1NC2D

Crystal structure of monoclonal antibody 2d12.5 fab complexed with y-dota
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
215
Chain Sequence
QVKLQESGPGLVQPSQSLSITCTVSGFSLTDYGVHWVRQSPGKGLEWLGVIWSGGGTAYTAAFISRLNIYKDNSKNQVFFEMNSLQANDTAMYYCARRGSYPYNYFDVWGQGTTVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY 2D12.5, LAMBDA LIGHT CHAIN
publication title Crystal structures of two complexes of the rare-earth-DOTA-binding antibody 2D12.5: ligand generality from a chiral system.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 215
sequence length 221
ec nomenclature
pdb deposition date 2002-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nc2D01
4U3HA 4GAGL 2PN5A 2BP3A 3UZEA 1NC4A 1DUYB 5IVOA 2G60L 4BH8B 4NO0A 5FDWB 2XA3A 3OAZK 4L3AA 4ZXBD 3TH3T 5E6YA 4MZ3A 5C0FB 2X4TB 2JB5L 5FECB 2Y72A 4MNHA 5AWNH 1T7WA 4KDVA 5J12B 1F5WA 1K6QL 1QHPA 3WN5B 4LVEA 1NFIB 2EIBA 4KI5E 4TUOA 4YBLC 3D9AL 2ICES 1ZANH 3LPFA 3P9MB 4Z7QF 3VFMA 1PQZB 3NIFE 3VE0B 4JFHE 4AM0B 3SKOB 1WTLA 2YRLA 1TJGL 4RRPG 4JN2B 2HRPL 1LWRA 1DANT 4OF5A 3HI1B 2VB5A 1RULH 4CN4A 2ZUVA 3ARWA 2QQKL 4LHUD 4U05A 5I71B 5IQ7H 5J89A 1HSBB 3EO9L 4PB0L 5L2JB 3LKPA 2GSIB 3QEQA 1KLUA 4KXZH 1N2RB 3IJSB 4X9HA 2M8XA 4YQXH 1KB5A 2VRAA 1N0LA 4F9PC 3HI5H 2FO1A 4ZUSB 1BWWA 4E42B 4P99A 3U9UA 4B7LA 4GKOA 4C4KO 3ESUF 3CC5B 3QO0B 4OCLC 4UILL 3U82B 3CPLB 4J4PA 4YLQT 4ZFGL 1LO2L 3ZO0A 3H2WA 4XC1L 5IOPB 2EEAA 4GAYB 1YY9D 4ETQA 3QYCA 4G43A 4FXKB 3CUPA 1R3KA 3S34L 4U6XB 1KPUA 4RCAA 3MRRA 5IROA 1T1YB 4BFIA 4PTUA 2J88H 5D2NE 5CAYB 1TTFA 1A21A 1AP2B 5JHDB 4MD5B 1ZSDA 3ARGA 4AIOA 1A1NB 1A6TA 1VADB 1WC7A 4L8BA 1JPFB 3CLFH 3RRQA 2CIKB 3P9WB 5T1LB 4MAYB 4PG2C 1C5CL 3ARPA 2LFGA 1QFWM 4PJGF 3UYRH 2FZ3B 4G7YH 5FKPA 3HRZB 3JWOH 1FO0A 1HEZA 2YD1A 5JOPD 3MRDB 3HLAB 3OKEA 3SE3C 3ZHLA 4XNYL 4M7JL 4KKCC 3KLAA 2ESVB 4MCYB 4YHOL 3MNWA 2UZIL 4LKXA 1I7UB 2DQJH 5TPWL 2FLBT 2ZUTA 1P5VA 4MS8C 4K7PL 4OZHA 1INDH 1H3PL 4YFLF 3EDKA 4WTZA 4HKJA 4KI5F 5HDBE 4FQIL 4L8CA 5E08L 2R2CA 2I25N 5FUOL 2RHEA 2W65A 5M7QA 3NIFF 1NJ9A 2R4RH 4PJDB 5IEHB 3VFOA 4AEHL 1TQCC 2R1WB 1Q1JL 4QRTB 3SE4C 4K9EL 1MHEB 1FVDA 3PWLB 1CD8A 4HV8B 1TTUA 3MUGB 3MV11 2QHRL 4U1GB 5I73B 5SV4A 1MI5A 5JHDD 1C08A 2FX7H 4RQQB 1DBJH 2OS7A 2BJML 4HDIB 4HQQH 4D9QD 4K7FA 5FYKD 4DQOL 1PFCA 5EUKB 5C1MB 5T1LD 3WBDA 1TZHA 4MAYD 4NQDA 1X3DA 4PJ8A 5I1AB 5J8OA 3L7FB 2ZPKH 4QYOA 4UQ2A 3OKMB 1I9RH 4MXWH 5HGGS 5JIIA 4LF3A 4N1EA 1K4CA 1UM6H 1MAKA 4OM0H 4LQFH 5FOBB 4NZUH 2BMKA 2R69H 4P0DA 5KZCB 1IQDB 1B4RA 2ESVD 3I75B 3X13A 4DAGH 4NQVB 2DQCL 2NW3B 1TCRB 4CU6A 3G6AB 3OX8A 4GXUM 4YHPA 2HVKB 4KQ3H 3QCUH 3ELAT 1SHMA 2AXGB 4OD3L 4P2OB 2HFGH 1ZVSA 4YXHH 3BHBA 3BDYH 1DP0A 1P4IH 2YN3A 1AFVL 4QHUB 2NYYC 5INDB 1ORSB 5FO9B 5DMYA 2R56H 3C6LC 3VW3L 5EZOL 2WBKA 1CTOA 3Q1SH 4M1GH 2Z92B 4JDTL 3LQAL 1IGYB 5CZXD 1G6RA 4ZOCA 4WFED 1IRAY 4ZODA 5D1XA 5JHDE 4JG0L 3C5ZB 5DRXA 4D9QE 3IDMB 5FYKE 4HKBA 1UWGH 1W2KT 3HC0A 5D8JL 3LN5B 2PTUA 1U95A 2D31A 4NT6A 4I9WD 2DM3A 5DRZA 2E5EA 1IFHH 1M7IA 1A14L 2VDKL 4X5WA 4GFTB 3GBNH 1T3FB 3WFZA 4ELMF 5KZCD 4PJXF 5E4EC 4X6EB 4ERSH 1U8PA 2IALB 5H35A 5HDBF 2ESVE 3DV6B 4JO1L 3T1FA 5J06A 4XBGB 4RAHA 2EZ0C 2I60L 1B3JA 3EYFB 4DKFL 3OPZH 2AERT 5AG9A 3QISA 3CX2A 2OR9L 4P2OD 2Z0BA 3RDTC 4YNYB 2AQ1A 2FIRT 3AB0B 5EBMA 4B7IA 3O6FB 3B9KC 5JDJA 1XGUA 5CINH 1QR4A 3F7RA 5F9JA 3IKCA 5J11C 4K3EH 4LHUG 1BBDL 1XCQB 4HGWB 3VGEA 2EIEA 4DTGL 1LDPL 3NH7L 1TJHH 5MEND 2DRUA 4WVRA 4QKXB 4HWEL 3WSQH 1Q72H 2QR0A 5ENWB 4AG4L 3LS5L 1ZA6B 4ONOA 5I1IL 3MXVH 4OCRL 4WFEE 1HXYB 1J1PH 2QQLL 4PJEA 3B5HA 3PDDA 1I8KA 2ZG1A 5ITFA 5BVPL 3C5ZD 2CRYA 1YECH 3O4OC 5IHLB 1UWXK 4EOWL 1RZ8B 5DVLA 4XVUD 4YHNA 3KS0H 4QTHB 4HIEA 3QEHB 4LMQE 4XNUL 1WEJL 1KIQA 1OSZA 2BSSA 3P11H 2WNGA 2JK5B 3BFOA 1JHLL 2EE9A 2FBJH 3PQYB 4AIZA 2UWEA 3ABZA 2LVCA 2AI0H 5HI5C 1PG7X 5D70L 2DL9A 3K1KC 4JRWA 2GK0B 1GHFH 3FONA 4AZ8A 3H0TA 1BAFL 4U1SB 1NL0L 4WHYG 2IPTL 3S35X 2X4SB 5B21A 1TQCB 1MHCB 4HPOL 1B0GB 1UG9A 3KNBA 2JB6B 3RIFF 3C8KA 5I1HL 1QPXA 3O6FD 3GMRA 4YR6B 3UYOD 2KL6A 4NC2B 5I18L 4LSRL 5TJWK 4NSKA 5HGDB 1I3RA 1T4KB 3KR3H 2OMNA 5JW4Q 4GW4B 5MENE 3BZEB 5K9QI 4XBPA 3S97C 2CO7B 3QCVL 1CE1L 1ZK9A 4F37K 3Q3GA 4RZCA 4J1UA 4X80H 5FV2A 4ORZC 1F90L 2NTFB 4J6RH 3UJTH 2ZNXA 4OCNC 5I74B 4NN7B 4KHTL 3BDXA 4XBEH 2UUDK 4J4PC 1I7RB 2G75A 3FT4B 3MZGB 3UJIH 2DQGL 4QHNB 4RMVA 5I1LA 5GS0H 4JVWA 1BIIA 1AIFA 1IC4L 1KCRL 4HGKC 4NM8H 1MNUH 3WFDL 1TNNA 2ZSVB 3PQYD 3C5SB 5E8NA 5KVFL 3D0LA 4JPIA 1M6OB 4RX4D 1B2WH 1RPQA 2VZSA 2DB8A 3ZZ1A 2YMXL 2D0GA 2XNAA 4M5YH 3C2SA 1NH6A 1IARB 1UXSB 4RAUA 4G6JL 4XVSH 3MNVA 5I1GH 3N85H 1C5BH 5IG7B 4H1LA 3QR2A 2QJDA 1MVUB 4LIQH 5HGAB 2FB4L 3ILQC 4WW2B 3CFEA 4U4BA 1WTGT 4WDIA 5JORA 1MLBA 1LK3H 1FGNH 3CFDA 3KPLB 4PJFB 4DN4L 1CDHA 2VDLL 4HJJH 3L7EB 3NCJH 4BH7A 1FV1B 3X17A 1ADQL 4S1SL 3PABA 1C5DA 1GH7A 1Y6KR 4POUB 3HNSL 2CXKA 4DVBA 2P46B 3GRWL 5F9OH 1IZKA 3IKKA 3EOBB 4JHAL 4GRMB 1MFEH 4QRRB 1XIWA 1MAMH 5CJOL 3I85A 3PQYE 3NCEB 1XGPA 1VFAA 3CLEL 3MSPA 2ORBL 1WFOA 2AXHA 2GCYA 5AZ2H 3VXTB 2OL3H 1XGYH 4X4ZA 4P59L 3F5WB 5KSAA 1CXFA 4F33B 1CLZL 5IW6B 