1NCAH

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDTATFFCARGEDNFGSLSDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH02
1PX3A 4KROD 4JDTH 4X5XA 4PD4J 2A73B 1LEIB 2DJSA 1JF1B 5EU4A 3BJ91 3KDMB 3LOWA 3CFJA 3MUY1 3P2TA 1S7QB 5I0DA 3G6JF 2EICA 4YO0B 4UOJA 4QTIH 5ALCL 1GCFA 1HHHA 1ZA3B 4OF8A 3L7FA 4ZPVA 4Q0XL 3SJVE 4WEMB 1JPST 1N8ZB 5EIIA 4F15C 1YY9D 3DVGA 3RAJH 2VL4A 4LNRA 3RPIB 3QHZL 2NY7L 4X4ME 3MUGB 4EDWH 3T1WA 1MHPL 2Y07L 3VXME 2E9JA 1A1OB 3MJ7B 1AIFB 2ADGB 1W0VA 3AAZA 1HQRA 1A9EA 4RQQA 2NX5D 3LPWA 5D7KE 1NCWL 3IJYB 3L5XL 1I1CA 5IKCA 1ZGLP 3GRWA 3NN8A 5IB5B 4R4FL 2I07B 1EVTC 2AXJA 5L9DL 4OCSL 5MEQB 2AJXL 3KPRD 3ZLQC 3NMEA 4J3XA 1ZLSL 3V6OA 1OSPL 1OSZA 1C1EL 1CXHA 5MI0C 5IF0B 1ED3A 3A6CH 4YHZL 2O61A 5C0BD 2JELH 3TIDB 4HG4K 3MRHA 4HBCH 4U05A 2EH8H 3SDCC 1IRAY 5CWSB 1T1WA 1DLFH 1ZS8B 3EOTH 3HE6D 4L3CB 2DLIA 1NCUA 4TUOA 2UY6A 2VMFA 2X1XR 5EU6D 3PHOA 3QG6A 5IVZA 3GRWL 3WIFB 2X1OA 1TZGH 4XNUH 3BX7C 3U9PH 2VDKH 1IEBA 3EYOB 3RWGA 4FZEL 1NGXA 4YDJB 3OB8A 3QDMB 5J0BA 3O6LH 4UT7L 1PYWA 2AK4E 4AH2A 5JO5B 3UC0H 5DK0A 3I6GA 5CCKL 4KHXH 1SJXA 2XKNB 2HJLA 1BBDL 2VDML 5TDNB 5JPMA 5ECJE 1JYXA 2CK2A 3MRLB 1MCCA 4GRWE 1E4KA 1J1PL 5KS9B 5KOVC 1GIGL 4M1DH 2GK0A 2FDBP 1C08A 2IF7A 4F58L 4IRZH 2MCPH 2CMRL 3CH1B 4DW2H 4HT1H 4UILH 2OTWB 3FQNB 4P4KB 3B8YA 5JXED 4J3TA 3ZKMC 4R4BB 5K59F 5D7IF 3VD7A 5ENWB 1F3JB 1U92B 4GG6F 4FFVC 3ESUF 1MFNA 1CGWA 4R3SA 2VIRB 1TIUA 1YMHA 3O6MH 1OWWA 4ZOBA 4M6OL 2FB4L 4Z7QF 4NP4H 3ZDZF 3ZKXC 1QLFA 2R2BA 3QNYA 3CMOL 3UYPA 4V1DA 1R24A 2RGSA 4OB5L 5TH2B 1CDBA 5EBLB 2YPVH 1A6WH 2P5ED 4M7LH 3TYFB 3RI5K 3O2WL 4PJCA 5FYJE 1MCNA 3ESVF 3ROLB 4F37F 4QXUL 1AY1L 3BXNA 3OTTA 1Y6MR 4H5SB 4AG4L 4Q7DA 2X2YA 4K8RD 3TP4A 1T04A 4EUPB 5IQ7L 4GG8B 5EFIA 3ARSA 1I1FB 3PUCA 4JPVL 4NC1E 3G08B 1U93A 4GRLD 2HN7A 3C9NA 4MMZC 3ULVL 1CD1B 4K9EC 2VH5H 3WNOA 4NNYB 5DUMH 2NY3B 2D03L 4OZIF 2QEJA 3TA3C 3CX2A 1I9IL 2AJVL 3OZ9H 4EVNB 4NM8L 3TH2T 4U1LB 5IB4B 3UTTD 1LD9B 2M1KA 4RMVA 1HYRC 2VAAA 3OL2A 2Z9TA 3HZYB 5J9PB 1EERB 2IPUK 4FQLL 5AD0A 4EN3D 4N0YH 1AC6A 4LSQH 4HX1B 2APFA 3DMMB 4ZOAA 1NDMB 5GGVH 3MXVL 3V6ZA 2P5WE 2GJJA 2EEDA 1VA9A 5F8RC 4B7LA 4F9PA 4L8CA 2WANA 5EUOF 1X5FA 4FG6D 5F3BB 4XNXL 1RZJH 4JN1L 1QSFD 5GISH 3OKLA 5CIPB 1MIEH 5GSVB 3RWDA 3ZHLA 2BOCA 2C3VB 2ZWLT 4HUMB 5FYLD 1N26A 2B5IC 3S3PA 2ADIB 4MA7H 5FGBA 5CJOH 4HIIB 1LHZA 1WF5A 5TPWH 5K9QG 1FAKT 3CFDB 2CLVB 3LZFH 4QTHA 3RY4A 4KKBC 1EO8L 4HZAA 4PRIE 5JNYB 1WBXA 5FHBL 1ONQA 1ULVA 4CN6A 3JXAA 1GOHA 2XY1A 3IF1A 1J05A 1LEGA 5AUMB 1X9QA 4LPUA 1JZ2A 2B0SH 3RVUD 1RD6A 4OZFG 3DHMA 1FN4B 5I8CB 1EAJA 1HSAA 2WBJD 1NJ9B 3NA9L 4Y4KA 5HI3D 5JOPD 5L0QB 4LCWB 4S0SD 1L7IH 2VRAA 7FABL 5KG9B 1D5XB 3IXTA 2Q3AA 3ARQA 5DF0A 4X98A 1E27A 1CFQA 1AHWB 5E2VL 3QXAB 1ZLVH 2Z4QB 4OFPA 4CDGC 1RZFL 1PD6A 2D9CA 1UKSA 3KPLA 3UO1L 5GHWL 3E3QC 4XP5L 5IWLA 1EX0A 2KPNA 3LN4B 4M6MH 3RWHA 4K7PL 2BC4A 2EYTA 1F4AA 4JHAH 2QQQA 4XCNA 4M5ZL 2BXYA 5KVGL 3H9SB 1J0IA 3HAEH 5EO0A 2OLDA 4WUUB 3CPLA 4K23H 3QXUA 5JR1L 4JM2A 2WLYA 5IB3A 4J3OC 5E99L 4JFDD 4N8VA 5EBGA 2EIZA 3CXHJ 2HFFA 3QRFM 4M7KL 4RZCB 4U3CA 5FFLA 4ISVB 2Y06L 3SDXE 1FZKB 