1NBVL

An autoantibody to single-stranded dna: comparison of the three-dimensional structures of the unliganded fab and a deoxynucleotide-fab complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2B-KAPPA BV04-01 FAB (LIGHT CHAIN)
publication title An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 48
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nbvL01
4KZEL 1CGWA 4M48L 5MEPB 3ZE1F 2FJHB 3QDMD 1V8HA 3VXPA 1I75A 1UACL 2XZAL 1RUKH 2F5BH 5HGHB 5TQ2H 3W81A 3LQZA 4QHUB 4PJDE 3KLAB 3LH2L 1EHXA 2OL3B 3K80A 5K9KA 3L7EA 4KKCD 5IJKC 3SE9L 1FZKA 3WS6C 4O58L 4POZD 3VFNB 2NW3B 4O2EB 1IZJA 2HH0L 4MA7H 1S5IH 1JFQL 1J7VR 1R3JA 2IGFH 3P2TA 3PP4L 2VZTA 3KYKH 3N0PB 5DO2D 1U8HA 4I0PC 3SDDB 3T8XB 4YC2C 3QDJE 2R4RH 1DQDH 4XB7A 4H0GA 1L0QA 2F54D 1R0AH 5ACZB 1K3IA 1U91B 3SHSA 1YY8A 4M93B 3QA3A 4X0KA 6FABL 3MRMB 4RGMC 3KYAA 4XHQA 4NT6A 2OBGA 2AEQH 4NC2B 2BVUA 4MZ2A 5HGDB 3E8UH 4XNXL 5D7SL 2G2RB 4EUPG 1XGYL 1D7FA 4MA8H 4J3WA 4LRIA 1S7WB 4KDTA 5L2KA 4NZRL 4P23D 3SY0B 3QHZL 1FSKB 4XI5C 2VIRA 4MA1C 5HXMA 1ZGLP 1HDMB 1MCSA 5E6IC 3C08H 1H0DA 4CNIB 4XNZB 5I15L 4NQXA 4XP5H 5HDOA 2ZKHH 3CH1B 4IMLA 1ZGLB 4R3SB 2MQCA 4DGYH 3BO8B 3GJFA 3V7AE 1JZ8A 5SWQB 5I8KH 5EN2A 4UNVA 1KELH 1A6VL 2V7NA 2LQRA 2ILLA 3IJYB 3LV3A 3OKDB 5EIIB 5EO9B 5F7KC 3VDCA 3NBNA 4U1MB 4ONOA 4LLDA 4QGTA 4E41A 4NZUH 4OBRA 5KAQF 1RV6X 2X4SA 2N56A 4TUOB 5D6CA 1QR1B 1MQ8A 4LPCA 5GGRA 5GJTL 4NUJA 5DQJA 2KQNA 1OW0A 3LD8C 3VGGA 4PGEB 5HYIA 1AXTL 3GBLA 2IANE 4CKVX 1EZVY 3MV9A 4PRDB 4X9GA 1Y6KR 1ZA3B 3OSKA 2AJUL 4XMPL 3KLDA 4ONHB 2VDML 1AQDB 3KPRA 4NWUH 4NM4H 4P5MA 1JGLH 3T0EB 3QUKA 1F4XL 1YJDL 5KN5A 4MSWA 3VWKD 5HYJB 2X4NB 3ZYIA 4G9DB 1RVFL 1KCRL 3MRGA 1P5VA 3CLFH 3PP3H 1OAQL 4PS4H 2H32B 1A4KA 4AG4L 5DD5H 4JFYA 4HK3J 5DRWB 4JM4L 2ZNXA 4M5YH 4QXUH 3TGXA 4BSWA 1D5MB 3JTSA 3VWJB 2BP3A 4YH6A 1NMCC 1KOAA 2DMBA 5DC0A 5E94A 3ZE2F 1NGPL 2FLRT 3BP7A 1WAAF 2Z8RA 4GFTB 1EFXA 5FYJL 1NBVL 4KUCF 3WXVH 3HI6L 3HI5H 5JMOC 1RZ8B 4QTIH 1DBKH 1KN4H 4ZO9A 2ADIB 3QCTH 5EULV 1A3QA 4PJCF 4MJIA 4PJHB 3GSUA 3GI9H 4Y5VA 3OB0H 4W68A 4KTEL 3LN4A 4OZHB 1E4JA 2F5AL 4YHNB 2EE2A 1DN0B 1C5CH 2NY4D 1RJYA 3WNMA 3X13A 4PJ9B 4HBCH 4F8QA 2E8YA 3VGAC 3BJLA 4X7EC 4YHLH 5CIPH 1A6TB 4OCXL 2CRMA 2NXZD 4P3CH 1KYOK 2NR6D 4XGZA 3RWFB 5TH2A 3IXAB 1IM9A 1Q9WB 1RIHH 3U9UA 1T03H 3ZZ1A 2VISA 1P4IL 2WW8A 5JIKA 2YKLL 4WV1C 2W0FA 3PWPE 3T1FB 3OJDA 4M6NL 2FNBA 4OLXL 3I6GA 1JHKL 2A1WL 4GO6B 5FUCE 5LXGL 2QHRL 1G9NH 4XBEL 3VGEA 1H9VA 2C1OA 4LAJH 1X7QB 1CLYL 3EUUA 3LEXA 5IGXL 1HSBA 1QSED 2VDRL 1I7RA 2R0KH 2B4CL 5F9OH 4KDVA 4XVJH 4XMKL 1XGTB 4HIEB 4NKDA 4EJ1C 5DK0B 4PBWD 4HC1L 4JFDE 4EDWH 5IB2B 5JW3H 1KLUA 3QUXD 3LS5H 4NQDE 1EVTC 2VDLH 3EYOA 1NH6A 3RAJL 1IRAY 4M1DH 4Z95H 4HGMA 4RMUA 3ZE2E 4UQ3A 4YHKL 5LGKA 1KT2A 4JFPB 1C1EL 3JV6B 3QHFH 2X1QA 3B9EA 1S78D 3O2VL 5MENE 4AENB 3AM8C 3S36L 4CMHB 1WBYB 5IJKA 1FZMB 1VERA 3WS6A 1OAUH 1I4FA 2AK4B 4WFGE 5D7LA 5F7MC 1Q0XL 3M1BB 4EVNA 5JHLL 3OJ2C 1H3PH 4XP9H 5GGUB 1W8OA 4UT9L 2WK2A 4GRLD 1KEGL 4MAYB 1VGEL 5BZDA 5HHPA 2NY5L 4IDJH 3RWGA 4UV7L 3QEQB 1PZUB 3R0MA 2ZCLH 1F8TL 3C5ZC 3MBXL 4K23H 2AKRB 4G6MH 2UY7A 5I19H 1RZGA 5GS1C 3T4AA 4TOYH 1MHEA 4HXBH 2X9YA 1II4E 4L8SB 3RY6C 5MP6L 4ODSL 2ED7A 2BX5A 5L7XL 3I6KB 4EXKA 3CDGB 5M95B 3ALXA 5E4EC 2B1HL 1F90L 1NL0L 3GBMH 1BBJA 1WC7A 3GMRA 1SJEB 3MLUH 5KS9A 2K7QA 4NQSA 4PUBL 1RY7B 5E6IA 5J6HB 5C0IB 2NY6D 4UDUA 1NC4A 1S7QA 3NN8A 4P4KB 1A9EB 2XIDA 4L9LB 5HHQB 3HN3A 1FZOA 4G7YH 3OV6A 1NCTA 4PJ5A 3G6DH 3LKRB 4NOFA 4JFZL 5D8JH 1LK2A 4FZEL 1VENA 5BS0A 3BZFB 1K8IB 5CP3A 3CVIL 1OAXL 3BH8A 1KCUL 3BP5A 3G04A 1IL1A 4CU6A 3PIQA 3UAJD 4HUUB 2ZUYA 3O4LB 1WZLA 4U3XA 1MH5B 3LRGA 2GY5A 4GS7C 2A73B 4J3UA 1LO5A 2EO9A 2OMNA 1KPRB 2GSIA 5E2JA 3BMVA 4HBQA 3TBTA 1DBJL 5INCA 4C56D 4DKDC 1KN2L 3FOLB 1RULL 1XH3B 2VRAA 4OQTL 1X5JA 2DS4A 3VRIB 2J5LC 4KV5F 1QRNE 4FG6D 4XPFH 4ZQKB 2R4SL 4Q74A 4Q7DA 1TQBB 3LKPA 4HIHA 3RWCA 1XGPA 3ZT7A 1S7UA 3NZHH 1PG7L 5HGBB 4PJIE 4WEUD 1QYGL 4XCNA 2XWTA 4F7PB 5JDJA 3EYQD 3TBYB 1IGCH 3KPQA 1PSKL 2DYPA 1NUFA 3FB7A 5I75B 4LP5A 3SOBH 3FT4B 4K71C 5DQ9B 4TRPH 4P9MH 5F6HI 4DAGL 1TENA 1ADQL 4PRBB 3NFPB 4FTVB 2YN5A 2N7BA 3MZGB 4GXUN 4QRRE 2XG5A 1JN6B 4TTDD 3T65B 4KTDH 3MCKA 4UMGA 4J3XA 4XPTL 2ZPKL 1QACA 5HDQH 2IAMD 3BWUC 5L6YL 4YO0B 4JANA 1EGJA 4UDTA 2EE9A 2FX7H 2W0PA 1I85A 4PJEA 5CP7A 3NIFE 1NKRA 4PY8I 5T5FL 2C4FT 1EEYA 2EO1A 2ICWI 5IB5B 4NM8L 4WTZG 3V7MA 5DMGD 2GT9A 1K2DB 1Y18B 3F58L 1BQHB 3ZDYE 2CK0H 1IM3A 1BEYL 3E1F1 1S9VA 3GSNB 5DWUH 5FB8B 5ICZA 2C7UB 4PJXE 3JWNC 4OGYL 4Z7VB 2R2BA 1OT1A 5E5MB 3BXNA 4NZTL 1C5BH 3WIFB 1OGTB 2W0KA 2FATL 4PJDA 3CFJB 3C9NB 5FYKE 3UTSB 4ZD3L 5LBSH 5AZ2H 3D2UA 1HHKB 1T04A 3MLXL 5T1DL 2ZJSL 2VABB 1XR9B 1J1PL 3B43A 1CDYA 5DT1H 4P57A 2P8LB 2OJEA 3GBNL 3QQ4B 4MQXC 5AZEH 3ARDA 2FECL 1OTTC 3HTLX 4BQ9A 3D18A 4WUUB 4KV5E 5EBMB 4MS8D 3QDGB 3EBAA 3WBDA 1FPTH 4K3DH 4JO1L 3UO1L 2CLVB 5IBTH 4IJ3C 5L8KB 4NNYA 4OZGF 1JZ3A 1S3KL 2VZUA 1DBMH 5DD3H 3K4DA 5IJVB 3WLBA 4BFIB 4LCCC 3KLHD 4OGZA 1QVOA 1L6ZA 3G08B 5MEOB 1OB1A 3WIIL 3UX9B 1RHHB 