2K7PA 1XCTB 1R24A 3OZ9L 4JLRB 2FEEI 4XGZB 3EOTH 3CSYB 4D3CH 4HJGB 2VZVA 4DGIL 2ARJA 1NLBL 1J05A 1H0DB 4R8WH 4DK6A 2WINB 4WY7L 4PJ8C 4JCMA 1TJIL 1MFAH 4PFEA 3WIFB 3EKCA 1S5IL 4PJGA 4XXDA 1WBYA 4LARH 4N0UE 2DQTL 4LRNH 1U3HA 3MV7D 3TA3C 5CIPH 4WFGD 1N59B 2P5WB 4XCFL 1QYGH 1G84A 5GZND 2J8HA 3VCLA 2DQEL 2LU4A 7FABL 2AKRA 4YWGL 5DYOB 2NY1B 2W9DH 2W0LA 3TO4C 2B4CH 1N3NB 4JHWL 3KJ6L 5E56A 1F4YL 5C8JB 3WKML 4QRRD 4GG6B 5H37G 3LH2L 5I8EB 4YHIB 4X6CB 2H26B 1XF4A 3CH8A 4DGYL 2YUWA 5DI8B 1IEHA 4PRAB 4Y0GA 3REWB 3QUXC 5TFSH 4NBXB 3FHAA 1I1CA 3Q6GH 1RFDH 2R0LH 1BP3B 3VGAB 1R3JB 3MJ7B 3SKUD 5FCUL 3BH9B 1AD9B 2IH3A 1Z3GL 1S7XA 5TE7H 4Y1AB 3INUL 1SEBA 1T89C 3OJDB 3SO3C 5DFVC 2BHUA 2NLJA 4H0HB 3IFNL 3LAFA 4PJFE 4NDMB 4NGHH 3MV7E 2I9TB 4KGJA 4WFGE 4U3CA 4EKXA 3MUY1 5CEZH 5FYKU 2P5WD 3NZ8B 1EDQA 2J5LB 2ZKHL 1PDKA 3NACL 2Y9RT 1R0AL 1QBLH 5L6YL 2NY1D 1FRGH 1HKFA 1NCBL 2YA2A 1OCWL 5DWUL 1AR1D 3AREB 1EO8H 2MPAL 4NZJA 1TETL 3EOYG 5C0EB 3BKML 1LO3L 2MSPA 2VXVL 2UYLB 3RIAF 2IEPA 4QRRE 5D2NA 1HE7A 3ZDYE 1FYTA 4WU7B 1FGVH 2PETA 3ZTJG 3QZWB 3S37X 3WNNA 2ZUUA 4XAWL 5C6WH 3MRLB 4FXGB 4LPTA 3GMPB 1FVCB 3QI9C 3RWGA 2FGZA 2HLAB 3DX6A 4GAGH 4A6YA 2OZ4L 2QEJA 1MCRA 3ROLA 1YNLL 4WIQA 4JKKA 4OGXL 4PY7B 3MLWL 1N0XL 3CVHB 4LLMA 4X4XA 2G60H 3RTQA 2AS5M 1ZHNB 4GXVH 3V2AR 1QFWH 5J57B 4EUPB 2DWDB 4Y1AD 3QIBA 2JB5H 5B4MD 4X98A 5DUML 3DYPA 1IAKA 4GUPB 4R7DB 4RIRB 1GC1L 2ZUYA 3QUKB 5EBGA 1NDGB 1CD1B 2Y4SA 4ELMA 1D9KB 3D9AH 1NBVL 1QZ1A 4PJXA 2P5WE 5EWIL 5CLWA 4RGNC 4LASL 1MAJA 5IMMB 5ID0A 4L8DB 4XNQA 2H8PB 4OZ4B 4WJ5B 1DUZA 3ARED 2XIDA 4Q6IA 3ULUL 5BMFL 1ORQA 1A2YA 2IGFL 4GG6E 3DVFA 3P9MA 4NFBA 4D0CA 3HN3A 1U8OA 4FFVD 3VE0A 4F58H 5LVEA 1AH1A 3VXUE 5KJRL 2ADFL 1FORL 4X6CE 1MHHB 1SEQL 1MFBL 1MIEH 3PWVA 4M7LT 1IILE 2V5RA 4NQUA 3OGCA 4GH7B 4UAOB 4G80B 1U91B 4DVRL 1EGJA 1LDSA 3ILQD 2VE6A 5DJ0B 3MO1B 4PLJD 4NQXB 4WW2F 1P6AB 4H26B 3MJ9L 5ANMA 4WTWA 2PKDA 2FO4A 4G42B 4ZO6A 2JELL 1Y6NR 1J8HB 5I8KL 2R1YB 4K3JL 3TO2A 3W0WA 4Y1AE 4MMXC 1P69B 1JRHL 2GTWA 2W92A 4YUEL 3S34H 4WCYL 3U0PB 2E6JA 3TO4B 1UC6A 5LQBH 3QO0A 3TV3H 3FZUD 2BSRA 1U3YA 3D25A 5E5RB 1D9KD 2X9YA 1K4DB 4OT1L 4CADB 1GIGL 3OG4B 4GS7C 1L0YA 4HS6B 3DUSB 1ROWA 4XPAL 2CDGA 4OLWL 2W9EH 2B5IC 3ZDYF 4XMPH 4KDWA 5DJ6B 2GHWB 5GJTL 4XNZC 1W8OA 4HF5H 4UOW0 4KMQA 2H9GA 4Q0XH 4JY4B 1C5CH 3RZCB 3HB3D 3IDGA 5IB2B 5JHDA 3NMEA 3L1OL 1T22A 2J6EA 3C6SA 5GQBA 1CG9B 1FZOB 3H3PL 4M7JH 4HS3B 5JXAH 4YPGA 3LRGA 3UTOA 2VQ1B 1P1ZB 1QLRA 5CP3A 4YHOH 2UZIH 5DSCA 5TPWH 2JCCB 4K7PH 1H3PH 4NNPL 4XPHL 3BEVA 1VERA 2EDBA 1J8HD 4QHLA 5MP6L 3KPRB 3MRDA 4FQIH 3STZA 2ZUWA 4MDJB 2YWZA 1CFQA 4JZNA 4O2FB 5FUOH 1XIWC 5EN2B 2H45A 5CEYB 1DTUA 1BOGA 1KCVH 1Q1JH 5J7CC 3WIIL 3BPOB 1AC0A 1HHGB 1OP3H 4RISL 4HK0B 5EOCJ 4LCCB 1NMAL 4JE4B 1CXKA 5KSAC 2PCPA 4F7PB 2HT3C 4MDIB 4XP5L 4ZPVA 2BJMH 5DRNA 4X6CF 4EJ1C 4DQOH 5EIIA 3DETC 1TLKA 4QRTA 5ISZD 3PWLA 4HV8A 3MUGA 3RZCD 3BIAX 4PLKD 3GGWB 3O2VL 3GSNH 2EE3A 1U3HC 2GW5A 5HDOA 1P53A 5IMKB 3MRMB 1LEIA 2XZQL 1BFOA 1JPGB 4QHKI 5C0AB 4LBEA 5JZ7D 4Z7UB 3L7FA 2VZUA 2DQCH 4M7LL 4QLRA 2XTLA 3QRGL 3GMLB 1H3UA 3JTSB 4OD3H 5IB1A 3QNXB 5FOBA 1J8HE 4FA8A 4WO4A 1Y0LA 2F54D 3O2DL 1C16A 4LU5H 1MQ8A 1MFDL 2GKIA 4NQVA 3IFOB 2NW3A 4PGBB 3VW3H 5EZOH 4P5MB 3PL6A 4TUJB 2EDDA 1QFUH 4QHKJ 2AXGA 5KSVA 1XEDA 2E7HA 3LQAH 3PG2A 3MODH 3ARDC 5INDA 4LDEB 1NGWB 4PP1C 3CH1B 2Q3AA 3HCVB 4FS0A 3K8KA 5MEOA 1J0ZA 4ZMAT 4Y16C 1G7IB 5MENA 1CFVL 1CDCA 3RNQA 2A74B 4Q2ZA 4UV7L 5ISZE 1BD2B 1T1ZA 5D8JH 3RWDB 1AXTL 1OP5H 3OKKA 3PHQA 1TXKA 1IEAB 1WISA 5B3JE 4MXQD 4S0TD 1DQML 4NWTL 1M05A 4XWOD 4ODUA 5E94A 3H7BB 4BZ1L 4NPYB 5C0AD 1RZFH 2BFVL 3HPLA 1ZHLA 4JO1H 2I60H 1YPZB 3LN5A 5GSVB 4DKFH 3W5NA 5I8OH 2VMFA 1MRCH 2W60B 2OR9H 4BSWA 2D9CA 3TH4T 3CZJA 1LGVA 2E9WA 3BVNA 3QDMB 2F54E 1WWWX 4N5ED 3O9WB 1KTRL 4ZAKC 1YEGL 2X4QB 4UNTA 3EJYD 4OCMC 1LDPH 3NH7H 3MUHL 3B6SA 3QZWG 4HWEH 1KJ2A 1XF5A 4YNYA 1JE6A 4M93C 5I1IH 5D7JA 3FT3B 3CU7A 1U0QA 1MCIA 4ZUUB 5E1AA 1XCQA 4AH2B 4EOWH 2R2HB 5ITBL 3RTQC 5E8DL 3EYUH 3TIEB 2Y6SD 2ZJSL 2AGJH 1HQ4A 3L5XL 2OI9C 1WEJH 3E2HC 5FDYA 5DMJB 1JHLH 4EUPG 1SJEB 1JMZA 3R4DA 4K3GA 1ETZB 4PP2A 3QB7C 2X4PB 1BQHA 4KJWC 1SY6H 1DBMH 3LSOA 3CFBB 2X1XR 4R7NA 2O5XH 4LCWB 4I4WB 3M17B 4PIRF 5C0AE 4QXTB 1BAFH 1WICA 3RI5F 4KY1H 1NL0H 3HC3L 4Z7UE 3MQIA 2IPTH 4XMKH 3VFPB 1UACL 1X5AA 3PQYA 1ULVA 2X40A 4UUJA 2VLJA 4OFIA 5LBSL 5IB5B 1IGCL 2HT2D 3QDMD 1ITBB 3HZMB 1RIVL 1JK8B 5T1DL 3BGMB 4MA1C 5BQ7A 2VITB 3O9WD 5I18H 4HW6A 4PRBA 1T21B 3HE7B 3UDWC 1YYLL 4YFLI 2DJSA 4U1IA 2CKBL 1F58L 3WKNA 3BXNB 3QCVH 1CE1H 2YK1L 3R0MA 2CR6A 3LEYH 1KJMB 2OBGA 3TM6A 4PR5A 3IGAA 5DQ9A 2VISB 1T4KA 4N0UA 2GFBB 1AHWA 3TT1L 3VH8B 1ES0B 1WBXB 4D9RD 3MLYL 2P24B 4ODHL 3WFDH 3WDJA 1UH3A 3O41B 4XP9L 1YEIH 2VKXA 2JJUA 2Q76A 2W0FB 2IQAB 5T5NF 5JIKA 3WJLA 1EVTC 3FT4A 2OR7A 4LCWD 1NGYB 1NAMA 2YMXH 2EICA 2LU3A 1U58B 1FFNB 4EI5A 1WUNT 1VKXA 4OLZL 4P4RA 4X7TB 3V4VL 4GMSL 3SY0A 4G6JH 3ALPA 4ZUWA 3V5DA 1A3QA 4OZIB 1M6OA 2EDHA 3QA3A 3QDME 4MQXC 3D39B 2YBRA 1DBBL 1CGXA 1UZ6E 1N6VA 3ARDB 1LNUA 4Z7NE 1XR9B 3C9NB 3QQ4B 2YKLL 1KIUA 1OP9A 2HKFL 