1NBXA

Streptavidin mutant y43a at 1.70a resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
120
structure length
120
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTAESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Structural studies of hydrogen bonds in the high-affinity streptavidin-biotin complex: mutations of amino acids interacting with the ureido oxygen of biotin.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 23
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1nbxA00
1DF8A 1PTSA 3X00A 2UYWA 4BJ8A 2Y3FA 3WZQA 3PK2A 1KL4A 1SWLA 4I60A 2BC3A 2FHLA 1HQQA 1VWMB 1NQNA 2C1QA 1SWUA 1SWDA 2RTKA 4BX5B 1HXLA 2IZLB 4BX6A 4GGRA 3VHMA 1RSTB 4Z6JA 3FDCA 4JO6A 3WYPA 5F2BA 4GDAA 3WZNA 1SLDB 1LCWA 2RTBB 4Z28A 2RTOB 4GGTA 1VWQB 4Z27A 1VWHB 4Z2OA 5B5FA 2RTLA 1N43A 2IZFB 3RY1A 1VWNB 4CPEA 1SWSA 4Z2PA 2RTEB 2OF8A 1SWOA 3SZHA 2RTIB 2RTJA 5IRAA 1HY2A 1VWAB 1AVEA 1VWRB 2IZJA 2RTQB 4Y5DA 3SZIA 4YVBA 1STRB 1KFFA 1NDJA 1VWOB 1STSB 1SWJA 5K68A 4DNEA 1VWCB 2OF9A 4OKAA 3RE5A 1RXJA 1MK5A 2IZDB 2FHNX 1SWPA 1LCZA 3RDMA 4BBOA 4BX7A 4BX6B 2GH7A 3T2WA 3RDOA 1RAVA 1STPA 2AVIA 5CHKA 1SWGA 4BCSA 4GJSA 2IZIA 2RTFB 5K67A 1SWTA 1SWQA 3EW1A 1SLEB 1RXHA 1N9MA 2G5LA 2IZHB 2C1SA 2MF6A 1RSUB 2UZ2A 1SWAA 4JNJA 3T6LA 1VWKB 4CPHA 3RDXA 1VWIB 1AVDA 4CPFA 1KL3A 5B5GA 1SRFA 2C4IA 1LDOA 5IRWA 1NC9A 1N4JA 1SWHA 2RTNB 2IZEB 1VWFB 2RTRB 2RTCB 1Y52X 4CPHB 3RE6A 1LELA 1MM9A 2QCBA 2OFAA 2JGSA 3EW2A 1SWRA 1SWFA 2A5CA 3RDSA 2IZAA 1MEPA 4GD9A 3WZPA 1NBXA 2OFBA 2RTAA 3SZJA 1SWKA 4BX5A 4U46A 3VHHA 2A5BA 4BX7B 1SWEA 1Y53X 2RTMA 2RTPB 2WPUA 4IRWA 3RDUA 2A8GA 3WYQA 3T2XA 3MG5A 2CAMA 3VHIA 4CPIA 5IRUA 1I9HA 3T6FA 1SRJA 2RTHB 1WBIA 2F01A 1VWDB 2IZKA 3RY2A 5CSEA 5JD2A 5L3YA 2RTDB 1VWEB 1LDQA 2IZGB 3VGWA 2Y3EA 1VYOA 1VWGB 4EKVA 3WZOA 1N7YA 1N9YA 1SWCA 1SWBA 1SWNA 2IZCB 2IZBA 4GGZA 1SLGB 1SRHA 1Y55X 1LCVA 1LUQA 1VWBB 1SREA 1VWPB 4Z2VA 1SRIA 1HXZA 3MM0A 1MOYA 2RTGB 1RXKA 1VWLB 4JHQA 1NQMA 4Y59A 1SLFB 3RDQA 2Y32A 2ZSCA 4GJVA 1KL5A 1VWJB 1SRGA 1IJ8A
chains in the Genus database with same CATH superfamily
3VE2A 1IKEA 1DC9A 2QOMA 2LBVA 3WZQA 1X71A 2FS6A 2A0AA 3CR6A 1EI5A 1KL4A 1LFOA 1X8OA 4TKHA 5EZ2A 3WJGA 1VWMB 2FRSA 1NQNA 2Q9SA 4YBPA 1SWUA 4EFGA 4BX5B 1JJUA 2IZLB 5BYPA 5LKEA 3CQRA 1BSOA 2RCTA 1GT4A 2W2AA 2FKJA 5IO7A 2Z4HA 1RSTB 1Y0GA 3HWFA 3WJCA 2FTBA 1SY1A 1YWAA 3BX8A 4GDAA 4GE1A 4ORSA 1TXLA 2LB6A 5F2BA 1G85A 3FA9A 4Z28A 3TGCA 1BSYA 2QM9A 4GGTA 4GUZA 1MVGA 4I6SA 2FLJA 2RTLA 5H8TA 1GT5A 3FYFA 1EIIA 2IZFB 1JZUA 1OSPO 1VWNB 1SWSA 2RN4A 3BS2A 5B10O 4YCEA 2IFBA 2OF8A 2RTEB 4IAWA 4Z2PA 1W4TA 2XKLA 4Y0QA 2QMIA 1EXSA 3PQSA 1GKAA 1ZNEA 4CV7A 2KT4B 5F58A 1D2UA 1AVEA 1HMRA 1VWRB 3KFIA 1JJXA 3B2LA 1VYGA 4Y5DA 3SZIA 3K3LA 2P8GA 4IMNA 4IB9A 4ZGFA 2POAA 3ZW1A 1H91A 1ICNA 1EPBA 3VG2A 5D4AA 3ZUIA 1SWJA 1E06A 1OBUA 1JJJA 1SXYA 5K68A 1DZPA 2R73A 3RE5A 2OF9A 2L5PA 2FT9A 1LIFA 1NP1A 2GC9A 2JN3A 3FR2A 1ML7A 2AT3X 2GTLO 4O4XA 4R0BA 1CRBA 3EBWA 3P6FA 3WOVA 4BX6B 4GU8A 3HOLA 3U0DA 3C76X 2X55A 3PEDA 2OY5O 3FW5A 1S44A 3RDOA 4NV7A 3T2WA 4A60A 4CK4A 4EQAC 5CHKA 1SWGA 4I3BA 4BCSA 4XMGA 2ACPX 3S5VA 2RTFB 3CWKA 1MDCA 2ASNX 1SWQA 4O3YA 3IFBA 5K67A 1JYJA 1SLEB 1FENA 2EU7X 4ZR2A 3ZWEA 2C1SA 2MF6A 1RSUB 3B2KA 1SWAA 2AT0X 2JU3A 3NADA 4OMXA 4U8UO 4CPHA 4O4UA 2AL0X 1W5RA 1SRFA 2C4IA 3FW4A 2QOSC 2X34A 3APUA 1FELA 