4Z8FL 4PTTB 3FAXA 2B8OT 2IBGA 4JKPH 3UZEA 4XH2B 5TE4H 3K1DA 1JGUH 3RTQA 2W07A 3V6FB 3N50A 4Q97A 5D71H 1NC4B 1SEBB 4H26A 2W0PA 4QRPA 2MHAA 4U1MB 1M4KA 3DSNA 3QH3B 3M17A 4F3FA 3IAGC 2ZOLA 4Y19A 2VLJE 1MIMH 5C6TH 4NO0D 3FQXB 3TJEH 1TNMA 4JR9H 1P7KA 3SO3C 2NXZB 1MRDL 3K4ZA 4WW2B 2D7PA 4DZ8A 5M95B 1L6ZA 5KVEL 3MLWH 1KOAA 4EDXA 1S9KC 2V2TB 5C3TA 4P23A 4XXDB 4M6AA 4MQ7B 2QKIB 5DJ8A 1V5JA 2VKXA 1EFXA 3F65A 1EMTL 1SY6A 4MJ6B 5J3HD 1RFDH 4Y4HA 3T3PF 1J5OH 1JYVA 4JFEE 4XB8A 4Y2DA 1OP5K 1MFAL 4U0RB 4WV1C 3RDTC 2VERN 4H20H 3OKDA 5GGQL 2EDFA 4Z7VA 2ZPKH 4XAKE 3BP6B 2YPLD 2YKLL 5FK9A 4JFXB 4OLWL 3WDIA 1O0VA 5J57B 3AS1A 3HNSH 3GBLA 3BD5A 1G7IA 4APQA 4XVTL 3UPRA 3D18A 1R3JA 1IGIL 3QJFA 1KPRB 1SY6L 43CAA 4UIKL 4L9LA 4S1SL 3ARXA 2VDOH 4L4TE 1NBYB 1YEEL 4WTZG 4FMFA 3ZT5A 4Z7UE 4JLRA 4DQOL 1B9ZA 1YQ2A 5SX5K 3U0PA 3RIFF 4YK4B 3UTZB 1OVZA 2W9DL 4YDIL 3QJHB 4J1UB 5HYSB 5IMKA 1DDHB 1G7HA 4GQ9H 3OXSB 5DJ0B 3UZVB 4I2XB 1WBZA 2C3HA 2B4CH 1F42A 2ERJC 4JZOA 3QIUD 1GYAA 1UWXH 5HHVL 3RIAK 4ZFZB 1HKLL 3AXLA 1NCTA 3BWAB 5HHOB 1U8IB 5FCSH 2DTSA 4UTAH 4MJ5A 1UM4L 3KLHD 1DQMH 2WWMD 1SVCP 1E4WL 4PGBB 4Y4FB 2HG5A 3VXUB 5DD1L 3V0WL 3SJVA 1AGEA 5TE7L 5ICYB 1BWMA 4W4NA 3GI9H 4WHTA 2PUQT 1R3KB 4DN3L 3HMWH 4QOKB 4TVSa 3U7YL 1WZ1H 4X4MA 3QT2A 1MJ7L 1UKTA 4WTXA 2BVTA 5SX4I 1IAIM 1L7TH 5L7XH 2HYMA 1FGVH 5DMYA 1OP3H 1FRGL 3VXMA 1VPOH 1YPZA 12E8L 2CLZA 3D39E 3LD8C 1TJHL 4NKMB 3E6FA 5IW6A 3VCLB 2YBRB 2GTWA 1ZVHA 4X0KB 3GSWA 4I3RL 1PG7L 3SDAD 1UXSB 3MRNB 2GSGB 3GI8L 3VXTB 1FORH 3O4OB 4YHLH 2OQJB 1KPVA 5E2UL 5MHSD 4X7DC 5IGXL 2VABA 3ALWA 1PX4A 4ACPA 5IESH 4YZFF 1UVQB 3QRGH 4OCNC 3BUYB 1SJVA 2W9LA 4YAQB 5HJ3B 3R1GL 4ZSOB 1W0WB 1ES0B 3TT1H 1J1XL 4U7KA 1RZKL 2CGRL 3NZHH 4YHOH 2CXGA 3TZVC 5K93A 2HT4D 4X6FA 3L3IB 5GGTA 3U0WH 1PZ5B 1NL0H 5F9JA 1PBYA 1UB6A 1U3HC 5TFSH 1EGJH 3QUKB 5KAQG 1CFBA 1S7UB 2YHGA 1TVBA 3PWLB 3GBMH 3S36X 2IH1B 4GBXB 2IAND 4P5TD 2QTEA 3DPBA 4TYUA 2N1KA 4LU5H 3IVKA 1CQKA 2WIIB 1F6AB 3UTSA 3BGAA 4K3GA 4OD3L 4X8JA 1OCWL 4ELME 1AI1H 1AQDB 3MGTA 1LMKA 1A14H 1URLA 2BP3A 4PRHD 3EO1B 5DD0L 3VRIB 3BMVA 4Y5VA 3T0DA 3WE6B 1CD8A 5GGTL 2BZDA 4FA8A 4UMGA 5BV7H 2BOBB 3QHFL 2OXHA 3QI9D 1RURH 3ILPB 3C8KB 1N7ML 1HYSD 5DRWB 1U8HB 2DQJH 5ID1A 1M71A 3SDYH 1QR1B 4KU1A 5I8EB 1Q9OA 3NABH 4OZHE 3G6JE 1XR8A 2PYED 3PGFL 3SKOA 1EEUA 1OAKH 1U0QA 3U4BH 5DYOB 3V4UH 4PJ7F 3MLYL 2DQIH 4PV8B 3WLWD 2XRAH 1RJLB 5CBAB 1KIUA 1P6FA 3SO5A 1B6UA 1CXLA 4WNQB 3D3VB 3DO7B 4PGDA 1MI5B 4P49A 3QPQD 2E27L 3SGEI 3RWFA 4CVXB 4HPYL 3UMTA 3BYTA 4AK1A 4O58H 2XTJD 3HNTH 4GOSA 4X7SH 3C5SB 2F53B 1A7NH 4HK0A 4NO2B 3HZVA 2EKSA 1AD0A 4CADB 3RWEA 5INDB 1DQQB 1LO3L 1WEJL 4OFYD 1A7PL 4PJ5B 1T0NA 5HHNA 3ZKQD 4YC2C 1KXVC 1WBYA 4FQCL 1HQ4B 2AW2A 2DQTL 4N1EA 1CGTA 1AGFA 1F4WH 1OGTB 3B2VH 3C6LD 3OB0H 3HE7D 5JA9A 3I6KB 4YHYC 3RZCB 1IQDB 3TVMA 4PGCA 2QQKL 2HJKA 2Z0BA 4X4XB 3D0VB 3OR6A 4M62H 4G43A 4PLJD 2DBLH 4U1IB 3DYPA 5FYJL 2DM3A 1E6JL 4KRMB 1CE1H 4KKNA 5I19L 2D2OA 3PGDA 2OI9C 4NKIL 4DKEL 2XN9A 4H88L 3TO2B 3UTQB 5DURD 5I74B 2YD9A 1S8DB 1PKQE 4YIQB 4JQXC 1WGOA 4LEXH 3TBSB 4OLXH 1F6LL 5DSCB 2VC2H 3EKCA 2CDFB 4JJHA 1B2WH 1VESA 2LAAA 4NZTH 