5D1QD 1E4KC 2ZCKL 1ZEAH 3G5VA 3CX2A 3PDGA 3MRCB 1JTPA 4FOMA 3VCLA 5C0AE 1N0LA 3MRPB 4BK4A 5CFHA 1JRHI 4RISH 2NZ9D 4Z8FL 4ZFZB 3WHE0 4DN4H 2JF1A 4HUNB 4MLIA 3G5YA 1MJ7L 4RFNC 3LKQA 1BLNA 4H0IA 4YX2L 3TV3H 4XBGB 3PWVA 2R9HC 2GJZA 1IBGH 2KUTA 3FONB 3B2UD 4M7ZC 1EV2E 5KSVB 4NN6B 4OLWH 2A6IB 2OL3L 5HGAA 5JR1L 4MJ5A 3PL6C 1NBYA 5EO1A 2IANA 4XB8A 4YGVA 3FFDB 4LLUA 3VXOB 3HE7D 3RUGE 3UTZB 3CSYA 4O02L 3FQWB 1AQKH 4ZAKB 1RK0B 1RURH 3MRJB 5GRXG 3LKSA 5B8CB 2BSRA 4Z7WF 1D5XA 3QXVA 3F7RA 1QHPA 2ADFL 4N0CD 2VLJB 4ZDHA 4CDHA 5KSBB 3KJ6H 3EO0B 1P2CA 5TQ0H 3EOAA 1DZBA 3I50L 5DHYB 4EBQL 4MNQB 2D9CA 5LQBH 5I1HL 4EN3B 4PRPB 1AE6L 3J8F7 4P2QB 5E8OB 2YMXL 2EDRA 3ABZA 5D2NC 3DGGB 2ZUSA 4ZPTA 3PWUB 4ZO7A 4IMKC 5KSUB 2X44D 4HUVB 3HCVA 3QJFA 1PW3A 2WBJB 1WSST 3EOBA 4JDTL 2HJLB 3VI4E 4JRXB 4PP2B 5CBEA 5IBLD 2V2TA 3GRWH 4PJBF 4K2UH 5TE4L 1C12A 3C5JB 5I1LB 1MFAH 4L4TB 1CU4H 3UJIL 1AGEA 4J1UA 4CAGA 3MREB 1JUFA 1K4CA 3REWA 1G7JB 2AXGB 3H9HA 3HZVA 3AY4C 2RBLA 1KLGB 2R56H 4G80B 4M61A 4PREB 4CN6A 1UZ8B 1FV1B 2XRAL 4OLUL 5HHVH 4JE4B 1QFPA 4M43H 5HHMD 4JVWA 1NKOA 4M6MH 4PB0H 1DSFL 5CWSA 1MI5B 5DVLA 4YHPB 5J89A 1NAMA 2BRRH 4FABL 3SJVE 3ELAT 5F9AC 3SGDI 3HNTH 4P5TC 32C2A 3PWPA 2CLRA 1YNKL 1RMFL 3EDKA 4WWKD 2Z91A 3DRQB 1CFVH 5DJ6B 5E2TL 4BQ8A 2CKBH 1JPTH 1J1OH 4HXAH 2UWEB 1VFUA 3EOTL 5T3XE 1NEZG 5KVEL 4Z7WE 1WEJH 3CVHB 3PGCA 3U7WL 3OR6B 4QT5B 2C1PB 4L3AA 1YMMA 3LPGA 4TSBL 1CFNA 4PG2C 1NCDH 4PG9B 4GKOA 4XX1E 2VL5A 3B8SA 5I8OL 2EYSB 4JFDA 3U0WL 1YECH 2BVQB 4NQDA 4LCWE 3FB5B 3OKMB 5ALCH 1AIFB 3MFFB 1V05A 1K4DB 1FN4A 4MXQD 4HKBB 1HHIB 3EW3B 1DQTA 3QDMB 2QJDA 3FO9B 5JIIA 3RL2B 3O8XA 1WAAA 5LKNA 3VXTA 1ACYL 4ONFL 4JDVB 4HIXH 4LAQL 4LLYA 5D2LB 5MENA 4KQ3H 5FCUL 1UXWA 3P0GB 1CFBA 3WS3B 3KNBB 4N1CA 5K9QG 2O93L 4I3GA 3KDMA 4PJCA 3TIEB 4LSPH 4N9GA 5TDPB 4YXKL 5JOEA 4EIGB 1U93A 1QSFD 3MGTA 5FKAB 4HZLA 1A21A 5HHNA 4KZDL 4C4KT 1S9YB 3TPUB 5J57B 1KJVA 2VDKH 4LLWB 5C08E 3SKJH 1DTUA 4NRYB 4N90E 1FHGA 4Y4FC 5FHAL 2B7DT 3FO1B 2F54B 4PD4K 4G8FB 1PX4A 3WO4B 4FQCH 3FQNB 3NCJH 1NC2D 1N5AA 4YNYB 1MRFH 3BZ4A 3F62A 3CCHB 3OKLA 3L95B 1A3RL 1RJCA 5D6DA 1RUPH 1AD9B 3MNVA 4P23B 1YC8A 1ZTXH 4XXDA 1R24A 1YEJH 1EO8H 4DCQA 2A83B 2ITCB 1GGUA 2EDOA 2L4OA 2DJ4A 2MKLC 4AQ1B 4BZYA 1YJDC 5TDOB 1UG9A 1U8LA 3ZO0A 1XF3A 3E2HC 1VESA 1B0RB 1HXMB 4DEPC 5E9DD 1T5WA 3WFDH 1N4XH 5DD6A 1BP3B 3VJ6A 3BIKB 1LD9A 3KR3H 3SKUD 2ARWA 6CGTA 1I3UA 2F74B 3S98A 3I2CH 2OZ4H 2EXWC 2VKWA 3HR5A 1AJ7L 1MLBA 5C08D 3TH3T 5D72H 4N90D 4XWOD 3TVMB 1DVFD 2FB4L 4NO0A 1F4YH 1ZE3C 5GRVK 3PL6A 5EU3A 2JB6A 4OCYH 4U6XB 4FP8L 5FM5M 2NY3C 2YXFA 4QOKE 2FGZA 3VW3H 1NLDL 5EBLB 1R3KA 3W39B 2BVYA 3WUWG 2PCPB 3NA4A 4H1LG 5IM7B 1JF1B 1UB6B 2UVFA 1MPAL 5E4IA 1ED3A 4Q0XH 1MCKA 2MNUA 3VWKB 1RI8A 2HMIC 5F72S 2EDHA 4QWWC 3DHMA 5AWNH 1QBBA 4JDZB 2I9LB 4ZOEA 2RFXB 4TN9A 2YPVL 3CU1A 4XMLH 1JGUL 4MDJB 5DI8A 3QCVL 3T0XA 4JPKL 4FQ2L 2X7LB 4QRRA 1LVEA 5B38A 3BGMA 2Y6SD 4LLVA 1S7RB 3D0VB 4WEBH 3MBEB 4M00A 5C0DA 4W4OC 1A4JB 4E41D 3WJLC 1LO0L 3I02A 5D96B 5C0CE 4KC3B 4K3JL 5CSZB 2AGJH 1N64L 4XPGL 3VXNA 2H3NB 2CDGA 4QRUB 5LWYL 3K74B 3VD4A 3ET9F 1YY9C 4P2RA 4QOKD 3RGVA 4HAGA 5I30L 4WCYL 4PRIE 4UU9A 4JR9H 5GGTH 2XYCA 3ARBB 2YD8A 2CLZB 4PJXA 1SYVA 3QIUC 3H9SA 3S88L 5DHVA 1AGDB 1E0OB 1UH2A 4RX4D 2NXZB 1NSNL 1X5XA 2KZWA 3PHQA 5I74B 2OR9H 4G8EB 1JGDA 3EJYC 3N1QC 4NP4H 43CAB 5JNYA 4OGAD 4XCCL 1INQB 2PTVA 5F7EH 3CSPA 5D7IF 3NH7L 5E95B 4RBPK 3ALWA 2LVEA 3AB0B 4DN3L 1EVUA 4NCDA 4HKXB 15C8L 2CUIA 5C09D 4OBSA 3VFSA 3OAYH 2GSGA 5JDSB 1M7DB 1ZLUK 5IVOA 2A77H 2PO6D 2CD0A 2MJWA 3JUZA 1IAIL 5ISZE 2DQGH 3FTGA 1XF2B 4JG0L 4X80L 1W72B 5T1KA 2UYLA 3CFIC 4MJID 3N85L 4O4YL 2ATPB 2O61A 1AGCB 4D9QD 3QDHA 1OTUC 2HLFD 4JVUA 5CD5C 4Z5RA 1IC5H 3HAEH 5D93B 4C83A 1EAPB 4PRID 4JZNA 4DVRH 2WP3O 4JRYA 5C0AA 3IFNL 4MXVF 2DBLL 3TYFB 3K2UL 4ENED 2HLAA 2HVJB 3MCLL 4HWZB 2PNDA 1HH6B 3FT2B 3FQUA 5CGTA 1XAUA 5FA4B 3TZVD 3B5GA 5E99L 4LSQL 3MXWL 3TCLB 1MHCA 3NTCH 2W91A 1FCGA 3LEVL 5C8JA 3SEPA 4G8IB 4K3EL 4PLKC 4G42B 4OAWB 3ZE0F 1I3VA 1U8NA 3CPLA 3LDBC 5BRZA 1U8IB 1BM3L 3GSNL 2NZIA 1Q9OB 4GRLB 1CLZH 4Y4FA 1WITA 1UCBL 3FFCB 4YBQC 1OAKH 1GGBL 4K7FB 3QNYB 3IU4L 2AERT 4X4XB 5I1KH 1GRWA 1I1YA 3T0BA 2EDKA 4OGXH 1R6VA 3BMWA 4KRNA 4U2YA 1BWWA 3FQTA 2IBGA 2NTFA 4XP6L 5K93A 3HFML 1IGIL 3RVTC 1UKSA 4WU7B 4XCEB 4Z77A 4OD2B 5JXAH 3QIWC 1J1XH 4R7NA 5DGQA 2Y7QB 2OCFD 2RIKA 1WFOA 2ZOLB 3WFCH 1AFVL 1N6QH 1NGQH 4Y19B 4JQXC 2DM3A 3DV6A 5A2JH 4XH2A 2EDQA 4RAVB 5EU6D 2EDTA 1IZKA 2NY6B 3PHOB 3QUMA 4V2CB 2AJXH 5DJ8B 1LO3H 2X70A 2BOCA 3K4AA 4ZTPH 5EUKB 1I9JL 4HULB 5HJ3B 5SV4A 3K7UA 1VEMA 3H2WA 5F3HB 5GIRA 1GAFL 1BQSA 4G5ZH 1I7UA 2CGRH 4LSSL 4GMSH 5DJXA 1QG3A 2XICA 4MCYB 5IK3A 5DS8B 3IAQA 2W9EH 3TF7C 1UJ3A 2EC9T 2J8UB 5AEAA 1D5IH 4XRCB 4MD0A 2VDQL 4IRSC 1X5FA 5EOTB 4LMQI 4WVRA 3BQUC 4I2XB 1ZVSA 2HAZA 4I0PD 3OHXB 1S5HB 4MXVE 3ZKNC 3CXHJ 4HQQL 3SQOH 3UJJL 3QCUH 4KHTL 1YEEH 3AREC 3MLSL 1I8LC 5E8DH 5JLZB 1JCKA 2ESVD 4G9FD 2Z31C 5DUBB 5FDWB 2AV1B 3U2SB 4XT1C 5JW4Q 3CMOL 2HT2C 1I7ZA 1Z3GL 1OP3H 3FZUC 2J6EL 4WY7H 