2RTNB 1VWFB 3APWA 1CBIA 2RTCB 4L1NA 2PY1A 2X8FA 3FEKA 1LELA 2QCBA 1RBPA 5HCEC 3ZW2A 3ZQ3A 5FQ7E 4KIIA 2KTDA 5HA0A 1SWFA 1KZXA 2ALLX 1G5WA 3V8UA 3NP1A 1OPBA 3B2IA 4GD9A 3FA8A 1A3YA 4TLJA 1BSQA 3AKNA 3BY0A 2OFBA 4MIRA 4ZFXA 3P02A 3STMX 4ALBA 2A2UA 4U46A 5EEEA 2MHDA 2DJGA 1KOIA 3SAOA 2WPUA 3RDUA 4CPIA 3WYQA 2A8GA 2G7BA 1GX3A 5K06A 2CAMA 3VHIA 4CDDA 5CE4A 3U03A 1IKJA 1FTPA 3ZW0A 2RQ0A 4O4OA 3P6CA 1VWDB 2LA7A 1YP7A 2X8SA 4EXZA 1LDQA 2BT9A 1YWBA 1EUOA 1AVGI 1B0OA 1VWGB 1P6PA 3BU1A 3MX7A 1I4UA 4ORYA 3WZOA 1ADLA 1KXOA 2GTFX 4GGZA 2OVAA 4AZQA 1BLRA 3WBGA 1Y9TA 3DSZA 1SRIA 1GT3A 2G8CO 1RXKA 3VG3A 1VWLB 1SLFB 2FGSA 2Y32A 4GJVA 1O1UA 4GZVA 3T1DA 3TGAA 2WEWA 2MO5A 4U3QA 3HTYA 4FBRA 1IJ8A 1DF8A 2Y3FA 2X45A 4PSQA 5DG4A 3ZI8A 1B56A 1PMPA 4WFUA 2K23A 4RUUA 1BBPA 4NP1A 4U9CA 1JQPA 5F6BA 1OEEA 2WUTA 2Q2PA 3NQ9A 4KC7A 4A8ZA 4NNTA 4Y0RA 4ORRA 2C1QA 2RTKA 1A18A 5KICA 3VHMA 2L9CA 2RCQA 1D3SA 2LKKA 5HCCC 2Q39A 3EBKA 4M7MA 2A13A 2W2BA 3PPTA 3D96A 2I5VO 1A57A 1NP4A 2FR2A 4KC8A 4Z27A 1VWQB 3STKA 1I05A 1SXWA 2QO5A 3ZUOA 5B5FA 3FMZA 1N43A 4OS8A 4ZH6A 4LZUA 4LQZA 3STNA 4CDEA 4CPEA 5EDBA 2K62A 3SZHA 3TZSA 1DZJA 1BEBA 3C78X 4AYHA 2AT6X 2HMBA 1X89A 2WR6A 2WSJA 3EMMA 1SA8A 5CYBA 4YVBA 2WQAE 3BSZE 3PP6A 1PEEA 1KFFA 1QFVA 4QRLA 2OY8A 3B2HA 3F6ZB 3LV4A 1B4MA 5B27A 3CKGA 3KVNA 4IABA 4YFPA 4DNEA 4GNWA 4YGGA 3B2JA 1SMPI 4XMCA 5AEOA 1OEKA 1XCAA 5HZ5A 3VG4A 4IB8A 4A1HA 4ZJ0A 1FEMA 4BBOA 5EPQA 4BX7A 3DTQA 1EW3A 3TF6A 4ZHDA 1IW2A 1HBQA 2R74A 1LNMA 4D6BA 5F1EA 1S2PA 3GE2A 1ERXA 4GJSA 4QNIA 5AJBA 1SWTA 1YIVA 3UEWA 1KT4A 1SY3A 2IZHB 4GETA 4HFOA 4QYPA 2XSTA 3HWEA 3T6LA 5LJHA 4YDBA 1BWYA 3RDXA 1VWIB 1AVDA 1I06A 4MVIA 1KL3A 1LIDA 1U18A 2X32A 1HMSA 2KD2A 3FA7A 4LZVA 1NC9A 1DV9A 3KFHA 2AH7X 4INNA 5JR8A 4FQBB 3SLTA 3Q34A 3L4RA 4B55A 4CPHB 5HZ8A 5H9NA 3RBYA 1FDQA 4GDZA 3KQ0A 3FENA 4GRJA 2YG2A 1G7NA 1MEPA 1X8UA 2OVDA 1K24A 2AF5A 4WHIA 1SXUA 1NBXA 3BU9A 3SOTA 3VE1A 2MWHA 1LICA 3MBTA 4BX5A 1LKEA 3O19A 1VPRA 4ORWA 2L67A 2RD7C 1CJ5A 2M4LA 3MG5A 4ML7B 1I9HA 3NR3A 1SRJA 4IAXA 3RSWA 5HZ9A 1KZWA 1WBIA 2OYBO 2IZKA 3KZAA 3RY2A 4N7CA 1ZNHA 3OJYC 5JD2A 3VGWA 3CBCA 3VG6A 1TVQA 4C5PA 3D4RA 4HPBA 4ES7A 1IIUA 4ZHFA 5IO5A 1K3BA 4TNNA 4Y0SA 2IZCB 1LIBA 4OEMA 2FWVA 1SRHA 1Y55X 2LFOA 1LUQA 1VWBB 2QO6A 1SREA 2WWPA 3ELXA 3FIQA 3BX7A 4L3RA 4Y0PA 4DQ4A 5HWZA 1MOYA 1QABE 2RTGB 3AEHA 4I9SA 1TOUA 4BGFA 4BQUA 4QGVA 5B29A 1BJ7A 1NQMA 2NNQA 2NNDA 4YBUA 1LIEA 3CQNA 3TGBA 3JS1A 1ICMA 1Y9LA 1KL5A 2F73A 3ELZA 3OD9A 5HTEA 5LJBA 1KQWA 1SRGA 4BJ8A 4HPAA 1BM5A 3AKMA 1IFCA 1SWLA 4HPDA 3S60A 4N7DA 1KQXA 1YWCA 2BC3A 2N93A 2FHLA 1HQQA 1R0UA 4AZNA 4O49A 1JIWI 1HXLA 4BX6A 1ACDA 4ORXA 4ZCBA 4O3XB 3VG5A 3CBSA 4TKBA 1DZMA 4MISA 2W2FA 2HZRA 3FDCA 5HAEA 1PBOA 1MX8A 2RTBB 1LCWA 3FELA 3OBLA 3WZNA 3RKGA 2FKGA 1EIOA 2A3FX 2X46A 3D97A 5B11O 4Z2OA 3NQ3A 5HZQA 2VFCA 5KIDA 1QFTA 1ALBA 1GX9A 4D6AA 2OVEA 4YGZA 4FBOA 1Z24A 1CBQA 4IBAA 4O9SA 5D45A 3D95A 4TJZA 3UEVA 1HMTA 2JW1A 2FR3A 2VFBA 2VDFA 3ZZVA 2RTJA 1O8VA 4NYQA 4CDFA 1VWAB 2IZJA 1IFBA 4EDEA 3P6DA 4NW4A 1TW4A 1T8VA 1U17A 2CM4A 2AMMX 1KT3A 2RTQB 4IMOA 2HKDA 4QGXA 4GK9A 1KT5A 3EM0A 4QAEA 5HA1A 1HBPA 1NDJA 1VWOB 1E02A 4AZPA 1JYDA 2HZQA 4YGHA 2JOZA 5L8NA 1PBYA 4AZRA 4AW8A 3U9PC 3OE3A 1SY0A 1SY2A 2OL6O 1SWPA 3JSQA 3RDMA 4YKOA 1EQDA 4ALOA 1OEJA 2GH7A 3I17A 4NNSA 3MVFA 2Q4NA 4YFRA 2OY1O 3KFGA 1QG5A 