3HE7D 4OCXH 4LLUA 1HCVA 3BH8B 4DN4H 4Y16B 2VDLH 3O8XA 3TC9A 3X11A 5ICZA 3BP4B 1MCFA 1MCQA 1RUKL 4OLUL 3IJYA 1T6WA 5HGAA 4ZSOE 3RVXC 3JWOC 3L3IB 4WW2A 2CO6B 4Y5XA 2IBZX 3MV01 2GUOA 2OTWA 3KPLA 5T5NG 3GUTB 1G1CA 3MV7A 5JO5A 2WW8A 3U7WL 2VXTL 2X9XA 5DHVH 4GSDL 3MBEA 1FCGA 3MLZH 1JYWA 2B1AL 3VXQA 1HYSC 3IRZA 1FZKB 3EDDA 5D1ZB 2MCPL 5BZDA 1NBYB 3QNYB 1OLZA 3CLEH 1SYSB 3GSRA 4ZFOL 3WHXB 2EKSB 3X3FL 3MOAL 2VXUL 3MRBB 4LCWE 2EDLA 4P59H 3UAJC 3U0TA 1CLZH 1MVFA 3OZ9H 4GRMA 3ZDXE 3L95B 2NTSP 3ZDZE 3MROB 4ZAKB 4LCYA 5TF0A 4ODXA 2ZOKB 4P9HC 5ACZA 3QIUC 2XG4A 5D71H 5EBLA 1NLBH 4EIZC 3D39D 2BXYA 5A3IC 4M93B 2X7LB 4LLYA 5DQJA 3F5WA 4JDVB 1ZLUK 1S5IH 1XCTA 3M8OH 2EDWA 4Z0XB 3ZYOA 4IRZL 2DQTH 4XGZA 4J3UA 4Y16D 1BZ7B 3CSYA 4E0RA 1NAKL 2BOBA 4ZQKB 1EEYA 2X41A 4OCSH 4XCFH 3F7VB 4ZYKB 3MGTB 2OI9B 7FABH 2DQEH 4NQTA 4YWGH 3T2OA 3WIFA 1JF5A 5JR1L 3WL9B 5HHQB 1V8HA 3QSKB 1R5IB 4WEUD 3IDYC 1BZQK 3L9RA 3FRPG 4PREA 3WKMH 4WO4C 3EYVA 2VQTA 2OM5A 1RK1B 5JOFA 1BFSA 5D1ZD 3AAZB 3H3BC 1RUQL 2EEDA 4L9DA 3H42L 1WWAX 5DYOA 3O4LA 4QWWC 3JSSA 4JFQA 4DGYH 3PL6C 1F3DJ 2C1PB 4JY6A 5EDXA 1XF2B 3SKMB 5C3TA 3I50L 1B0WA 3AMKA 2J1KA 5JIHA 4GW1B 3JV6B 4ALAL 5E5MB 2LABA 1UZ6F 4ZAKD 4Z7NF 3WDIA 5EUOB 3VXUA 3BYTA 2V17H 4JFFB 1KFAL 2C4XA 4YHIA 4X6CA 2H26A 4CNIA 1Q9OB 2ZWLT 5AG8A 1MUJB 4WGVB 3B2UD 5FCUH 5BXFA 3KDMA 5D72L 3D39E 2XFXA 1A6UL 4M62H 5CHNB 1K3ZA 3INUH 5K59E 5FA3B 3REWA 1KPRA 4ZO7A 3FT2B 3P30L 3S8WA 4UU9B 3IFNH 4JPVL 2WUCH 1WAAF 2CLVB 4XT1C 2C3VB 4L8SA 1KIPA 4EVNB 4QF1A 2ZKHH 4XHJC 4BQCA 3IS1X 4UIMA 2V2TA 4IRSD 4NC0B 4X99B 5L6YH 1MWAL 4Z6AT 1OCWH 5DWUH 3T8XA 3VJ6B 5TDNB 4UZGA 4NN5C 3BUYA 4Y4HA 4LDOB 2LV4A 2FYYA 4WUUB 3N1QC 4JFPB 3G5VA 3T77A 5BRZE 3RWCB 1J1OH 4M4RA 3ZDXF 3ZDZF 5HHOB 4YIQB 1P7QB 1QEWB 4JFXB 3NCYS 1AGDA 4P5KB 4F2MB 4GRWF 5AZEH 2OZ4H 5HDQL 4OI8A 1YNLH 1G9NC 3V7AE 3EO0B 5HYQB 3MLWH 4XCEB 1ZT4A 3FOLA 4CN1A 5FHBH 5K9JH 2VXQL 5LWYH 2HRLA 2HMIC 2ZZUT 3UO1L 4Z7VB 3EDEA 3MRKA 4MB5A 3KPMA 5E03A 4LLWA 3SBWA 4R3SB 1OB1A 4ZUTB 4W4OA 5BJTB 4RFOL 3O3UN 5IBTL 4XP6L 5CBEB 2LTQB 3KYMB 3MLVL 4WV1C 4R7DA 1KACB 4RIRA 4WWID 4KHXH 2ADGA 1ONQB 4M8QA 3V6FB 5BMFH 1PY9A 1NSNL 4L4JA 1D9KA 2FJHA 2IGFH 4I3SL 4YFDB 3IXTA 4WUUD 4IOFD 5CWSA 5IMMA 5J6GA 4L8DA 5KJRH 2P49B 2ADFH 3HUJB 1MFBH 1HH6B 4WNQB 4OFVA 1XGRB 3QIUB 1VDGA 1P7QD 1FNEB 4KK8C 1OHQA 1J1XL 2WBWB 4DVRH 3EDJA 1R3LA 4OFKA 1RSFA 5D6DC 3V6ZB 5A40E 3IJHA 5K59F 4LVNC 1I8LA 2DLIA 4JGMA 3AS3A 2XWJA 4O9HH 4HIXH 1QKZH 3MJ9H 2QQQA 1UCTA 2HJFB 1AHWC 2JELH 1VGEL 2WUBH 5I8KH 1IEBB 1OAYL 3C8HA 4RFNB 1QR1B 5TE4L 4ZDHA 1QP1A 1WJ3A 3KPQB 1JRHH 3GEWB 2ZOLA 1AGCB 4Y8AA 3VH8G 4YUEH 4WFFD 4WCYH 4HIJA 5DJ0A 1LE5A 2HT4D 5GS0C 2C3HA 4R2GB 4NQXA 3WJLC 2EE6A 5DT1L 1P9MC 3DI2B 4OT1H 4LSSL 5F6HJ 5DURB 4EI5C 4TSBL 5I66A 2HG5B 4B53A 1E4WL 3VFSA 1JGDB 3ARUA 1INEH 2HTLD 4OLWH 4N8CL 1YEJL 1A7RL 5GJTH 3RL1B 4JM2F 4HSQA 2O5ZL 3ES6B 4X7EC 4F15B 4FQXB 4L4TB 1UKQA 4YJZL 1YEDB 4WUUE 3C5JA 3IVKA 3BKYH 3WIHH 3UPRA 1ZVYA 3L1OH 4QXGH 3WE6A 1QVOA 1S9YA 3T08A 5ESAA 5EA0L 4NUGL 2P45B 2E9JA 3O8XC 4NN6B 4OZFB 1KTLB 5A3ID 2QTEA 3MLSL 1U8JB 4ZNEE 2EH7L 5ISZA 3IFLL 2APVA 4JJ5A 4CRPA 3D6GA 5FCSH 2RBLA 3OXRB 3RAJL 4K7PY 3ULVD 4JY4A 4GRLD 5DLML 1A8JH 1MJ8L 1JN6A 2K1MA 4HC1L 4L29A 4NNPH 4JFYA 1BQLH 3QDGB 5DMKA 5MP6H 2EXWC 3MBEC 1S9KC 4HS3A 2L7UA 2W1NA 1U92A 4Z7VE 4WFFE 3ROOA 2M2DA 2X70A 1UKSA 4R2GD 1YEKH 3HG1B 3MCLH 4NHUA 4OF0A 4ODBD 2R8SL 3U36B 5F3HB 1A1MB 2DMKA 4RISH 2EDRA 3OAZH 3FO0L 2YD2A 1NMAH 5DURD 3HNVH 2F54A 5JNYB 1VGKB 1CLCA 4YAQB 1S9WA 1VPOH 3F12B 1WK0A 1FQ9C 3QWRD 1JMXA 4FQHA 1I3UA 5ESQA 3V7AG 4FQXD 4L4TD 2OJEB 3ARVA 4G6MH 4LCCA 5KOVC 3SOBL 1XGTA 1FJ1A 4NHCL 5CD3A 3HUJE 3O2VH 5ESVB 1ZT7B 2Z93B 4XI5C 3ZSTA 4AENB 2PW2B 3WFCH 4HWUA 2ADJA 1NBZA 3X14B 2DI7A 3VWKA 4PV8A 3ULVE 4MGXA 2DBJA 4IIQA 4Z7OE 3R06B 3QDGD 2VWEE 4K2UL 2NXYD 3PGDA 5E4IA 3O2DH 1Q0YH 3T3ME 2QBWA 4WV1B 2A0LC 2EDQA 2J2ZA 2JIXA 3FRPA 4Q58C 2R15A 2D0HA 5B38G 3BP6A 2UVEA 3QNXA 2YR3A 2D4FA 5CD5D 3GMOA 1KEML 4U7SA 4X7DC 1FLTX 2HN7A 1MJ7L 2FIKB 1KCKA 5DD0H 3NCFB 5C0BA 3VI3E 1HSAA 4ZFFA 1J18A 4P2QB 3P77A 4L4TE 3LEXA 3BKJL 2GIYA 3RKPA 1ZTXL 2DD8L 1AXTH 2O93L 1CVSC 1AXIB 5EU7E 1EHAA 4JO4L 3CH1A 4APQB 3EO1B 5JW4N 1EJOL 2BSTB 4GAFB 4Q6YA 3QFDB 4L8SC 1DQMH 1XR8B 2CH8A 2SEBB 4NWTH 1QSFE 3QXAB 1Z2KA 4IOIB 5ELIA 3GI9L 4YPJA 1JNHA 4HFWA 4JO2H 4Z0BL 3RWDA 4KUZL 5IJVA 15C8L 2CUMA 4IM8A 3QDGE 1E28A 4KPHH 3EZJB 4Y4HC 4P3DA 4OQTH 3QNZB 4YBQC 5TGBB 3BZ4B 1BGXH 4WWKB 5DO2C 1RIUH 2XY2A 1AKJB 3GMMB 1HNGA 1DLHA 1QFHA 5E6IB 1WV7T 5DEFA 3QDMA 4DFIA 3FFDA 3SE9L 3VFRA 1F4HA 3O9WA 3D3VA 1HINH 1CICA 1JTOA 2X4QA 3RU8L 4WU5B 5ITBH 1TNMA 4P2QD 2ZJSH 3KXFB 3F7YA 3TVMB 2QQNL 1NUFA 1DE4B 43CAB 4X9GA 2B1HL 3U79A 4C56A 1YMMB 5ABDE 3WUWB 1N8ZA 1WAAA 3QXDB 4ZSOA 1P4LA 3ULVF 4APQD 1JGLL 3KGRA 1S8DA 1NFDB 4LCUB 1YEFL 3CMOL 3SBWC 1U8LA 2R2HA 4QEGA 3TFKC 4J12A 3R8BB 4Z78A 5DFWH 4M43H 5JXEC 3HC3H 1K2DB 4HUXA 3PWJB 4CKVX 4OAWA 3MRNA 2FX9L 2BC4B 2G9HB 3A67L 5CGYD 3PWUB 2Q6WB 5SWSD 1UEYA 3WD5L 1I7ZA 4XAKD 2ZCLL 3RIFK 2A2QT 1RIVH 3BN9C 1RZ7H 1OF2A 3QXWA 1YUHA 3M17A 3W5MA 2CQVA 