4AM0B 3FQRB 2EXYC 4TPRH 5F7EL 1DUZB 4PJXF 1A47A 2J2ZA 3BPNC 4WEBH 5I76B 3CSBA 1XF5A 1PZUB 1NGPH 5KW9H 3PL6B 5E1HB 4LVHC 1ND0B 1Q94B 1J8HD 4WO4D 3FT4B 1RMFH 1ZHKA 5T5FL 4F8QA 3ZE0F 3KR3H 2VLKE 2LE9A 2JJSC 4Z7NE 1EIBA 4HFWB 3EFDL 4IIQC 4FZ8H 4JO4L 5DFTA 3VWJD 1G7PA 4LSVH 4PRIA 4OIIH 4WI6A 1SMOA 2XFXA 3ECBB 5C0AB 1KGCE 4X4YB 2BNQD 1BFOA 3NCYS 1XF3A 4PJBF 2FIRT 4GG6E 4YR6B 1O5DT 2ZUXA 3L95B 3B9VA 4HGKC 5FYLH 4ZTPL 1RIUL 4X4ZA 1JWMA 4CKVX 1TPXB 3OKYA 3VH8B 1KB9K 3TO4C 2BNUA 2OZ4L 2A6JA 5SWSD 1D9KA 2I27N 3TBWA 4LBEA 4Y0GA 4NPYA 4HIEA 1CZ8L 3DO3A 3OKNA 2J5LB 5IFJB 5DWUL 3ZO0A 3BPOB 3DURB 4W68A 3SKNB 4I0PD 5BQ7A 4YH6A 3V4VL 4QRRE 1BECA 1EAPB 1Z2KA 1EFQA 4OF7A 3SKJL 3ZTJG 3V6OC 5J1TC 1D3CA 3HFML 3H7BB 5TQ0H 5F7HA 2EH7H 4PJEA 1NFDA 4PJHA 1S5IH 2C3GA 5JLZB 3RGVB 3MCLH 1BJ1J 1OGAE 3QUZB 4MNGB 4Z5RB 1HHGA 4OT1L 1BJMA 2X4TB 4L5FH 3MV7A 3MOQA 1LILA 3MGOB 3QXWA 4PJFA 1WT5C 1WC7B 3H8NA 5D9SB 1A7RL 2C1PB 1FZMA 3WFCL 1KC5H 5DUBB 5INCB 4PRPA 2FH8A 5JQHC 4EUPH 4TNVK 3OKMA 5DLMH 4DKFL 1AFVL 2EYSA 2Q86A 4M9PA 3ELAT 4NBYB 1PLGH 5JIPA 3OJMB 2PTTB 4OCYH 2F74A 1BF2A 1HHIA 3MNWB 1WWBX 5B38B 3BIKB 5EUOE 4GW1A 4YXHL 1U8MA 2OJZH 4UQ3B 4IDJL 4L8DA 5DJDB 4LLDA 5F9WC 2VLJA 4LARH 4ONHB 3VFVA 1FL5A 2JJWA 1WTGT 3CDGB 4NQED 5D93C 1CXFA 4LKXB 2QSQA 4E42A 1YA5A 3R0MA 2B2XH 3EGSA 2EKJA 5FO8A 4OQ1A 3ZDXF 1L0YA 1T89A 3Q5TA 3SDCD 4OKVA 3EHBD 3FB6A 1NFIA 3MRRB 4ODWA 4KZDH 4FTVA 3S35L 5CP3H 3JVGA 1N0LA 3MV8A 5I66B 1UH2A 3KXFE 3RFZC 4NZDA 3TCLB 4JANB 3O9WB 3IAQA 1VFOA 5D7JA 4HPOL 2R0LH 1MRFH 3ULVC 3C5ZB 1KFAH 4JFEA 1D5ZA 3MMEA 5MEND 2FGWH 4PJAB 3GMNA 2APWA 3SDDB 2XKSA 4FQIL 5D7LB 2ESVD 3JWOC 2FIKB 3WBDA 5ACZB 1QNZH 4JFYA 3RHWF 3T3ME 4D0BA 3DX7B 1UC6A 1RU9H 5C1MB 3CGTA 4FQXB 4HUKB 4RX4A 3QDJD 4G6KH 3EYVB 4XVJH 1C16A 4L4TA 1MCPL 3IFNL 8CGTA 4Z7UA 3MR9A 4QT5B 2ZCKH 2YC1A 3AU1A 5T1DL 3VFGH 3S5LG 4G9FE 4W4OC 3ZKMD 5IW3A 1J0KA 1W72H 3KPPB 3VW3L 1F11B 4E41D 4Y5YA 4DVBA 3VFNA 5E2WH 4FFVD 4LLQA 1R5VB 3KPNB 5L8JB 4YHPB 1CLZH 3T65B 5EU7E 1HILA 4WU5A 2XG5A 3GHEH 1PSKL 3NBNA 1T21B 2X4SB 2GJ6D 1A4KB 1QRKA 4JRXE 1S7XB 3BE1H 2DL2A 2Q8BH 5HHXH 2YWZA 4TVPD 2EYRB 3GMRB 4MXVF 2NY0C 2YN5A 2GEEA 1BVKB 3KJ6L 4ZUSA 4HKBA 4P2QE 2CO6B 4PG9A 4JRYD 2P8MA 3KYAA 4HS3B 1ETZA 1JPGA 1E4XI 1GAFL 4HC1H 1JGLH 5ICZB 2JB5H 3WN5C 4J23A 3FAWA 1H3WM 5FGBC 3GMQB 1ROWA 3QIBA 2D31A 4KMTL 4LRNH 3ARUA 5EDXA 5C9JA 4U33A 2QHRH 2VDPH 1KELL 3I9GL 3UEZA 1FIEA 4JDZA 5IMMB 2DJUA 3U2SA 3HUJB 5ISZD 2QBWA 3BDYH 4MA8H 1MWAA 2F8VA 2PO6B 5CS7A 3BHBB 1QLEL 1KCUH 1NAMA 2JK5B 3STZA 5E9DE 1QHPA 2APXA 1HIML 2XZZA 2XPGB 2E7MA 4LGPB 4ODXB 2R23A 3T3PE 1P9MA 5ESAA 1T2QH 3TLRA 1IGFH 5EOTB 2D0GA 1OF2B 5E00B 1NH6A 3QCTH 4X80L 1FNGA 3WJJC 4KGJA 2VQ1A 4QXGH 3SE4A 2X42A 4XNZB 2DM4A 1N0XL 1OPGL 1Q9LA 3W39B 4BQBA 3O45B 1ZXQA 2V2XA 4TSBH 3ZT7A 2V6HA 1NAKH 1DUYB 1MWAL 4YHKL 4ZS6D 4U6VL 3DVNA 4GAYB 5H35B 1NAML 5IUSA 1I85A 1QBBA 1R5IB 4J7RA 4PRAB 4MYWB 4RMWA 3FQUB 5F3HA 5C07D 4UINL 4YJZL 5E0QA 1ZE3C 4BFEA 2ZSWA 4KKBD 3Q0HA 4POUB 3EJYD 2BVOB 1A3QA 2XWJB 2AK1H 5KSAA 4JFZH 5E6YA 1QRND 4M4RA 1JCKA 2MNUA 4X7TA 2E9IA 2H6PB 5EORL 1H15A 3QDHA 5J1SC 4XCYB 5I30L 