin a in complex with cathepsin h: n-terminal residues of inhibitors can adapt to the active sites of endo-and exopeptidases
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cathepsin H
total genus 18
structure length 98
sequence length 98
chains with identical sequence J, K, L
ec nomenclature
pdb deposition date 2002-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1nb3I00
1GD3A 3KSED 1CYVA 1N5HA 1TIJA 2CH9A 2W9QA 3L0RA 4N6MA 1IV9A 5ELJA 2KXGA 4CCVA 5A0OB 3QRDA 4N6V0 5EQLA 5LC7A 1YVBI 3K9MC 3PS8A 1PFPA 1ROAA 3IMAB 1DVDA 3LH4A 1M9GA 1N5PA 2BO9B 2O9UX 4N6TA 1MNLA 4LZIA 1N9JA 2OCTA 1NB3I 1DVCA 1MOLA 3MWZA 4N6NB 3S67A 1KWIA 3UL5A 1NB5I 1LXEA 3KFQC 1R4CA 4IT7A 3NX0A 1CEWI 1A67A 1CYUA 4N6UA 1A90A 1EQKA 5LC6A 1FA3A 1GD4A 1RN7A 1STFI 1WNHA 3Q2PA 4ZM8A 3GAXA 3SVAA 1G96A 4TX4A 5ELUA 3UL6A 1FUWA 4N6LA 4EYCA 2W9PA 3PXMA 3PYJA 4N6OB 1IV7A
chains in the Genus database with same CATH superfamily
1NJI4 1BNJA 3KSED 3KZTA 4XM4A 2W9QA 4N6MA 1BRHA 1LRAA 1W4NA 3GSPA 3LZAA 1UUVB 2KCDA 2XRXB 1W6YA 1YJN3 1RGEA 4HM5B 1LOXA 1Q864 2CHCA 1GSPA 1W2B2 1M9GA 1KD14 1NWWA 4BU4A 1HZ1A 1IT7A 1JBTA 1AQZA 2BMOB 3AGOA 2OWPA 1N9EA 1RHLA 1W01A 2H0HA 3NX0A 4L7KA 1DMMA 1K41A 2CFDA 1MGWA 2K54A 1FA3A 2GSPA 2CKFB 2D42A 3I0YA 1O7PB 1MWTA 2E2VA 3DUKA 3E99A 4CPKA 1YJ93 1IVUA 2BMRB 3AMOA 1VQ93 1NNVA 1R4YA 1OH0A 3F7SA 3FLJA 3K0ZA 4HM6B 3WR2A 1YIT3 1LQGC 4O8SA 2W56B 1BSCA 1E97A 1T2IA 2F99A 3JUOA 1DMQA 1JB2A 1U5OA 1TFKA 2HMLB 1I0XA 2W6JH 2QEX3 1YNVX 3NBRA 3G16A 5IG0A 4ORLA 1ZX2A 1JKGA 5IEOA 3PZWA 1JZOA 4O02B 1EA2A 1RNTA 1RCLA 1IYYA 4HYZA 2XFTA 4EC6A 2XSOB 2CWVA 2HMMB 3DH2A 3F14A 1VQQA 1K9M4 1FW7A 2PNCA 1A67A 1RSNA 2Z6BA 1B2UA 3CCQ3 5IG4A 2RNTA 2YFJB 4FR9A 3GWRA 3Q2PA 4LYLB 1BANA 1J2BA 1UCJA 3I553 2F5WA 1VQM3 3PXMA 2MF7A 3EC9A 3FKAA 3JUQA 1O7MB 1IV7A 3B7CA 4CJNA 3H51A 3X42A 1RDSA 2PZVA 4MJDA 3F40A 4KT3B 3X41A 2R4IA 4XDWA 1N8QA 4G1MB 3KIIA 1JV2B 7RNTA 1ZS7A 2E2TA 1RTUA 1CH0A 3O8YA 5JBSA 5DREA 4HM0B 4J5KA 4EV2A 4R80A 5LC6A 1VQ83 4DKIA 1BRKA 1LOWA 2J8XB 3UNLA 2WOFA 2BHMA 3GZRA 1K734 4AKYA 1VQ73 5CF2A 3JUPA 3S27A 5IENA 1RGLA 3FZWA 2Y73A 3B4OA 1KSIA 3DGMA 3Q90A 1FGTA 3MYTA 4KFFA 5G1KA 2OOVA 4CCVA 4LMIA 3IPTA 4N3VA 3PS8A 5AIHA 1ROAA 1T3BA 4FMBA 1TFOA 3FH1A 2IUJA 3T0UA 3FG1A 3T8UA 3CU3A 3CPOA 5HGRA 1ISKA 2SBLA 3UL5A 1VQP3 1NB5I 2RFRA 3ZG0A 1CEWI 4J9AA 1SARA 1CYUA 1IVVA 1OHSA 1Q40B 2HMOB 2LQVA 2F56A 3UL6A 3HZPA 1K28A 1VQL3 1AVLA 1X1WA 2CFLA 3CXC2 1UW1A 2CX0A 1RGKA 2K3DA 3RGRA 3BB9A 5ELJA 1CYVA 2CC3A 4EV5A 2F5MA 5KP3A 4QWTA 1UGHI 3K7CA 1RCKA 3J7Yd 1JB4A 4HKVB 3SX1A 1UI8A 3I563 4R9LA 1AV4A 1RGAA 5BIRA 3MSOA 1DETA 1UGIA 1IVWA 4RNZA 2W03A 3M8CA 3WOEB 1YGWA 4HM3B 1Q9EA 1LVNA 1Z1SA 1B3SA 1GMPA 3KKGA 3N54B 5JPUA 3KCHA 1N8R4 1FGOA 3MPHA 4LSOA 1BNGA 4XB5A 1FGRA 2GEYA 2L4VA 1BSEA 1YHQ3 4MMYB 1PY3A 4ILFA 4BIRA 4HM1B 2RSXA 2QGUA 3AGNA 5DRVA 1E3VA 2LYXA 2F86B 2BIRA 3RGAA 1A2PA 1ZGXA 1WTHA 1GD3A 3BLZA 2CH9A 1SIHA 1TUHA 3CCV3 3DZLA 1BGSA 4OK0A 1W02A 5EQLA 1RN4A 1C54A 4MMXB 4OUQA 4KFEA 4PEJA 4HM8B 4WHAA 8RNTA 5AIFA 3U97A 1W00A 1QAKA 2P38A 2XR8B 1RGFA 3NBBA 1B2XA 2STDA 3EBYA 2P0MA 3WDGB 1O7WB 1TTOA 1Y4KA 2UUGC 3BNDA 1FYSA 5BXQA 1EEJA 3G6E3 4GSPA 3GAXA 1ASKA 4IPBA 3OW22 6RNTA 1HKXA 5STDA 4HJLB 1WMPA 1GS3A 1UUWB 4MMZB 1RGHA 4RNTA 4U13A 3QRDA 4NHFA 3S5CA 2B24B 2O9UX 4BTXA 1MNLA 1F8NA 3MG1A 4HM7B 2IY2A 1QMAA 2GXFA 3S28A 4N6NB 2CWTA 4CDLA 1IT8A 2CK3H 1NDOB 3KE7A 1BRIA 3WA2X 2IMJA 3Q1CA 5KP1A 3HIGA 3NM7A 1A90A 5AYSC 3EJVA 3WHOA 1BIRA 4GL6A 1RRLA 3EF8A 1RN7A 3X3YA 2CWUA 1IU7A 1AY7A 1MWUA 3F8XA 1GYBA 1HU9A 3FF0A 2P09A 4X2HA 3SOAA 1YGEA 1M904 3PYJA 3DGYA 5IW9A 3D3LA 1US1A 3DMCA 3WOFB 3LTCA 1N5HA 1UCKA 1FGMA 3RDEA 2CX1A 3D79A 1QVG2 3GZBA 3AMOB 4HM4B 1KQS2 1SIIA 4H61A 3CCM3 2H0GA 2C4BA 3DXOA 2XFSA 