3QG6A 3AU1B 3U6RB 3O3DB 5KG9A 2NY0D 4MSWA 1QACA 1RUAH 3FRUB 4WWKD 4S0SD 2OL3B 5I9QB 2GJ6B 2CKBH 1F58H 1FG2B 4TUKL 8FABB 1JWMB 1AKJD 3HZYA 5E6ID 1KTKE 2V9QA 3FTGA 2IBGA 3V9FA 2YK1H 5DK2A 1WWCA 3RGHA 3B9EA 1GOFA 1T21A 1I8LC 5I30L 5SX4H 4U0QB 3REVB 1A6VL 4MX7A 1O0VA 3TT1H 2Y5EA 3KXFD 4XPTH 4P2QE 4ZOAA 1UXWB 3TVMD 5LGJB 3BXNA 1HXMB 3MLYH 5HY9B 1LK2A 3EIFA 4ODHH 3FMGH 2GAZB 1EHLL 5D7SH 2X89D 4HUMB 5DHYB 1VESA 2GFBA 1IC7L 1ZKAA 5I6XC 2L7JA 3GMNB 3VH8A 4OKVB 1MELA 4OLZH 3V4VH 3VRLE 3OTTA 4AYFA 4HS8H 3B9VA 4HCRA 1A7OL 5IMOB 2V7HB 3UEZA 1G7MB 5CJXA 2FEEL 5SWSE 4KROB 4XAKE 1IJ9A 3GSOB 1DBBH 2XWTA 1N64H 1NGYA 5C08E 1J5OL 4ODWA 1CT8B 2YKLH 5IIEA 1OLLA 1SYVA 1B6DA 2GJ6D 2A6JB 5CSGA 1G7LB 4K8RC 1RUKH 4OLUH 5ID1B 4OZFG 4XTRD 4JPWL 4KK9C 5SWZA 4M7ZB 1N5AA 4LIQE 5EZIL 3KXFE 2VXTH 4K23H 4KK5D 1WZKA 4RDQG 1SMOA 2VIRB 4GSDH 4YHLH 4OJFL 1KB5L 3DXAB 3QEGL 4XP1H 2B1AH 5GZOC 4NRYA 3QQNA 4O2EA 2MCPH 1KSRA 3G5XA 4MA8L 5IFJB 4JZJA 3TN0A 5DTFA 3BE1H 1IGMH 3X3FH 1UWXH 3MOAH 4ODSL 5MI0B 4ZOBA 3OKDA 2VXUH 3VG0L 2A6IA 5KSBB 4ZPTB 4Y5VB 1U8MA 1UB5B 3VXMA 5JHLL 5I16A 5D1ZA 5BRZA 4OIIH 3I02A 1QFWI 3O3BB 4JM2A 2X4OA 3MRQA 4Q9RL 4KROD 3WHXA 3RHWF 1MPAH 4YEEA 4PG9A 4MD4B 4NO5A 3UZVB 5L8KB 1RUMH 3Q6FA 5EO1B 2GJJA 2X42A 3ARTA 1X5ZA 3DBXB 1YY8B 5DK0B 1S7SB 4K94C 5E0QA 3SJVA 2DI8A 4NO3A 4KZEL 4IRZH 2GJ6E 1EFXA 5C09D 1RI8A 5CSBA 1ZWIA 2BRRL 2Z9TA 2AXFA 4Z76B 3VI4E 3VWKC 1QBBA 4M1CD 5D2LB 1S7QB 4JFOB 4JREB 5F9WC 2WIIA 1I8MB 4IIQC 1KNOA 5FKAB 4JDZB 4R96A 4YDLC 4K71C 3TCXA 5F8RC 1FO0L 3CVHL 3DXAD 5F88B 1NUGA 4HBCL 2GITB 4IRSA 3MGTA 4Z95H 1ZLVK 5FO7A 1RUQH 4G9DB 5CEZD 4OBSA 3WL9A 3WV0A 1ZV5A 2UUDH 3MRFA 4NKOA 4KTDH 1CXIA 4C59B 4OB5L 4RBPK 1JVKA 3ZTNL 1RK1A 3LB6D 4OD2B 5C0GA 3PIQA 1KFAH 5B38A 1DEEA 1HH9A 4Q9CA 5FAAA 3WLWD 1G0DA 3OKLA 5HPMA 1T5XB 4EN3B 1A6UH 1XF2A 3KPOB 3W11D 3MCKB 3EGSA 1RZJC 1ND0A 3AC0A 2OYPA 4ESKA 2YN5A 4QRQA 3P30H 4LSQH 3BGFC 2ZCKL 4E5XB 5MERA 5L0QC 1S7TB 2BSED 5IK3B 4GAJH 4QXWA 5C09E 4PTTA 4G9FA 4YEFA 5CHNA 2IFFL 1RZIB 1FP5A 3CZFA 3DO3A 1MWAH 3SGDH 1X5FA 1ZT1B 4Q9QL 5J13B 4IMLA 2I5YH 3TNNA 4HFUH 5EPMA 3RWIA 5E2TL 3QULB 1QLFB 3LDBC 4EVNA 5IMLB 1M4KA 3DXAE 2B7DT 3FOMA 2G5BB 1T5WA 5CEZE 3CXHJ 1IVLA 4S1DD 1J87A 3D18B 5KSBE 5D96B 4IRJD 1DR9A 1NCAL 1OAUL 4X9BA 2VNCA 5KS9E 4X0KA 4WUUA 5HDQH 5ICXA 5KVDH 4U1NB 1CICC 4J3SA 2F19H 3I6LD 1XAUA 4U1JA 3S35L 2DJ4A 3W2DL 1S7UB 1XH3B 4GKZA 5CBAA 4EN3D 4RMUA 2CLZB 4P5KA 2A83A 3LKNB 4HUNB 3OXSB 1HCFX 4PUBL 4ZNEA 3U9PH 4YGVB 3UO1H 5D7LB 1A9EA 1G6RL 1CDUA 4C83A 4LGRB 4LCIH 2CIIB 4PD4J 3WUWG 3GZKA 4I5BA 3O3AA 3GJEB 4RFOH 2OSLB 3P0VL 3MCG1 1FHGA 4PRDA 4GOSA 3MLVH 3SQOL 2D7NA 1NSNH 4R3SA 4ONHB 1U36A 2EDJA 5BJTA 4I3SH 3RWFB 1K5NA 4YZFE 4FMFA 3V0WL 5DDHB 4MQ7B 4HH9B 2AJYH 2IJ0C 4YXKL 5CBEA 1WCBA 3GBLA 3IF1A 2BNQB 2CUIA 2ATKB 3KYNA 3KYMA 4G8GB 1QUNA 3CCHB 4XPGL 2VC2L 1MCDA 1J1XH 1F2XK 1LMKA 1CK0L 3NABL 3V6FA 4D0BB 4YDKL 2R1XB 4ELKB 1FNSL 1JFQH 1O5DT 4IS6A 2O61B 1UJ3B 1OL0A 5EU4B 4UDTA 5CMAA 4QY8A 1XF3A 3ULSB 3UTSA 3MJ6A 3RWHA 3I6LE 1FNEA 1VGEH 3RJQB 3WXWH 1OAYH 5IKCA 3KYAA 4U6HB 3QQ9D 5D7LD 1QSEA 4M1DH 2XT1B 4GRLA 1JPTH 3QDAA 1T83A 1O7SA 4YDLB 3VFNA 4LSSH 4QRUA 3SDYL 1F2QA 3RUGB 4JQXC 4TSBH 4F3FB 1E4WH 3A6CL 3O11A 5C6PB 1TITA 1DBAL 3LHPH 3ILPA 4YDIL 2GY7B 2FR4B 4N8CH 1YEJH 1A7RH 3T3PE 3LKOA 1U93A 4LEXL 3O45B 5CJXC 3U4EA 3K4DA 2O5ZH 3QAZB 1RJZB 1J8KA 2GY5A 3VD5A 3CXDL 3GNML 4V1DA 2WLZA 1CTNA 4RGMB 5KS9F 5DMGD 1FL5B 4S1QL 1VA9A 2BNQD 3LKRB 4LVOC 4G8GD 5GIRB 1ZHBB 2Y7QB 4NUGH 2BHZA 3QHFL 5EA0H 3UTTB 3RL1A 1GJIA 4O58H 4Y5YA 3WIHA 3N9GL 2IH1A 4FQXA 3MLSH 4L4TA 1FZJB 3IFLH 4CDGC 3RAJH 2YPVL 2H2PC 1KTDB 2BVPA 1MJ8H 1G0YR 1IAMA 3LQMA 3RZWA 2YHGA 3IT8D 4HC1H 5DJAB 3PV6B 3V79C 4ISVB 4FFWC 2Q8BL 5F7EL 4OZFA 4KKAC 3SDAC 1QSFA 1LE9B 5GGQL 2YSSA 5D7LE 1EV2E 3D87B 3OXRA 4JZJC 4OSUL 5MEPB 3TN0C 2P42B 3BISA 3RWJA 4F8TA 1UYWL 3W9DB 4NQCA 5F89B 5E8OB 1UA6L 3HHRB 2XA8L 4YZFF 1ZA3A 5H8DA 5J1TC 2Z35B 1F02I 5C0DA 1LVEA 1MEXL 3QEUA 4JM2C 1BVLA 1S9XB 4I18C 1A1MA 2OJZL 1DQDH 3QWOA 1KC5L 3SOBH 5GHWL 1R5VB 3MV9B 1QLEL 3QFJB 4YFEA 4MCZA 1DQJB 1T66D 2BNQE 4CMHC 3MLUL 5IP4A 4G8GE 3KYOB 3DSFL 2R29H 1T04A 5HVGB 3UTTD 3I6GB 5ACMA 4MXVE 3ARBD 1NMCC 1P6FA 4PJBA 3L5IA 4LRIA 5GS1C 2Y06H 4PGZA 4UIKH 3MFFB 2DDQL 4P4KA 3VFWB 5ESVA 1X6LA 3FQUA 5LAXB 3WFBH 5T3ZL 3BX7C 4I13B 1OM3L 3ZKMD 3MMEB 1LQSR 2QHLA 1BIHA 1OTSD 3NCMA 4OF3A 1WBZB 1Q9WB 1JYVA 4BM7A 3PDOA 4DCQB 2EIZB 5T1MA 5GISL 2HJLA 5KVEL 5EZLB 4U1MA 1NGXB 3B8SA 3ARFA 3RUGE 2VLKB 1F6AB 4ZFZB 1KEMH 2GI7A 3OKYA 2APTA 2NR6C 4BQ9A 4DN3H 3VXPB 4CMMA 5HJ3A 1J0YA 4GG8B 5BZWB 4R97C 2BY3A 1JI1A 3BKJH 2EDOA 5EOQL 3MC0A 4XWGL 4U0RC 1ZTXH 2DD8H 5F71A 2EKJA 3MV9D 3CFKB 3QFJD 3MJ8A 4JO4H 3MXWL 3T4YA 4HUWA 3EFDH 1EJOH 1KT2A 1PZ5A 5IB4B 4ENEC 3HAEH 1FFOB 1FL6B 2DYPA 3S37L 4LEOB 3L3OA 4OV6F 5GGTH 5LXGL 1N4XH 3OJ2C 2Y5TB 3VRIA 3F58L 4NRZA 3MRJB 3EJJX 4HXAH 4KUZH 4W4NA 5GGRB 15C8H 2XZAH 5B39A 4AEIL 2AJUH 3SDCA 1D5IL 1YJDH 3WEXA 4IOIA 3S7GA 1BJ8A 4LLQB 4YDJA 4AMKL 3T65A 5BVJB 3EYQC 2B39A 1G0XA 2IPKB 5FUZH 1IE5A 2P7TA 4MLIA 5JQHC 5SWSA 4LOUD 2FD6L 2C4FU 