2FR4A 3RBGA 2X4RA 5BS0D 5E70A 3BP4B 5FUCE 1D5BB 4NHUB 3RWJA 1O7VA 4QHLA 3LQAH 3ZKND 5IEKB 4OZHA 5C3LD 2FBOJ 2PW1A 2IQAB 4PB0H 2A9NL 2AGJH 2C3XA 4MGXA 3KHQA 5C09D 3BDXA 2NZ9C 1E6OL 1N2RB 3B9KB 2EDEA 4WDIA 4XPTL 2VB5A 2VZTA 2FD6L 1ZT7B 3NH7L 2DLFH 4PJ8A 3CIQA 5F9OH 5LAXA 2IAMA 3RKPA 1Z9OA 4ZO6A 4FP8L 4QRSA 1KB5A 3P4OB 5D1ZB 3WYRA 3KPQA 2UZIL 3QEGL 1YECH 3ZYIA 1CQYA 1RPQA 2P49B 4I77L 4D9RE 4NKDA 1NEZG 35C8H 3D2UD 2VSDA 4Q6IC 2BY0A 1MREL 4WJ5B 3JV5A 4PJDA 1NQBA 5CD3B 1WICA 1G9NC 4H1LB 3MRGB 4P23C 3CC5A 4YGVB 1XIWB 4XPAL 3CXDH 4PJGB 1FO0A 3I75B 2IG2L 1MY5A 15C8H 4GUPA 4K3EL 1KPUB 1P4IH 5ESQB 2O5YL 3HG1E 5LXGH 5DJCA 2FYYA 4CMHC 4M8QA 3C60A 25C8L 5J12C 3RUGE 1KB5L 5F1SA 1QEWA 3NPZB 4OCXL 2W38A 4G8GB 3QQ3B 1U2CA 2CLRA 2QSTA 5ALBL 2NTFB 3CZFB 3N1MC 5DS8A 3GMPB 5ID0B 2WP3T 4O2EA 3O6FC 1A1NB 4GAJH 3T1FA 1FO0L 4P2OA 1XF4A 5HHPB 3N1PC 2XA8L 4DGVL 1YNTB 1KACB 4GLRI 1A1MA 1I1AA 5DHYA 1T80A 3ET9F 3RIAF 4JY4B 1X5JA 4RGMC 5L6YL 2FX7L 5D6DC 2CIIA 3IDYB 3DXAA 1T7WA 1P7QB 4NQDB 1DBML 3EZ8A 5AZ2H 3P73B 1MEXH 2ADJA 5C9KA 2CSPA 2OJEB 3SKUD 2DL9A 3C5JA 1JWUA 4NT6B 4WHCA 4PP2B 1IBGH 4IRSA 1XGQB 4NNPH 3VJ6B 2XG4A 2FO4A 3NCJL 4MSWA 4HQQH 4M4PA 4LFHG 2P5EB 3BKJH 2ZCHH 4RWYL 1U2HA 5TGBB 2WUCL 2YPKA 4BZYA 2X7LB 2MSPA 5C86A 1KIRB 4TSAH 2A77L 3EO0A 5A2KH 5IT2H 4TOYH 2D7TL 4G9DB 3HI1A 1CL7H 4JG0H 4K3JH 1P69B 5IW1A 5JIHA 4KRPB 3VDBA 3DBXB 1JK8A 4PTUB 1J10A 2C7UA 4M5YH 5DJXB 4OD2B 2R8SL 2EDQA 4NJAL 3O4LE 1UQSB 1BZQK 1ZHNB 3SE9L 3X11B 1YQVH 4G8IB 2C1OB 2FATL 5SWZB 2DQGL 5FCUH 5FM5M 4P3CL 5JW5B 4YWGH 2W59A 1FNHA 4QNPE 3TIEA 3LKPB 3CXHK 4F33B 1Q9WB 3QDME 3GFUA 1HINH 3OKOA 2WINB 4MDJB 1ERNA 4YPGA 5SWQA 1P4LA 3T77A 5F7DA 4OD1H 4IRJD 3O2VL 2OBGA 5MERB 5LWYL 1KUMA 4X9IA 1ADQA 3MREB 3RNKB 4OCRL 3WFHA 3ARDB 3GM8A 4PYGA 4YDLC 5I6XC 5KS9E 1RSFA 4P5KB 1C8PA 5HTSA 4L4VD 1BIHA 1PFCA 1T1ZA 2DQHH 1BD2A 2M26A 2FBJL 3O8XC 1I8IA 2H3NA 2PR4H 1U41A 1QYGH 4BFIB 5A2FA 4PFEA 4YPJA 1IEAA 3DUUB 3WCYA 4LCCC 3V0AC 3BQUA 4KJYB 2C3WA 1TVHA 2GJZA 2IBZY 3AY4C 1E0OB 2R0KL 4LQFH 3C09B 1ADQL 1JHKL 1KTDA 4P57B 5GZNC 3TFKC 2Q7NA 4M02A 4ONFH 3GSQB 4G80B 5AEAA 4MD4B 5DZNA 4N1HB 4Y5VC 4D3CH 4TQEL 3RX7A 5JOPE 3FO2A 3H9HA 5BRZD 4MAYA 3U83A 4JKLA 3VMPA 4ZS7H 5A2JH 4Z7WF 3LEYL 4NDMB 4U1GC 4CDHA 5T3XD 1BQHG 4MNHB 2GUOA 3GHBL 3JV6A 1QBLL 1C12A 2VWEC 3T0EA 2E8ZA 1QBAA 3HHRB 5KSUA 1T66C 4P4RA 2WBJB 1XCQB 3DV6A 3TZVD 1MCWM 1S7SB 1G7QB 5C6WH 5C0GA 3OXRB 2YXFA 2IWGA 2DQEH 3WKML 1U3HD 5KVFL 4E5XB 4U1KB 3MA9H 5B8CA 2DJ4A 4JZJB 4WIQA 4Z0XB 2F58H 4NCC2 5HHMD 1FNFA 4NQVA 4D9QE 1FHGA 1CR9L 4MA1C 3H2WA 1K4DB 3S4SA 2N7AA 3ARGD 2FJGA 5IR1A 2HVKB 2VOTA 3FB8B 1XEDA 1R5WA 3UBXG 2R15A 4LP4A 3ZTJH 3NPSC 1YEJL 5EU4B 5KSBB 3CFJB 5IBTL 4CNIB 4G42A 4W6YB 5AYUH 2LQRA 3VFSA 4DN4H 4HMCA 3QNXA 4XPHL 4LCYA 4ZAKA 5CP7A 3GIZH 3MUZ1 4G9FA 5I18H 3TVMC 3AREB 5EIIB 3FO1B 3MZTA 5IK3B 4FNLH 3DVGB 5C0RL 5AAMA 4LNRB 4D9LH 3QDGE 3FFCB 3PQYA 2C26A 4FQJH 3LHPH 4WEUD 3LKSA 5FDYA 3BSZH 5DMGC 2FWOB 3IT8D 1W0VB 2VLRE 4BQ8A 3AAZB 1F5WA 1GZPB 2LV4A 1HQRB 1DVFB 4NC2B 4NJ9L 3VXOA 4OZFB 3MBEA 3Q48A 5IKCB 4F7MB 3TBTB 3TBYA 1QVOB 1H8NA 1XZ0A 3IS0X 4P2QA 2UYLA 