3VRJA 1WFNA 1U92A 5IOPA 5CJOH 1H5BC 4IRZH 1CZ8L 3AS0A 3OGCA 2OTUB 5CJQL 3RVWC 4BFEA 2UUDK 5JA8B 2K3TA 3MO1B 3P0YH 4XI5D 5E2WH 3FRPG 4M62H 4HX1A 3MACL 5EOCH 1MUJA 3UTQB 2XTLA 2ZSVA 3O2WH 4X5XB 5DUPH 4JZJB 3NA9L 4U33A 2GJ6A 3SJVA 3FJTA 5TFSH 1P9MC 1XIWC 1BQLL 2HFEB 1NGYB 3K8MA 4KPHH 5FHBL 1KIPA 43C9B 3BT2L 3RWIA 4G8GA 3MOBL 2Y23A 1FJ1A 1UQSA 1XGQA 3NZ8B 1CT8A 4OZFH 4PJ5D 4XCYA 4GW5B 3JV4A 2VC2H 1JNNL 3IU3B 3ULSA 2VAAB 1GCFA 3HE6A 1LNUA 4U1JA 2IAMB 4Z7WA 4W4OA 1SY6H 1DL7L 3HUJE 4RFEB 3A6BH 5DRZB 1OF2B 3ZKQD 2G60L 1J8HE 1G9ML 3GHBL 1YN7B 1HCFX 1X5IA 1RFDH 1HHHB 1HEZB 1RUAL 3ZHLA 5GRJH 3ARXA 4YHML 4UBDC 5EOQH 1RPQA 4GKZB 4DTGH 2R0ZL 1UYWL 2L7UA 3V8OA 4PYHA 1C08B 5C0NC 1TQCC 3GK8H 1KIRA 5D7JC 4KMLB 2JJVA 4FHBD 2V17H 3QIUA 1BJMA 5JPMB 5LCVH 5HPMB 1CXKA 5TGBA 3DPBA 4MQ7B 2ZZUT 4F33B 1CGUA 2QADC 2XKSA 3U6RB 3QXDA 3CXDH 3UPRA 2QSCH 4LIQL 2DYPD 3L5WA 2XACC 3IDYB 3S5LA 5BO1H 4HK0A 4AMKL 4LHUB 3P11H 2DQUH 1CD0A 4CU8A 1ZLSH 5KVMC 2XA8H 5J13C 3MV8E 2KZ1B 2OK0H 1AHWA 1IT9L 1S7SB 4IOFC 5D9SA 4PJAF 2HTKC 3TO4A 1HE7A 2J8OA 1J8HD 2BMKB 3EYUL 3W2DL 1A1OA 4IIQA 4HWNA 4XZUB 4DUVA 3LMJL 5I1IH 5EU5B 1U58B 5D1QB 4HJJL 2AEWA 4LL9A 3HPLA 3SDCC 1AR2A 4ZFOB 3CVHL 3OR7A 3BP6A 3IFOA 1X5KA 1ZLWK 1T6VN 2BJMH 2XI9A 2MQ3A 3LZFH 1MFNA 4NHCL 1EO5A 3BVNB 3HNVL 1INEH 1FFPB 1L7IH 1N6UA 1NFIB 3QZWB 5DXWA 4XVTL 4YFLI 2X4UB 3IKCB 2YPLE 2VXVH 3GMPA 4WRLA 3F65A 1RIUH 2W60B 1P69B 3FAWA 4JFXB 4M8QB 4E42B 2V9QA 4M3KB 3QQ9C 1K6QL 3VXMB 4YHZL 2ICES 2L7JA 3H42H 3STLB 4TYUA 1ZVYA 4ELMB 1F4WL 35C8H 3MA9H 3RGHA 1NMAH 4P46C 2YK1L 3QUZD 3TT3H 2R1XB 3HE7B 3E3QC 3MFGB 4K3HA 4TQEH 4UILL 4Y1AE 1FZJB 5MERA 3VFGH 1W2KT 1B4RA 3BZEA 4Y4KA 5CZXC 3ZT5A 1MIEL 3BFOA 1KGCD 1LP9F 2ERJC 4R26L 3M8OH 3VMPA 1E28A 1MIML 2VAJA 1YDPA 2VQ1B 5DK2A 5C07A 2DRUA 2VZVA 5JW4N 3WEXA 5DSCA 3X12B 2BNRB 3CFEA 5E2UL 1QFWI 4L1HA 5JQ6L 1FO0H 4IRSA 4EZMA 5FO9B 4OFIA 1MCDA 4NSKB 3S36X 4R4NC 4KKNA 2CMRH 3EFDH 4G6JH 1J88A 2NNAB 3JV5A 3ULVF 4JLRA 4UIKL 4LASL 1FGNH 1I8LA 3GMLA 1REIA 3C5ZD 3BRDA 4YDKH 4K94L 4IHOA 4WW2F 1T83C 2AXFA 1SEQH 4QHKI 3HB3C 3DUUB 4ZPVB 2HFGH 1TPXB 5J06A 1S9XB 3MJ9L 3VA2C 3OWEA 3TBSB 5FF6A 3T4YB 1DEEA 5EU7C 3CMGA 1L9NA 2A6JA 3KPMB 4HGKC 2EH7L 5EDXA 2XTJE 3SE3C 1M7IB 2HKHL 1MCPL 2XXCB 1JYVA 3HPJA 2XY1A 5F21B 4RWHA 5H35B 2CIKA 1P9MA 5DDHA 3WE6B 1P84K 3S37L 3LPFA 4M7LL 2PR4L 1N7MH 1A1MB 1EJOL 2Y9RT 4NKMA 4WWKB 2G75A 2E6PA 3JBG7 3DBXA 4PRAA 2P5WE 1D6EB 5EH1A 1BAFL 2J88L 3OF6A 1CICD 1BZQK 5E5UB 4C57C 3QUYA 4FQLL 2P49B 1GZQA 3KHOA 1UWEH 4PR5B 5F7DA 2X1XR 4PJGE 4HPOL 3HG1A 3Q3GA 4JRWA 5FYLD 4OV6F 1F58H 3IF1A 2VZ1A 1Q72H 5HY9A 3NMEA 1GOHA 3V5DA 3PABB 2JCCB 3V0VB 4XP4L 5DMYA 4LVNC 5ERWB 1QBLL 4LQFL 4RAUA 1F00I 4MJ2A 2PKDA 1RUQL 3EDEA 3LS4H 3RU8H 4JGJA 4QO1A 2YD3A 1DDHB 5IIEA 4NO2A 1J05A 2C3HA 4R8WH 1G84A 1QSFB 4Y8DC 2HG5B 3HKFA 3X14A 3MV11 5T33H 3ISWA 1VA9A 4BH8A 2FJGA 5K9OB 4WWID 4P4RA 4M5ZH 4U3CA 1U8OA 4L5FH 1R3HA 4ODTH 3L9RB 2JB5L 3UMTA 3MODL 3O81A 4I4WB 2Z92B 4LLQA 1BFTA 3SGEH 5SWSA 1TZHB 5FV1L 3EGSB 3IAGC 1NC2B 2EZ0C 1I8MB 3MRIA 2CXKA 1KFAH 1BVKA 3THML 3V4UL 4PGBB 4YGAB 4CMHC 3Q1SL 4G7VH 1QFWM 3WD5L 1FFQA 4N0YH 2GUOA 1MAKA 1CWVA 1CLOH 3P9LB 3O4OC 4LBEA 4Y4HC 1A9BB 2DWEB 2Z93B 5CWSB 3SDCA 3L5IA 5DEZA 3LIZH 3O3AA 4Z7UF 2FSEB 5GSVB 3VXPB 4MAYC 1M1SA 3BKJL 4P2CG 4JG1H 3MRKA 1CTOA 1K8DB 4X7SL 4PB9H 4JM2F 1W72L 3LQZB 4UQ2A 5E9DB 5I2IA 5K9KB 3L7EB 4TULL 3VD7A 2WIIA 1WBZA 1FZKB 2EIEA 3QIBA 1Z5LA 3OB8A 4UTAL 2IQ9H 4FQQA 4LPUA 5TPWH 2X4TB 4PJ8A 1XT5A 2PTTA 3RJDA 1R3JB 1RUMH 3BD3A 5F89A 3HZYB 2BCKA 4MQXD 1QFWL 1MOEA 1OTTD 5DRXA 3S34L 5JHDE 5CBAA 2VITB 4UZGA 4TSCH 4I3RL 4X0KB 3QA3B 4P46A 5IW1A 1W0VA 4P4KC 4U6HB 5FUOH 4L9LC 2JJTA 4Z7NF 2LU4A 4YUEL 1ZT7A 4HS3B 1RHFA 4EUPA 1WWWX 4ZUUA 2VLRD 1LDPL 2IPUG 3V4VH 5IB3A 1M05A 2ICWA 5L2KB 5EO0B 2IMNA 5DFVC 4NQCE 2VIRB 3B9VA 4OLEA 2IALA 3MLWH 4WW1B 2F53E 4XAWH 2P1YA 4FFYL 1H0DB 3TA3C 4Y5XA 3NPSC 3RKDC 3RWHA 4N1HB 4IMLB 1UM6H 4NWTH 3K3QA 4PGCB 1JWSA 5A2IH 3K2MC 3HMWL 3L3KA 3ARQA 5EN2B 1A0QL 3UEZA 3N1PC 5E8PA 2YD7A 1FFNA 3LV3B 4RRPG 3ARGA 3RIFK 4MNHA 4S1RL 3A6CL 4C4KO 2DQJH 3RTQD 4LLDB 4E41B 5ANME 5I1CL 4Z7UE 5GGRB 4NO0D 2DQTH 3U7YH 3VGHA 2VSCA 3KAAA 3MGAA 2Q7NA 1ZT4B 4YXLL 3PL6D 3INUH 5HVFB 2IPTH 5FA3A 3BYYA 1AY1L 4FQHA 2E6QA 2QR0A 4J6RL 4NBZB 4M7KL 1YPZF 1OM3L 3O3BB 3KPRB 1ONQA 1CXFA 4P5MB 4ODXA 4F9PC 3F7YA 3QUKB 1CBVH 4WHTA 4BJLA 4CDGC 3CIQA 2DI9A 1LK3H 4ZSOE 4XVSH 4I77L 1JL8A 4KY1H 3P4OB 3SE3A 2BDNL 2OXHA 4X9BA 3ULVC 2HRPH 3IFPB 2HKFL 3RJQB 3MNZA 3AS3A 3MRGB 4ACPA 2VDNL 1U8JA 4NKIL 5LJYH 3C8KB 4FS0A 4B5EA 4Z7NE 4AT6B 1O7VA 4DFIA 1X44A 3JTSB 3VFPB 1FQ9C 4NUGH 3S8WA 4PV8A 5C09B 1PZ5A 4Y2DC 4JO2L 5HVHC 1DQQA 3MV8A 2AVGA 2DQCL 3GMNB 3G5ZB 1EFXB 2R23A 3WKNA 2M1KA 3G6JE 2ZUQB 3TO2A 5ALBH 4CVZA 4MJIB 4KJQC 5FGSA 1NAKL 3GSUB 4Y5VB 3GSVA 3P0VH 3PWLA 2VQTA 1UM5L 4FFZH 4NNPH 1O0VA 4P2RD 3GUTA 3HC4H 4P59H 4R90H 4AL8H 4NDMA 1RJYB 4FNLH 3X13B 2B2XL 1UH3A 3S35X 2YHGA 3D48R 3H9SD 4KZEH 3RFZC 4M48H 2MPAL 3OJMB 2AS5M 3QR2A 1CE6A 1D5ZB 4XGZB 3TZVB 1UACH 2XZAH 1NANI 