2XACC 3FB6A 5LCVL 2VLKD 4QCIB 5C08A 1KB9J 1H15B 5FHAL 2APBA 3RU8H 4IHOB 4LNVA 1RU9H 1AO7A 4N8VA 2QQNH 3GO1L 2FCBA 2A6DB 5E6IA 5FYJU 1MF2L 4M61B 4MXVF 1MH5A 1H5BC 3PXJA 3MV9E 1GGYA 3QFJE 2R2BA 1W72A 4R90H 1JNLH 2F8VA 1JGLH 4WW1B 3L3KA 1FDLH 1YEFH 4ZTOL 3T0EB 1A3LL 2BOCA 2PW1B 5M94B 1VB9A 3DWTA 5I0DA 1MFCL 3RI5K 2HA1A 1Q9LB 5FEBA 2JLLA 3VA6A 4HKXB 2DS4A 5DHVB 3GSXA 5IFAL 4Y7MA 4Z5RB 3DRTA 2ZCLH 1U8QA 2Y07L 1YEEL 3S4SB 2I24N 3P9LB 3CXHK 2J12B 5FUCC 3G08B 1CE6A 3UTQA 3PWJA 4CW1B 4J3TA 4L3EB 5FO8B 3RVUD 3C09C 2VDPL 1H9VA 3RWEA 4MNQA 1YZZA 4XVTL 4I18B 3J8F7 3M1BB 1AXSB 2W07A 4PJ7F 2X6MA 2VLKE 1FC1A 2ATPA 2C1OB 3GIZL 4J3VA 1L9MA 1IL1B 1BWMA 1R3HA 4JGUA 5HD8D 1CIUA 1JHKL 2RIKA 3LV3B 4LSVL 4Y19B 5TF1L 1NUDA 3WNPA 2YD8A 4OI9A 5D7IB 4P23C 2Z4QB 3OJVC 3QUMA 4PD4K 5GS1B 4I3RL 3T2NL 4HX1A 4P2RB 4A6YL 4OV5B 2ILLA 1NLDH 4FFWD 3T0ED 1T83C 3OR6A 3C60B 3TBSB 3UPCA 2DMBA 3ZT5A 2R23A 1NKOA 4I0KA 1WITA 4NNYB 5HGHA 1HXMA 4G8EA 1UM4H 2PTTB 5GJSL 4KJQC 1C1EH 1A7OH 1I9EA 1W8NA 3S5LA 1NCDL 4L3CA 1CDYA 3D69B 4NUJB 2P8PB 5FGRA 1GCFA 1BF2A 2P1YA 4FFZL 1S9VB 4X4MA 4P3CL 3FQNB 3T2PA 1D5ZA 4Y2DB 3MGOA 5EOTA 3SCMB 3V5KB 5D93B 3OKOB 3JXAA 4IDLA 3S96B 1HQRB 1BFTA 3FB8B 3VRJB 3P4NB 5FM5M 1AE6H 1JIBA 4U0RB 3S36X 1DVFB 3DYOA 1CT8A 1DSFH 1HHKB 4P9ML 4U6YB 3BZDA 3F8UB 1OGTB 4YHYB 1RULL 1LO5A 4Y19D 1BLNB 2GJZA 4GBXA 5C09A 3UX9B 5IQ7L 5ERWB 1H8SA 1HILB 1KB5H 1P84J 1RURL 2GQHA 2BVOA 4XVJH 1EGJL 4P2RD 5HBBA 2GEEA 3DGGB 2AABH 4PRPE 5EC2A 3T0EE 1RV6X 3C60D 3HI5L 4ODSH 3VG0H 1CQYA 4KRPB 4L1HA 3OHXB 1QSVA 3PHOA 2VLRA 3LPGA 5EO9A 2HWZL 2KDGA 4Q9RH 4XXCC 2MKWA 1EEZB 5HYIA 4PPTA 4ZPTA 5HI4C 3OB0K 2VYRE 3MRGA 5KS9A 4Y2DD 3SCMD 4HKZA 3NFNA 4KFZC 4YX2L 3O3BA 1LEGB 2J88L 5B8CC 3RKDD 3RNKB 5EO1A 1JWUB 1DVFD 1H5BB 4PJAF 4QGYA 3DX8B 4KKBC 4LRIC 2V6HA 3DROA 4JRXE 4P4KC 1S7WA 1U8KB 4ENED 1CFNA 1EMTL 1U8HB 4Y19E 1FH5H 4GKNB 4LKCB 1MCBA 4H20H 2J6EL 1FO0H 1INQA 2H6PA 2XWBB 5D7IE 3UCRA 3UBXA 3UYRL 2BDNH 4R4BB 4RAVA 4G7YL 4P2RE 3JWOL 3VXOB 5KANI 5JW3H 2Z8RA 1UT9A 3MLTB 4BSVB 1D5XB 4KRPD 5IF0A 3SPVB 1DANU 3ARFC 4HJ0C 4Y4FA 5DUBB 1GZPA 1BQSA 3BOVA 3QDJB 4PYHA 2DQJL 3L3DB 2VDNH 3GSUB 2PYEB 4KC3B 3TYGH 4G9DA 5GGSY 1ZE3C 5FV1L 3HR5B 3SDXF 4JZOA 3ZL4H 1Q94B 1T20A 3QG7L 4IRJA 4G5ZL 2APXA 5F3BB 1T0NB 2R4RL 1EERB 5TDOB 1MCKA 2H32A 2ZCKH 3DIFB 4OD2A 5GGSA 9CGTA 6FABL 1F3JA 4U2YA 5HYSB 4JEGB 4TNWF 5GGUB 3BWAA 4XCNA 2ITDA 3UP1A 4P9HL 2IANE 3DHJA 2IFFH 3SE8H 4TVPH 4EXPX 2XG5A 3RGVA 5IVXB 3UTZB 3GIVB 1GGIH 3ZLQC 4UDUA 1S7TA 1MCOH 1M7DA 5IK3A 5ADPL 3SDCC 1UQSB 5E8PA 1WSST 1LD9B 1V3LA 4I0PC 3DSNA 1IAOB 1JZ5A 1I9RL 3EOAB 2WBJA 3MFGB 4JFEA 4KUCD 4M6MH 5JW5A 3BQUC 3GSVB 5DVMA 1ZS8B 2OQJA 4OM0L 3QUYA 2HJKB 3MLXH 2KQNA 4LQFL 3VD7A 5HVFB 4I2XB 3P2TA 1GGTA 1DBKL 2R69L 3MA9H 4R0LC 2J8UB 4ZS6D 2EDFA 2ICWA 1NCAH 1OAUH 1PG7H 3PDGA 3I3BA 5DJ8A 2NZ9D 4DAGL 3QDJD 1X44A 5DEGB 3ULUD 2PYED 4L4VA 2DQUL 4G6KH 5ICYB 2VQUA 4QRPB 4WUKH 1T2XA 4KKLC 2HFGL 4YXHL 3S35H 3W2DH 1P4IL 2OMBA 2NXZC 3HMXA 3IFPB 5CJ8A 5I19H 5DJ2B 1G7HA 2ZP0T 2R56L 1S78C 4ORGB 1HOCB 5F7MC 4HK3N 4MJIA 1S7UA 3P0VH 3FN0H 1T80A 2A6KA 1ZLUH 3Q0HA 4OCYH 5D7LA 5EG6C 5BV7C 3SGJA 2ZG2A 3SQOH 1UWGL 2IF7A 3KLHC 3RY6A 2DQFB 3MREB 3P0GB 5IR1A 3GMQA 1W0WA 3LD8B 5ALCH 3V0WH 3GDBA 4YHKH 5D6CA 4GW5A 1FFPB 2Q7YA 4JM4H 3S4SG 5GS2D 4DFHA 2KZWA 3T09A 1BEYL 3W81A 4MA3B 4OUUB 2UY7A 2VR4A 4XPGH 2VC2H 3L5WB 3BGAA 4MA7H 3ZKNC 4DKEH 1CK0H 1KB9K 4YDKH 2EH8H 1FNSH 1KJVB 3DVNB 2AJVL 1TZIA 1SM3L 3QDJE 1FIEA 3BEWB 3ULUE 2PYEE 2XN9B 4QRPD 3WS3B 1FAIL 5EOCH 3V6OC 4KVNH 1I9JH 1JF6A 1NUNB 3GSQA 4IDJH 3N1GC 1F42A 5JLZB 3JV0A 4K3EL 2RJMA 1PLGH 1TJHL 3GFUA 3DVGA 5BS0B 4F7CB 1G9NL 1VFBA 3WSQL 1Q72L 2YPLB 3KJ4C 3VWJC 3MXVL 3SDYH 4MQSB 3TBVB 3G6JE 2OTUA 2BNUA 5I1DA 5IVXE 3DVIA 2XKNB 1YECL 5E9DB 4KAQH 3T0VA 4LEXH 2CDEB 3MOQA 2GK2A 3MRPA 1B4JH 2AJZB 2HVJA 4AT6A 2X5PA 4G8FB 3GNMH 3VFTB 1A4JB 4LK4A 3KPPB 4S1QH 3KPSA 5I8CB 2EYRA 5JPNA 3QHFH 3L3GA 2EEBA 3BO8A 1IAII 2J8UE 3O3EB 1TVDA 1CN4A 5HVHC 1RJZA 3DMMB 4PJ7A 4BKLB 5CEXB 4LFHD 2C7UB 1U8IB 3FCTA 4OGAD 2HTKC 1MQKH 2XN9D 1L7TL 3NFPA 3NN8B 3VXNB 2P47B 2CGRL 4QRPE 5GIRA 4H8WH 4X6DB 1NCCL 2Q8BH 3LQZA 4GBXC 3MRCB 1KXTB 3W9EB 3ARBA 2H1PH 3BRFA 1I4FA 4OSUH 3QP3A 1VEPA 5BS0D 1EJ6A 2YPLD 4RNRB 3QO1B 1NCTA 1UA6H 2XA8H 2X4RB 1GVIA 1LEKB 1PKQB 3UJTL 3BIKB 1HIML 5E9DD 4P46B 4PLOB 4XBEL 5HTSA 5TH2B 4R0LB 5GS0L 3FQWA 1YNTB 4YO0A 2OJZH 5BW7C 1CFTA 1KC5H 4EEEA 4NM8L 2VDOL 1WZLA 3D85D 4WI8A 3MLUH 1YQ2A 3ULUF 1QOKA 3DSFH 1RK0B 2J8OA 3OV6A 3CMGA 4GQPH 2DQDH 3DMMD 1Z9MA 4QHMB 3NIGE 4H1LH 4H25B 5DZNA 2CDFB 1U41A 2ADIA 2MJWA 1NGQL 4XVSL 5DJXA 5DC9B 4NQSB 4U1LA 2XN9E 3WFHB 4EI6B 4Y4KA 2GYSA 2V7NB 4Z7WE 2YRZA 4NO2B 1CS6A 1HHHA 1D5BA 4FZ8L 3G6JF 1FGNL 2KQMA 5DJCB 5IVXF 3MFFA 1A6ZA 3FO9B 4HJJL 3IU3A 4KV5F 5BS0E 3G5ZA 4NC1E 3E6HB 2NMSA 2YPLE 5LAXA 5E7BA 1A0QL 2PUQT 2E7MA 4OD1L 2VR5A 3P4MA 4GO6B 4YDVB 2PR4L 4MVBD 4UT6H 4Y4FC 1RZGA 1WBZA 4NKDB 4P46D 1UCBL 3SO5A 1XGQA 5H94A 2YZ8A 1I1FB 3P40A 3BKCL 5I76A 5F7KC 4PV9B 3GB7A 1QQDA 1MAML 2CKBB 4HH8A 5INCA 3CAFA 1FFQA 4MD0B 3MXWH 3GJFA 3MLRL 4PLNC 4KKLD 