3SOYA 1KC84 2IYJA 4WYKB 4STDA 2OCTA 2I9WA 1JNQA 1I3IA 1MOLA 5M1AA 3ER7A 1RLSA 3DGLA 3OWYA 1JBSA 4IT7A 1AVKA 1TU5A 1D6YA 1FUTA 1M1K4 5AI1A 1A2KA 1I0VA 1FZUA 1STFI 2YFLB 3D4AA 3FCSB 1NU3A 4R9KA 3SVAA 4WP5A 3DM8A 1DMNA 2JQ5A 3ECFA 3OX9A 2GEXA 3GZYB 1JZDA 5FGOA 2FNQA 5BVBA 4H3UA 1B27A 2YFIB 3NBJA 4XBXA 5CK6A 4J5GA 3WA3A 2HMKB 4XBTA 3RNTA 3G4S3 1BRNL 2ZDJA 1BRGA 4RBNA 3LH4A 3DY5A 1MWSA 4BTYA 2F98A 3U1WA 4K1UA 3N9HA 2XH9A 2IUKA 3CCR3 1RGCA 1NB3I 1KWIA 2GBXB 1D6ZA 3CC73 3VF1A 4K1VA 2CG0A 4N6UA 3ZFZA 1BUQA 2XGNA 3ROBA 1C7HA 4WFOA 1GOVA 3CNMA 2WGQA 3LT9A 5AIGA 1G96A 1FUWA 1QVF2 1EKMA 3AHSA 3D5GA 4EYCA 5G1LA 4HOHA 4EXRA 5M19A 3CCL3 1B2MA 2HMNB 1D6UA 5GSPA 1B2ZA 4NREA 1IV9A 1ZO2A 2KXGA 3LTAA 4N6V0 1VQO3 3MHEA 1BUJA 1W2ZA 1GY6A 1OACA 1BAOA 3VGNA 2V1LA 1OUNA 2RBIA 2RGQA 3HIIA 1HYFA 2CFWA 4FMAA 1VQ63 2QA43 3NM2A 3MWZA 1FGQA 2BT3A 4KVHA 3CNXA 3TDGA 5I97A 3KN4A 3PCRA 1BSDA 3B8LA 4X2OA 1I2GA 3NV0A 2XGLA 4WYKA 1BRJA 1Q824 1L5GB 3V98A 1UCLA 1Q7Y4 3EX9A 1OGZA 4RNYA 4Q53A 4BTWA 1B20A 5IERA 2O3OA 1IK3A 1I2FA 3D9RA 1IQ8A 3L0RA 1G0TA 3LYGA 1VQ43 3CD63 5LC7A 2RCDA 1V58A 5IEPA 4BL3A 5EVHA 2KF6A 1LNHA 3G8ZA 1TJDA 2YX9A 4BL2A 3D5IA 1O7HB 5AYRB 5IF6A 3LT8A 1JN5A 1N9JA 3NXJA 2L1SA 2Z76A 1LXEA 3KFQC 5M18A 1RJOA 2AAEA 1BVIA 2FGTA 1OCVA 1VQK3 3DGOA 3KSPA 2OQEA 3JVCA 3GZXB 2B1XB 5ELUA 2P05A 1BRSA 3NQZA 4FCJA 1W6GA 1WMNA 3PCSA 1I3FA 3QK9A 3CC43 1YVSA 3AHWA 3X3XA 1GY7A 2C11A 1JRQA 1BNSA 1W6CA 5AIIA 1TRPA 3FG3A 3F8HA 3B4PA 3EQQB 1BNFA 2ML6A 1U8CB 1PFPA 3IMAB 3NV0B 1K8A4 4HAAA 1BNEA 1LOVA 2W56A 1MWRA 4WWUC 2HOHA 1I8VA 2UGIA 4IIAA 1GOYA 3NHXA 1DYUA 1UI7A 1ULIB 4LZIA 1GOUA 2OTL3 1I70A 2H0IA 3BNBA 1LQMB 4GHOA 2BNGA 3NUVA 3OXAA 4LGQA 1Q42A 2INXA 4XBYA 1V57A 1CQSA 4HBRA 2UX0A 1AR0A 3OV4A 3WMDA 3Q3FA 1WNHA 1SPUA 3GRDA 4XDVA 2R41A 5D83A 4ZM8A 1IVXA 3JUMA 1QJGA 2CG1A 3HX8A 1VQ53 2W9PA 2GBWB 4N6OB 3S29A 3S67A 1TIJA 2JDIH 2ML5A 3F9SA 3WODG 5JPPA 3LTDA 5D81A 1LOYA 2A15A 2WGOA 1RRHA 2D1WA 1X1UA 2XF3A 1B2SA 1NO3A 3K9MC 1WMOA 1RKYA 1DE3A 2QIYA 2CIUA 1QAFA 3VSYA 4K90B 1PU4A 1Q7HA 6GSPA 3CPW2 1M1XB 3G713 3BNCA 7GSPA 2CFKA 1E3RA 5CXOA 4O2HA 1X1XA 1OHPA 5CLKA 3BNEA 3JUNA 3V92A 7STDA 4I5QA 2BMQB 2Q07A 5CF1A 2ZHXB 2OOVC 3NQYA 1JN5B 2ZL8A 1UUGB 3MKIA 1LNIA 5BU4A 1T5YA 2XSHB 1GY5A 1OGXA 5KP4A 2CFGA 1Q814 1IQXA 4J8TA 1S5AA 3LMLA 1OF5B 2HMJB 5A0OB 1A2VA 1BOXA 1EG9B 2IA7A 1IDPA 2OQEC 3HOHA 4KFDA 4LEHA 5IG5A 4R1KA 1W5ZA 1JJ22 3X3ZA 1VQN3 3CMA3 4N6TA 1X1YA 4KZ1A 1Q40A 2Y74A 3EHCA 2KF4A 3EBTA 3H3HA 4FCZA 4L8PA 4HM2B 1RGGA 1RMSA 3CCJ3 1S723 3EN1B 4JF8A 4HVNA 1YIJ3 4AEQA 3G0KA 1FUSA 1B21A 4FCMA 1UCIA 4R4KA 1GD4A 2WOHA 1ROVA 2CW9A 3SEDA 4FMCA 3A5EA 1BSBA 2Z7AA 3STDA 2ZA4A 4N6LA 3K63A 4MEIA 1EUIC 3FGYA 2XEPA 3MG3A 4EBGA 2GU3A 3HK4A 2M7OA 1O7NB 1OHOA 4L8OA 2W0QA 1JBRA 2F4YA 1JB5A 4K61A 2OTJ3 1BU4A 3FSDA 4NPBA 3CME3 3CCS3 1RNBA 3EB8A 2BO9B 2E2UA 4FMDA 2KAAA 2BU4A 2C10A 3FF2A 1DVCA 4RZMA 3ALAA 3CCU3 1BNIA 3UJMA 1R4CA 3CCE3 2KRTA 3EE1A 1UDII 4AKZA 1EQKA 1W7CA 1TRQA 4EW5A 3BU4A 2WO0A 8CHOA 1T2HA 2KF3A 5HOHA 3T8NA 1IQYA 3IJEB 5FW5A 5AEWB 1ULJB 4JRFA 2MC8A 3SYUA 5IG3A 1OPYA 2Z77A 4HZ9B 1YJW3 3FG4A 2FXTA 1MGRA 2SARA 1O7GB 1RN1A 5TGNA 3UB1A 1YI23 4O3VA 5EEOA 1G02A 9RNTA 3K5TA 5D82A 1VZZA 3URPA 5AEUB 1YVBI 3OWSA 3SXXA 2P0XA 4OVMA 3PGBA 3CC23 1DVDA 2AADA 1N5PA 3DGNA 4GB5A 1QALA 2W04A 3OWUA 1STDA 1GMQA 1OF5A 1SJWA 1WQLB 3LTBA 3LXUX 3EN8A 3N8BA 2K0MA 5G2GA 4HZBB 2KF5A 3SLUA 3V99A 3X40A 6STDA 3F7XA 3A76A 1TP6A 1I2EA 1V74A 1JKGB 2GU1A 5RNTA 1BNRA 3BIRA 1SQWA 1GMRA 4TX4A 1PYLA 4I4KA 3ZG5A 2W2CA 3MG2A 3HI7A 3LOYA 1BSAA
chains in the Genus database with same CATH topology