3IS1X 4JG1H 1ZTXH 1QSED 1VERA 2AEWA 4M6NL 1NC2A 4R96A 3QHTC 1LNUA 1ED3B 1EJOL 4QHNA 1ODAA 1GL4B 4NRZB 5F7WC 4LCWE 1GXEA 5GRUH 5BJTB 2DLTA 4OJFH 4NGHH 4PBVC 4ZTOL 4NSKA 2CJUL 1RK0B 1WVZA 2H32A 2Q3ZA 3KHOA 3WS3A 3FT2A 3LPGA 4OCLC 1DZBA 3ZDXE 1K8IB 4NZRH 1UENA 5E6IA 1NGWA 1NGXB 3U9UA 4C83B 1KJ2A 4WENB 3I6GB 1JIBA 3SEPA 1TTFA 3F6LA 5I1KH 4LF3B 3UJJH 5E9DA 4DVRL 4HKZA 2Z31D 1VSCA 4M1GH 2H9GB 3H9SE 5JPMB 4DGIH 2ICWB 1RVFH 2DN7A 3LKNB 4TUKH 4WUUE 3ROOB 4YQXL 1J8KA 4JREC 4MX7B 1KN2H 4XWOC 4PJIA 4K2UL 3BN9C 1A6PA 4HDIA 2A38A 1K4CA 2X4NA 1MHEA 2HFGH 5HYJD 2F5BH 3V0VA 4M7JH 4KPHL 4EKXA 5T1MB 4P3DB 1IFHH 2F54D 1UM5H 1A4JB 1ZLWH 2M2DA 5BW7C 2APBA 2DICA 1KJ2L 2VITB 4U1HA 2D0HA 3VFOA 4ODHH 4UV7L 3FQTB 1IE5A 5JOFA 2Q1EA 3QCVL 1Q0XL 1TJGL 4DCQB 1YMHB 1DE4B 2XXCB 2BERA 1BBJB 4X7FC 3BD3A 3VI3E 2HT2D 1MF2H 5I15L 2R2BB 1YEIH 1CICB 3ZYJA 5F44A 2AABL 3VFPB 3BI9X 3QEQD 1JZ8A 3IAPA 3K2UL 3MOAH 2GW5A 4FHBD 1TZIA 3K46A 3WO4C 1L4IA 1FBIL 2VXTH 2ITDB 1A7QL 4FQHA 2MQCA 3KPSD 1T04B 4O9HH 4ZQKA 1SJHB 3GSOA 4MXVE 4F7EA 5L8LB 3MLZL 5JQ6H 1YY8B 3AMLA 1D6VL 1TQBB 3C9NB 3O11A 3ZZ1A 5HGGS 5D1QB 1OY3B 4LPYA 1M7XA 3B5HA 3OF6A 5FOJA 1YEFH 2CKBA 5I2IA 4ZYKA 1ZSDA 5CD5D 3G6DH 4M7ZB 2W60A 4FFWD 2K9UA 2VAAB 3P9WB 1TCRA 2XWTA 4OM1H 2FECI 2OMBA 2VXVH 3EYQC 4C4KO 5DJ2A 3JVGC 4L29A 5AD0B 1MQ8A 2Y5EA 4BZ2H 1FL6B 2NY6C 3HNVH 5KTEH 2VDLL 4LGSB 3MV9D 4UT9L 2YSSB 5B39G 4P3WA 4P5TB 3HG1A 4R0LA 5DC0A 4A2MA 2Q6WB 1FVDA 4HV8B 3RUGA 3MJ9H 1KXTB 4NN6C 2CKBL 1OARL 3OKLB 4J3UA 1XR9B 2P42B 4I2XE 2P47B 4UNVA 1OAUH 2A73A 1LEIA 1IVLA 3O6KL 3PV6B 2JCCB 4Y5XC 3X3FL 2DLGA 3KDMA 2IMMA 5HHOE 1S7QA 2H41A 3C6SB 5IG7B 5CILH 4QTHB 4I9WD 3VXUE 2EE3A 4KDTC 1Q1JH 4JFPA 4X99B 2EE6A 1TQCB 2JLLA 5GGUB 4TNWK 3IF1B 3K7UA 1UACH 1LEGB 4XBPB 4QOKE 3RPIA 5JPNB 1RUKH 3G5XA 5I1GH 3MUGA 3ZTNL 3P3YA 2R56H 5HBBA 3TN0C 5DI8B 1A1OA 3MJ7A 2ADGA 1A3LL 4N90E 3IDMB 1MCOH 4QHUB 4Y4KB 3P9LB 4FFZH 4Q74A 4V1DD 3ULVD 3ARFA 2I07A 2MMXA 1I9JH 5C0IA 1YUHA 5BO1H 5MEQA 4ZFFA 3HI6L 4BH8B 3KPLB 2CIKB 4CVZA 5IF0A 2HH0L 4ZSOE 3TIDA 3U79A 3RWHB 2WWKO 3VD9A 2BC4B 4I3SH 1ZS8A 3QIBC 3M8OL 4N8CL 1OM3H 5ITBH 5J11C 1KTKE 1KJ3L 5EO0B 3WIFA 1JTOA 4JGMA 3EYOA 4XBGB 4KDVA 2DQFA 5EIQA 4N8VB 4YDJA 3UAJC 4RISH 2RHEA 5JO5A 4JVUA 5H2BB 2HFFB 4LLYB 4OIAA 2NR6D 5I1CH 3L5HA 3BGFB 2H1PL 3WFDL 1T7YA 3BT2H 3HPLA 5TDNA 1OAZH 1MVUB 3AFLA 3KYMB 2EIBA 5KS9A 4NUGL 2K7QA 2DQUH 2BHUA 2PXYA 4DK6A 1HHJB 2H8PA 1II4E 4KZEH 4F3FB 2ZOLB 4J3SA 3EYSH 4YXKH 4ZO7A 1EHXA 2ENYA 1YN6B 3RU8L 1EHLH 4DJMA 4R4BA 3CU7A 1S7WB 3QIWB 1J8HB 3BKCL 1XGRB 1F8TH 1IC7L 1U92A 5IBUB 1EHAA 1CXIA 4DZ8B 4Y8DC 2VIRA 5IFAL 4OGZA 4YBHA 3NIFE 2ZOKB 2EIEA 3BD4A 4MXWL 4NOBA 1RUAH 1QFHA 5C0CB 3VWJB 3T4AB 4JPIA 4ZUVB 3D3VE 4J4PA 1MI5E 2IFGA 1LE5A 2VAJA 3TYFA 4KKAC 4JO2H 5KVDH 3E8UL 2F53E 4AEFA 1AQKL 1BIIA 5T1LA 5ACLA 3BOVA 1ZWIB 5E24E 4YHMH 1J1OL 1Q72H 3QULB 3BH8B 4WHYH 4PJ5E 5FK9B 4H5SA 3W2DL 2P45B 4GG8A 3WEXA 3UDWA 3UPRB 1FJ1B 1I1FA 2DB8A 3D18B 1CE6B 1IC5H 2R1YA 3L3JB 2V2WB 1CD1A 3TJHC 1IAII 1AXSB 1GHFL 1YYLL 5T3XH 5CJQH 3U0PB 1P84K 5L8KB 4NNYA 1QA9A 1MH5B 2BFVL 3VG0L 4EVNA 1QOKA 4O2CA 4U1LA 1C5BL 4L8SC 