5D5ME 2AP2A 5J6HB 2OL3L 4X6BB 1W0VB 5F8QC 3S37H 5BZWA 5GRVK 3TZVC 3ZSSA 5HYSG 3CDGA 4X5LA 4X8XA 4NZTH 4U1HA 4PJAA 2JE8A 4W6WB 3RGVC 3EOTL 2P48B 5IV2B 2WQ8A 1XFPA 4Q97A 3PNWB 1CIDA 3I3EA 5AAMA 4AEIH 4X6DE 1A9BB 4HZLA 1D5IH 2FL5A 3DUHA 3QIWA 3VWJB 2R9HD 5IQ9A 1MFAL 1YN7B 4AMKH 2Y5TA 4TOYL 4LARL 3CDYA 5EFIB 3MRJA 5KVGH 3MACH 4LRNL 3UZQA 1R6VA 1EUTA 4X4YB 4FTVA 1QRNB 2R2EA 1JWSA 5LKNA 1D6EB 5J3HC 3TPKA 1PKQE 3IDUA 2DM7A 3SQBA 3SDXA 2YC1B 1KF9B 4D0DA 4OLYH 1U8NA 1ZGLA 1KUMA 1YDPA 3BN3B 4EDXB 5HXMA 1E6JH 3BESR 3GO1H 1C8PA 1MF2H 5E00A 3RX8A 4NQEB 4PGCB 3OKNA 2IAMC 3WFEL 3SDDA 1HDMB 3GSWA 3W39A 5IVZB 5T3XL 1LP9B 2DM4A 4Z7WF 2A6DA 3Q6GL 4Q74A 4XNMB 4QOKB 5TDPA 4NZDA 1RFDL 5DJYA 3G5YA 4DEPB 1B0RB 5J9PA 1RMFL 1Y18A 2XZCH 3AUVA 3SGJC 4PRPA 3PWPA 3VFVB 3T0EA 3RY6C 3BDBA 1RVFH 2PW1A 4TSCL 4U1KA 3GK8L 3LKQB 3BSZL 3STLA 4ZFOB 1V3MA 4MZ2A 1Q9LA 4IBLT 3GRWA 3DO7A 1WLHA 4HKXA 2BY1A 5T1KB 2BVQA 1NC2B 1JF1B 5CS7A 5ALBH 3S4SA 1QRND 3FFCE 1TPXC 5I17A 3GIZH 4NRXA 3TLRA 3UBXI 4DUXA 1S5HB 5FO8A 3V5HA 1BVKB 1T1XA 2VTFA 4LSVH 5IW3A 1G9EA 5D5MF 3DGCR 4JANB 5FM8A 3TIDA 1AXSA 3QH3B 4NQED 4F7EA 4I3RH 4BELD 1FGVL 5FM4A 3WO4C 4A6YH 1EXUA 3UROR 32C2B 4UBDC 5SWQB 1ZLWK 4JRXA 3PGFH 3LV3A 5HI3D 2NX5A 4Y19A 2CK2A 1NGZA 4B50A 5A2JH 5E8EB 1E27B 4PRIB 4S2SA 4QOKD 2Z31B 3MRIA 4QT5A 3I9GH 5GJSH 3HA0A 1P2CA 3TGXA 1NCDH 4P2RA 5C9JA 3WCYA 1I8IB 4GXVL 1QFWL 3TBSA 4FFZH 1JYNA 2IG2L 5I2IA 4OF7A 4M6NL 4X6FA 4BQ8A 4P3CH 4WGWB 2ARWA 4KK6C 2VLLA 3JWDH 2PTTA 4DZBA 2DOCA 4NZRH 1PYWB 5T1KD 3SGDI 5IHZA 1NC2D 1V7NH 5GRYA 2AK1H 2QADC 5CLTA 2BVUA 1QRNE 4TRPL 3QJFB 1CVRA 1YN6A 1KCSH 3PXHA 1E6OH 2C26A 4WHYH 4P9MH 1F3DH 4PGEA 4Y2DA 4PRNB 2ZNWA 3S96A 2ICWI 2WQRA 4HIHA 4TSAH 3P4OA 2IANA 5KSUB 1RURH 3TH2T 4F58L 4NQEE 2PYFB 2XTJB 4NFDA 1CLOL 1J0KA 5I75B 1EGJH 1QFPA 1AY1H 2X4NA 1MIEL 2W0KA 1CDIA 3BPLC 4NNXB 1YYMH 3MV8B 1A4KA 2ZUQB 2AJ3A 4PJ9B 1MWAB 2CD0A 2GTZA 4E9LA 4CVZB 3LVEA 1LP9E 4KJPD 4PRID 5F1SA 2Z31D 2GT9A 1RJLB 2YEZA 4QOKE 2OK0H 2VAAA 1MLCA 3TCLA 2ICWJ 2HWZH 5T33H 3RVWC 3RHWK 4XCCL 3FB5A 5C0IB 3OHXA 1D5MA 2FGWH 3HZVB 5LQBL 3VXRB 3TV3L 3QUZA 4F7MB 4N0FA 4YX2H 1P7KA 4NFCA 5EC1B 2N7BA 2RGSA 3NA9H 1HZHH 5FFLA 2PXYB 2MNUA 1KG0A 3FQRA 4O5LL 2FEDC 1I7TB 1OY3B 2I9LB 2IAMB 2JTDA 3ZE0E 2W9EL 4XMPL 4J3OC 3T0DA 5AD0B 4POZC 1EMTH 4Y4KC 4AQOA 4HF5L 1QA9B 1J10A 2BERA 4LLDB 4P5TB 4WHTA 4OUOA 2J6EH 2F53B 4Q0XL 4OLVH 5ETUB 3RNKA 5IUSA 2XTJD 3E3QE 4K8RL 3RVTC 5CP3H 3V4UH 3MV8D 4PJ9D 1LO4L 3OF6A 4MHHI 5JXAL 1X7QA 4PRIE 4XC3L 3T0WA 3THMH 2P8LB 3AM8A 2CRMA 1F3RB 2Q3ZA 2BRQA 2PNDA 5GRWA 1PJ9A 4BZ2H 2FLRT 5GRZA 4LDLB 3TBWB 1A64A 1OWWA 3QG7H 4MNGA 1TPXB 1HHJA 4G5ZH 1QNZH 3B8YA 3MX0A 3VXRD 5D1QC 1KCVL 2UZYB 3GSUA 6FABH 4XZUB 2VO5A 4ZUVB 2PXYD 3ZT6A 4P9HH 1D3CA 3EJZC 1K8DB 2COQA 4R4ND 3MGAA 1JV5B 1AGFB 1AQDB 3BD4A 1DQLH 1OTTD 4LQ1A 4K94L 4Z77B 4ZD3L 3BMWA 4NWUH 5HYSA 4P5TD 5ADPH 4DUWA 3QIWC 3B9AA 1QRKA 5AEAA 2FJGB 5IM7B 2XTJE 2FJFA 3G6JA 1G7QA 3BP7A 4OFPA 4FQQB 3GSNL 5IVXA 1CFSB 1Z9LA 1YJDC 5JOPE 1DBKH 2XQBH 4HIIB 4O2CA 4OCWL 3RVVC 2F5BL 3U4BL 5C0JB 1BZ9A 1TVBA 4YK4C 1X5GA 3SKNB 3IU4H 1M71B 5DVNA 1LD9A 1XMWA 1IC5H 3E6FA 2IBBA 2DQUH 6CGTA 5AUMA 4YBLB 1A1OB 2HJKA 3VGFA 4N9GB 1L6ZA 1IGJA 4XB8A 1KXQE 3BW9B 5H37H 5L8JB 5A2FA 4HWZB 4LU5L 1A6AB 4J3WA 1IM3B 3QQ3A 1RQ5A 5FK9B 3HPJB 1KPVB 1QFUL 4G6FB 3HE6A 3SDDC 2FDBP 3QXTA 2Q1EA 2X4UA 4H5SB 5FIEA 4G6AC 3JV4A 2HFFB 4G3YL 1BOYA 3MODL 4O51A 4WHDA 5FB8B 4PJ5A 1F6FB 4ZS7L 2DWEB 1F11B 4JCLA 1RZJL 1KIRA 1S7VB 2NY2C 4M3KB 4LSTH 4X5XB 3GHBL 4BK4A 3OB8A 3DV4A 1DN0A 4M5ZH 3EFFA 2HFEA 2IPUK 2YOCA 5C0CA 2ARJQ 3DX9B 4KDTA 1QG3A 1BQUA 1BEYH 4TTDC 2JJTC 1G7PA 1KBGL 1RZFL 4JQIL 4F7TB 4N0CC 2RQ8A 3MREA 4P57A 2AJVH 3V0VA 2P8MB 4NOBA 5CZVL 1SM3H 5I8OL 5C0NC 1MRCL 2E6QA 1FAIH 4OZGB 1AJ7L 2H3NB 3JTTA 1OQXA 4JAMB 4QXUL 5E2JA 2QKIA 3IS0X 3FQTB 4RBPH 3AXLA 1KJ2H 2YD4A 2WWMC 1A7NH 1QD0A 4PJDE 5EU6B 3ZTJH 4G6FD 4PBWD 2XN9A 1G9NH 4I77L 4EQ2A 4B41A 5ACLA 1GL4B 4Z7WA 3MYJA 1CGTA 2OTPA 5GRUH 3IXAA 1T03L 5A16B 2FWOB 2XICA 3H9HB 5HHNB 3EYUL 2AGJL 4PJIB 3MRHA 1HHIB 3NGBC 5L88L 4NKMB 2G2RB 3PWNA 4I9WE 3D2UB 3E8UL 4IMKA 2Z91B 1SY6L 3U46B 1DBML 1RJYA 2O5XL 3O2WH 2ICEB 3I6KB 4KY1L 3ECBB 4UQ3B 3G6DH 3OAYK 4XMKL 3PUCA 4PBXA 2AV1A 3Q5TA 1E4XH 1L7TH 1RHHB 2AEWA 2CLRB 4L9LA 3D85A 3WJJA 5JOEA 2CGRH 3D0VB 2YRPA 5I8CA 5D5MA 1NCCH 3DX7B 3O3EA 4RRPA 3DMMA 4KJYA 1GOGA 4OIBA 1Z0MA 5EU6D 1FN4A 3HAEB 2AXJA 1I9IL 2NPLX 1JBJA 4RMSA 4HHAA 2ITCA 5MEQA 2VL5A 4LAQL 3MNZB 1MJJB 3MRCA 3LEYL 4GT7A 1YA5A 1JTPA 1R5WB 1HIMH 1NCWH 4OFYD 3X12A 4JFDB 2Q8AL 1CGUA 3OR7B 4YK4B 4KKCD 3EHBC 4QO1A 1TQBC 1FZMA 4JG1H 4LLVB 1T0MA 4PJHB 5HYJB 1NAMH 2VDOH 4ZTPH 1KULA 4MS8D 1YEIL 2V2XA 1RZKH 3D2UD 3QPQC 5DD6B 2K3TA 5IROC 3QUZC 4P46A 1I1AA 4ZO9A 4HCRL 1CXLA 1AGEA 4XRCA 1NGQH 2B0SL 1MFNA 3C6LB 3ARGC 5F97E 3VFUB 4PJDF 1P7HL 2ZSWB 4OZGE 5K9OB 3F62A 4M7KH 1RK0A 1AGBB 1UVQB 4KMLB 5HGBA 2BCKA 4QHMA 1TMCB 5L9DH 2IFGA 4FZ8H 4XH2A 4OCXL 1OAXL 4JN1L 5EU6E 4CVXA 4GLRH 1Z5LB 3FB7A 4PRHB 1FVEB 4DZ8A 4NQSA 3WFHA 1IGTA 3RA7L 3L3HA 1A0QH 5KN5A 3WHE0 2EDKA 4OD1H 43C9B 2PR4H 5K9KA 1XZ0B 