2R56A 3S5XA 2IZIA 2BLGA 2X8TA 3FEPA 4YKMA 2BSZA 1TOWA 3EW1A 1RXHA 1N9MA 2G5LA 4JNJA 4LKTA 3O22A 2UZ2A 3HWDA 1VYFA 4CPFA 5FENA 1OPAA 2JU8A 3PH6A 5LKFA 3IA8A 3UEUA 3WJDA 2KTSA 1HQPA 1SWHA 4PJ2A 5IRWA 1AB0A 2IZEB 1GKAB 2PI3O 2RTRB 2GTLM 1I78A 3PECA 5IO6A 3RE6A 1GM6A 1MM9A 4ID2A 1YP6A 1KGLA 5FQ6E 1SWRA 1SXXA 3WXQA 2A5CA 3ZW1B 3VPJE 4ZHCA 1DF3A 3LTWA 3LHNA 2HNXA 4QZTA 4M6SA 1RLBE 2JU7A 5H9AA 3FR5A 5H9LA 5FQ8E 4U8UM 1MX7A 5BVSA 1JV4A 3SZJA 1SWKA 3NX2A 1A2DA 4I3DA 4YFQA 5AQ6A 1SWEA 1Y53X 2GJ5A 2RTMA 2RTPB 1QWDA 3HPEA 1U0XA 4IRWA 1X8QA 3T2XA 3WJBA 1HN2A 5IRUA 3NBXX 1GGLA 3E3CA 3Q6LA 4HPCA 2WQ9A 2RTHB 3P6GA 2F01A 4YDAA 3T6FA 1OBQA 2BHVA 2BS6A 2LBAA 3NQKA 1N0SA 4QGWA 5CSEA 5BVQA 5L3YA 2RTDB 1VWEB 3FA6A 1ZNLA 2IZGB 4YCHA 2I5ZO 5LJDA 4DQ3A 3EC5A 1ERBA 2GTLN 4ZHGA 2KW1A 1FJ1E 2ACOA 3FLLA 1SWBA 2AT8X 4NYRA 4WBKA 2RA6A 2IZBA 3HK1A 4GKCA 2QO4A 5H9KA 5HBSA 1LCVA 3N91A 1VWPB 1OBPA 5EEDA 5IXGA 3HOEA 3EYCA 1HXZA 1S7DA 3MM0A 4IB7A 5F6ZA 4XMHA 2HYSA 4KCAA 4OS3A 3WVMA 2AT5X 4AZMA 4Y59A 2ZSCA 3QKGA 4CSBA 1VWJB 3KFFA 4U8UN 5L8OA 1KT7A 1PTSA 3X00A 2UYWA 2OL7A 3CKFA 3PK2A 1EPAA 4I3CA 4I60A 4EEJA 1W6FA 1YUPA 5LJEA 1QY1A 1ZNKA 1SWDA 2NP1A 5EDCA 2CM9A 4GGRA 4UU3A 5DPQA 4MEEA 3PDFA 5L8IA 3C77X 2OFMX 3SLOA 1UYNX 4CDCA 4Z6JA 3WYPA 4JO6A 3FR4A 3ZW0B 3PQUA 1SLDB 4K19A 4DCBA 3P24A 3UEXA 5KHPA 2RTOB 2ZAIA 2HLVA 1VWHB 2JMBA 2G79A 2F09A 3SLJA 3VU1A 3QQ2A 3F8AA 3F9DA 4OS0A 2FS7A 4MVKA 4KT5A 4ON1A 2AKQA 2DJFA 5D8JA 3RY1A 3CMPA 3S26A 3VG7A 2ZAGA 3D9WA 3FIDA 1SWOA 1ZNDA 2RTIB 3BDRA 2NNEA 1QQSA 1HY2A 5IRAA 5HCDC 3H3IA 1X8NA 3RWXA 5FFHA 2MM3A 4RUNA 4OMWA 1STRB 2OY7A 1BRQA 1E00A 1CBRA 1GX8A 3APXA 1YWDA 1STSB 2WEXA 4XMFA 1JMZA 1UREA 1B8EA 1GT1A 1PM1X 5LJGA 1VWCB 4OKAA 1RXJA 4NLJA 1MK5A 4JGLA 2IZDB 5BVTA 2FHNX 5HZ6A 4GH7A 2L68A 5LJKA 1LCZA 4BVMA 3JQOA 4ZGUA 4I9RA 4O3ZA 1RAVA 1T0VA 1XKIA 1LF7A 1STPA 2AVIA 2OL8O 1QY2A 1UZ2X 3BRNA 3P6HA 4I95A 3UAQA 1LPJA 1CBSA 1QY0A 4TKJA 3G7XA 4MVEA 4ODDA 4ARHA 2OVSA 1VWKB 2DM5A 2Q2MA 2X4MA 2G78A 4ZH9A 4KH8A 4MVLA 2E4JA 5B5GA 3PH5A 1FE3A 1LDOA 5B3MO 4BOEA 1N4JA 4NV8A 1L6MA 3O2YA 2CZTA 5LJCA 2YMSA 1Y52X 4TQ2A 4QZUA 4LKPA 2OFAA 2CBSA 2JGSA 2CBRA 2OZQA 3EW2A 1BRPA 1DZKA 3NPOA 3P6EA 4QYNA 4IB6A 2OFRX 3WJEA 2BS5A 5F7GA 5B2AO 3NX1A 4WFVA 3RDSA 1GXAA 2IZAA 4A1YA 1T68X 1E2TA 3WZPA 4AZOA 1UYOX 1ZNGA 2RTAA 1DFVA 4COTA 3VHHA 2A5BA 4O4SA 1JMXA 2MJIA 4BX7B 3APVA 5D48A 5FAZA 3WJFA 5C0NA 2Z4IA 5AJCA 4YMYA 1ZRYA 4FBVA 4FGIB 1E5PA 4HWMA 4XMEA 1X8PA 4UU2A 3RZYA 3GAQA 5D47A 4YH0A 3AUMO 5HTDA 4OELA 2Y3EA 4ORUA 1VYOA 2CZUA 4EKVA 1I04A 1N7YA 1N9YA 1SWCA 1SWNA 1AELA 1SLGB 2A2GA 4Z2VA 2ANSA 2X56A 1JBHA 4ZHHA 1KT6A 1NGLA 1O1VA 4GNYA 3I0AA 4JHQA 3RDQA 1AQBA 1EALA 4O3WA 1G74A 1MUPA 2O62A 3HWGA 1WUBA 4NLIA 4XMDA 4QQ1A 3BLGA
chains in the Genus database with same CATH topology
1DF8A 1PTSA 3X00A 2UYWA 4BJ8A 2Y3FA 3WZQA 3PK2A 1KL4A 1SWLA 4I60A 2BC3A 2FHLA 1HQQA 1VWMB 1NQNA 2C1QA 1SWUA 1SWDA 2RTKA 4BX5B 1HXLA 2IZLB 4BX6A 4GGRA 3VHMA 1RSTB 4Z6JA 3FDCA 4JO6A 3WYPA 5F2BA 4GDAA 3WZNA 1SLDB 1LCWA 2RTBB 4Z28A 2RTOB 4GGTA 1VWQB 4Z27A 1VWHB 4Z2OA 5B5FA 2RTLA 1N43A 2IZFB 3RY1A 1VWNB 4CPEA 1SWSA 4Z2PA 2RTEB 2OF8A 1SWOA 3SZHA 2RTIB 2RTJA 5IRAA 1HY2A 1VWAB 1AVEA 1VWRB 2IZJA 2RTQB 4Y5DA 3SZIA 4YVBA 1STRB 1KFFA 1NDJA 1VWOB 1STSB 1SWJA 5K68A 4DNEA 1VWCB 2OF9A 4OKAA 3RE5A 1RXJA 1MK5A 2IZDB 2FHNX 