3U9UB 3D39E 1LE9B 3LH2H 3RDTD 5CJ8A 1OT2A 1EBPA 2VISB 2IPUK 4BSVA 4Z9KB 1DUZA 4P5TD 3B9KC 3SE9H 2YPLA 5FGBC 2IADA 2W0FB 4O58H 3OJDB 1YPZE 1KENL 3EYFB 3DUSA 4I13B 5F1NA 3I6GB 3X17A 2HH0H 4L8DA 1RJLA 2YC1A 1JFQH 1TJIL 2LTQB 3PP4H 1H3WM 1FYHB 4LGRB 2C1OB 2OI9B 3LEXB 1UT9A 5I1JL 1FORL 1I7RB 4UUJA 4X6CE 1I1AA 4PBVC 4QRTA 4OCMC 3VXUA 6FABH 4LVHB 5T3ZE 3J7HA 2LE9A 4JFED 2VLME 4XNXH 4Y1AA 5D7SH 1XGYH 1KLUB 3TBWA 2MCG1 4NZRH 2HWZL 1FFOA 4DOHB 3QHZH 1WWCA 4APQC 5EU6B 2WINA 4UQ3B 2UZXB 1A6ZA 4PJAA 5I15H 1ZLVK 3U4BH 3VFTB 2A6KA 5GGQL 1FNSL 4OI9A 1I4FB 3KHQA 2AV7A 2CK2A 4EVNB 4XNQA 3UBXI 3IETA 2GTWA 1A6VH 5BRZD 4ZFOL 4F2MA 4YC2B 4Y4FD 3CFKA 1T21A 5BZDB 4LCUA 4JGMA 5DFTA 3RWGB 1NUNB 1F2XK 3T0AA 5JO5A 5GJTH 4JM2C 4QHNA 3V6FA 2I26N 4RGMB 2ESVB 2GCYA 1NMBL 1G9MC 1RZGB 3MLVL 1AXTH 1ZHLB 3DIFA 3T4AB 5HHOD 1MHEB 4Q6IC 4XMPH 2AJUH 4CN1A 1T1XA 1G7IA 2VDMH 4AH2B 2VLMD 3LKOB 3NACL 2OJZL 4YFLF 1BBJB 5LAXA 1F4XH 2C26A 1ZOXA 4MA1B 5CCKH 5LGJA 4ZFGL 5C7XL 5KS9B 1YJDH 2AAVA 5E6IB 4D0CA 1QO3B 5D5MF 3R06B 1L7TL 5E8NB 2YZ8A 4M7JL 4YPGA 1KB5A 3O41A 4UDUB 1NC4B 1UXSB 3HLAB 1RVFH 1KCRH 1R5WB 1BBDL 1BJ1J 1FZOB 4P3DA 1OAQH 4AG4H 1N59A 1U3JA 4PJ5B 4P9HC 1LK2B 2D03L 4JM4H 5J9PA 5BS0B 1Z0NA 4GRMA 4X4ZA 3MLRL 2EXWD 5JIHA 4DJMA 3QO1B 3BP5B 3G04B 4KRPB 3PIQB 3QBTB 1NGPH 3X3GL 1LP9A 2DMCA 3L3HA 4KK6C 1G0XA 1NFDE 5FYJH 1NBVH 3LD8B 3HI6H 3NCMA 3IXTA 2OM5A 3OKNA 3TBTB 5FYJD 4BA8A 2NY3D 5AUMA 5INCB 4Q2ZA 4KTEH 1GGCL 2F5AH 4QRPA 2G5BA 3GMQA 1J5OL 3HI1B 5T1LD 4RBPH 4RMQA 2GHWB 3B3IA 4OCXH 2HMID 5F1OB 4K7PL 2WQRA 1XGPB 1S7UB 4WGVB 4FQIL 5K9JL 4Y16A 5F97E 3V6OC 1UVQB 4XCNB 1WIPA 2XWTB 2XZZA 1MLCB 2GJ6D 3RQ3A 4LCYA 4ONGL 5DEFA 3KPQB 2VLKD 1ZLUH 3DI3B 4FRWA 2DYPB 3FB7B 1P4IH 3GFUA 4HUMB 4G8GD 4WW2A 2YKLH 4MJ6A 2YEZB 4Q58C 5AAMA 4M6NH 1NMCB 4OLXH 1JHKH 2A1WH 2ID5A 5LXGH 2QHRH 2D7QA 1KULA 3S3PA 4XBEH 2Z9TA 3V52L 3B4NA 4JANB 3W9EA 4JHAL 1CLYH 4B53A 5D5ME 4ZTOL 5IGXH 3V5HA 2XWJA 2VDRH 4PJEB 5CP7B 2B4CH 3RNKA 9CGTA 3VA6A 1QQDB 1T3FA 5A2KH 2HA1A 3HNTL 1ODAA 4XMKH 3UTTD 1P4LB 4IRJA 1QD0A 3QH3A 1YY9D 4WTZA 4HC1H 4UOJA 4JJ5A 5J1AB 1HQ4B 1S9VB 3VGAB 3QIUD 3RAJH 5ICZB 3TNNA 2BNQD 1AGBB 4NOBA 4UV4L 1KPVA 1MCHA 3BXNB 5DJYA 4YHKH 2W9LA 4PJDB 1DLHB 1C1EH 2H41A 3O2VH 1T4KA 3DTXA 3E6HA 1TZGL 3D2UB 3QXWA 1VEPA 4BZ2L 3S36H 1DBBL 1T04B 3B9KA 4WV1B 3BRFA 1PD6A 5H8DA 5ICYA 1Q0XH 2ZG3A 4P57B 4R97C 5ALCL 2OJEB 3DGCR 2Z35A 5JHLH 3OXSA 5FEBA 4PTTA 4UT9H 4M3JA 4Z78A 5JHDA 2X2YA 3D18B 3RY5A 1KEGH 3GIZL 3WXWL 1VGEH 2F58L 2NY5H 4UV7H 3SDXB 3R8BB 2YWZA 3AC0A 5IBUB 1F8TH 3MBXH 4NNYB 1X5GA 1GH7A 4R7DA 2CKNA 2X9XA 1YQVL 3Q6FA 1OTUD 1TTGA 5CD5D 1OB1B 1NDMB 1YYLL 2R2EA 4YBLB 2YUWA 4ODSH 5MP6H 5JUEL 5L7XH 4QCIA 4NQCA 2EH8H 2B1HH 1F90H 4U0QB 1NL0H 1QEWA 1TZIA 3D69A 4APQA 1RZKC 3VCLB 2F53A 4P99A 4WI2A 4GLRH 1IEAB 4PUBH 1H8NA 2RCSL 3FQXA 2MKWA 2JIXD 4KHXL 1F3DJ 2HRLA 4X6DF 1H8OA 3G5YB 2VTFA 4PJ7F 4ISVA 5IVZA 3LKQB 2PXYC 4MCZB 4PLKD 3U79A 4JFZH 4HUKB 3BEWB 5BV7L 3B2VL 3PWVB 3KS0H 4FZEH 1ACZA 5GJSL 1NJ9B 2GJZB 5KANI 1B0WA 3BHBA 4MB5A 1BQUA 3CVIH 1FYTE 1Z0MA 2YBRA 1OAXH 3QPXL 4YBHA 1KCUH 4Z7UA 2CR6A 4Z7QF 1KEML 1JWUA 2IPKA 4YBQD 2VWEC 3SPVB 1DQML 1YUHB 4YXHL 5HGAB 4U1SA 4MJ5B 3KXFE 2V2XA 1NBYB 2D0HA 1KTRL 1V3KA 3GHEL 5AYUL 2IANB 4LDLB 3BD5A 3PQYA 4LLUB 4GT7A 2AQ3A 3RVTD 5KG9A 1DBJH 2CRYA 3CSYB 2R0LL 1L0XA 4Q6IA 2X41A 1XGUB 1CVRA 2Y36L 3ARUA 3QIWD 4TNVF 4ZOBA 1TVBA 1KN2H 2ARJQ 5BVJB 2VZ3A 3BJ91 3QT2A 4P3WA 3LKSB 5E4EB 1JJUA 1RULH 4ZSOA 4MNGA 4OQTH 2C3WA 1I9RL 2BSRB 1G6RA 3REVA 3MBEC 2C3VA 1SYSA 2R4SH 4ZDHB 4LKCA 5IVXE 4L4VE 3EOAB 4P0DA 4TTGA 2E27L 1PG7H 5C6TL 1B2WL 1QYGH 2RJMA 3QULA 3ULUL 1JF6A 4GG6F 3NOIA 1PSKH 3S4SB 2R1YA 4O2CA 1VPOL 4ZPTB 3A0OA 1ORSA 1OWWA 3KPOA 4DAGH 4DUXA 3HCVB 1ADQH 1J12A 4PRHA 1YEDA 3PNWA 4YDLC 1MFDL 3ARBC 4KJPC 1G7HA 2V2TB 3VXSE 1QHOA 3BQUD 1VFMA 1C12B 4XPTH 2ZPKH 3A67L 3NFNB 4AEHL 1JZ6A 1UM4L 1X9QA 5L6YH 3ZKND 5F7WC 4GS7B 4POUB 2QL1A 3QWRA 3T2NL 3OG6B 1AGEB 4J1UB 3ARED 3RX7A 1JUFB 1K4CB 1IAMA 3REWB 2Z31D 5EZOL 5T5FH 3H9HB 3HZVB 4KK8D 2HT2D 1RZIB 4S2SA 4NM8H 1U8KB 3FZUD 1UA6L 5F1KC 5K59F 1ZK9A 3F58H 4LNVA 1CR9L 1BEYH 2J5LB 3VXRD 2XWBB 4U49A 4ZXBA 2JK5B 5CEZE 2HP4A 4OGYH 1CDUA 3RBSA 4NZTH 3SGJA 1XCQA 3O3DB 3PJSA 3RX5A 2FATH 3D39A 3FT3B 4LLMA 4PYGA 1NAMB 1MJUL 1XIWD 4ZD3H 4WI6A 5DJAA 3BOVA 4A6YH 3MLXH 32C2B 5T1DH 4K71B 2ZJSH 1OP5K 1YPZA 4HT1L 4E5XA 1J1PH 3ARFD 2Z91B 3GBNH 4ZUVA 2P8PA 4KKLC 4L8BB 5TDNB 1J0IA 4V1DE 1VFOA 1CDIA 1JHTA 1NEZA 3PGCB 2D0GA 4Q9CA 2NX5D 3T1WA 1YMMB 4KVCL 4JO1H 3UO1H 3HG1D 3MLPA 3QNZA 1D5BA 2PW2A 2VL5B 5DJCB 4GG6E 3PWNB 1S3KH 4UBDD 1MCWM 4NQDB 5GXBB 1LHZA 4F8TA 3C60A 2EDFA 2CDEB 5C0ND 4GKNB 3WIIH 5D7JD 4JPIB 3WN5A 1FN4B 2ZCKH 1XMWA 5KSAA 5FIEA 1MCJA 1TNNA 2ZCHL 3VXTB 1I3GL 5IVNA 1U6AL 4LLYB 5MENB 1UXWB 4Z8FH 2QADD 1FNFA 4PJCB 5C0FA 4JKLA 4IEFB 3TT1L 4N9GB 3C5SA 1MJ7H 1U93B 2VOTA 3QDAA 1NFKA 4YWGL 4HZLB 4YX2H 3OTTA 2C9AA 1JGVL 1KJVB 5K59E 1I9IL 1QFOA 5F3BA 4PTUA 4MWFA 1K5NA 3D1MC 5HYQA 4IOFD 1H3TA 1BIIA 1FRGL 4JN1L 4JB9L 1HKLL 2HTKD 5C3LD 5JR1H 2OL3H 