4Z77B 4ZNCD 1G7HB 5IB4A 1V8HA 5AZEL 3FRPG 3H0TA 1LD9A 4HUVA 3GUTB 3FTGB 1HOCB 3HZYA 5J9PA 4OZGA 3V9FA 3S37X 4BK5A 3JV4A 4HJJL 1LEKA 3MOBL 4JFHD 3ULUL 3DMMA 1NDMA 3B83A 5AYQA 4NM4L 3QUMB 5IROA 3VRLF 5JXAL 1RK1B 2ATKB 1AO7B 3U4AA 2CH8A 5F3BA 1E4XL 4F2MB 1AGEB 1NKOA 1SEQH 4P46B 5CIPA 1WFUA 3X13B 2R2HA 5GSVA 3BGMA 1P6AB 4RDQF 4GS7B 6CGTA 3CK0H 3CD4A 2NZ9D 3RBSA 3RTQD 1N64H 2W65B 2ADIA 4BM7A 4ODVH 4HIIA 2VQUA 4QRPD 2CLZB 4U6TA 3CFDA 2CLVA 5A2IH 4IS6A 4Y19D 3P30H 3PGCB 4B41A 5JNYA 5IW6B 3IKCB 2AEPH 3CFCL 3DUSB 5C0AE 1N6QL 1IM9B 1K6QH 5D2LF 3GSWB 4XCFL 3I2CH 4P9ML 4YFLI 4S1QH 3H7LA 4XAWL 3UJIL 4PRNB 5AUMA 5MI0B 5IVXB 1KPVB 4EI6A 2BVPB 3TT3H 5I73C 4EJ1C 3STBA 1J12A 1I7UB 3WFEH 5FUOL 4XWGL 1FP5A 4X6EA 4P23D 3CDFA 2HAZA 1FN4A 5I8CA 3HPJA 3VGDA 1EFXD 4N68A 1I8LA 4IRSC 4LCWA 2X4OB 5K9KA 4AMKL 5KG9A 1RZIA 4Y4HD 1D5XA 3FQWB 4MJIB 4Y2DD 4KK6C 5DMKB 1AHWA 4J6RH 5AWNH 3QXAA 1MLCB 4BSJA 3FT3A 1JZ7A 3OAUH 5DR5H 2NNAB 2VN4A 5D1XC 5J7CC 1MCHA 1J11A 3QUXC 5EPMA 4NIKB 1RZJC 2BNRD 1QLRB 3IVKB 1BFVL 4APQD 4ZXBC 4Y16B 1IARB 3H9SA 4X8JB 1JZ3A 2J12B 4IOIA 3MGTB 4XX1E 1IL1B 4XMPL 4AY0A 5CGMA 4MNGE 3IDGB 4WUUA 4NWTL 1RZ7H 3MLRL 3IDXH 1J7VR 3MLXL 4NQXA 5DEZA 3VXNB 3WSQL 5JDSB 2GJ6E 4OBRA 3QNZB 5C2BL 2JTDA 4UQ2A 4RZCA 5ID1B 4ISVA 2V5TA 2OR9L 1FZKA 4PTTA 4CW1B 4MD0A 1D6EA 5ELIA 4XH2A 1X7QB 1Q9OB 4GRMB 5LGHL 3V8CA 4RMRA 1UM6L 5F97E 5FHAL 4ELKA 4G7YH 2ZG2A 2R1WB 1VACB 3SKOB 5C0FB 1SEBA 4HIXL 1H3UA 5ALCH 5GS1C 3J8F7 4U1MA 3QH3A 4Q0XH 1ZHBB 5B3NA 1I7RA 4HUNB 5EBWB 3RA7L 3SJVD 1B4RA 3I50L 4G6JL 3P0YL 4PGDB 5DA0B 5E2TL 3FQXA 5DQ9B 2DLHA 3RWFB 4UU9A 3N9GL 3QHZH 2NY7H 1BQSA 1MHPH 3TNMA 1G7JA 1FPTL 1TCMA 2Y07H 5LCVL 3ZHDA 4Q9QL 4HK0B 2XZAL 2EKSB 3VXMD 1GGUA 5BVPL 2V2TA 3RWEB 2RCSL 4OAWB 4IJ3B 4HLZH 4M93B 1NCWH 3L5XH 2EDXA 3NCEB 4R4FH 3U4EA 5D7KD 1WBYB 5ADPL 4UDUB 5HPMB 1AGFB 1DL7H 5L9DH 4OCSH 1EK3A 3TA3B 2DYPB 2BY1A 4XGZB 2AI0L 5ISZB 4FFYL 1ITCA 4RNRA 1ZLSH 5BCAA 4PJAE 1OSPH 1ZA6B 3D85B 1C1EH 4G5ZL 5D7LE 4YHZH 4S11A 1BOGB 4JFXA 1IC4L 3DROA 3S5LB 2FHFA 3I3EA 1IZKA 1NBZB 1T1XA 5GJTL 1P53A 3BIAX 2ICEB 1MNUL 2XN9B 3HZKB 4HAGA 1KPRA 5E56A 4K7FB 4M43L 3GRWH 3LKRA 3O8XD 1A7OH 5LBSL 1C5CL 1G6RA 3MRCB 2VLME 1KJVB 4FZEH 2YUXA 3UTZA 4UT7H 3I84A 1QRNE 3UCRA 4J1UA 5C0EB 5HYSA 5CCKH 1H5BC 5GPRA 4GKSB 2AK4D 1KCLA 4PY8I 5FYKL 5FGRA 4EI5A 3A67L 3ULVF 1AKJA 2XIDA 3OXSA 5DJ0A 1T03H 2X9WA 2VDQL 5DK2A 1AD9B 3VGAC 3HMXA 5GZND 3TFKD 4PJCF 3OJDA 1J1PH 3SKMA 1GIGH 1ZHKB 2GFBB 3MODL 5E5MB 1O7SA 3BWAA 5HHOA 3RVXC 4F58H 1I8KB 1U8IA 1J0YA 2CMRH 1FYHB 4XNQB 1G6RL 2CXKA 5I1IL 5ICYA 3MO1B 5DVLA 4NRYA 5BXFB 3QUYC 1R3KA 2RBLA 1T66D 5IBLC 4MZ3A 4QF1A 4W70A 3HMXL 4M6OH 2FB4H 4E0RB 1FFPA 3GMMA 5DRXA 1RI8A 3BO8A 1Z5LA 4NKMA 3CMOH 5EU7C 2XZQH 2VL5B 4OB5H 3VCLA 2YBRA 4X0KA 4XC3L 1D9KB 1UXSA 2GSGA 3TBWB 4LBEB 4WWKA 3VXTA 2OQJA 1KTRL 4NPYB 4HIHA 1MELA 3H9YA 4MB3A 3HUJE 5FYJD 4NYLB 4QXUH 4R9HA 1AY1H 1Z0NA 3U82B 1UVQA 3OAYK 1VGKA 4AG4H 3BUYA 2V5MA 1IKFL 1W2KT 3ARWA 4YAQA 5HJ3A 4JFFB 5IQ7H 4ZSOA 1W0WA 1ES0A 2BJMH 3SCMC 4DTGL 3HA0A 4KVNL 5DHVH 1YC7A 4OV5B 1JRHI 4HG4J 1EXUB 3VFMA 4PJEB 3QBTB 4JPVH 3UTPE 1NFDB 4PJHB 