1NJI4 3KSED 3KZTA 4XM4A 2W9QA 4N6MA 1W4NA 3LZAA 1UUVB 2KCDA 2XRXB 1W6YA 1YJN3 4HM5B 1LOXA 1Q864 2CHCA 1W2B2 1KD14 1M9GA 1NWWA 1IT7A 2BMOB 2OWPA 1N9EA 1W01A 3NX0A 4L7KA 1DMMA 1K41A 2CFDA 2K54A 1FA3A 2CKFB 2D42A 3I0YA 1O7PB 3DUKA 2E2VA 1YJ93 3E99A 1IVUA 2BMRB 3AMOA 1VQ93 1OH0A 3F7SA 3FLJA 3K0ZA 4HM6B 1YIT3 4O8SA 2W56B 1E97A 3JUOA 2F99A 1DMQA 1JB2A 1U5OA 1TFKA 2HMLB 2W6JH 2QEX3 3NBRA 3G16A 5IG0A 4ORLA 1ZX2A 1JKGA 5IEOA 3PZWA 4O02B 1EA2A 4HYZA 2XFTA 4EC6A 2XSOB 2CWVA 2HMMB 3F14A 1K9M4 2PNCA 1A67A 2Z6BA 3CCQ3 5IG4A 2YFJB 4FR9A 3GWRA 3Q2PA 1J2BA 3I553 1VQM3 3PXMA 2MF7A 3EC9A 3FKAA 3JUQA 1O7MB 1IV7A 3B7CA 3H51A 3X42A 2PZVA 4MJDA 3F40A 3X41A 2R4IA 4XDWA 1N8QA 4G1MB 3KIIA 1JV2B 2E2TA 3O8YA 5JBSA 5DREA 4HM0B 4EV2A 4R80A 5LC6A 1VQ83 3UNLA 2WOFA 2BHMA 3GZRA 1K734 4AKYA 1VQ73 5CF2A 3JUPA 3S27A 5IENA 3FZWA 2Y73A 3B4OA 1KSIA 3DGMA 3Q90A 1FGTA 3MYTA 4KFFA 2OOVA 4CCVA 4LMIA 3IPTA 4N3VA 3PS8A 5AIHA 1ROAA 4FMBA 2IUJA 1TFOA 3FH1A 3T0UA 3FG1A 3T8UA 3CU3A 3CPOA 5HGRA 1ISKA 2SBLA 3UL5A 1VQP3 1NB5I 2RFRA 1CEWI 4J9AA 1CYUA 1IVVA 1OHSA 1Q40B 2HMOB 2LQVA 3UL6A 3HZPA 1K28A 1VQL3 1AVLA 2CFLA 3CXC2 1UW1A 3RGRA 3BB9A 5ELJA 1CYVA 2CC3A 4EV5A 5KP3A 4QWTA 3K7CA 3J7Yd 1JB4A 4HKVB 3SX1A 1UI8A 3I563 4R9LA 1AV4A 3MSOA 4RNZA 1IVWA 3WOEB 2W03A 4HM3B 1LVNA 1Z1SA 3N54B 3KKGA 5JPUA 1N8R4 1FGOA 3MPHA 4LSOA 4XB5A 1FGRA 2GEYA 2L4VA 1YHQ3 4MMYB 4HM1B 2RSXA 2QGUA 5DRVA 1E3VA 2LYXA 2F86B 3RGAA 1WTHA 1GD3A 3BLZA 2CH9A 1SIHA 1TUHA 3CCV3 3DZLA 4OK0A 1W02A 5EQLA 4MMXB 4OUQA 4KFEA 4PEJA 4HM8B 4WHAA 5AIFA 3U97A 1W00A 1QAKA 2P38A 2XR8B 3NBBA 2STDA 3EBYA 2P0MA 3WDGB 1O7WB 1Y4KA 3BNDA 5BXQA 3G6E3 3GAXA 1ASKA 4IPBA 3OW22 1HKXA 5STDA 4HJLB 1WMPA 1GS3A 1UUWB 4MMZB 4U13A 3QRDA 4NHFA 3S5CA 2B24B 2O9UX 4BTXA 1MNLA 1F8NA 3MG1A 4HM7B 1QMAA 2GXFA 3S28A 4N6NB 2CWTA 4CDLA 1IT8A 2CK3H 1NDOB 3KE7A 3WA2X 2IMJA 3Q1CA 5KP1A 3HIGA 3NM7A 1A90A 5AYSC 3EJVA 4GL6A 1RRLA 3EF8A 1RN7A 3X3YA 2CWUA 1IU7A 3F8XA 1GYBA 1HU9A 3FF0A 2P09A 4X2HA 3SOAA 1YGEA 1M904 3PYJA 5IW9A 3DMCA 1US1A 3D3LA 3WOFB 3LTCA 1N5HA 3RDEA 1FGMA 1QVG2 3GZBA 3AMOB 4HM4B 1KQS2 1SIIA 4H61A 3CCM3 3DXOA 2XFSA 3SOYA 1KC84 4STDA 2OCTA 2I9WA 1JNQA 1MOLA 3ER7A 3DGLA 3OWYA 4IT7A 1AVKA 1TU5A 1D6YA 1M1K4 5AI1A 1A2KA 1STFI 3FCSB 2YFLB 1NU3A 4R9KA 3SVAA 4WP5A 3DM8A 1DMNA 2JQ5A 3ECFA 3OX9A 2GEXA 3GZYB 5FGOA 2FNQA 5BVBA 4H3UA 2YFIB 3NBJA 5CK6A 4XBXA 3WA3A 2HMKB 4XBTA 3G4S3 2ZDJA 4RBNA 3LH4A 3DY5A 4BTYA 2F98A 3U1WA 4K1UA 3N9HA 2XH9A 2IUKA 3CCR3 1NB3I 1KWIA 2GBXB 1D6ZA 3CC73 3VF1A 4K1VA 2CG0A 4N6UA 1BUQA 2XGNA 3ROBA 1C7HA 4WFOA 3CNMA 2WGQA 3LT9A 5AIGA 1G96A 1FUWA 1QVF2 1EKMA 4EYCA 4EXRA 3CCL3 2HMNB 1D6UA 4NREA 1IV9A 1ZO2A 2KXGA 3LTAA 4N6V0 1VQO3 3MHEA 1W2ZA 1GY6A 1OACA 3VGNA 2V1LA 1OUNA 2RGQA 3HIIA 2CFWA 4FMAA 1VQ63 2QA43 3NM2A 3MWZA 1FGQA 2BT3A 4KVHA 3CNXA 3TDGA 5I97A 3KN4A 3PCRA 3B8LA 4X2OA 3NV0A 2XGLA 4WYKA 1Q824 1L5GB 3V98A 1Q7Y4 3EX9A 1OGZA 4RNYA 4Q53A 4BTWA 5IERA 2O3OA 1IK3A 3D9RA 1IQ8A 3L0RA 3LYGA 1VQ43 3CD63 5LC7A 2RCDA 5IEPA 5EVHA 1LNHA 3G8ZA 2YX9A 1O7HB 5AYRB 5IF6A 3LT8A 1JN5A 1N9JA 3NXJA 2Z76A 1LXEA 3KFQC 1RJOA 2FGTA 1OCVA 1VQK3 3DGOA 3KSPA 2OQEA 3JVCA 3GZXB 2B1XB 5ELUA 2P05A 3NQZA 4FCJA 1W6GA 1WMNA 3PCSA 3QK9A 3CC43 3X3XA 1GY7A 2C11A 1JRQA 1W6CA 5AIIA 3FG3A 3F8HA 3B4PA 3EQQB 2ML6A 1U8CB 1PFPA 3IMAB 3NV0B 1K8A4 4WYKB 2W56A 4WWUC 4IIAA 3NHXA 4LZIA 1DYUA 1UI7A 1ULIB 2OTL3 3BNBA 2BNGA 3NUVA 3OXAA 4LGQA 1Q42A 2INXA 4XBYA 1CQSA 4HBRA 2UX0A 1AR0A 3OV4A 3WMDA 1SPUA 1WNHA 3GRDA 4XDVA 4ZM8A 5D83A 1IVXA 3JUMA 1QJGA 2CG1A 3HX8A 1VQ53 2W9PA 2GBWB 4N6OB 3S29A 3S67A 1TIJA 2JDIH 2ML5A 3F9SA 3WODG 5JPPA 3LTDA 5D81A 2WGOA 2A15A 1RRHA 2D1WA 2XF3A 1NO3A 3K9MC 1WMOA 1RKYA 2QIYA 2CIUA 1QAFA 3VSYA 4K90B 1PU4A 3CPW2 1M1XB 3G713 3BNCA 2CFKA 1E3RA 5CXOA 4O2HA 1OHPA 5CLKA 3BNEA 3JUNA 3V92A 7STDA 2BMQB 2Q07A 5CF1A 2OOVC 3NQYA 1JN5B 2ZL8A 3MKIA 1T5YA 2XSHB 1GY5A 1OGXA 5KP4A 2CFGA 1Q814 1IQXA 4J8TA 