1N5AB 1GGYA 3LN5A 4GAYA 3W9DA 4IJ3B 2P42B 1MHHA 3OKLB 4LPYA 2V7HA 1FL5A 1JMXA 4XC1L 4O02H 1MVUA 4Z7OF 1FGVL 3MNVB 1JYXA 3RRQA 4XTRC 1JPFB 2DLHA 4XXDB 1R24B 1XZ0A 4X9HA 4F7EB 2EEDA 1TCMA 2EIZA 3SDCD 1JHLL 2YR3A 3G9AB 4DVBA 2VUOA 1KSRA 1P1ZA 2ADFH 4YFDB 5L9DL 1A02N 1VDGA 5IMOA 3MJGX 2BHYA 4YK4C 1XF3B 5I1GL 3I50H 4EBQH 1T5WB 1OGAA 5I1HH 3WJJC 1T7XA 4RFNB 1AE6H 2V5RA 2PXYA 2YMXH 5DD6B 3VJ6B 1LD9B 1H15A 1KJ3L 2IBZX 4MD5A 1DQLL 2EYTB 3L7FA 4Y88A 1G7LA 2XY2A 1MWAA 3T0EE 5IHZA 3QO0B 4XPAL 4JDTH 3HR5B 4M7ZB 2ZWLT 3O2DA 3QQ9D 5TE4H 1B9ZA 1F11B 1JNHA 5HYJE 4NO0B 3UJIH 4HSQA 2ARJA 3PL6B 5EU3B 1U42A 3T04D 4EXPX 2JB6B 1U95A 4CVXA 4MB3A 3RWDA 4JEGB 5DEGB 4OM0L 4S1DC 1R3KB 2CXGA 5DZLA 5EUOF 4GAGL 3TIDB 3WUWA 2G9HA 3IDIA 1YYML 4H1LA 1CL7L 5CZXD 2XRAH 3QYCA 1KIUA 4OLUH 3LRHA 5F6HJ 4ODVL 3TYGL 2DAVA 3SQOL 1DSFH 3W11D 3DX6A 1T5XA 5F7FA 2I5YL 3KVQA 3K0WA 4KK5C 1M4KA 4FABH 4HDIB 1F4HA 5D2NB 1MQKL 5DI8B 1KYOJ 3TC9A 1I3RA 4OZHE 1FLTX 4WU5A 4HJ0C 1YNKH 1RMFH 2FH6A 1WICA 4GXVL 1WTLA 3BGMB 5B38B 5J1SC 2P46B 4PY8J 5E2TH 2ICWJ 5C0DB 3U48A 3EOTH 5KVEH 3I02B 3RIFF 2FIRT 5D5MA 1QFHA 2BFVL 4L29A 5DR5L 3U7WH 5HYJD 1EXUA 3EDDA 3QZWG 5DA4A 4TSBH 4JZOA 3KWWA 3MCG1 1LEIA 3VXNB 4OI7A 1N3NA 2CDGB 2NY7L 1F5WA 4P2RB 5I8OH 2B5IB 1GGIL 3U0WH 3HB3D 3KLSA 3VGFA 3QQ3B 4UU9B 2R8SL 2DKMA 4HMCA 5ADPL 3HR6A 3H9SB 5M7QA 2NQCA 3P4NA 3PHQB 4PGDB 3QFDA 5JW5A 1ACYH 4ONFH 4WI5A 5DF0A 4LAQH 1JGDB 5FCUH 4K8RC 3T2OA 3GSRA 2H9GB 4WFHE 4DZBA 4P5TB 2R2CA 4X9FA 4YXKH 5GZNC 3TN0C 3GGWA 4KZDH 3L3DA 4WO4A 5ACLA 2QHLA 2VXSL 3PV6B 5CMAB 3H3PL 3VFSB 4FFWC 1CG9A 4R0LA 2GSGB 4MVBC 5FHAH 2D31A 4OKVA 1WBXA 2CO6B 1U8QA 4HLZH 3DX8A 2GYSA 3IYLW 3OQ3B 4OD1L 1P7KA 3DVFA 1T0NA 3RKPA 2R1WA 5F96L 5T1KB 1W0WB 2UYLB 4LP4A 5EBWA 1HSAA 4JFEB 4QKXB 5B39B 3FRUA 2O61B 2AK4E 3JSSA 1CLCA 3KYMA 3MRQA 1A3RH 4Z5RB 1JGEA 3MR9A 4OI8A 1P7HL 3C87A 1BVLB 4JRYB 3QEHA 4KGJA 1EGJL 4HKZA 4GQ9L 2OK0L 3CC5B 2HLAB 2BSTA 5GRZA 1F42A 4F7CA 3FQUB 3C6SA 3QEQE 2Y4SA 1U3HA 4HWUA 3MRNA 2Q8AL 4LSTL 5C8JB 4WFHD 4ORGA 4D8PB 4YFEA 2RAMA 4QRSA 1U8NB 1CF8L 3BPLC 4OIIL 5BRZB 3GJEA 1FYTA 3GSWB 3LCYA 4I18C 4Y4FB 1AJ7H 4NYLA 1P5UA 3DX9A 1Y6NR 1TJHL 4JFQB 4MDIA 5D7KE 2FB4H 3KXFA 1I1YB 1OTSC 4KVNL 2EZ0D 3VXUD 4D9LL 3DO7A 3GKWL 5HHOB 4FP8H 4Z77B 1MJ8L 4LPVA 4R7NB 1NLDH 2VXVL 3WFBL 4FQPA 2APBA 3N1FC 3RHWF 4ZNEE 4U6VL 4JKWA 4Y4HD 5E1HB 8FABA 1MPAH 3DV6B 1QPPA 4L4VA 3O4LE 1IC7L 4MAYD 2XPGB 2X70B 3ECBA 3OKKA 2BOCB 2D7OA 2HFFA 4URTB 3QEQD 4UB0L 4DEPB 2D7NA 1NDGA 2YPVH 5GIRB 1M6OA 4OZGB 4NBYB 3WJJA 2QEJA 3RIAK 1JGUH 5DJXB 5IK3B 5DD0L 2BVPA 5FGRA 3QRGL 3QCVH 4O5LL 3O9WC 5GHWL 4JPKH 2D7MA 4FQ2H 4KRLB 1TPXC 3VXSA 5IEHA 2BNUB 3WDHA 1ZVSB 5IESL 2FO4A 2KPNA 3WHXB 1LO0H 1EJ6A 4K3JH 3RZCA 3HZMA 4RDQG 1N64H 4JY6A 4P4KD 4U1NA 4XPGH 4X6DA 3CLEL 1E6OL 2NY3B 3VFRA 1RZFL 3QWOA 5LWYH 1HNGA 3VRJB 2MOVA 4OZ4A 3GMOB 1A6WL 2OMBA 5I30H 4WCYH 4FTVE 2AQ2A 4TVPD 5T1LB 5DFVD 2XZCL 3S88H 3MLZL 4MAUL 1LWRA 2XQYG 4OUUB 1YEKL 3B5HA 2C5DC 5IEKB 1NSNH 3TA3D 1IGML 1MUJB 2ZSVB 4BZ1L 4NBXB 2GJ6B 3RKDD 3QAZC 4XX1G 3M45A 2VLKB 5IMLA 4LRNL 4NHUA 1YC7A 2KQMA 1KIPB 4XCCH 3RWIB 4G8GB 4W4NA 1FJ1B 1UQSB 4XCYB 1CT8B 3HMXA 3NH7H 3JV4B 2XXMB 3H7BB 4DN3H 3ULSB 3DVNA 15C8H 3MGOA 4UNUA 4V1DA 5D70L 3MV7A 4U1JB 3MUY1 4ZG1A 4Z7WB 1A22B 2E9IA 4FXLA 4Z7VE 1YQ2A 3IS0X 4O51B 12E8L 2J4WL 3OAZH 5GRUL 3IB4A 3T3PE 3UTSE 1UWXK 1IAIH 2X05A 7CGTA 1QBAA 4WHCA 4JG0H 4GG6A 4X80H 3RI5K 3VFMA 1U2HA 3UTTB 3N85H 5MI0C 3VFNA 4PJFF 4O4YH 1NCAL 3G6AA 5JOPD 1KIRB 4I8DA 2O5XL 3QFJA 3QIUB 5IHUL 2APXA 2BNQB 3T8XA 4PJBB 4RGNC 3IFNH 4WUUE 3GMMA 2DBLH 3K2UH 5ACZA 4Q9QL 4H88L 4ZFFB 3MCLH 3ULVD 3QDGE 1VGKB 2BHUA 1MFCL 1KCSL 1HOCA 5E03A 5FYLL 5FECA 2NY0C 3BAEL 5E99H 4LSQH 3MXWH 3QXDB 4U2ZA 5HGDA 2YD2A 3LEVH 3S5LB 1CIDA 4HK0B 3TN0A 4K3EH 3D85A 1BM3H 2APWA 3GSNH 4CADA 4Y2DD 5J11B 5BV7C 3D3VD 5FOJA 4L9DA 5C71A 2XKUA 1UCBH 4GW4A 1GGBH 1NAML 3IU4H 4QLRA 2F15A 3CH1A 1IQDA 2FH8A 4R3SA 5LGHL 1A1OB 2MSPA 4XP6H 3HFMH 4KJQD 3ZDXE 1IGIH 1NCWL 4PFEA 1HK6A 5J56B 5EZLA 1GC1C 1ZLVH 4BH7B 5CUSL 2DTML 4I9WE 3IJYA 5EIIA 3IDJA 1HYRC 3HPLB 4BM7A 4OLVL 1B6DA 1F6LL 1AFVH 1VFBA 2X4RA 3OR7B 3BP6B 1E4XI 2AW2A 4Y2OA 1R3LA 1QR1A 2DICA 4PGEA 2DMKA 1YN6A 1C5DB 1I9JH 2DIJA 5HYSB 5CSBA 1GAFH 2UZIL 1ZA3A 1AQDA 3ULUC 4LSSH 3B9KD 3FO2B 3U46B 4PJFE 3GMPB 3FOMA 3LDBB 4LRIC 4RZCB 3T0EA 4KDTC 2XQYK 3T3MF 5EZIL 4I18A 3QHTC 1QLEL 3HRZB 2FEDC 2VDQH 1CE1L 4ZS7L 2VLJE 2W07A 1U9KA 5KSBE 4G43A 1ZWIB 4HQQH 3UJJH 2IC2A 3SN6N 4KHTH 2H32A 4MNQE 3MLSH 3WNNA 4EOWL 1AXIB 4PRPE 1BECA 3DROB 2Q6WA 4P2QE 5EFIA 3L5XL 4YZFF 2Z8WC 3CMOH 4NJ9L 2FR4A 1Z3GH 2J6EH 1P7QA 4QXTA 2DJSA 1CZ8H 4O00A 4LEOB 1JWMA 3AS2A 5CJQH 5KJRL 4JRXE 2DLEA 1IC4L 4APQD 4UINL 4WUKL 4L4TE 5D2LF 2A0LC 4C59B 2IWGA 1UJTA 3W0WA 1JYWA 3MACH 1RZ8A 3NA9H 3FN0L 1A6AA 1OW0C 1YDPB 4KK9C 3SBWC 1BQLH 5C07B 2GEEA 4WI9A 5FHBH 3TJEL 3BT2H 1KIQA 4OZHA 3CUPA 3MOBH 1G1YA 3BKYL 3WEXB 2IFFL 5DTFA 3O9WA 3CFEB 4LEXL 3U1SL 4EQ2A 1JNNH 2EDBA 4HV8B 1V3JA 4IRSB 1A6TA 3BQUB 1DL7H 3SE8L 3RWFA 2G60H 4JLRB 1CD1A 1G9MH 1MI5E 