4FQJL 4FABH 1OPGH 3B9DA 4NJAH 5F7DB 5D9SA 1EAPA 3TJHC 3L6FB 1UCBH 3TPUB 4JFDD 1RUPL 5AYQA 2FSEB 5CGMA 3NCYP 4PJIE 5E4EB 3BKCH 3MLZL 5DJDA 3KWWB 2YD9A 5HYJD 2K9UA 2NNAB 3FFCA 3WLBB 2BNRA 3MLRH 4F80A 5IBLC 5A43C 1AD0B 1AR2A 1JNNH 3RDTB 4C54A 2DAVA 1P5UA 2AEQL 4W68A 3B9KB 5CCKL 3HZKB 2NYYD 5JA9A 1JHTB 5EBWA 1UB6B 5SX5K 5J11B 1VEMA 3C6LD 3BT2H 4WEBH 3VU2A 5D71L 5CJQH 5SV3A 3MR9B 4MJ5A 4JRYA 4HUVB 5C07A 3DURB 1SJHA 3RQ3A 4TOYH 3VDCA 3M8OL 1ITCA 2RB8A 3O4OB 1NC4B 1X4XA 3DUUA 1IGFL 4NO0B 4TVSa 1U2HA 4OCSL 3QJHA 1ACYH 4MNHB 3O6KH 4X7SH 1I1YA 3L5JA 3PJSB 1X6NA 1I3GL 2VABA 4I48A 5EFIA 3TBYA 4JFDE 5BOPA 1FSKC 3VFMB 4TQEH 1ZHKA 4PJHE 2EZ0D 5HYJE 1QRNA 3AS0A 2FHCA 5BO1L 3WFEH 4FQCH 3RDTD 3HE6C 2HH0L 2NY3C 3B9KD 2PO6A 3AY4A 4OZGF 1JGEA 1IM9A 4EDXA 4OFDA 2J4WL 2A9MH 5T3XH 5D1XC 2V17L 3LKPB 1F45A 1K8IA 3QEQB 2M26A 3IETB 4FG6C 4BSJA 1RMFH 1KB5B 4M62L 3U9UB 1TVHA 5IB3A 4LVHC 4TSCH 1X5JA 3GK8H 1N7MH 1WGOA 3BSZH 5IVZA 1T2JA 1NC4D 4KDTC 2WUCL 3RPIA 1Q0XL 1AI1L 4GKSA 2PTVA 3E1F1 1TQBB 2DBLH 2I27N 3AFLA 4ZXBA 4PJIF 4G43B 4KKNA 3CUPB 4WHCA 4HUUA 1KPUB 2AJXL 3MRRB 5HI5D 3AS1A 4CVWA 3WNMA 2Q7NA 4PTUB 1J12A 3C08H 1JF1A 1NPUA 3TT3H 1J1OL 1U9KA 1ZSDB 4N8PA 2RR3A 4S10A 1WC7B 5AAWA 4LNRA 1KLGB 4JANA 5AZEL 1I3VA 2EIDA 4LHUA 3KPNB 1DQQA 3QEQD 5FKPB 3Q2CA 4MB3A 1FO0B 1BBJA 1NANI 5HHPA 5SWQA 3OKEB 5FHBL 5K9JL 4NYLA 4NC1C 4NCC1 1JPST 5LWYL 3KLAB 2IG2H 4M6NH 3MNWB 4LKXB 5E8EA 5C71A 3WMSA 2Z31A 4OZHB 4J4PD 3CJJA 1DUYA 4IMKC 4HKJB 4BH8A 5FDWA 3OG6B 2MFNA 3U30C 4L8CB 4TRPH 2X4TA 2W65B 5C0FA 2ERJC 1NJ9B 5FECA 1EX0A 3VFOB 3WN5A 1UADC 4L9LC 1R3IH 4M02A 4KHXL 3WJJC 1NFIA 4U3XA 2YXMA 1FVDB 2HLFC 5F1OB 1OAQH 1PQZA 4AM0A 1CLOH 1M1SA 3SKOA 1C08B 3G9AB 4H8WC 1CGWA 2FBOJ 4JN2A 1KCUL 4K7FB 3HI1A 3HAEG 1TZHB 4NQDB 3G9VA 4PJ8B 4RA0C 3JWNC 4MQTB 4QYOB 4UQ2B 3MLPA 1HSBA 3I84A 4LF3B 5L2JA 1K4CB 2V5YA 3TA3B 4O9HL 2GSIA 1QKZL 4HIXL 2BMKB 1N2RA 4PJFF 3IJSA 2WUBL 4U2ZA 4RGOH 4XCCH 4ZUSA 5E7FA 4D8PB 4E42A 5F6IC 3OX8B 4YHPB 3CC5A 3CPLA 3GJFK 1I1AC 1L6XA 1ZVSB 4AK1A 3BHBB 3QXVA 4RWHA 4LPYA 4O5LH 5IOPA 5A2IH 4GAYA 2WAHA 5K9QG 1INEL 4FXKA 4U6XA 2AV7B 2VH5L 1MCEA 1T1YA 3CNKA 1FBIH 1DQTA 2JJSA 5ADOL 1G6RB 3QUXB 4BFEA 3H9YA 3BKYL 1PSKH 3ALXA 3WIHL 3PE9A 5D1XB 1AP2A 4K8RH 5FGBA 4MD5A 4QXGL 5DRXB 1A1NA 1VADA 2NY4C 2B8OT 4FNLH 5AD0A 1LO4H 1G7JB 1TFHA 4NQDD 4PJ8D 1JPFA 3EYSH 4EBQL 4LLDA 2CIKA 4P5TA 5T1LA 4MAYA 3F7PC 5KOMC 3SO3B 4XC3H 5ETUA 2AQ2A 1U95B 2D31B 4NT6B 4HWNA 4MMZC 3BJLA 1G9MC 3TA3D 1N5YL 2FZ3A 5DRZB 1A7BA 1M7IB 4X5WB 1BQLL 2YA0A 3HRZA 1LHZA 3HLAA 2F15A 5H35B 4NCC2 3T0AA 3UTPD 3T1FB 2ESVA 4MCYA 3TO4D 3CSBA 1I7UA 1YEKL 3MCLL 2DKUA 1JPSL 5CSZB 4TNWK 3ZYZA 4M00A 1MIMH 1XGUB 4MLSA 2AJSH 3HNVL 1S7RB 4GQ9L 5F9JB 4GG6F 3IKCB 3LZFH 4PJDA 5IEHA 1VPOL 4K94H 2EYTB 4ZD3H 2R1WA 4XZUA 2QR0B 3QI9B 4UINL 1MHEA 3QUXD 4G6ML 3G04B 2EXYC 4KRNA 4PJEB 4Z8FL 1I8KB 2QV2A 4CU8A 3I3DA 3HC4L 4FG6D 4RQQA 3VG9C 4HDIA 2WV3A 3WFCL 4OCWH 3U4BH 4Z77A 2F5BH 4YHNB 3R1GH 1QBMH 4NQDE 5EUKA 4HIEB 5I1AA 3T0BA 1KIQB 1OSZB 2BSSB 5DFVD 3OKMA 3MA7B 4FQ1H 4AIZB 2UWEB 4RMRA 3JV5A 2D03L 1PY4A 1U3JA 4YHMH 4N1CA 1CBVL 4KI5C 1LO0H 3KPRD 4RGNB 2MQ0A 3H0TB 3A6BL 1IQDA 1Q0YL 1KV3A 3BIBX 3I75A 3SKNA 3S88L 1M71A 2DIBA 4JHBA 1TCRA 3G6AA 4R4FL 2HVKA 3U7AA 3KNBB 4PBVC 4P2OA 4NJ9H 3GMRB 2PO6C 3AY4C 4G3YH 1TIUA 4JB9H 1YC7A 4QHUA 3CK0L 1ORSA 4ZS7H 5FO9A 1RZJH 1I3RB 2KPNA 5DD0L 3IDXH 3RPKA 3LIZL 3GHBH 4XBPB 3QI9D 2Z92A 1IGYA 1OW0A 4H5SA 4RZCB 1OTUC 2A38A 5E99H 1F11A 3C5ZA 2G75B 1YQVH 5I1LB 3IDMA 4F9PA 1FIGH 1KBGH 4JQIH 1PX3A 5KAQG 3BJ91 4ZXBC 1AIFB 1QSZA 2X05A 1WFNA 4G7VL 1IAIL 4JO2L 5EORH 1SVZA 5CZVH 5DR5H 5E8NB 2JCCE 3D0LB 3DX9A 4XNXH 4JPIB 5KTEL 1FPTL 5HHXH 1AJ7H 4KPHL 3KPRE 4RGND 3K8LA 2ICCA 4QXUH 1T3FA 4OQTL 4GS7B 4YC2C 4X6EA 2XNAB 2IALA 5D2NC 3DV6A 4XBGA 4RAUB 1BGXL 1ODAA 3MNVB 4HWBA 2B5IB 1RIUL 3EYFA 1BHGA 4XNZB 2FH8A 4H1LB 1NCNA 4I77H 1MCWW 5C2UB 3O6FA 2YD3A 4TN9A 2X9WA 1PD6A 3CFEB 1KXVC 4WDIB 5JORB 4PJCB 1MLBB 3CFDB 1HINL 3PP4H 4HGWA 1T03H 5GGVL 3JUYA 2IBZY 1ERNA 2NY4B 2E7LA 4BH7B 2VOTA 5DFTA 1BD2D 3PABB 5ENWA 1C5DB 3QIBC 4M3JA 1ZA6A 1UEMA 2IC2A 1HXYA 2D0FA 5L88H 2E8YA 1Z0NA 1CDGA 4DVBB 3U1SH 3E8UH 5GSRB 5FXCH 1RZ8A 3H9HA 5FM5O 5BV7L 3SE3A 4HPYL 3IAPA 4PJIA 4WTZG 4QTHA 4M43L 3LS4H 1XIWB 3JWDC 3QEHA 4FXLA 1YY9C 1Q8MA 3GBMH 5J12C 2JK5A 4NKMA 2GCYB 4Q6IC 4RX4A 4RGNE 4BFBD 2GK0A 1RZ7L 1TENA 5KSAB 4HXBH 1R24B 4U1SA 3BRGC 1RUAL 4GRWH 5I1JL 4WENB 4X7FC 1UFUA 2X4SA 1I9IH 1MHCA 4RMQA 2ARJB 1B0GA 4LAQH 1J05B 2JB6A 3H9SB 5LGHL 3HNTH 4XPFH 3K1DA 4CL7A 2L0DA 4YR6A 5L8LB 4I0CC 5I71C 1H3WM 4PJGB 1CD9B 1WBYB 4XXDB 4F8QA 5T3ZD 1U3HB 5HGDA 3QUML 1IAIM 4GW4A 2Q8AH 4NKIL 3LMJL 4XPTL 5B3JF 3BZEA 1RIHL 3FKUS 4HZAA 1NEZB 2ZUSA 1BD2E 2HFTA 1GXEA 3VCLB 2AKRB 4OLXH 4HT1L 4Y88A 1MCWM 3FMGL 5D7SL 2BVEA 1JGUL 2V5SA 2NTFA 2X1PA 1H3VA 2JCCF 1I7RA 4HCRH 4KI1A 1MRDL 1KENL 4JFDA 3OR7A 3O6MH 4QHNA 1XIWD 2B0SH 1YPZE 4QTIH 4HS8L 2ZSVA 1JZ7A 5F7HA 1A7PH 1XF4B 3C5SA 4KQ4L 5MHSD 5HYFA 1N64L 5KSAD 5CKAA 1AC6A 4YE4H 2HT3D 1OAXH 1GRWA 1UM5L 4JN1H 1FLRH 1WCQA 1UXSA 5FGBC 2RCSH 5IWLA 4LSUH 3DETD 