1S5AA 3LMLA 1OF5B 2HMJB 5A0OB 1A2VA 1EG9B 2IA7A 2OQEC 1IDPA 4KFDA 4LEHA 5IG5A 4R1KA 1W5ZA 1JJ22 3X3ZA 1VQN3 3CMA3 4N6TA 4KZ1A 1Q40A 2Y74A 3EHCA 3EBTA 3H3HA 4FCZA 4L8PA 4HM2B 3CCJ3 1S723 3EN1B 4JF8A 4HVNA 1YIJ3 4AEQA 3G0KA 4FCMA 4R4KA 1GD4A 2WOHA 1ROVA 2CW9A 3SEDA 4FMCA 2Z7AA 3STDA 4N6LA 3K63A 4MEIA 3FGYA 2XEPA 3MG3A 4EBGA 2GU3A 3HK4A 2M7OA 1O7NB 1OHOA 4L8OA 2W0QA 4K61A 1JB5A 2OTJ3 3FSDA 3CME3 3EB8A 2BO9B 2E2UA 4FMDA 2C10A 3FF2A 1DVCA 4RZMA 3ALAA 3CCU3 3UJMA 1R4CA 3CCE3 2KRTA 3EE1A 1EQKA 4AKZA 1W7CA 2WO0A 8CHOA 3T8NA 1IQYA 3IJEB 5FW5A 5AEWB 1ULJB 4JRFA 2MC8A 5IG3A 3CCS3 1OPYA 2Z77A 4HZ9B 1YJW3 3FG4A 2FXTA 1O7GB 3UB1A 5TGNA 1YI23 4O3VA 5EEOA 3K5TA 5D82A 1VZZA 5AEUB 1YVBI 3OWSA 3SXXA 2P0XA 4OVMA 3PGBA 3CC23 1DVDA 1N5PA 3DGNA 4GB5A 1QALA 2W04A 3OWUA 1STDA 1OF5A 1SJWA 1WQLB 3LTBA 3LXUX 3EN8A 3N8BA 2K0MA 5G2GA 4HZBB 3SLUA 3V99A 3X40A 6STDA 3F7XA 3A76A 1TP6A 2GU1A 1V74A 1JKGB 1SQWA 4TX4A 4I4KA 2W2CA 3MG2A 3HI7A 3LOYA 3M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  3KSE D;  1CYV A;  1N5H A;  1TIJ A;  2CH9 A;  2W9Q A;  3L0R A;  4N6M A;  1IV9 A;  5ELJ A;  2KXG A;  4CCV A;  5A0O B;  3QRD A;  4N6V 0;  5EQL A;  5LC7 A;  1YVB I;  3K9M C;  3PS8 A;  1PFP A;  1ROA A;  3IMA B;  1DVD A;  3LH4 A;  1M9G A;  1N5P A;  2BO9 B;  2O9U X;  4N6T A;  1MNL A;  4LZI A;  1N9J A;  2OCT A;  1NB3 I;  1DVC A;  1MOL A;  3MWZ A;  4N6N B;  3S67 A;  1KWI A;  3UL5 A;  1NB5 I;  1LXE A;  3KFQ C;  1R4C A;  4IT7 A;  3NX0 A;  1CEW I;  1A67 A;  1CYU A;  4N6U A;  1A90 A;  1EQK A;  5LC6 A;  1FA3 A;  1GD4 A;  1RN7 A;  1STF I;  1WNH A;  3Q2P A;  4ZM8 A;  3GAX A;  3SVA A;  1G96 A;  4TX4 A;  5ELU A;  3UL6 A;  1FUW A;  4N6L A;  4EYC A;  2W9P A;  3PXM A;  3PYJ A;  4N6O B;  1IV7 A; 
#chains in the Genus database with same CATH topology
 1NJI 4;  1BNJ A;  3KSE D;  3KZT A;  4XM4 A;  2W9Q A;  4N6M A;  1BRH A;  1LRA A;  1W4N A;  3GSP A;  3LZA A;  1UUV B;  2KCD A;  2XRX B;  1W6Y A;  1YJN 3;  1RGE A;  4HM5 B;  1LOX A;  1Q86 4;  2CHC A;  1GSP A;  1W2B 2;  1M9G A;  1KD1 4;  1NWW A;  4BU4 A;  1HZ1 A;  1IT7 A;  1JBT A;  1AQZ A;  2BMO B;  3AGO A;  2OWP A;  1N9E A;  1RHL A;  1W01 A;  2H0H A;  3NX0 A;  4L7K A;  1DMM A;  1K41 A;  2CFD A;  1MGW A;  2K54 A;  1FA3 A;  2GSP A;  2CKF B;  2D42 A;  3I0Y A;  1O7P B;  1MWT A;  2E2V A;  3DUK A;  3E99 A;  4CPK A;  1YJ9 3;  1IVU A;  2BMR B;  3AMO A;  1VQ9 3;  1NNV A;  1R4Y A;  1OH0 A;  3F7S A;  3FLJ A;  3K0Z A;  4HM6 B;  3WR2 A;  1YIT 3;  1LQG C;  4O8S A;  2W56 B;  1BSC A;  1E97 A;  1T2I A;  2F99 A;  3JUO A;  1DMQ A;  1JB2 A;  1U5O A;  1TFK A;  2HML B;  1I0X A;  2W6J H;  2QEX 3;  1YNV X;  3NBR A;  3G16 A;  5IG0 A;  4ORL A;  1ZX2 A;  1JKG A;  5IEO A;  3PZW A;  1JZO A;  4O02 B;  1EA2 A;  1RNT A;  1RCL A;  1IYY A;  4HYZ A;  2XFT A;  4EC6 A;  2XSO B;  2CWV A;  2HMM B;  3DH2 A;  3F14 A;  1VQQ A;  1K9M 4;  1FW7 A;  2PNC A;  1A67 A;  1RSN A;  2Z6B A;  1B2U A;  3CCQ 3;  5IG4 A;  2RNT A;  2YFJ B;  4FR9 A;  3GWR A;  3Q2P A;  4LYL B;  1BAN A;  1J2B A;  1UCJ A;  3I55 3;  2F5W A;  1VQM 3;  3PXM A;  2MF7 A;  3EC9 A;  3FKA A;  3JUQ A;  1O7M B;  1IV7 A;  3B7C A;  4CJN A;  3H51 A;  3X42 A;  1RDS A;  2PZV A;  4MJD A;  3F40 A;  4KT3 B;  3X41 A;  2R4I A;  4XDW A;  1N8Q A;  4G1M B;  3KII A;  1JV2 B;  7RNT A;  1ZS7 A;  2E2T A;  1RTU A;  1CH0 A;  3O8Y A;  5JBS A;  5DRE A;  4HM0 B;  4J5K A;  4EV2 A;  4R80 A;  5LC6 A;  1VQ8 3;  4DKI A;  1BRK A;  1LOW A;  2J8X B;  3UNL A;  2WOF A;  2BHM A;  3GZR A;  1K73 4;  4AKY A;  1VQ7 3;  5CF2 A;  3JUP A;  3S27 A;  5IEN A;  1RGL A;  3FZW A;  2Y73 A;  3B4O A;  1KSI A;  3DGM A;  3Q90 A;  1FGT A;  3MYT A;  4KFF A;  5G1K A;  2OOV A;  4CCV A;  4LMI A;  3IPT A;  4N3V A;  3PS8 A;  5AIH A;  1ROA A;  1T3B A;  4FMB A;  1TFO A;  3FH1 A;  