3ARRA 3IXAA 1Q9WA 3GHBH 4JM2D 3GMLB 2Z31B 2HN7A 2X4QB 1RUAH 5TE7L 1SVCP 4MNQD 3KPSD 3PQYD 4PRPD 4YHMH 3U4EA 4P2QD 3T1FA 2AXFB 1JNLL 2R0ZH 1H5BB 1UYWH 3HS0A 3VXRB 3T3ME 2UWEE 5FF6B 1DEEB 2A6JB 1CDJA 2VR9A 4E9LA 1BPVA 1FAIL 5BVPL 5DMKA 2CIKB 1XIWB 5DDHB 2YUXA 3SKMB 2HFTA 4LIQH 4YZFE 2GIYA 4A6YB 4AMKH 2G75B 1F02I 3RP1A 1FAKT 3MRRA 1KF9B 3NCYP 3DBXB 4PRAB 4NKQB 2HT3C 3I9GL 4HF5L 4KKAC 3QDME 5BXFB 1ZA6A 4JFPA 1IT9H 3JV6A 4KK6D 2E5EA 5D2LE 2NX5B 1MFEL 5J0BA 3I3EA 5F7DB 3EYUH 3OPZL 4WI4A 5D1XC 2E6JA 1ZKAA 3W2DH 4PV9A 3HG1B 1WBYA 2VXTL 1FZMA 4FZ8H 4QRQA 3RZWA 3IF1B 3M1BA 5AD0B 3V5DB 4CJ1A 2XV6B 1TQCB 3LMJH 4KI5C 5D7JB 4HJJH 4F80A 2F19L 4RAUB 3CVHH 2WBWB 2F54E 1E4XL 2PW1A 1TTFA 3WFHA 2AKRA 5IIEB 4Q9BA 1CGVA 1J05B 3TJHC 4BUHA 4XVTH 4TVSa 4L8SA 3X14B 4BH8B 4R6UA 4K7PX 5FK9A 1JK8B 2BY2A 4P4RB 3D0LB 1HKFA 1U8OB 3UYPA 5J13B 1BZ7A 3L1OL 4LLQB 1K6QH 4YHZH 3IDGB 2J7LA 5FYKL 5C0IA 5J6HA 1IAKA 3DXAA 1DUYB 5SWSB 1CS6A 5ENWB 3MRFA 3ZTNL 1HHGA 1F4WH 5HHQA 2YK1H 4OCLC 1BVKB 2QSTA 5F9DC 5C0BD 1S7TA 3D9AL 4NRXB 5F9JB 2GFBB 5D7IB 5IMMB 4OZFG 3ZMRA 5I73B 3DURB 4UILH 1IMHC 4ZNEA 2PYEA 4LBEB 3VFUA 3SDCB 3O3AB 1MIEH 2XZQL 4HUUA 3RWJA 3O4LA 1BD2D 3UROR 5A16A 2B8OT 4R26H 2I60L 3MRKB 4M6OL 1U8MB 4UQ2B 3BPNC 1KPRA 2ICCA 5I2IB 4L3CA 1MIMH 1W8NA 5E6ZA 3MYJA 3IRZA 1NPUA 4H8WL 3E6FA 3QIBB 4OLZL 4FQQB 3M17A 4PJ8B 4EDXB 1BX2B 5E2UH 5F89B 1JV5B 2BCKB 5JQ6H 5DRXB 1FBIL 3GM8A 5CBAB 3Q5OA 1JIBA 1LGVA 5HGBA 5IR1B 1XFPA 4P46B 5IW1B 3FN3A 2FL5A 4LASH 1W0VB 4UIKH 3TBYA 3WCYA 4F7PA 3T0DA 1MF2L 3U4BL 5CZVL 5KVDL 4K94H 3FT4A 1Z9SA 4HIJA 4U0RC 4NQEA 4DKEL 3CXHK 5I8EA 3NFPA 5B3NA 1UKTA 2VR4A 4FTVA 4ZUUB 3CD4A 4PGZA 1UENA 4FQXA 5IB3B 4GMTL 2ICWB 3MJ9H 5FV2A 2G5RA 2I9TA 4KRPC 2ERJB 4F58L 2EH7H 3TVMD 2HKHH 5D1ZC 1MCPH 4XNMA 5M94B 3BIAX 3O3EB 5CZKA 3RWHB 4OCSL 3SBWA 4X83A 1OGAD 1WZKA 3VRLE 1HNFA 3S37H 3DECA 3EHBC 2PR4H 4M7LH 5DA0B 4FMFA 2PXYD 1K2DA 1Y18A 1EJOH 3BWAB 3N50A 5E8PB 2BOBA 3L3IA 4G6FB 1OQOA 4MNHB 4RRPA 4JCMA 2C7UA 1OD7A 3QUML 5CCKL 5L88L 2J3SA 5E5MA 2H2SC 5FYJU 1BAFH 1OGTA 4HIIA 2Q1EA 2J88H 3WNPA 2WBKA 5ESVA 3CFJA 1V3MA 4FQLH 1OP3K 2BC4B 4MLSA 3IDUA 3UDWA 4BELD 5FA3B 4FQHB 4HPOH 4OT1L 1U0QA 1ZHNA 4M9PA 4POZC 1GZPB 1XR9A 3RVVC 1VKXB 1A7BA 2P8LA 2JTDA 1X6LA 2BHZA 1Z9LA 1AC6A 3F7YB 3NIGE 4XP4H 5C0JB 4WHTB 2B1AL 4JAMA 1OP5H 1AO7D 4WUUA 1QBLH 4RWYL 2XN9A 4LQFH 5EBMA 5CEXA 3OKOA 3MBED 1MAML 5DZOA 3PGFL 1JPGB 1QSEE 5DJDA 1RUQH 3QEGL 5IBUG 5IV2B 4L3EA 4GAFB 1J10A 1CGXA 1I85C 4RA3A 1U8JB 2VZSA 1EDQA 4MGXA 5IJVA 2MQ0A 3QXAA 3CFBB 3G08A 5ESAB 5JORB 4ZUSA 2WUCL 3EDJA 1D6VL 2J8UF 4KTYA 4PV8B 1PZ5B 3GO1L 5CILL 2R2HA 3MV8B 3ARBD 4KJPD 2JB5H 5DJ0A 1T0MA 3MODH 5F88B 2R23B 4H20L 2EDDA 4WI3A 1S9WA 5D1XA 3TO2B 1FP5A 3SDYL 1ROWA 4OFYA 1RAMA 3FCTA 4YIQA 3THMH 3V4UH 3PWLB 5I1EL 3H3KA 3UYOD 3DVGA 3Q1SH 1MAJA 2BVEA 3BP4A 3WD5H 4NDMB 5T3XL 1JZ7A 4LVNB 3GNML 4LLAA 3ARDC 4TNWK 3TFKC 3QJHA 4AEEA 3FFCE 1SJHB 4JQVA 2IQAB 1CE6B 3PWJA 2CDFA 2J1KA 3BKJH 4P5KA 1KJ2A 4D0DB 4X7SH 1W72H 3FFDA 4TUJA 3WDIA 4TULH 3UTZA 4BSVB 4HS6A 3KG5A 1DUZB 4X7CC 4PJFA 5T5NG 4ZAKA 3DX7B 1RK0A 4UTAH 5A3IC 4LARL 5F1NB 2X42A 5BW7C 4L8DB 1RJLB 4YBLC 2YC1B 5B8CA 1G9EA 4KKLD 2FLBT 2VLJA 1QFWH 3IAPA 5DYOA 5KSBA 2HT4C 3S34H 4CGTA 5EC1A 4NCC2 4UUJB 5C92A 1I1AB 4QRTB 4I3RH 3VXUB 5DJ2A 4NNXA 4EN3A 3S4SG 1IC1A 1CDHA 3AU1A 5CEYB 1RQ5A 4CMMA 2EICA 1BREA 3EJJX 1U41A 4YUEH 5KSUA 4XBPB 2WBJA 3O4OB 1LDPH 4Y4HB 1M7XA 2J8UE 3ARPA 4JRXA 5GZOD 3C5JA 4L4TA 4I2XE 2WINB 2IH1A 3DYMA 1FH5L 4MMXC 3OJVC 3VXQB 1WISA 3FFCD 4FFYH 4ZYKB 3DMMA 5SWZA 3HNSL 1A6ZB 2UVEA 2XQBL 4PJAB 1IKFL 4PJIF 5C9JB 3DRTB 5CHNA 5DRNA 3MREA 5MHSD 3FB6A 1G7JA 1ZXQA 2E9JA 3MJ6A 1A6UL 4MA3A 4C56E 3HMWH 2AV7B 4XNQB 4PREA 1A0QH 2OR7A 5E7FA 1FCCA 3RNQA 5A1AA 4KJWC 4XAKE 2CIIB 3I85A 3MLTB 4QY8A 2EH8L 3MRBA 4S1RH 3A6CH 5KAQG 2VL4A 4WHYG 1T21B 1F6FB 4Y19D 2IG2L 5I1CH 2DI8A 3FL7A 4QHKJ 5ITBL 2LVCA 1AR1C 5JO5B 3S96A 4QHNB 3NIFF 2GCYB 4YXLH 4ZOAA 5F7UA 3DIFB 1AY1H 1D9KA 4LFHD 1Z2KA 4J6RH 4WJ5A 2IBZY 4M7KH 1OM3H 5IUSA 1G7IB 3ZDYF 1UB5B 1FVDA 5E00B 5JZ7C 5HYFA 4PJXF 5IP4A 4ZNCD 5LGJB 1G9NC 1A3LL 3CVHA 1PKQB 4I77H 4D0CB 2EDEA 1LO2L 1IAOA 3TA3B 4YPGB 2BDNH 3FQRA 3MUZ1 5D1ZA 2R69L 3O41B 2HKFH 3NPSB 1A14L 2E7HA 1J86A 4PG9A 1P4BL 4QTHA 2VDNH 5IW6A 5C0RL 4NKIH 3QI9A 3OKEA 5JW4M 1EHAA 4HUXA 2HVKA 1A2YB 2VERN 4H25B 4X4ME 4NO5B 5J9PB 3OKMA 3CDCA 1R5VA 1HHIA 4FQ1L 4XAKD 3RIAF 5IFJB 4JO2H 3QDMA 4JPVL 5I1DB 3RWEB 4C55A 1LP9B 2DQCH 4JDVA 4ELMF 5D2LA 2WWMC 25C8L 1S78C 1Q9LA 4AM0B 3WS3A 3KNBA 3IXTB 1FLRL 3OKNB 5AUMB 1OSZA 1NAKH 1UFUA 1QLFB 3P9MB 4Q2ZB 4XP1L 4S1DD 4J7RA 1UM5H 3V6ZA 4OZIF 4QRPB 4LLWA 5IB1A 5FUCC 4LSRL 5C0GB 5GISL 2B2XH 5HVWA 3B3IB 2FWOB 3LAFA 3DETC 1LE5A 2F54A 2MPAH 4G8FA 3BGFC 4GSDL 2AEPL 2N4IA 3TH2T 5DEFB 1CFQA 1EHLL 4KK5D 4RQQB 2ZUXA 4KH2A 5IROA 1NGXA 4WW2B 5F44A 4MJ6B 4HJ0D 4P23A 3N9GL 1KENH 3SCMC 3JVGC 4QHLB 4Y2DB 4POYA 5HVHB 3D3VB 1PEZA 1TJIH 3MV7D 1BZ9A 1XGRA 1NLBL 2NY2C 5TDOA 3O8XC 4WIQA 3WDJA 5I1JH 2YRPA 1FORH 1B0RA 1HXMA 4TPRL 3WL9B 2IEPA 2BSSB 4JFFD 3RVXC 