1SWPA 1LCZA 3RDMA 4BBOA 4BX7A 4BX6B 2GH7A 3T2WA 3RDOA 1RAVA 1STPA 2AVIA 5CHKA 1SWGA 4BCSA 4GJSA 2IZIA 2RTFB 5K67A 1SWTA 1SWQA 3EW1A 1SLEB 1RXHA 1N9MA 2G5LA 2IZHB 2C1SA 2MF6A 1RSUB 2UZ2A 1SWAA 4JNJA 3T6LA 1VWKB 4CPHA 3RDXA 1VWIB 1AVDA 4CPFA 1KL3A 5B5GA 1SRFA 2C4IA 1LDOA 5IRWA 1NC9A 1N4JA 1SWHA 2RTNB 2IZEB 1VWFB 2RTRB 2RTCB 1Y52X 4CPHB 3RE6A 1LELA 1MM9A 2QCBA 2OFAA 2JGSA 3EW2A 1SWRA 1SWFA 2A5CA 3RDSA 2IZAA 1MEPA 4GD9A 3WZPA 1NBXA 2OFBA 2RTAA 3SZJA 1SWKA 4BX5A 4U46A 3VHHA 2A5BA 4BX7B 1SWEA 1Y53X 2RTMA 2RTPB 2WPUA 4IRWA 3RDUA 2A8GA 3WYQA 3T2XA 3MG5A 2CAMA 3VHIA 4CPIA 5IRUA 1I9HA 3T6FA 1SRJA 2RTHB 1WBIA 2F01A 1VWDB 2IZKA 3RY2A 5CSEA 5JD2A 5L3YA 2RTDB 1VWEB 1LDQA 2IZGB 3VGWA 2Y3EA 1VYOA 1VWGB 4EKVA 3WZOA 1N7YA 1N9YA 1SWCA 1SWBA 1SWNA 2IZCB 2IZBA 4GGZA 1SLGB 1SRHA 1Y55X 1LCVA 1LUQA 1VWBB 1SREA 1VWPB 4Z2VA 1SRIA 1HXZA 3MM0A 1MOYA 2RTGB 1RXKA 1VWLB 4JHQA 1NQMA 4Y59A 1SLFB 3RDQA 2Y32A 2ZSCA 4GJVA 1KL5A 1VWJB 1SRGA 1IJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF8 A;  1PTS A;  3X00 A;  2UYW A;  4BJ8 A;  2Y3F A;  3WZQ A;  3PK2 A;  1KL4 A;  1SWL A;  4I60 A;  2BC3 A;  2FHL A;  1HQQ A;  1VWM B;  1NQN A;  2C1Q A;  1SWU A;  1SWD A;  2RTK A;  4BX5 B;  1HXL A;  2IZL B;  4BX6 A;  4GGR A;  3VHM A;  1RST B;  4Z6J A;  3FDC A;  4JO6 A;  3WYP A;  5F2B A;  4GDA A;  3WZN A;  1SLD B;  1LCW A;  2RTB B;  4Z28 A;  2RTO B;  4GGT A;  1VWQ B;  4Z27 A;  1VWH B;  4Z2O A;  5B5F A;  2RTL A;  1N43 A;  2IZF B;  3RY1 A;  1VWN B;  4CPE A;  1SWS A;  4Z2P A;  2RTE B;  2OF8 A;  1SWO A;  3SZH A;  2RTI B;  2RTJ A;  5IRA A;  1HY2 A;  1VWA B;  1AVE A;  1VWR B;  2IZJ A;  2RTQ B;  4Y5D A;  3SZI A;  4YVB A;  1STR B;  1KFF A;  1NDJ A;  1VWO B;  1STS B;  1SWJ A;  5K68 A;  4DNE A;  1VWC B;  2OF9 A;  4OKA A;  3RE5 A;  1RXJ A;  1MK5 A;  2IZD B;  2FHN X;  1SWP A;  1LCZ A;  3RDM A;  4BBO A;  4BX7 A;  4BX6 B;  2GH7 A;  3T2W A;  3RDO A;  1RAV A;  1STP A;  2AVI A;  5CHK A;  1SWG A;  4BCS A;  4GJS A;  2IZI A;  2RTF B;  5K67 A;  1SWT A;  1SWQ A;  3EW1 A;  1SLE B;  1RXH A;  1N9M A;  2G5L A;  2IZH B;  2C1S A;  2MF6 A;  1RSU B;  2UZ2 A;  1SWA A;  4JNJ A;  3T6L A;  1VWK B;  4CPH A;  3RDX A;  1VWI B;  1AVD A;  4CPF A;  1KL3 A;  5B5G A;  1SRF A;  2C4I A;  1LDO A;  5IRW A;  1NC9 A;  1N4J A;  1SWH A;  2RTN B;  2IZE B;  1VWF B;  2RTR B;  2RTC B;  1Y52 X;  4CPH B;  3RE6 A;  1LEL A;  1MM9 A;  2QCB A;  2OFA A;  2JGS A;  3EW2 A;  1SWR A;  1SWF A;  2A5C A;  3RDS A;  2IZA A;  1MEP A;  4GD9 A;  3WZP A;  1NBX A;  2OFB A;  2RTA A;  3SZJ A;  1SWK A;  4BX5 A;  4U46 A;  3VHH A;  2A5B A;  4BX7 B;  1SWE A;  1Y53 X;  2RTM A;  2RTP B;  2WPU A;  4IRW A;  3RDU A;  2A8G A;  3WYQ A;  3T2X A;  3MG5 A;  2CAM A;  3VHI A;  4CPI A;  5IRU A;  1I9H A;  3T6F A;  1SRJ A;  2RTH B;  1WBI A;  2F01 A;  1VWD B;  2IZK A;  3RY2 A;  5CSE A;  5JD2 A;  5L3Y A;  2RTD B;  1VWE B;  1LDQ A;  2IZG B;  3VGW A;  2Y3E A;  1VYO A;  1VWG B;  4EKV A;  3WZO A;  1N7Y A;  1N9Y A;  1SWC A;  1SWB A;  1SWN A;  2IZC B;  2IZB A;  4GGZ A;  1SLG B;  1SRH A;  1Y55 X;  1LCV A;  1LUQ A;  1VWB B;  1SRE A;  1VWP B;  4Z2V A;  1SRI A;  1HXZ A;  3MM0 A;  1MOY A;  2RTG B;  1RXK A;  1VWL B;  4JHQ A;  1NQM A;  4Y59 A;  1SLF B;  3RDQ A;  2Y32 A;  2ZSC A;  4GJV A;  1KL5 A;  1VWJ B;  1SRG A;  1IJ8 A; 
#chains in the Genus database with same CATH topology