2IUJ A;  3T0U A;  3FG1 A;  3T8U A;  3CU3 A;  3CPO A;  5HGR A;  1ISK A;  2SBL A;  3UL5 A;  1VQP 3;  1NB5 I;  2RFR A;  3ZG0 A;  1CEW I;  4J9A A;  1SAR A;  1CYU A;  1IVV A;  1OHS A;  1Q40 B;  2HMO B;  2LQV A;  2F56 A;  3UL6 A;  3HZP A;  1K28 A;  1VQL 3;  1AVL A;  1X1W A;  2CFL A;  3CXC 2;  1UW1 A;  2CX0 A;  1RGK A;  2K3D A;  3RGR A;  3BB9 A;  5ELJ A;  1CYV A;  2CC3 A;  4EV5 A;  2F5M A;  5KP3 A;  4QWT A;  1UGH I;  3K7C A;  1RCK A;  3J7Y d;  1JB4 A;  4HKV B;  3SX1 A;  1UI8 A;  3I56 3;  4R9L A;  1AV4 A;  1RGA A;  5BIR A;  3MSO A;  1DET A;  1UGI A;  1IVW A;  4RNZ A;  2W03 A;  3M8C A;  3WOE B;  1YGW A;  4HM3 B;  1Q9E A;  1LVN A;  1Z1S A;  1B3S A;  1GMP A;  3KKG A;  3N54 B;  5JPU A;  3KCH A;  1N8R 4;  1FGO A;  3MPH A;  4LSO A;  1BNG A;  4XB5 A;  1FGR A;  2GEY A;  2L4V A;  1BSE A;  1YHQ 3;  4MMY B;  1PY3 A;  4ILF A;  4BIR A;  4HM1 B;  2RSX A;  2QGU A;  3AGN A;  5DRV A;  1E3V A;  2LYX A;  2F86 B;  2BIR A;  3RGA A;  1A2P A;  1ZGX A;  1WTH A;  1GD3 A;  3BLZ A;  2CH9 A;  1SIH A;  1TUH A;  3CCV 3;  3DZL A;  1BGS A;  4OK0 A;  1W02 A;  5EQL A;  1RN4 A;  1C54 A;  4MMX B;  4OUQ A;  4KFE A;  4PEJ A;  4HM8 B;  4WHA A;  8RNT A;  5AIF A;  3U97 A;  1W00 A;  1QAK A;  2P38 A;  2XR8 B;  1RGF A;  3NBB A;  1B2X A;  2STD A;  3EBY A;  2P0M A;  3WDG B;  1O7W B;  1TTO A;  1Y4K A;  2UUG C;  3BND A;  1FYS A;  5BXQ A;  1EEJ A;  3G6E 3;  4GSP A;  3GAX A;  1ASK A;  4IPB A;  3OW2 2;  6RNT A;  1HKX A;  5STD A;  4HJL B;  1WMP A;  1GS3 A;  1UUW B;  4MMZ B;  1RGH A;  4RNT A;  4U13 A;  3QRD A;  4NHF A;  3S5C A;  2B24 B;  2O9U X;  4BTX A;  1MNL A;  1F8N A;  3MG1 A;  4HM7 B;  2IY2 A;  1QMA A;  2GXF A;  3S28 A;  4N6N B;  2CWT A;  4CDL A;  1IT8 A;  2CK3 H;  1NDO B;  3KE7 A;  1BRI A;  3WA2 X;  2IMJ A;  3Q1C A;  5KP1 A;  3HIG A;  3NM7 A;  1A90 A;  5AYS C;  3EJV A;  3WHO A;  1BIR A;  4GL6 A;  1RRL A;  3EF8 A;  1RN7 A;  3X3Y A;  2CWU A;  1IU7 A;  1AY7 A;  1MWU A;  3F8X A;  1GYB A;  1HU9 A;  3FF0 A;  2P09 A;  4X2H A;  3SOA A;  1YGE A;  1M90 4;  3PYJ A;  3DGY A;  5IW9 A;  3D3L A;  1US1 A;  3DMC A;  3WOF B;  3LTC A;  1N5H A;  1UCK A;  1FGM A;  3RDE A;  2CX1 A;  3D79 A;  1QVG 2;  3GZB A;  3AMO B;  4HM4 B;  1KQS 2;  1SII A;  4H61 A;  3CCM 3;  2H0G A;  2C4B A;  3DXO A;  2XFS A;  3SOY A;  1KC8 4;  2IYJ A;  4WYK B;  4STD A;  2OCT A;  2I9W A;  1JNQ A;  1I3I A;  1MOL A;  5M1A A;  3ER7 A;  1RLS A;  3DGL A;  3OWY A;  1JBS A;  4IT7 A;  1AVK A;  1TU5 A;  1D6Y A;  1FUT A;  1M1K 4;  5AI1 A;  1A2K A;  1I0V A;  1FZU A;  1STF I;  2YFL B;  3D4A A;  3FCS B;  1NU3 A;  4R9K A;  3SVA A;  4WP5 A;  3DM8 A;  1DMN A;  2JQ5 A;  3ECF A;  3OX9 A;  2GEX A;  3GZY B;  1JZD A;  5FGO A;  2FNQ A;  5BVB A;  4H3U A;  1B27 A;  2YFI B;  3NBJ A;  4XBX A;  5CK6 A;  4J5G A;  3WA3 A;  2HMK B;  4XBT A;  3RNT A;  3G4S 3;  1BRN L;  2ZDJ A;  1BRG A;  4RBN A;  3LH4 A;  3DY5 A;  1MWS A;  4BTY A;  2F98 A;  3U1W A;  4K1U A;  3N9H A;  2XH9 A;  2IUK A;  3CCR 3;  1RGC A;  1NB3 I;  1KWI A;  2GBX B;  1D6Z A;  3CC7 3;  3VF1 A;  4K1V A;  2CG0 A;  4N6U A;  3ZFZ A;  1BUQ A;  2XGN A;  3ROB A;  1C7H A;  4WFO A;  1GOV A;  3CNM A;  2WGQ A;  3LT9 A;  5AIG A;  1G96 A;  1FUW A;  1QVF 2;  1EKM A;  3AHS A;  3D5G A;  4EYC A;  5G1L A;  4HOH A;  4EXR A;  5M19 A;  3CCL 3;  1B2M A;  2HMN B;  1D6U A;  5GSP A;  1B2Z A;  4NRE A;  1IV9 A;  1ZO2 A;  2KXG A;  3LTA A;  4N6V 0;  1VQO 3;  3MHE A;  1BUJ A;  1W2Z A;  1GY6 A;  1OAC A;  1BAO A;  3VGN A;  2V1L A;  1OUN A;  2RBI A;  2RGQ A;  3HII A;  1HYF A;  2CFW A;  4FMA A;  1VQ6 3;  2QA4 3;  3NM2 A;  3MWZ A;  1FGQ A;  2BT3 A;  4KVH A;  3CNX A;  3TDG A;  5I97 A;  3KN4 A;  3PCR A;  1BSD A;  3B8L A;  4X2O A;  1I2G A;  3NV0 A;  2XGL A;  4WYK A;  1BRJ A;  1Q82 4;  1L5G B;  3V98 A;  1UCL A;  1Q7Y 4;  3EX9 A;  