1SBSH 3RA7H 5IG7A 3H9SD 2IH3B 1S7XB 3WHE1 1MVUA 4MAYC 1SEBB 4FQJH 3QHZL 1VEOA 2NLJB 4PJCE 4F57H 4M8VA 1U3HD 5T3ZE 4PJFA 4X7CC 1RUPH 3FJTA 3L7EA 4K23L 5L7XH 4YHLL 5LG1A 1FV1A 4OGYL 4XP1L 3VD3A 3AGVA 4D9RE 1MOEA 2NZIA 4Z7UF 3BE1L 1IGML 3O6LL 2AEQH 3E0GA 5CCKH 2Z8VC 1OT2A 3VGDA 2YUZA 3EOBA 4N0RA 2OXHA 4QRRA 5IHBA 3NOIA 4UI2A 2EC9T 1FYTB 4OIIL 4W81A 5FYJL 1L4IA 3QRFM 1K9TA 1WWBX 1MPAL 3VXTA 1RUML 3RWGB 4PGJA 3B9KA 3ARDD 5CZXC 4WI2A 4A6YB 4PP1D 4F33A 4U1GC 5I73C 3ROLB 5IW6A 4JLRA 1UB6A 4QNPE 5J56B 5LGKA 3CDCA 1IGFH 4GMTL 4LLMB 4X4XB 4HJGA 3RTQB 2EDYA 2DM2A 3H9SE 1H0DA 1KGCD 3QIBB 2WINA 2YS4A 3E2HB 4X98B 35C8L 1RHFA 3DURA 4PJGE 1IAKB 4ODTH 1I3GH 1P4BL 5E2WH 1MHPH 1NGPL 3CFCH 4NP4H 4ELMB 1N59A 1RD6A 4PJXB 1J0HA 2P5WA 5ID0B 4XNQB 1T0PB 4BQ6A 3ORJA 4Z95L 3ZKXC 2A9NL 1DUZB 5J1AB 3HS0B 3T0XA 1YPZF 5BO1H 3PJSA 1N3NA 4JVUA 4Q6IB 2HH0H 4KTDL 1ORQB 1A2YB 4P2OC 4MA1B 4J8RB 4DGVL 5C8JA 4D0CB 2J4WH 1U8OB 4GG6A 1FYTD 3J7HA 5I8EA 2VZTA 3PWVB 2V5MA 4OZIE 3OGCB 2XYCA 5DI8A 3S98A 4CDHA 4PRAA 1OW0C 3FHQA 2CRIA 2VE6B 1F4AA 4LSQL 5ANMB 1Q0XH 4PJCF 3C5ZC 3RTQD 1AI1H 2FO4B 4GAJL 1R3JA 3IETA 3MJ7A 2CUHA 1T1WB 1BECA 2X10A 4XVUC 3BH9A 3TO2B 1AD9A 3UC0L 3QIBD 3W0WB 4JO3H 1KGCE 2GTWB 4Y1AA 1V7ML 3WDHA 1C7SA 3OJDA 1IBGH 4NM4H 2AJXH 2I5YL 2VDML 2BSRB 4HFUL 4KJWD 3D25B 4NDMA 2I9TA 3NZ8A 3K3QA 1Y6MR 3GKWL 4JQVA 4LHQB 3BAEL 2CDGB 3TWCH 1S3KH 2X09A 2UV3A 3AREA 3F6LA 2H9GB 5C0EA 3AB0C 2IQ9L 2UYLA 3O6FC 4H1LG 5D7JC 2DIAA 1MRFH 2Y25A 3IDGB 5EH1A 2LAGB 1FYTE 4JFFD 3HMXL 5KVDL 4JKLA 1WF5A 4WU7A 1T22B 3QZWA 4QNPF 2F19L 3C6SB 5DQDL 1Z9OA 4OIAA 5F7YC 2E7LC 3MRLA 1HN1A 4FXGA 4YPGB 1B90A 1KLGA 1FVCA 3GMPA 4CGTA 4M9OA 1QLRB 2E9BA 2HLAA 3U9PL 2WLYA 1EIBA 3TF7C 5DSCB 3KPNA 4QRSB 4LCIL 3BEVB 4PY7A 2W9LA 3CVHA 4QHLB 3STZB 4BQBA 1ZHNA 5JDSB 3W0WD 4UOJA 1GGBL 3PP3K 1JYXA 2NY7L 1CFQB 4EUPA 2DWDA 3N1MC 1MCSA 3P0YH 4JZNB 3RBGA 1BOGB 4GUPA 3QUKA 1NDGA 4ELME 1CD1A 4PJXE 3N1FC 4LPVA 1H3GA 2PCPB 4LMQI 2AJYL 5DRWB 5DF0A 4LLAA 1URLA 2H8PA 4ZPVB 4OZ4A 5DRNB 4WJ5A 5HHOD 1DFBH 1KCUH 5EIIB 1QPPA 4MQXD 1QFOA 4OZIF 4AJ0A 1JFQL 4U6VL 1V5JA 5IEKB 3FO2B 3QWQB 4HEPG 5F6HI 5EUOE 4JFFE 4XX1E 1MHHA 2MHAB 2ZCHL 2D7PA 3ULVH 2YWYA 1CLYH 3BPNC 3WXWL 4HULB 1LEIB 1BFOB 2ED8A 4G80A 2VR9A 1U91A 4OM1L 5K33A 1OD9A 4LBEB 3BD5A 3RVXD 1NEZG 4M1DL 7CGTA 3MO1A 1JPTL 5I74C 5ANME 3TA3A 4NN7C 4J23A 3IDYB 4H26A 5IB1B 3U7YL 4HGMA 3T4AB 2CMRH 4WO4B 4RFEB 4G42A 5GXBB 1J8HA 1Y0LB 2R1YA 3NCBB 3W0WE 1HYSD 3ZKXB 1RZKC 3CFIC 1C16B 4D8PA 3NAAL 3LHPL 3U0PA 3TO4A 2NY5H 3PL6B 2VH5H 5KSVB 1M7XA 3UAJD 5ADOH 4PY8I 3GM8A 1K4DA 4CADA 2OCFD 4HS6A 3DUSA 3O0RH 1CL7I 3X3GH 5MEOB 3QIUD 5IWLC 5HHOE 2QSQA 2AV7A 5DJ6A 4O58L 5MENB 3RNQB 4Q2ZB 4EBQH 1GPOH 1T1ZB 4CN6A 3QUXA 4OZFH 3OKKB 3PHQB 3RZCA 4Y5XC 4WW2C 2MTPA 1N5YH 5IB2A 3LPWA 3B83A 4PY8J 1VHPA 1WQVT 3DTXB 1M05B 4R26L 1ZLWH 4ODUB 1CG9A 5E94B 4IJ3C 1FZOA 1Z9SA 3KLDA 5DD1H 1G7JA 2B2XH 3HPLB 1ZHLB 1EO7A 4S1RH 2VQ1A 5GZNC 1P1ZA 1T89A 4BUHA 2JCCA 4BSWB 1JPSH 4NN5B 4HLZG 3BVNB 4WO4D 3KPRA 5CP7B 1DN2A 4MDJA 4GQ9H 1GYAA 4O2FA 4QWWD 5F7UA 5EN2A 4U31A 2D7QA 1YC8A 3PL6D 3V52L 1EAJA 2XRAL 3CVIL 5FYLL 5CEYA 3SN6N 3B6SB 4ONGH 4XPBH 2GSGB 1KJ2B 1XF5B 4YXLL 4UINH 1HHGA 5CSZA 1DQDL 4HK0A 4WI4A 5D7JB 3QPXL 3ZE2E 1GGCL 2WZPD 5HHVL 1S7RA 5JQ6L 4Z8FH 2X1QA 3HC4H 5E1AB 4F7PA 5EUOF 4MDIA 2R29L 1I85A 2EYTA 12E8L 1HQ4B 3QI9A 1E4XI 4KU1A 3G04A 2KKQA 2Y06L 4UIKL 4KVCL 3AMLA 2NW2B 2D03H 3GGWA 4PP2B 3JBG7 1BQHB 3P3YA 3V0AC 1CBVH 3LSOB 4R7NB 3WFBL 4XHJD 5IMKA 3MRMA 2KBGA 3A6BH 1JPGA 5C0AA 4O00A 1JZ6A 3S88H 2F5AL 4Z7UA 1KN4L 2NY1C 3MA7A 3HG1D 4UUJB 3R8QA 4R4FH 3GMLA 2VLJB 1AR1C 3JTSA 4WI3A 2QSCL 5BQ7B 2R0ZH 1UKTA 3CK0H 4PRBB 1JI2A 3BPCB 1BREA 3IDJB 3IFOA 3TJEH 4U1IB 4DN3L 4PGBA 2JJWA 4P5MA 2WIMA 4TUJA 3LIZH 4XX1G 5D7JD 1PAMA 1FC2D 4U7KA 4LVNB 4PR5B 1NGWA 3IGAB 3HCVA 5DQ9B 3EFDL 5DZLA 4N0UB 3VGAC 1AHWB 2YD6A 4JKWA 3NFSL 3BPNB 1X4YA 3A6OA 1G7IA 5C0RL 5GGTL 4N0YL 1N4XL 4LSPL 1J0IA 2A74A 2HMID 2CSPA 1BD2A 2D7TH 1MY5A 1IAIH 4G7VH 2W38A 5B4MC 4HXAL 5F7WC 4N68A 2Q76B 5KTEH 1IEAA 4Z7VF 1EO5A 5C7XL 1FPTH 2XZAL 2AJUL 2E9IA 1QTYT 1NAMB 1YJDL 4PS4L 4GLRI 4EI5B 2J5LC 3H7BA 4NPYA 1VKXB 4JQVC 4P4RB 3SY0B 1YPZA 5FUZL 5GSVA 4ZUWB 3HG1E 2VLJD 3V5DB 1PW3A 3AREC 1DCLA 2VAJA 2LAAA 2W60A 3QA3B 2YBRB 1A3RL 1LNUB 3FAXA 4LLUB 4FFVC 3ZE2F 1NMBL 5GGVH 5FF6B 4KK8D 3S36H 4KTYA 3HUJF 3O8XB 3X11B 5ICZB 1W72H 3QT2A 1RU9L 3BWUC 2F74B 3IJYB 5DD5H 1FG9C 4JY5H 3FT3A 4FOMA 1A7QL 4Y5XB 4R90L 2GUOB 1JNLL 2OTWB 4PJCA 4ZUUA 1YMHB 4PLJC 3RY4A 1FDLL 2I26N 3MV7B 1D6VL 4AH2A 3ETBF 5JO5B 1N6QH 5BV7H 4W4OC 1X5YA 3Q5OA 4IJ3B 2CK0H 4Z7OF 3TIEA 4HPYH 3MBEB 3K2MC 3VXQB 5BZDB 3T3MF 5GS0D 2V5TA 3GSRB 4OF8A 1SJEA 1FL3B 2N7AA 1CZ8H 1ETZA 3FZUC 2X4PA 1CGSL 5GSRA 3CFBA 4KRMB 1D9KC 4LCWA 3U0TB 4I4WA 3FN9A 4EI5D 4PYGA 3W82A 4QXTA 5I1JH 2DLGA 5IJKA 4LCYB 4ODXB 3VFPA 5ACZB 2VLJE 1FE8L 2DKSA 5EBLB 1NDMB 3U83A 5IB5A 3VI3F 5LGHH 3HZMA 2E27L 4LLYB 5DQJB 4C58B 2YD5A 1JK8A 3BGMA 2VITA 4YHZH 4RWYH 3HE7A 3HB3C 3WXVL 4I3GA 3O8XD 3QUMH 4BA8A 2DLFH 4NKIH 3LMJH 4E0RB 2BOBB 1EEYB 1RIHH 4UAOC 3H9SA 2Q86B 5CIPB 4HT1H