 3VE2 A;  1IKE A;  1DC9 A;  2QOM A;  2LBV A;  3WZQ A;  1X71 A;  2FS6 A;  2A0A A;  3CR6 A;  1EI5 A;  1KL4 A;  1LFO A;  1X8O A;  4TKH A;  5EZ2 A;  3WJG A;  1VWM B;  2FRS A;  1NQN A;  2Q9S A;  4YBP A;  1SWU A;  4EFG A;  4BX5 B;  1JJU A;  2IZL B;  5BYP A;  5LKE A;  3CQR A;  1BSO A;  2RCT A;  1GT4 A;  2W2A A;  2FKJ A;  5IO7 A;  2Z4H A;  1RST B;  1Y0G A;  3HWF A;  3WJC A;  2FTB A;  1SY1 A;  1YWA A;  3BX8 A;  4GDA A;  4GE1 A;  4ORS A;  1TXL A;  2LB6 A;  5F2B A;  1G85 A;  3FA9 A;  4Z28 A;  3TGC A;  1BSY A;  2QM9 A;  4GGT A;  4GUZ A;  1MVG A;  4I6S A;  2FLJ A;  2RTL A;  5H8T A;  1GT5 A;  3FYF A;  1EII A;  2IZF B;  1JZU A;  1OSP O;  1VWN B;  1SWS A;  2RN4 A;  3BS2 A;  5B10 O;  4YCE A;  2IFB A;  2OF8 A;  2RTE B;  4IAW A;  4Z2P A;  1W4T A;  2XKL A;  4Y0Q A;  2QMI A;  1EXS A;  3PQS A;  1GKA A;  1ZNE A;  4CV7 A;  2KT4 B;  5F58 A;  1D2U A;  1AVE A;  1HMR A;  1VWR B;  3KFI A;  1JJX A;  3B2L A;  1VYG A;  4Y5D A;  3SZI A;  3K3L A;  2P8G A;  4IMN A;  4IB9 A;  4ZGF A;  2POA A;  3ZW1 A;  1H91 A;  1ICN A;  1EPB A;  3VG2 A;  5D4A A;  3ZUI A;  1SWJ A;  1E06 A;  1OBU A;  1JJJ A;  1SXY A;  5K68 A;  1DZP A;  2R73 A;  3RE5 A;  2OF9 A;  2L5P A;  2FT9 A;  1LIF A;  1NP1 A;  2GC9 A;  2JN3 A;  3FR2 A;  1ML7 A;  2AT3 X;  2GTL O;  4O4X A;  4R0B A;  1CRB A;  3EBW A;  3P6F A;  3WOV A;  4BX6 B;  4GU8 A;  3HOL A;  3U0D A;  3C76 X;  2X55 A;  3PED A;  2OY5 O;  3FW5 A;  1S44 A;  3RDO A;  4NV7 A;  3T2W A;  4A60 A;  4CK4 A;  4EQA C;  5CHK A;  1SWG A;  4I3B A;  4BCS A;  4XMG A;  2ACP X;  3S5V A;  2RTF B;  3CWK A;  1MDC A;  2ASN X;  1SWQ A;  4O3Y A;  3IFB A;  5K67 A;  1JYJ A;  1SLE B;  1FEN A;  2EU7 X;  4ZR2 A;  3ZWE A;  2C1S A;  2MF6 A;  1RSU B;  3B2K A;  1SWA A;  2AT0 X;  2JU3 A;  3NAD A;  4OMX A;  4U8U O;  4CPH A;  4O4U A;  2AL0 X;  1W5R A;  1SRF A;  2C4I A;  3FW4 A;  2QOS C;  2X34 A;  3APU A;  1FEL A;  2RTN B;  1VWF B;  3APW A;  1CBI A;  2RTC B;  4L1N A;  2PY1 A;  2X8F A;  3FEK A;  1LEL A;  2QCB A;  1RBP A;  5HCE C;  3ZW2 A;  3ZQ3 A;  5FQ7 E;  4KII A;  2KTD A;  5HA0 A;  1SWF A;  1KZX A;  2ALL X;  1G5W A;  3V8U A;  3NP1 A;  1OPB A;  3B2I A;  4GD9 A;  3FA8 A;  1A3Y A;  4TLJ A;  1BSQ A;  3AKN A;  3BY0 A;  2OFB A;  4MIR A;  4ZFX A;  3P02 A;  3STM X;  4ALB A;  2A2U A;  4U46 A;  5EEE A;  2MHD A;  2DJG A;  1KOI A;  3SAO A;  2WPU A;  3RDU A;  4CPI A;  3WYQ A;  2A8G A;  2G7B A;  1GX3 A;  5K06 A;  2CAM A;  3VHI A;  4CDD A;  5CE4 A;  3U03 A;  1IKJ A;  1FTP A;  3ZW0 A;  2RQ0 A;  4O4O A;  3P6C A;  1VWD B;  2LA7 A;  1YP7 A;  2X8S A;  4EXZ A;  1LDQ A;  2BT9 A;  1YWB A;  1EUO A;  1AVG I;  1B0O A;  1VWG B;  1P6P A;  3BU1 A;  3MX7 A;  1I4U A;  4ORY A;  3WZO A;  1ADL A;  1KXO A;  2GTF X;  4GGZ A;  2OVA A;  4AZQ A;  1BLR A;  3WBG A;  1Y9T A;  3DSZ A;  1SRI A;  1GT3 A;  2G8C O;  1RXK A;  3VG3 A;  1VWL B;  1SLF B;  2FGS A;  2Y32 A;  4GJV A;  1O1U A;  4GZV A;  3T1D A;  3TGA A;  2WEW A;  2MO5 A;  4U3Q A;  3HTY A;  4FBR A;  1IJ8 A;  1DF8 A;  2Y3F A;  2X45 A;  4PSQ A;  5DG4 A;  3ZI8 A;  1B56 A;  1PMP A;  4WFU A;  2K23 A;  4RUU A;  1BBP A;  4NP1 A;  4U9C A;  1JQP A;  5F6B A;  1OEE A;  2WUT A;  2Q2P A;  3NQ9 A;  4KC7 A;  4A8Z A;  4NNT A;  4Y0R A;  4ORR A;  2C1Q A;  2RTK A;  1A18 A;  5KIC A;  3VHM A;  2L9C A;  2RCQ A;  1D3S A;  2LKK A;  5HCC C;  2Q39 A;  3EBK A;  4M7M A;  2A13 A;  2W2B A;  3PPT A;  3D96 A;  2I5V O;  