1OGZ A;  4RNY A;  4Q53 A;  4BTW A;  1B20 A;  5IER A;  2O3O A;  1IK3 A;  1I2F A;  3D9R A;  1IQ8 A;  3L0R A;  1G0T A;  3LYG A;  1VQ4 3;  3CD6 3;  5LC7 A;  2RCD A;  1V58 A;  5IEP A;  4BL3 A;  5EVH A;  2KF6 A;  1LNH A;  3G8Z A;  1TJD A;  2YX9 A;  4BL2 A;  3D5I A;  1O7H B;  5AYR B;  5IF6 A;  3LT8 A;  1JN5 A;  1N9J A;  3NXJ A;  2L1S A;  2Z76 A;  1LXE A;  3KFQ C;  5M18 A;  1RJO A;  2AAE A;  1BVI A;  2FGT A;  1OCV A;  1VQK 3;  3DGO A;  3KSP A;  2OQE A;  3JVC A;  3GZX B;  2B1X B;  5ELU A;  2P05 A;  1BRS A;  3NQZ A;  4FCJ A;  1W6G A;  1WMN A;  3PCS A;  1I3F A;  3QK9 A;  3CC4 3;  1YVS A;  3AHW A;  3X3X A;  1GY7 A;  2C11 A;  1JRQ A;  1BNS A;  1W6C A;  5AII A;  1TRP A;  3FG3 A;  3F8H A;  3B4P A;  3EQQ B;  1BNF A;  2ML6 A;  1U8C B;  1PFP A;  3IMA B;  3NV0 B;  1K8A 4;  4HAA A;  1BNE A;  1LOV A;  2W56 A;  1MWR A;  4WWU C;  2HOH A;  1I8V A;  2UGI A;  4IIA A;  1GOY A;  3NHX A;  1DYU A;  1UI7 A;  1ULI B;  4LZI A;  1GOU A;  2OTL 3;  1I70 A;  2H0I A;  3BNB A;  1LQM B;  4GHO A;  2BNG A;  3NUV A;  3OXA A;  4LGQ A;  1Q42 A;  2INX A;  4XBY A;  1V57 A;  1CQS A;  4HBR A;  2UX0 A;  1AR0 A;  3OV4 A;  3WMD A;  3Q3F A;  1WNH A;  1SPU A;  3GRD A;  4XDV A;  2R41 A;  5D83 A;  4ZM8 A;  1IVX A;  3JUM A;  1QJG A;  2CG1 A;  3HX8 A;  1VQ5 3;  2W9P A;  2GBW B;  4N6O B;  3S29 A;  3S67 A;  1TIJ A;  2JDI H;  2ML5 A;  3F9S A;  3WOD G;  5JPP A;  3LTD A;  5D81 A;  1LOY A;  2A15 A;  2WGO A;  1RRH A;  2D1W A;  1X1U A;  2XF3 A;  1B2S A;  1NO3 A;  3K9M C;  1WMO A;  1RKY A;  1DE3 A;  2QIY A;  2CIU A;  1QAF A;  3VSY A;  4K90 B;  1PU4 A;  1Q7H A;  6GSP A;  3CPW 2;  1M1X B;  3G71 3;  3BNC A;  7GSP A;  2CFK A;  1E3R A;  5CXO A;  4O2H A;  1X1X A;  1OHP A;  5CLK A;  3BNE A;  3JUN A;  3V92 A;  7STD A;  4I5Q A;  2BMQ B;  2Q07 A;  5CF1 A;  2ZHX B;  2OOV C;  3NQY A;  1JN5 B;  2ZL8 A;  1UUG B;  3MKI A;  1LNI A;  5BU4 A;  1T5Y A;  2XSH B;  1GY5 A;  1OGX A;  5KP4 A;  2CFG A;  1Q81 4;  1IQX A;  4J8T A;  1S5A A;  3LML A;  1OF5 B;  2HMJ B;  5A0O B;  1A2V A;  1BOX A;  1EG9 B;  2IA7 A;  1IDP A;  2OQE C;  3HOH A;  4KFD A;  4LEH A;  5IG5 A;  4R1K A;  1W5Z A;  1JJ2 2;  3X3Z A;  1VQN 3;  3CMA 3;  4N6T A;  1X1Y A;  4KZ1 A;  1Q40 A;  2Y74 A;  3EHC A;  2KF4 A;  3EBT A;  3H3H A;  4FCZ A;  4L8P A;  4HM2 B;  1RGG A;  1RMS A;  3CCJ 3;  1S72 3;  3EN1 B;  4JF8 A;  4HVN A;  1YIJ 3;  4AEQ A;  3G0K A;  1FUS A;  1B21 A;  4FCM A;  1UCI A;  4R4K A;  1GD4 A;  2WOH A;  1ROV A;  2CW9 A;  3SED A;  4FMC A;  3A5E A;  1BSB A;  2Z7A A;  3STD A;  2ZA4 A;  4N6L A;  3K63 A;  4MEI A;  1EUI C;  3FGY A;  2XEP A;  3MG3 A;  4EBG A;  2GU3 A;  3HK4 A;  2M7O A;  1O7N B;  1OHO A;  4L8O A;  2W0Q A;  1JBR A;  2F4Y A;  1JB5 A;  4K61 A;  2OTJ 3;  1BU4 A;  3FSD A;  4NPB A;  3CME 3;  3CCS 3;  1RNB A;  3EB8 A;  2BO9 B;  2E2U A;  4FMD A;  2KAA A;  2BU4 A;  2C10 A;  3FF2 A;  1DVC A;  4RZM A;  3ALA A;  3CCU 3;  1BNI A;  3UJM A;  1R4C A;  3CCE 3;  2KRT A;  3EE1 A;  1UDI I;  4AKZ A;  1EQK A;  1W7C A;  1TRQ A;  4EW5 A;  3BU4 A;  2WO0 A;  8CHO A;  1T2H A;  2KF3 A;  5HOH A;  3T8N A;  1IQY A;  3IJE B;  5FW5 A;  5AEW B;  1ULJ B;  4JRF A;  2MC8 A;  3SYU A;  5IG3 A;  1OPY A;  2Z77 A;  4HZ9 B;  1YJW 3;  3FG4 A;  2FXT A;  1MGR A;  2SAR A;  1O7G B;  1RN1 A;  5TGN A;  3UB1 A;  1YI2 3;  4O3V A;  5EEO A;  1G02 A;  9RNT A;  3K5T A;  5D82 A;  1VZZ A;  3URP A;  5AEU B;  1YVB I;  3OWS A;  3SXX A;  2P0X A;  4OVM A;  3PGB A;  3CC2 3;  1DVD A;  2AAD A;  1N5P A;  3DGN A;  4GB5 A;  1QAL A;  2W04 A;  3OWU A;  1STD A;  1GMQ A;  1OF5 A;  1SJW A;  1WQL B;  3LTB A;  3LXU X;  3EN8 A;  3N8B A;  2K0M A;  5G2G A;  4HZB B;  2KF5 A;  3SLU A;  3V99 A;  3X40 A;  6STD A;  3F7X A;  3A76 A;  1TP6 A;  1I2E A;  1V74 A;  1JKG B;  2GU1 A;  5RNT A;  1BNR A;  3BIR A;  1SQW A;  1GMR A;  4TX4 A;  1PYL A;  4I4K A;  3ZG5 A;  2W2C A;  3MG2 A;  3HI7 A;  3LOY A;  1BSA A; 