1EMTL 1T3FB 2IH3B 5EC2A 4A6YL 3RUGF 3BIKA 4MD4A 4IRJB 3QH3B 2Q7YA 2F74A 2XT1B 3VG9B 4ZUWA 4LHUD 3RI5F 4JJ5B 1YEIL 5IQ7L 3QFJD 3MRHA 4HK3N 3LKNA 3TNNB 2HWZH 3QDJA 1IGFL 1KPVB 4N8VB 4AEIL 5DJYB 5DVOA 4K8RH 4ELME 1AI1L 4OFDA 3MROA 1PQZA 3U82B 3VMOA 3DTXB 4NFDA 4K8RD 3OAUL 4R96A 4K07A 5GGQH 3B9KB 5EBLA 1FNSH 5GZND 5ICYB 2PCPA 3TN0D 4IS6A 5D6DC 5BW7A 1UB6A 3OXSB 4OZIE 4OIAA 4FG6C 2YXMA 2QQKL 4PTTB 3VI4F 2ICEA 2YA1A 2V5SA 4FFWD 3ZYJA 3TESA 4MVBD 4JKPL 4O2FB 2I9LA 1EEZA 2P43B 3EYQC 4GUPA 2P5ED 2CO7B 2QSQA 5L8JB 1NMBH 4LK4A 3MLVH 4R7DB 4HFUL 2JCCF 7FABL 2DQIL 3LSOA 4GQPH 2R2EB 3KPTA 2BNRE 3NACH 2OJZH 1F3JA 3D0VA 4U7SA 2DL9A 1A4JA 1QEWB 2WWKO 1QTYT 2P44B 2F53B 4APQB 3BEVA 4ZFGH 5C7XH 1WIUA 2ADJB 2FD6L 2DQEL 3VXMD 3UP1A 1L7TH 2ORBL 4M7JH 5CKGA 4NKOA 2GAZA 1FL6A 1TETL 1BBDH 4RDQF 4ISVB 5IVZB 2P24B 3MTRA 3QG7L 3MRDA 2YPKB 4OTXL 4HHAB 5E7BA 5CD3A 1P6FA 1CQKA 3P4MB 2D03H 3T77B 3BHBB 1P84J 4QGYA 2YBRB 3MLRH 1AGDA 3IFLL 3SKNA 1MRDL 4GBXC 1JWUB 2IPKB 5CIPA 5HHME 3X3GH 5C2BL 1BFVL 3KPPB 3WNOA 4X7FC 1C7SA 1C8PA 1OTSD 3DO3A 4JM2B 4MHHG 2WMPA 43CAA 5F8QC 3TBVB 1JPSL 4UOW1 1INQA 1CI5A 3KPSB 3PQYB 1ES0A 5IF0A 5KG9B 4Q6IB 2DLFL 1TVBB 1Q94B 3O3UN 4HKXA 4LOUD 2A9ML 1GGCH 3GZKA 1FG9C 1JP5A 4RMTA 5CSGA 2BNRD 4HKJB 4ZSOB 4MNGB 1J5OH 2XNAB 1G6RB 3REVB 1SYSB 1CCZA 4Q97A 4LKCB 2YS4A 1QSEA 2E7BA 4F7TA 4K7PH 3ESVF 1ORQA 4FQIH 4LVOC 1CFSA 5K9JH 3QULB 5CGYC 5B39G 3BD4A 4ONGH 1NANH 2PYFA 2DQFA 4HS8L 2R1YB 4O2CB 1AGCA 3QUXA 3IJHA 4GH7B 1ORSB 1UWXH 1X4YA 2AI0L 4JVPA 1F3RB 2JCCE 2B5IC 3RGVC 4PRHB 1YEDB 4XPBL 3FO0L 4OQ1A 2HVJA 5FOBB 1HH6A 3S3SA 3V52H 3FT2A 5FA4A 1KCKA 4JHAH 3H9ZA 4ZTOH 5SX4I 4NRZA 4B0MM 3TCLA 2DB8A 2P7TA 4LHQB 4JO3L 1QSFE 2DWDB 4I0CC 4G42A 4S2SB 4KJYA 1A7PL 4GRLA 4YJZL 3L3GA 4ZXBB 4UV4H 4K7FA 2VXQL 5ELIA 4JY4A 4DW2L 1ZHBB 1XCQB 2NMSA 4JY5L 3PJSB 3V5KA 3D39B 4LLMB 3BDBA 5J12B 1TZGH 3ZSSA 4BZ2H 4OD2A 4N8CL 1DBBH 4HUWA 2FCBA 4E5XB 1TIUA 1JNJA 1C7TA 1BGXL 2Y7QA 4H8WC 3SCMA 1H3GA 4CJ0A 2ZOLA 3JVGA 3MX0A 1YEHL 4ZUVB 4KKBC 2P8PB 4N0CC 3TCXA 1IEBA 1JHTB 3A6OA 2FIKA 3GIZH 3HC3L 3WXWH 2F58H 4DZ8B 1JI1A 4QEGA 3ZTJG 1A1NA 5C6PB 3BX7C 3WFEL 4YDJA 5HJ3A 1GXEA 5E9DE 1JRHL 1X4XA 3IJSA 5F3HA 1T7YA 1GSMA 1E6JL 2B39A 4HJGB 2O5ZL 5C0BB 1D5BB 2PUQT 5DQDL 4MCYA 2HTLC 5DS8A 2X89D 1YQVH 1YYLH 2J8UA 5F93C 1IGYB 5JUEH 1EH9A 2FX8L 3U0TA 3EO9L 5KSAB 3O6ML 4I2XA 3OHXA 1BD2B 2X6MA 1IQWL 4RGND 1N0XL 2RCSH 3V0WL 4JO4L 1FL3A 1ZSDA 5B3JF 1Y0LA 4G6KH 2E9BA 4KHXH 5FDWA 3ROLA 2NY0D 5C0FB 1NQBA 1RU9L 4C56A 4D94A 3C5SB 3P77B 4NC1C 4PBXA 5K33A 1OAYL 4R97B 3MA7A 5BV7H 3B2VH 2WP3T 2NLJB 2OTUA 3WLWC 5L2KE 5GJSH 3DSNA 5F3BB 5KVGL 3ILQC 3ORJA 1GHFL 2Y06L 2A6DA 5DUML 3QPXH 4PTUB 1KEMH 4MWFB 3MLYL 5HYQB 3DXAD 4X5XA 1BIIB 4JZJA 5DD1L 1DQMH 5D71L 4YXHH 1Q9KA 3GHEH 2BZDA 3LN5B 5AYUH 3W9DB 2ZSWA 2WV3A 1S7VB 1MHHB 1FL5B 4GW5A 4HMDA 2R0LH 5C9KA 2Y36H 1MVUB 3IU3A 1SMOA 2VAAA 2PYED 1UJ3C 1XZ0B 2W0LA 4C58B 4X8XA 2IAMA 1I9RH 4E41E 2MHAA 1OF2A 1QPXA 1P1ZB 1P6AB 5JPNB 3GB7A 5F6IC 2HJFA 4M02A 1DE4A 4F9LA 5AG8A 3HRPA 2E27H 5C6TH 1B2WH 2KL6A 3ULUH 1OGAB 3MUJA 3VD5A 4KGLA 4GKZA 2PXYB 3ZL4L 4DGIL 4MD5B 1H15B 4X4MA 5I18L 3ULUD 1C08A 1VPOH 3FMGL 4GG8A 3KPRE 3L7FB 4AYFA 5DHXB 5FXCH 3UYRL 1MWAB 1U3YA 5JPMA 1ULVA 5IHZB 4YHYC 4BFGA 3H3BC 5L2KD 3T08A 1QRNA 4Q9RL 1MFDH 2FEDD 2AJYL 1QOKA 2Y1VA 3MJ8B 1UZ6E 4GBXA 3A67H 4AEHH 1UM4H 3ALPA 2DQDL 2ARJB 4PJIA 2ZUUA 3T2NH 1EUUA 4OUOA 5ID1A 1L9MA 5B3JE 3GJFH 3RWDB 1CVSC 4XXCA 3AFLA 5EZOH 3TWCL 2FBOJ 1ITCA 4NQED 4BKLA 2O5YL 1UA6H 1CN4A 2G9HB 2GITA 3IDIB 5C09E 4H1LB 1CR9H 2QKIA 1RZJL 1AO7B 3JWOL 1PY9A 3HE6C 1VADA 4GRWH 4WFED 1ETZA 2V2WB 3V8CA 3PDDA 3ROOA 5F1SA 2A0LD 2GK0A 3DX6B 2M2DA 3MMEB 1T5XB 3AVEA 4KK9D 2H26A 1MJUH 3VE0A 4MJIE 4MXWL 4MJ4A 4XZUA 3MV9D 4D9QE 1I3RB 1U58A 4HT1H 4TVPL 4ODHL 4UAOC 3KPRD 1MCQA 4YDLB 1KXVC 5HI3C 4U1IA 1OHQA 3W82A 2YZ1A 4GW1A 3U30B 1DFBL 1TVDA 4L29B 4Y89A 1EXUB 1FFPA 3JZ7A 5HYSG 4D2NA 3EKCA 3QZWA 4JZOB 3KWWB 4KVCH 4OJFL 2WSKA 1WT5A 2X4UA 1AGFA 5B4MC 4X5WB 1UGNA 1PJ9A 5BCAA 3IRPX 3JWDL 4M8QA 5ETUB 1MY5A 5ECJE 4NO3A 4PY7A 4Y5YC 1CGSL 1I1RA 5J11C 1DVFC 1PG7W 2WNGA 3JXAA 5FM8A 1CGTA 3P4NB 2ZCHH 1AHWC 3F7QA 1L4IA 3QFDB 4WEMB 4ELMA 4RCAA 1I3GH 1EFXD 1U6AH 1KNOB 1FNGA 2AJVL 4L3ED 3TO4C 4HPYL 3GSRB 4DZBB 2UZYB 1EHNA 5FO7A 3TT1H 5HD8D 4IIQC 3CK0L 2QTEA 3GGWB 4YWGH 4OZIA 4WO4B 1QP1A 3MV01 3QEUB 1JGVH 3ZYOA 1I9IH 2ZUTA 2NPLX 1B3JA 1CXHA 2HT3D 1CG9B 3K8KA 3ULVL 4KKAD 1PX3A 5EU6E 3NIDF 2D31B 4ZUTA 1WBXB 2D7TL 1JBJA 1U8QB 2JJUA 3EDFA 4R4BA 3DX8B 1FRGH 4JN1H 4JFOB 4JB9H 1HKLH 1KCVL 2VQ1A 1T0NB 1WWBX 5D1XD 4KAQL 3VI3E 1IM9D 1LILA 1HSAB 1HILA 4OCNC 1KLFA 3X12A 3QSKB 1G6VK 3KYMB 3MRQB 4K7PY 4XC1H 4N68A 1JGEB 3MR9B 4KI5D 1FGVH 2H1PL 5KVFL 3X3FL 3C8HA 4NSKA 1JHLH 3QEHB 4HKZB 1A6PA 5JW4R 4KXZH 3GRWA 2BSTB 3RPKA 4ELKB 4F7CB 5L9DH 3C6LC 2Q3AA 3C6SB 2FZ3A 5EBGA 1U3HB 2NYYC 2EDXA 2ESVE 3MRNB 4G9FE 4ZOCA 5I1GH 2VKXA 4IOIA 3RUGA 3BUYA 4ORGB 3TJHD 4KQ4L 4OFVA 1Z9OA 1KJ3H 4QRSB 3DUUA 1DQLH 3GJEB 3F5WA 1A7NL 3TBSA 3BKCL 4Y0GA 4BYHA 2EDWA 4Y4KC 4PPTA 1QA9A 