1A57 A;  1NP4 A;  2FR2 A;  4KC8 A;  4Z27 A;  1VWQ B;  3STK A;  1I05 A;  1SXW A;  2QO5 A;  3ZUO A;  5B5F A;  3FMZ A;  1N43 A;  4OS8 A;  4ZH6 A;  4LZU A;  4LQZ A;  3STN A;  4CDE A;  4CPE A;  5EDB A;  2K62 A;  3SZH A;  3TZS A;  1DZJ A;  1BEB A;  3C78 X;  4AYH A;  2AT6 X;  2HMB A;  1X89 A;  2WR6 A;  2WSJ A;  3EMM A;  1SA8 A;  5CYB A;  4YVB A;  2WQA E;  3BSZ E;  3PP6 A;  1PEE A;  1KFF A;  1QFV A;  4QRL A;  2OY8 A;  3B2H A;  3F6Z B;  3LV4 A;  1B4M A;  5B27 A;  3CKG A;  3KVN A;  4IAB A;  4YFP A;  4DNE A;  4GNW A;  4YGG A;  3B2J A;  1SMP I;  4XMC A;  5AEO A;  1OEK A;  1XCA A;  5HZ5 A;  3VG4 A;  4IB8 A;  4A1H A;  4ZJ0 A;  1FEM A;  4BBO A;  5EPQ A;  4BX7 A;  3DTQ A;  1EW3 A;  3TF6 A;  4ZHD A;  1IW2 A;  1HBQ A;  2R74 A;  1LNM A;  4D6B A;  5F1E A;  1S2P A;  3GE2 A;  1ERX A;  4GJS A;  4QNI A;  5AJB A;  1SWT A;  1YIV A;  3UEW A;  1KT4 A;  1SY3 A;  2IZH B;  4GET A;  4HFO A;  4QYP A;  2XST A;  3HWE A;  3T6L A;  5LJH A;  4YDB A;  1BWY A;  3RDX A;  1VWI B;  1AVD A;  1I06 A;  4MVI A;  1KL3 A;  1LID A;  1U18 A;  2X32 A;  1HMS A;  2KD2 A;  3FA7 A;  4LZV A;  1NC9 A;  1DV9 A;  3KFH A;  2AH7 X;  4INN A;  5JR8 A;  4FQB B;  3SLT A;  3Q34 A;  3L4R A;  4B55 A;  4CPH B;  5HZ8 A;  5H9N A;  3RBY A;  1FDQ A;  4GDZ A;  3KQ0 A;  3FEN A;  4GRJ A;  2YG2 A;  1G7N A;  1MEP A;  1X8U A;  2OVD A;  1K24 A;  2AF5 A;  4WHI A;  1SXU A;  1NBX A;  3BU9 A;  3SOT A;  3VE1 A;  2MWH A;  1LIC A;  3MBT A;  4BX5 A;  1LKE A;  3O19 A;  1VPR A;  4ORW A;  2L67 A;  2RD7 C;  1CJ5 A;  2M4L A;  3MG5 A;  4ML7 B;  1I9H A;  3NR3 A;  1SRJ A;  4IAX A;  3RSW A;  5HZ9 A;  1KZW A;  1WBI A;  2OYB O;  2IZK A;  3KZA A;  3RY2 A;  4N7C A;  1ZNH A;  3OJY C;  5JD2 A;  3VGW A;  3CBC A;  3VG6 A;  1TVQ A;  4C5P A;  3D4R A;  4HPB A;  4ES7 A;  1IIU A;  4ZHF A;  5IO5 A;  1K3B A;  4TNN A;  4Y0S A;  2IZC B;  1LIB A;  4OEM A;  2FWV A;  1SRH A;  1Y55 X;  2LFO A;  1LUQ A;  1VWB B;  2QO6 A;  1SRE A;  2WWP A;  3ELX A;  3FIQ A;  3BX7 A;  4L3R A;  4Y0P A;  4DQ4 A;  5HWZ A;  1MOY A;  1QAB E;  2RTG B;  3AEH A;  4I9S A;  1TOU A;  4BGF A;  4BQU A;  4QGV A;  5B29 A;  1BJ7 A;  1NQM A;  2NNQ A;  2NND A;  4YBU A;  1LIE A;  3CQN A;  3TGB A;  3JS1 A;  1ICM A;  1Y9L A;  1KL5 A;  2F73 A;  3ELZ A;  3OD9 A;  5HTE A;  5LJB A;  1KQW A;  1SRG A;  4BJ8 A;  4HPA A;  1BM5 A;  3AKM A;  1IFC A;  1SWL A;  4HPD A;  3S60 A;  4N7D A;  1KQX A;  1YWC A;  2BC3 A;  2N93 A;  2FHL A;  1HQQ A;  1R0U A;  4AZN A;  4O49 A;  1JIW I;  1HXL A;  4BX6 A;  1ACD A;  4ORX A;  4ZCB A;  4O3X B;  3VG5 A;  3CBS A;  4TKB A;  1DZM A;  4MIS A;  2W2F A;  2HZR A;  3FDC A;  5HAE A;  1PBO A;  1MX8 A;  2RTB B;  1LCW A;  3FEL A;  3OBL A;  3WZN A;  3RKG A;  2FKG A;  1EIO A;  2A3F X;  2X46 A;  3D97 A;  5B11 O;  4Z2O A;  3NQ3 A;  5HZQ A;  2VFC A;  5KID A;  1QFT A;  1ALB A;  1GX9 A;  4D6A A;  2OVE A;  4YGZ A;  4FBO A;  1Z24 A;  1CBQ A;  4IBA A;  4O9S A;  5D45 A;  3D95 A;  4TJZ A;  3UEV A;  1HMT A;  2JW1 A;  2FR3 A;  2VFB A;  2VDF A;  3ZZV A;  2RTJ A;  1O8V A;  4NYQ A;  4CDF A;  1VWA B;  2IZJ A;  1IFB A;  4EDE A;  3P6D A;  4NW4 A;  1TW4 A;  1T8V A;  1U17 A;  2CM4 A;  2AMM X;  1KT3 A;  2RTQ B;  4IMO A;  2HKD A;  4QGX A;  4GK9 A;  1KT5 A;  3EM0 A;  4QAE A;  5HA1 A;  1HBP A;  1NDJ A;  1VWO B;  1E02 A;  4AZP A;  1JYD A;  2HZQ A;  4YGH A;  2JOZ A;  5L8N A;  1PBY A;  4AZR A;  4AW8 A;  3U9P