#chains in the Genus database with same CATH homology
 1NJI 4;  3KSE D;  3KZT A;  4XM4 A;  2W9Q A;  4N6M A;  1W4N A;  3LZA A;  1UUV B;  2KCD A;  2XRX B;  1W6Y A;  1YJN 3;  4HM5 B;  1LOX A;  1Q86 4;  2CHC A;  1W2B 2;  1KD1 4;  1M9G A;  1NWW A;  1IT7 A;  2BMO B;  2OWP A;  1N9E A;  1W01 A;  3NX0 A;  4L7K A;  1DMM A;  1K41 A;  2CFD A;  2K54 A;  1FA3 A;  2CKF B;  2D42 A;  3I0Y A;  1O7P B;  3DUK A;  2E2V A;  1YJ9 3;  3E99 A;  1IVU A;  2BMR B;  3AMO A;  1VQ9 3;  1OH0 A;  3F7S A;  3FLJ A;  3K0Z A;  4HM6 B;  1YIT 3;  4O8S A;  2W56 B;  1E97 A;  3JUO A;  2F99 A;  1DMQ A;  1JB2 A;  1U5O A;  1TFK A;  2HML B;  2W6J H;  2QEX 3;  3NBR A;  3G16 A;  5IG0 A;  4ORL A;  1ZX2 A;  1JKG A;  5IEO A;  3PZW A;  4O02 B;  1EA2 A;  4HYZ A;  2XFT A;  4EC6 A;  2XSO B;  2CWV A;  2HMM B;  3F14 A;  1K9M 4;  2PNC A;  1A67 A;  2Z6B A;  3CCQ 3;  5IG4 A;  2YFJ B;  4FR9 A;  3GWR A;  3Q2P A;  1J2B A;  3I55 3;  1VQM 3;  3PXM A;  2MF7 A;  3EC9 A;  3FKA A;  3JUQ A;  1O7M B;  1IV7 A;  3B7C A;  3H51 A;  3X42 A;  2PZV A;  4MJD A;  3F40 A;  3X41 A;  2R4I A;  4XDW A;  1N8Q A;  4G1M B;  3KII A;  1JV2 B;  2E2T A;  3O8Y A;  5JBS A;  5DRE A;  4HM0 B;  4EV2 A;  4R80 A;  5LC6 A;  1VQ8 3;  3UNL A;  2WOF A;  2BHM A;  3GZR A;  1K73 4;  4AKY A;  1VQ7 3;  5CF2 A;  3JUP A;  3S27 A;  5IEN A;  3FZW A;  2Y73 A;  3B4O A;  1KSI A;  3DGM A;  3Q90 A;  1FGT A;  3MYT A;  4KFF A;  2OOV A;  4CCV A;  4LMI A;  3IPT A;  4N3V A;  3PS8 A;  5AIH A;  1ROA A;  4FMB A;  2IUJ A;  1TFO A;  3FH1 A;  3T0U A;  3FG1 A;  3T8U A;  3CU3 A;  3CPO A;  5HGR A;  1ISK A;  2SBL A;  3UL5 A;  1VQP 3;  1NB5 I;  2RFR A;  1CEW I;  4J9A A;  1CYU A;  1IVV A;  1OHS A;  1Q40 B;  2HMO B;  2LQV A;  3UL6 A;  3HZP A;  1K28 A;  1VQL 3;  1AVL A;  2CFL A;  3CXC 2;  1UW1 A;  3RGR A;  3BB9 A;  5ELJ A;  1CYV A;  2CC3 A;  4EV5 A;  5KP3 A;  4QWT A;  3K7C A;  3J7Y d;  1JB4 A;  4HKV B;  3SX1 A;  1UI8 A;  3I56 3;  4R9L A;  1AV4 A;  3MSO A;  4RNZ A;  1IVW A;  3WOE B;  2W03 A;  4HM3 B;  1LVN A;  1Z1S A;  3N54 B;  3KKG A;  5JPU A;  1N8R 4;  1FGO A;  3MPH A;  4LSO A;  4XB5 A;  1FGR A;  2GEY A;  2L4V A;  1YHQ 3;  4MMY B;  4HM1 B;  2RSX A;  2QGU A;  5DRV A;  1E3V A;  2LYX A;  2F86 B;  3RGA A;  1WTH A;  1GD3 A;  3BLZ A;  2CH9 A;  1SIH A;  1TUH A;  3CCV 3;  3DZL A;  4OK0 A;  1W02 A;  5EQL A;  4MMX B;  4OUQ A;  4KFE A;  4PEJ A;  4HM8 B;  4WHA A;  5AIF A;  3U97 A;  1W00 A;  1QAK A;  2P38 A;  2XR8 B;  3NBB A;  2STD A;  3EBY A;  2P0M A;  3WDG B;  1O7W B;  1Y4K A;  3BND A;  5BXQ A;  3G6E 3;  3GAX A;  1ASK A;  4IPB A;  3OW2 2;  1HKX A;  5STD A;  4HJL B;  1WMP A;  1GS3 A;  1UUW B;  4MMZ B;  4U13 A;  3QRD A;  4NHF A;  3S5C A;  2B24 B;  2O9U X;  4BTX A;  1MNL A;  1F8N A;  3MG1 A;  4HM7 B;  1QMA A;  2GXF A;  3S28 A;  4N6N B;  2CWT A;  4CDL A;  1IT8 A;  2CK3 H;  1NDO B;  3KE7 A;  3WA2 X;  2IMJ A;  3Q1C A;  5KP1 A;  3HIG A;  3NM7 A;  1A90 A;  5AYS C;  3EJV A;  4GL6 A;  1RRL A;  3EF8 A;  1RN7 A;  3X3Y A;  2CWU A;  1IU7 A;  3F8X A;  1GYB A;  1HU9 A;  3FF0 A;  2P09 A;  4X2H A;  3SOA A;  1YGE A;  1M90 4;  3PYJ A;  5IW9 A;  3DMC A;  1US1 A;  3D3L A;  3WOF B;  3LTC A;  1N5H A;  3RDE A;  1FGM A;  1QVG 2;  3GZB A;  3AMO B;  4HM4 B;  1KQS 2;  1SII A;  4H61 A;  3CCM 3;  3DXO A;  2XFS A;  3SOY A;  1KC8 4;  4STD A;  2OCT A;  2I9W A;  1JNQ A;  1MOL A;  3ER7 A;  3DGL A;  3OWY A;  4IT7 A;  1AVK A;  1TU5 A;  1D6Y A;  1M1K 4;  5AI1 A;  1A2K A;  1STF I;  3FCS B;  2YFL B;  1NU3 A;  4R9K A;  3SVA A;  4WP5 A;  3DM8 A;  1DMN A;  2JQ5 A;  3ECF A;  3OX9 A;  2GEX A;  3GZY B;  5FGO A;  2FNQ A;  5BVB A;  4H3U A;  2YFI B;  3NBJ A;  5CK6 A;  4XBX A;  3WA3 A;  2HMK B;  4XBT A;  3G4S 3;  2ZDJ A;  