3L3IA 1WAAA 1PZ5A 2B4CC 2VZSA 4JFOA 3D0LB 3ULVH 1JGDB 4N9OB 2LU3A 3QUKA 4M3JA 3MV7B 3TVMD 1S7UA 5HYEA 3PWLA 4FXGB 1I9IH 2AJVH 4UNUA 2HLAA 4GBXA 4NM8H 2VISB 1FZMB 3QWRD 4PRPB 3WUZA 3VXSB 4LVNB 2IH3B 2WIIA 1I7ZB 3SGJC 4FQLH 1M6OA 5C8JB 3WNNA 1AQDA 3VRIA 2EYSB 3EO1A 4N5EC 1NCDL 4WUKL 4XXCC 1GZQA 4PG2C 3MXVH 4X9BA 4K07A 3WE6A 1P2CB 1NMBL 3CH8A 3Q3GA 2P5WD 2BOBA 4RGNB 1FCCA 1LO5B 3ZSSA 4XNXH 3GJFA 3C8KA 5FYJU 3CU1A 4LLDB 5GS0L 4JN1H 4HZLB 2BX5A 5DRWA 2BDNL 3VFVB 1FL5B 3AROA 1QR1A 4WU7B 5I8EA 5TE6L 4JKMA 3EGSB 1CGSL 4F7CB 5FO8B 4R2GC 3HC3L 2HKHL 3CMGA 1D5MA 5A3ID 4OFVA 1EO8H 4FOMA 4JCLA 1DBBL 2L7JA 5J8OA 4PV8A 5BZDB 1ORQB 1NEZB 1RJLA 5CBAA 2R69L 3MV8B 4PRID 5FHBH 1BGXL 4WV1B 4RGOL 3D3VA 3RDTB 2ICWI 1MI5A 2YXMA 2WAHA 2OSLB 4N9GB 5H8DA 1D5ZB 4JM2F 4NO2A 5FUCC 4DAGL 3MRBA 4CADA 1DQQA 1UWEL 5DD5L 2DQDH 1KULA 5E8OB 3LKOB 4PJ5A 3NA9H 4Q2ZA 4MB4A 1VDGA 4PJGE 7FABH 1FG9C 1S7TA 5T1KB 3VFWA 1I9RL 3PHQA 4WFGE 3ZYOA 4XWOD 4W6XB 3HE6C 5E2VH 1OGTA 1E4JA 1DTUA 1YEKL 2AJZB 1C16B 3LSOB 3FOMA 3I6KA 1FL3B 2UVEA 1RZFH 2DRUA 2VDKL 5DVOA 4URTB 1YN7B 3UO1H 1IQDA 2CKNA 5GHWH 5FGSA 4XP5H 5D2NA 3PDOB 4G8GE 1T0PB 4K7PH 3C8HA 5EB9A 1KLUB 5IHBA 4F7TB 3REWB 5FGCB 4M5ZH 4LLQB 5KVGH 3TO2A 4ETQB 1ZEAL 1S8DA 1INDL 2K7PA 4YIQA 4O00A 2VJXA 3LAFA 5JR1H 4LK4A 1IMHC 1HILB 3TBSA 4WU5B 4G7VL 5E99H 9CGTA 3E2HC 5DSCA 4IRZL 2IPTL 1AC0A 4LHUG 2ZCLH 3B9AA 1MCKA 3K1KC 4AM0A 3FQRA 5CJ5A 4M7KH 4R0LC 1BAFL 3GBNL 2Y06H 3ABZA 1XF2B 4Z8FH 3I02B 5KSVB 4NQDE 2B1HL 4MDIB 4YLQT 4ZUSB 2LVCA 4HKBB 1AJ7L 1UGNA 5KANG 1ND0A 5JXEC 2P8MB 2HT3C 3X14A 1X4ZA 3LD8B 3FT4A 3V52H 4U1SA 3CX5J 4Z7VF 4QRQB 5IJKC 1U91B 4TNWF 1OW0A 4HFWA 3LV3A 4LIQL 4YDVB 3QXVA 2VLJD 1P7HL 5C9JB 5C0AA 1A6WL 2AJSL 2XTLA 4M7LL 4X4YA 1GOFA 5CEYB 1T2XA 5BZWB 4YR6A 1JNHB 3BMWA 3WHE0 2BRRL 3L95A 2DWDA 3QEHB 3GGWB 3VDCA 3ZL4L 3OKEB 3F62A 1LK3L 3V5HB 1CK0L 1XGPA 1IGML 3VH8A 2O26U 3EYQD 4FTVD 1R3LB 2ZUYA 2EECA 5D7JD 1J0ZA 2SEBB 1MFAH 3CVHA 5HHMB 4JFED 2VUOA 5IFJA 1N5YL 1FNGB 2WSKA 1RJZB 4GKZB 1FZOB 5GGQH 3DURA 4NNXB 5DUML 5FO7B 3SKNA 1BLNB 4CAGA 1QKZH 3BFOA 3U6RA 2YKLH 1IC1A 4OLWH 1YEGL 4XAKD 3BP5A 5GGVY 1G9NH 1OT2A 2O5XL 4D8PA 1V7NL 4XVTH 3MRJB 3H7BA 4ORZC 4QXTA 1IGIH 3DVNB 5E6ZA 3LB6D 1MAML 1SY6H 4UIKH 4S1SH 5JLZA 5F3HB 3RGVA 4U31A 4KQ3L 1IAOB 4MAUL 1YEEH 4LSQL 2E6PA 4DQOH 5E7BA 3QUZA 4MNGA 4L4TD 2OP4L 4Z5RA 2ZSWB 4WFFE 4TTGA 5HPOA 3DARA 4HWEL 2X4TA 1YPZF 3CVHL 1QR4A 2W9DH 4YDIH 1WC7A 4EIGB 5D9SA 2C1PA 3LQZA 3NGBC 5F1IB 1H15B 2FR4B 1NMCB 2X4RB 4FG6C 2VUYA 3RWJB 3ES6A 4QHLB 1QBML 2NY5L 3Q5OA 1DBAL 5HHVH 1QSEE 1U9KA 1HH6B 1BQHB 1HKLH 3EO9L 2A74A 4HLJA 4U4BA 1UM4H 5B38A 5JZ7D 3ARTA 2NXYD 3LEVL 2CPCA 3BZEA 5DD1H 4JHBA 4UQ3A 1X4YA 5K9OA 5DJDA 1MVFA 3HN3A 4WDIB 4GKNB 4ONHA 1MPAL 3CDGA 2FEEI 4J3WA 3R8QA 5MEOB 3U7YH 4P4KC 5LAXB 2IAMB 5HYQB 4QYOA 1MJ7H 2UZXB 1ITBB 1IKNC 4WI9A 1TTUA 1FRGH 2FECL 4C4KT 3RY6A 12E8H 2R9HC 4DFIA 5JOEA 4NKDB 5IB1A 1TJHH 4PJDB 4PP1D 3MRRA 3D39D 1BJ1H 3QIBD 5D2LE 3F7QA 5I66A 43C9B 2HFTA 1PG7H 1FO0B 3GI8H 4GUPB 5E2UH 3C5ZA 3GB7B 5IGXH 4GRWF 3UAJD 4AT6B 1FFNB 1OTUC 2FYYB 4PJAA 2XICA 4M8QB 3C60B 5H37G 3SDDA 1P5VA 3R1GH 