C;  3OE3 A;  1SY0 A;  1SY2 A;  2OL6 O;  1SWP A;  3JSQ A;  3RDM A;  4YKO A;  1EQD A;  4ALO A;  1OEJ A;  2GH7 A;  3I17 A;  4NNS A;  3MVF A;  2Q4N A;  4YFR A;  2OY1 O;  3KFG A;  1QG5 A;  2R56 A;  3S5X A;  2IZI A;  2BLG A;  2X8T A;  3FEP A;  4YKM A;  2BSZ A;  1TOW A;  3EW1 A;  1RXH A;  1N9M A;  2G5L A;  4JNJ A;  4LKT A;  3O22 A;  2UZ2 A;  3HWD A;  1VYF A;  4CPF A;  5FEN A;  1OPA A;  2JU8 A;  3PH6 A;  5LKF A;  3IA8 A;  3UEU A;  3WJD A;  2KTS A;  1HQP A;  1SWH A;  4PJ2 A;  5IRW A;  1AB0 A;  2IZE B;  1GKA B;  2PI3 O;  2RTR B;  2GTL M;  1I78 A;  3PEC A;  5IO6 A;  3RE6 A;  1GM6 A;  1MM9 A;  4ID2 A;  1YP6 A;  1KGL A;  5FQ6 E;  1SWR A;  1SXX A;  3WXQ A;  2A5C A;  3ZW1 B;  3VPJ E;  4ZHC A;  1DF3 A;  3LTW A;  3LHN A;  2HNX A;  4QZT A;  4M6S A;  1RLB E;  2JU7 A;  5H9A A;  3FR5 A;  5H9L A;  5FQ8 E;  4U8U M;  1MX7 A;  5BVS A;  1JV4 A;  3SZJ A;  1SWK A;  3NX2 A;  1A2D A;  4I3D A;  4YFQ A;  5AQ6 A;  1SWE A;  1Y53 X;  2GJ5 A;  2RTM A;  2RTP B;  1QWD A;  3HPE A;  1U0X A;  4IRW A;  1X8Q A;  3T2X A;  3WJB A;  1HN2 A;  5IRU A;  3NBX X;  1GGL A;  3E3C A;  3Q6L A;  4HPC A;  2WQ9 A;  2RTH B;  3P6G A;  2F01 A;  4YDA A;  3T6F A;  1OBQ A;  2BHV A;  2BS6 A;  2LBA A;  3NQK A;  1N0S A;  4QGW A;  5CSE A;  5BVQ A;  5L3Y A;  2RTD B;  1VWE B;  3FA6 A;  1ZNL A;  2IZG B;  4YCH A;  2I5Z O;  5LJD A;  4DQ3 A;  3EC5 A;  1ERB A;  2GTL N;  4ZHG A;  2KW1 A;  1FJ1 E;  2ACO A;  3FLL A;  1SWB A;  2AT8 X;  4NYR A;  4WBK A;  2RA6 A;  2IZB A;  3HK1 A;  4GKC A;  2QO4 A;  5H9K A;  5HBS A;  1LCV A;  3N91 A;  1VWP B;  1OBP A;  5EED A;  5IXG A;  3HOE A;  3EYC A;  1HXZ A;  1S7D A;  3MM0 A;  4IB7 A;  5F6Z A;  4XMH A;  2HYS A;  4KCA A;  4OS3 A;  3WVM A;  2AT5 X;  4AZM A;  4Y59 A;  2ZSC A;  3QKG A;  4CSB A;  1VWJ B;  3KFF A;  4U8U N;  5L8O A;  1KT7 A;  1PTS A;  3X00 A;  2UYW A;  2OL7 A;  3CKF A;  3PK2 A;  1EPA A;  4I3C A;  4I60 A;  4EEJ A;  1W6F A;  1YUP A;  5LJE A;  1QY1 A;  1ZNK A;  1SWD A;  2NP1 A;  5EDC A;  2CM9 A;  4GGR A;  4UU3 A;  5DPQ A;  4MEE A;  3PDF A;  5L8I A;  3C77 X;  2OFM X;  3SLO A;  1UYN X;  4CDC A;  4Z6J A;  3WYP A;  4JO6 A;  3FR4 A;  3ZW0 B;  3PQU A;  1SLD B;  4K19 A;  4DCB A;  3P24 A;  3UEX A;  5KHP A;  2RTO B;  2ZAI A;  2HLV A;  1VWH B;  2JMB A;  2G79 A;  2F09 A;  3SLJ A;  3VU1 A;  3QQ2 A;  3F8A A;  3F9D A;  4OS0 A;  2FS7 A;  4MVK A;  4KT5 A;  4ON1 A;  2AKQ A;  2DJF A;  5D8J A;  3RY1 A;  3CMP A;  3S26 A;  3VG7 A;  2ZAG A;  3D9W A;  3FID A;  1SWO A;  1ZND A;  2RTI B;  3BDR A;  2NNE A;  1QQS A;  1HY2 A;  5IRA A;  5HCD C;  3H3I A;  1X8N A;  3RWX A;  5FFH A;  2MM3 A;  4RUN A;  4OMW A;  1STR B;  2OY7 A;  1BRQ A;  1E00 A;  1CBR A;  1GX8 A;  3APX A;  1YWD A;  1STS B;  2WEX A;  4XMF A;  1JMZ A;  1URE A;  1B8E A;  1GT1 A;  1PM1 X;  5LJG A;  1VWC B;  4OKA A;  1RXJ A;  4NLJ A;  1MK5 A;  4JGL A;  2IZD B;  5BVT A;  2FHN X;  5HZ6 A;  4GH7 A;  2L68 A;  5LJK A;  1LCZ A;  4BVM A;  3JQO A;  4ZGU A;  4I9R A;  4O3Z A;  1RAV A;  1T0V A;  1XKI A;  1LF7 A;  1STP A;  2AVI A;  2OL8 O;  1QY2 A;  1UZ2 X;  3BRN A;  3P6H A;  4I95 A;  3UAQ A;  1LPJ A;  1CBS A;  1QY0 A;  4TKJ A;  3G7X A;  4MVE A;  4ODD A;  4ARH A;  2OVS A;  1VWK B;  2DM5 A;  2Q2M A;  2X4M A;  2G78 A;  4ZH9 A;  4KH8 A;  4MVL A;  2E4J A;  5B5G A;  3PH5 A;  1FE3 A;  1LDO A;  5B3M O;  4BOE A;  1N4J A;  4NV8 A;  1L6M A;  3O2Y A;  2CZT A;  