4RBN A;  3LH4 A;  3DY5 A;  4BTY A;  2F98 A;  3U1W A;  4K1U A;  3N9H A;  2XH9 A;  2IUK A;  3CCR 3;  1NB3 I;  1KWI A;  2GBX B;  1D6Z A;  3CC7 3;  3VF1 A;  4K1V A;  2CG0 A;  4N6U A;  1BUQ A;  2XGN A;  3ROB A;  1C7H A;  4WFO A;  3CNM A;  2WGQ A;  3LT9 A;  5AIG A;  1G96 A;  1FUW A;  1QVF 2;  1EKM A;  4EYC A;  4EXR A;  3CCL 3;  2HMN B;  1D6U A;  4NRE A;  1IV9 A;  1ZO2 A;  2KXG A;  3LTA A;  4N6V 0;  1VQO 3;  3MHE A;  1W2Z A;  1GY6 A;  1OAC A;  3VGN A;  2V1L A;  1OUN A;  2RGQ A;  3HII A;  2CFW A;  4FMA A;  1VQ6 3;  2QA4 3;  3NM2 A;  3MWZ A;  1FGQ A;  2BT3 A;  4KVH A;  3CNX A;  3TDG A;  5I97 A;  3KN4 A;  3PCR A;  3B8L A;  4X2O A;  3NV0 A;  2XGL A;  4WYK A;  1Q82 4;  1L5G B;  3V98 A;  1Q7Y 4;  3EX9 A;  1OGZ A;  4RNY A;  4Q53 A;  4BTW A;  5IER A;  2O3O A;  1IK3 A;  3D9R A;  1IQ8 A;  3L0R A;  3LYG A;  1VQ4 3;  3CD6 3;  5LC7 A;  2RCD A;  5IEP A;  5EVH A;  1LNH A;  3G8Z A;  2YX9 A;  1O7H B;  5AYR B;  5IF6 A;  3LT8 A;  1JN5 A;  1N9J A;  3NXJ A;  2Z76 A;  1LXE A;  3KFQ C;  1RJO A;  2FGT A;  1OCV A;  1VQK 3;  3DGO A;  3KSP A;  2OQE A;  3JVC A;  3GZX B;  2B1X B;  5ELU A;  2P05 A;  3NQZ A;  4FCJ A;  1W6G A;  1WMN A;  3PCS A;  3QK9 A;  3CC4 3;  3X3X A;  1GY7 A;  2C11 A;  1JRQ A;  1W6C A;  5AII A;  3FG3 A;  3F8H A;  3B4P A;  3EQQ B;  2ML6 A;  1U8C B;  1PFP A;  3IMA B;  3NV0 B;  1K8A 4;  4WYK B;  2W56 A;  4WWU C;  4IIA A;  3NHX A;  4LZI A;  1DYU A;  1UI7 A;  1ULI B;  2OTL 3;  3BNB A;  2BNG A;  3NUV A;  3OXA A;  4LGQ A;  1Q42 A;  2INX A;  4XBY A;  1CQS A;  4HBR A;  2UX0 A;  1AR0 A;  3OV4 A;  3WMD A;  1SPU A;  1WNH A;  3GRD A;  4XDV A;  4ZM8 A;  5D83 A;  1IVX A;  3JUM A;  1QJG A;  2CG1 A;  3HX8 A;  1VQ5 3;  2W9P A;  2GBW B;  4N6O B;  3S29 A;  3S67 A;  1TIJ A;  2JDI H;  2ML5 A;  3F9S A;  3WOD G;  5JPP A;  3LTD A;  5D81 A;  2WGO A;  2A15 A;  1RRH A;  2D1W A;  2XF3 A;  1NO3 A;  3K9M C;  1WMO A;  1RKY A;  2QIY A;  2CIU A;  1QAF A;  3VSY A;  4K90 B;  1PU4 A;  3CPW 2;  1M1X B;  3G71 3;  3BNC A;  2CFK A;  1E3R A;  5CXO A;  4O2H A;  1OHP A;  5CLK A;  3BNE A;  3JUN A;  3V92 A;  7STD A;  2BMQ B;  2Q07 A;  5CF1 A;  2OOV C;  3NQY A;  1JN5 B;  2ZL8 A;  3MKI A;  1T5Y A;  2XSH B;  1GY5 A;  1OGX A;  5KP4 A;  2CFG A;  1Q81 4;  1IQX A;  4J8T A;  1S5A A;  3LML A;  1OF5 B;  2HMJ B;  5A0O B;  1A2V A;  1EG9 B;  2IA7 A;  2OQE C;  1IDP A;  4KFD A;  4LEH A;  5IG5 A;  4R1K A;  1W5Z A;  1JJ2 2;  3X3Z A;  1VQN 3;  3CMA 3;  4N6T A;  4KZ1 A;  1Q40 A;  2Y74 A;  3EHC A;  3EBT A;  3H3H A;  4FCZ A;  4L8P A;  4HM2 B;  3CCJ 3;  1S72 3;  3EN1 B;  4JF8 A;  4HVN A;  1YIJ 3;  4AEQ A;  3G0K A;  4FCM A;  4R4K A;  1GD4 A;  2WOH A;  1ROV A;  2CW9 A;  3SED A;  4FMC A;  2Z7A A;  3STD A;  4N6L A;  3K63 A;  4MEI A;  3FGY A;  2XEP A;  3MG3 A;  4EBG A;  2GU3 A;  3HK4 A;  2M7O A;  1O7N B;  1OHO A;  4L8O A;  2W0Q A;  4K61 A;  1JB5 A;  2OTJ 3;  3FSD A;  3CME 3;  3EB8 A;  2BO9 B;  2E2U A;  4FMD A;  2C10 A;  3FF2 A;  1DVC A;  4RZM A;  3ALA A;  3CCU 3;  3UJM A;  1R4C A;  3CCE 3;  2KRT A;  3EE1 A;  1EQK A;  4AKZ A;  1W7C A;  2WO0 A;  8CHO A;  3T8N A;  1IQY A;  3IJE B;  5FW5 A;  5AEW B;  1ULJ B;  4JRF A;  2MC8 A;  5IG3 A;  3CCS 3;  1OPY A;  2Z77 A;  4HZ9 B;  1YJW 3;  3FG4 A;  2FXT A;  1O7G B;  3UB1 A;  5TGN A;  1YI2 3;  4O3V A;  5EEO A;  3K5T A;  5D82 A;  1VZZ A;  5AEU B;  1YVB I;  3OWS A;  3SXX A;  2P0X A;  4OVM A;  3PGB A;  3CC2 3;  1DVD A;  1N5P A;  3DGN A;  4GB5 A;  1QAL A;  2W04 A;  3OWU A;  1STD A;  1OF5 A;  1SJW A;  1WQL B;  3LTB A;  3LXU X;  3EN8 A;  3N8B A;  2K0M A;  5G2G A;  4HZB B;  3SLU A;  3V99 A;  3X40 A;  6STD A;  3F7X A;  3A76 A;  1TP6 A;  2GU1 A;  1V74 A;  1JKG B;  1SQW A;  4TX4 A;  4I4K A;  2W2C A;  3MG2 A;  3HI7 A;  3LOY A;  3M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...