4XNYL 4XPAH 3KPMA 4NYLB 5KS9E 3DX9B 3HUJF 1VEOA 3OMZA 3QXUA 4TSAL 4MDIB 2X4OA 3BKML 1CFTA 3KXFB 5H35A 4LU5L 5H2BA 4OB5L 3IDXL 3D25A 3DO7B 1A1MA 1JYNA 1BVZA 1QLRA 4PJ5E 1HH9B 2FHBA 4OM0H 5D7LD 5BS0E 4GAGH 4ERSL 1YYMH 3ZDZE 8FABB 1CL7H 4JKKA 2CKBA 3U36A 5EORL 3B6SB 2PO6C 1WCQA 4M9OA 3NIDE 1ZT1B 5J3HC 4CW1B 3ECBB 3OKKB 2XOTA 4ODVH 4YK4B 4FFVC 5SWZD 3TYGH 4PR5A 1FIGH 1PYWB 3D5OF 4UT6L 1NDGB 1M6OB 2I5YH 3OXRA 3FHQA 1MQKH 2BVPB 2JCCA 4RMRA 2GQHA 4S0SD 2HJKA 4GXVH 5ERWA 4Z0BL 4KMTL 5IEHB 2PTUA 1TCRA 3DV4A 4B7LA 1GIGL 2BXZA 2FO4B 4EEEA 4N0UE 5E6ID 3L5HA 1B0GA 5K9QI 3IVKB 5GGVL 3SDXF 2BFVH 5DR5H 4LHJB 2P8MA 1HZHL 1EEUA 1NC4D 4JY6B 4U1NB 5IW3A 4X6DB 3HZKB 1OY3B 4JFHD 1QSFA 4PJ7B 3VFRB 3QWOB 3WO3B 2NY7H 4GAJL 2I27N 3VH8B 2V9TA 5EPMA 5B22A 1GGIH 5CP3H 4BQ6A 5BS0D 1PVHA 2DDQL 3L9RA 2R8SH 2CQVA 5ADPH 5DFWH 2H8PB 4DKFL 4Z0XB 1FNEB 1HINL 4HCRL 5CAYB 4KRPD 1G7PA 1FFRA 3E0GA 4P2OC 5D1ZD 4F7MB 3EGSA 1NC2A 3QUYC 1I8MA 4PJEE 3VDAA 4MZ3A 5HSFA 5IFAL 4CVUA 4NHUB 3L6FA 1TFHA 3EHBD 1WUNT 4U1HA 3P9LA 4LCWA 4YDVA 4JN2A 1A9BA 2Z93A 1G6RL 3DVNB 3RL1A 1ZANL 3MGOB 5C0EA 2VR5A 4V1DB 2VE6A 3MV7B 2FSEA 2QQLL 2VXSH 3CFCL 5GSVA 3H3PH 1I8KA 4CU7A 2H2SD 1K85A 3IGAA 1K8DA 3NVQA 5EZJA 5E9DA 5E24E 5E0QA 4OD1H 1MFBL 4JFFB 1LEKA 4NZJA 3WKML 5F96H 4GG6B 4P9HL 3VFMB 1V5JA 4YDIL 3RVVD 1MCBA 2X4TA 5T5NF 5F7NC 5C86A 3G6AB 4ORZC 4MX7A 3QFJB 5C08A 3HZYA 2VN7A 2OZ4A 4Y5YA 5EIQA 1F6AB 1DVFA 4X5LA 2VITA 3GMMB 1EGJH 4GQ9H 2YUZA 1PKOA 5BZWA 1KJMA 1GGTA 1HOCB 3GSQB 3SDXE 5FECB 4U6HA 4GOSA 5IB4A 2Q8AH 4FZ8L 4HS3A 4LSTH 3ILPA 5GRYA 1QZ1A 3TN0B 4QNPE 4JREC 2VDPL 3WIHL 2BY3A 3D85B 5I73C 5E56A 1CF8H 1WK0A 1Y6MR 4OIIH 5EO0A 1HHJB 4CADB 1KGCE 3VMNA 4M1CC 4WW1A 2Y07L 3IDNB 1NGZA 3SKOB 1TJHH 3B83A 4GW4B 4JPWL 5JTWA 4KVNH 1IQDB 4BFBD 2P5EB 4PGCA 5GRVL 4D9LH 1I1FA 3D2UD 3GKWH 3O0RL 5EU4B 1SJVA 5IQ9B 5EZLB 2I07B 5GGRY 1MJ8H 3QIBC 2DD8L 3WUZA 2CSPA 3GIVA 3IDJB 4PRNB 3WFBH 1IKNC 3S6CA 4PJ8C 1LEGA 1QKZL 4U6VH 1HQRA 3QG6B 3V2AR 1MJJA 1VFBB 2X4RB 3ARDD 3QDJD 3SE4A 3ZE1E 2APVA 1R3LB 3TFKD 1SEBB 3LVEA 2CR3A 2OX5A 5T3ZL 1IC7H 3C6LA 1MCCA 5HPOA 1ZT4A 5GS3A 5ICXA 1YN6B 4UB0H 1T1ZB 2AXJA 2FJFB 3OBAA 2JJTC 4QOKA 4XPHL 3O3BA 2J12B 4ODUA 5DD0H 3FOMB 3BPLB 5A3ID 3QRGH 4O5LH 5GHWH 4GLRI 3BIBX 4I18B 4RX4A 4LNRA 5GGTA 2EC8A 5I17A 3P4OA 4L8CA 4QXGL 5IESH 3AAZA 2HT4D 4F3FA 3IFPA 4G43B 1INDL 4X6FA 3FB8B 4Y5XC 4PJGF 1T89C 3C8KA 3BI9X 5E5RB 4RNRA 1Q1JL 2Q6WB 5EFIB 3CLEH 4AT6A 1E6OH 1I8IB 1HN1A 1RZFH 2Q87A 1DBAL 2FR4B 3VFPA 1TLKA 4X99A 1P7QB 2AK1L 4QXTB 5C09A 1A6WH 2DLGA 3ARGC 4ESKA 1JWMB 4UIMB 1PLGL 3GMNA 3G5ZA 2PO6A 2XZCH 3MLZH 4MAUH 5FUZL 5C0CA 1YEKH 4HLZG 3W0WB 1MEXL 1IGMH 4BZ1H 1A6AB 2D7PA 1T6WA 2NY1C 4YHOL 5FYLE 4LRNH 1A8JH 2IAND 4NCC1 5IKCA 3R4DA 5KW9L 2X4PA 1KIQB 2ITDA 1QUNA 3CUPB 1DR9A 5DTFB 3O9WB 3BDXA 1Q0YL 3WFZA 4PRIA 4KJWD 2E7LA 1RZKL 3HAEA 5D70H 4M6AA 1D5ZA 3TZVA 3LN9A 4DK6A 12E8H 2J4WH 5I9QB 2FGWL 1CD1B 1AR1D 5GRUH 3TNMA 1LE9A 1JF5A 2HN7B 2AJSL 1A64A 2R29L 4XHJC 3VFVA 3U4EB 1NCAH 3EYFA 3GEWB 4JQIL 1MWAL 1U36A 2H2PC 1MNUL 2RQ8A 3HS0B 2O5XH 3O2DL 4S11A 2OSLA 2BRQA 5JZ7D 5IHUH 1HI6B 4I3SL 2A9NL 1NGWA 2XKNA 2BXYA 3LB6C 4G3YL 1DANT 1JTOA 4U31A 4A2LA 5E08L 4P2OA 4Q9QH 4H88H 3QUZC 5DMKB 1MFCH 5ISZA 1YMME 1KCSH 3QAZB 5FYLH 1DQJA 2C3GA 3BAEH 4WDIA 2EE6A 3BH9A 5EUOB 1BFSA 1WTGT 3MRRB 3GI8L 4ZO6A 5EU6A 3FAXA 2WLZA 4WHYH 3VFWB 3UBXB 1ZA6B 5IHLB 1WAAE 2EKSB 2WWMD 5DK3A 3SO5A 3VFTA 1NAMH 2D3VA 1KBGL 3UC0L 1SBSL 3AUVA 4PV9B 4J2XA 5LGHH 4PJCE 5HGGS 4QRQB 3H7LA 5MI0B 1NCWH 1B4JL 3PWPD 4J12A 1V3LA 5CUSH 2DTMH 2FECI 2JE8A 5H94A 4OF7A 3H0TA 1A7QL 1PG7X 4I0PA 4OLVH 8CGTA 1OSPL 4K9EL 4U1LA 3H6JA 1O7SA 5GGSB 2CJUL 4RGNB 3DETD 3S97C 2A38A 2GTZB 3CDFA 1BMGA 1P53A 2PW1B 1JZ4A 3WFHB 4G9FA 2ESVA 4W6WB 5L0QC 5FCSH 1I1AC 1XEDA 2NY0B 4LPTA 2DTSA 5ADOL 1YMMD 1ZHLA 3RX8A 3BPOC 4NJAL 3T0VA 1ND0A 2UZIH 4AH2A 2V9RA 1ZAGA 3MUGB 3LKOA 4JFDD 5FK9B 5MEQA 2VLRE 2W9DL 4NQDD 3SCMD 1TVHA 4P2YA 3IDMA 5BV7B 5EZIH 1BZ7B 1IILE 1QLEH 4YHIA 1JTTA 1QO3A 1UEMA 1CE1H 3OX8A 3R06A 5E8NA 4ZS7H 1IAKB 1YEFL 3DXAB 4AZ8A 3VDBA 2YD1A 2NY2D 3LHPL 2M26A 3O8XD 1UXSA 3HLAA 3MRFB 1VACA 1R5WA 1HHGB 1T2XA 4J8RA 4EI6A 2CRZA 2NW2A 5JXEC 5MEND 4KUCD 3LQAL 4EOWH 3I6LE 4BQBA 3RVXD 3B8YA 3L5XH 3P30L 1S7TB 5DVKA 4ETQA 4WFGD 4NJ9H 4OZFA 2PYEB 3VFUB 2MCPL 1IKNA 4XNUL 4OF3A 3QO1A 2KDGA 3RWJB 5KJRH 1CICC 1U8HB 5A16B 1IC4H 4UINH 4WUKH 1SY6A 3JWOC 1RZJC 2Y72A 1FG2A 4RIRA 1YY8B 2P4AB 4L3CB 1EPFA 3FN0H 3LRSA 3MYJB 4NT6B 3L5JA 1E27A 3E6FB 3TJEH 1X5YA 4AQOA 4M1GL 3RPIA 3PUCA 3BKYH 3M17B 2IFFH 4WI7A 4LEXH 3U1SH 1WJ3A 3HI1A 2GI7A 4NC0B 1X3DA 4N0UA 2XTJC 3O6KL 2VH5L 3U9PL 1IFHL 1IARB 2OTWA 3SE8H 1UVQA 3G6JF 2FL5B 1MLCA 4NQXB 5I16A 1T89A 1PBYA 1H3UA 4U3HA 5TE7H 1VHPA 4M4PA 4HIJB 3GJFB 3I6LD 5D2NE 4NQEB 4EI5C 5I8EB 3WSQL 1BQHG 1AD0A 2YEZA 2X1WL 4Z18A 1JNLH 2PETA 3NGBB 2V7NB 4FQXB 5AG9A 4I48A 1MCOL 2R9HD 2QQNL 5F9WC 3JWDC 2I9TB 3HUJA 4GRWB 4OD3L 2X4SB 5CLTA 1J8HA 4F15C 1FAIH 5D6CB 4DWHA 4XNMB 4NUJB 3ZLQC 5DQJB 2Y5EA 5F7YC 5BVPH 4U1GB 1QQDA 3MRLA 1UWGL 1P4LA 4R2GB