5LJC A;  2YMS A;  1Y52 X;  4TQ2 A;  4QZU A;  4LKP A;  2OFA A;  2CBS A;  2JGS A;  2CBR A;  2OZQ A;  3EW2 A;  1BRP A;  1DZK A;  3NPO A;  3P6E A;  4QYN A;  4IB6 A;  2OFR X;  3WJE A;  2BS5 A;  5F7G A;  5B2A O;  3NX1 A;  4WFV A;  3RDS A;  1GXA A;  2IZA A;  4A1Y A;  1T68 X;  1E2T A;  3WZP A;  4AZO A;  1UYO X;  1ZNG A;  2RTA A;  1DFV A;  4COT A;  3VHH A;  2A5B A;  4O4S A;  1JMX A;  2MJI A;  4BX7 B;  3APV A;  5D48 A;  5FAZ A;  3WJF A;  5C0N A;  2Z4I A;  5AJC A;  4YMY A;  1ZRY A;  4FBV A;  4FGI B;  1E5P A;  4HWM A;  4XME A;  1X8P A;  4UU2 A;  3RZY A;  3GAQ A;  5D47 A;  4YH0 A;  3AUM O;  5HTD A;  4OEL A;  2Y3E A;  4ORU A;  1VYO A;  2CZU A;  4EKV A;  1I04 A;  1N7Y A;  1N9Y A;  1SWC A;  1SWN A;  1AEL A;  1SLG B;  2A2G A;  4Z2V A;  2ANS A;  2X56 A;  1JBH A;  4ZHH A;  1KT6 A;  1NGL A;  1O1V A;  4GNY A;  3I0A A;  4JHQ A;  3RDQ A;  1AQB A;  1EAL A;  4O3W A;  1G74 A;  1MUP A;  2O62 A;  3HWG A;  1WUB A;  4NLI A;  4XMD A;  4QQ1 A;  3BLG A; 
#chains in the Genus database with same CATH homology
 1DF8 A;  1PTS A;  3X00 A;  2UYW A;  4BJ8 A;  2Y3F A;  3WZQ A;  3PK2 A;  1KL4 A;  1SWL A;  4I60 A;  2BC3 A;  2FHL A;  1HQQ A;  1VWM B;  1NQN A;  2C1Q A;  1SWU A;  1SWD A;  2RTK A;  4BX5 B;  1HXL A;  2IZL B;  4BX6 A;  4GGR A;  3VHM A;  1RST B;  4Z6J A;  3FDC A;  4JO6 A;  3WYP A;  5F2B A;  4GDA A;  3WZN A;  1SLD B;  1LCW A;  2RTB B;  4Z28 A;  2RTO B;  4GGT A;  1VWQ B;  4Z27 A;  1VWH B;  4Z2O A;  5B5F A;  2RTL A;  1N43 A;  2IZF B;  3RY1 A;  1VWN B;  4CPE A;  1SWS A;  4Z2P A;  2RTE B;  2OF8 A;  1SWO A;  3SZH A;  2RTI B;  2RTJ A;  5IRA A;  1HY2 A;  1VWA B;  1AVE A;  1VWR B;  2IZJ A;  2RTQ B;  4Y5D A;  3SZI A;  4YVB A;  1STR B;  1KFF A;  1NDJ A;  1VWO B;  1STS B;  1SWJ A;  5K68 A;  4DNE A;  1VWC B;  2OF9 A;  4OKA A;  3RE5 A;  1RXJ A;  1MK5 A;  2IZD B;  2FHN X;  1SWP A;  1LCZ A;  3RDM A;  4BBO A;  4BX7 A;  4BX6 B;  2GH7 A;  3T2W A;  3RDO A;  1RAV A;  1STP A;  2AVI A;  5CHK A;  1SWG A;  4BCS A;  4GJS A;  2IZI A;  2RTF B;  5K67 A;  1SWT A;  1SWQ A;  3EW1 A;  1SLE B;  1RXH A;  1N9M A;  2G5L A;  2IZH B;  2C1S A;  2MF6 A;  1RSU B;  2UZ2 A;  1SWA A;  4JNJ A;  3T6L A;  1VWK B;  4CPH A;  3RDX A;  1VWI B;  1AVD A;  4CPF A;  1KL3 A;  5B5G A;  1SRF A;  2C4I A;  1LDO A;  5IRW A;  1NC9 A;  1N4J A;  1SWH A;  2RTN B;  2IZE B;  1VWF B;  2RTR B;  2RTC B;  1Y52 X;  4CPH B;  3RE6 A;  1LEL A;  1MM9 A;  2QCB A;  2OFA A;  2JGS A;  3EW2 A;  1SWR A;  1SWF A;  2A5C A;  3RDS A;  2IZA A;  1MEP A;  4GD9 A;  3WZP A;  1NBX A;  2OFB A;  2RTA A;  3SZJ A;  1SWK A;  4BX5 A;  4U46 A;  3VHH A;  2A5B A;  4BX7 B;  1SWE A;  1Y53 X;  2RTM A;  2RTP B;  2WPU A;  4IRW A;  3RDU A;  2A8G A;  3WYQ A;  3T2X A;  3MG5 A;  2CAM A;  3VHI A;  4CPI A;  5IRU A;  1I9H A;  3T6F A;  1SRJ A;  2RTH B;  1WBI A;  2F01 A;  1VWD B;  2IZK A;  3RY2 A;  5CSE A;  5JD2 A;  5L3Y A;  2RTD B;  1VWE B;  1LDQ A;  2IZG B;  3VGW A;  2Y3E A;  1VYO A;  1VWG B;  4EKV A;  3WZO A;  1N7Y A;  1N9Y A;  1SWC A;  1SWB A;  1SWN A;  2IZC B;  2IZB A;  4GGZ A;  1SLG B;  1SRH A;  1Y55 X;  1LCV A;  1LUQ A;  1VWB B;  1SRE A;  1VWP B;  4Z2V A;  1SRI A;  1HXZ A;  3MM0 A;  1MOY A;  2RTG B;  1RXK A;  1VWL B;  4JHQ A;  1NQM A;  4Y59 A;  1SLF B;  3RDQ A;  2Y32 A;  2ZSC A;  4GJV A;  1KL5 A;  1VWJ B;  1SRG A;  1IJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...