5D7LA 4DUVA 2FIKA 1QEWB 5D6CA 3UYOD 2E3VA 1J1XH 1JMZA 1RZKH 3BW9B 2CGRH 1AP2B 5ACZA 4JHAL 5DS8B 1DR9A 3DX7A 4HULB 3INUL 4KV5E 4Q6YA 1PQZA 4FQXA 1IILE 4IOSD 3R4DA 2MPAH 3BPNB 5D5MA 4AQ1B 2R4RL 2M8XA 5F1NB 5FDWB 3VFRA 1A1MB 4YBLB 4LVHB 3TC9A 1F4HA 3DSFL 2NY3C 1X4XA 4OFKA 4KK8C 3KPPA 1F11A 2AXGB 3DXAB 3FFCE 1GC1L 1R5VA 2YUWA 4OD3H 1OCWH 5DZLA 5DD0H 2MQ3A 4YHPA 4IIQB 2R0ZL 4BQCA 4HWBA 2A6IB 3T65A 5GGTH 3C5JB 1H8OA 3FHQA 1NBVL 1JWUB 1Z0MA 1QPPA 3QHFH 5IQ9B 5KSAD 3DMMC 2P48B 1T21A 2X4SA 5IEHB 3LCYA 1N7MH 1MCJA 2KZWA 3MRKB 3PWPB 4KKAD 2EYRA 1YMMB 2YPKB 3GMRA 1U3ZA 3AUVA 1SYVA 1BVKA 1T3FB 4XC1L 2WWKT 3D69A 2G2RA 2ID5A 1LDSA 1BM3L 1A5FL 3T04D 4HS3A 3PGFH 3IGAA 5ICZA 3S7GA 5FM8A 3TO4B 4KC3B 2C7UB 4LHQB 2AEIT 4I5BB 3MLYH 4HWBL 1K8DB 4GRWH 3JUZA 4HW6A 3GMQA 5EIVA 3SOBL 4IOFD 3IJSA 2E27H 1UH3A 3W11C 4ZFGL 1CTNA 4HPYH 3TJHD 2DM2A 3KJ4C 4PJ8D 5J3HC 2ZG3A 4UTBL 5IHUL 1J9CT 4H20L 2APVA 1UT9A 3HUJA 5F89A 1TFHA 5DTFA 1LO3H 1WEJH 1A7PH 5EO1A 3BHBA 2AV7B 2JK5A 1A6ZA 1EVUA 3RPKA 1U42A 4FQCH 2DQTH 2EDHA 4ODXA 3WFHB 5EOTA 5L0QC 1JWSB 5E00A 3HLAB 5TDOB 1QP1A 1TXKA 5IMOB 4HD9A 1VB9A 1T1ZB 2QQKH 1T22B 1BD2B 2VXQL 4BUHA 3W39A 5FYJH 1E6JH 1EO5A 4C57C 4NO5B 5CEZL 5I19H 2GAZB 4F7PB 1DUYA 4NKIH 3SPVB 4LDLB 3FHAA 4DKEH 4YXLL 5IOPA 1MFEL 4H88H 4GXUN 4GAYA 5H35A 3MLUL 1IM3A 1OP9A 4PRAA 5JHDB 1AH1A 3FQUA 1S78D 4RFOL 4JGUA 5FB8B 4HCRA 4P2CG 2J8UA 2VDNL 5F7EH 3FO2B 3H9HB 5D93B 4ODSL 4MAYB 4LMQI 2EDWA 2H6PA 2WWMC 3UTOA 4XCYA 3G6AB 4P99A 4RSVA 4F80A 5EU5B 3BP4A 3BPLB 4MZ2A 4NHUA 3SGKA 5J6GA 3JV6B 1C12B 2BSSB 5LGKA 5IEKA 5L7XL 2EC9U 3ARRA 3O3DA 2IQAA 5KSUB 1X5AA 5I71B 3EFDH 4IRSD 4JY5L 3DV6B 2VLKD 1EBPA 4J2XA 1IAIL 1RUPL 4XP6L 1X5HA 3KPMB 3L1OL 3D5OF 4HCRL 1N2RA 3P11L 5C0GB 3B9KA 4PJEF 1RHFA 3CSPA 1T7XA 1NFDF 4PJHF 5B8CB 1KGCD 5IHZA 1FVEA 5D1XD 3T0BA 2QSVA 3QUXD 2ZJSL 2X4QB 4NQVB 2Q7YB 1NEUA 1RIUH 3NACL 4PJFF 3QRGL 3VXQA 2NXZC 2RR3A 1WITA 4WW2C 5B39B 4LAQL 3HAEG 4WJ5A 2FJGB 3G04B 3HB3D 5IR1B 3BZDA 4H1LA 3TEUA 1X5KA 3BAEL 3WJLA 4CGTA 2OZ4H 4O5LL 3VFUA 4PJGA 4JDVB 3TWCL 1WWAX 3I75A 4OZ4A 5EU6A 2AJUL 1CZ8H 2P46B 5T3ZE 5DWUH 4JEGB 2HT4C 4N1CA 5ESQA 4LOUC 5E4EC 3V4VH 4U0RC 2UVFA 3SKJH 3R8BB 4ZAKB 4QRRD 2QR0A 5F88B 4LDOB 3HFMH 2EDLA 3QQ3A 2JE8A 4PUBL 2NTFA 4WCYL 3GMPA 3I6LE 5GJSL 3PQYB 2JCCE 3LQAC 3NCCB 2IJ0C 4MCYB 3LKSB 4OT1H 2FHCA 4YFEA 1OGAD 5HHPA 5BV7L 1FNEA 1MRCL 1UG9A 3PIQB 4WI8A 1A7RH 2NY0B 2OX5A 5I0ZA 2BHZA 3WFCH 4MNQB 1HSBA 4UB0L 4YK4C 1HXMB 4CMMB 4OBSA 3SDYL 3GK8L 2G9HB 3HC0B 3BQUD 4TTDC 1P7QA 2CR6A 4NQDA 1R3IL 4NO3A 1X5IA 3WN5B 3P73A 4DKFH 1AFVH 2NY4B 4C59B 4RFNC 2OJEA 4KWUA 1XCTA 1HN1A 1OAKL 4R96B 3U4BL 4NT6A 1S9VB 4X6CB 3X12A 2DQIL 4YXHH 4Y88A 3MROA 3VJ6A 4IDJH 4GXUM 1K2DA 1QSVA 2FLRT 3N85H 2P5EA 1UEYA 3T8XB 5TGBA 4Y4FC 2YRPA 2X7LA 4O58L 3D25B 3HNTL 1KIRA 4RRPG 4ZUTA 4CRPA 1KXQE 2H32B 3QPQC 3FT2B 3T0ED 1A7NL 4Z7UF 1FFOA 3AM8A 5E6IB 1A2YB 4PTUA 5DJXA 1I1YB 3UP1A 3MBXL 3S35H 5HGAB 4NFBA 2LFGA 4NWUL 1U6AH 1ACYH 1DANT 1UQSA 1ZHNA 2P7TA 5F72S 3RL1A 1KB9J 2GK2A 4GRLA 3KXFD 3X11A 4HPOH 5CINL 4B7IA 1V3KA 2I60L 4UT6H 2C1OA 1HZHL 5SWZA 2ZG1A 1MFDL 1JZ6A 4PJIB 5JW5A 3IDIB 2E6QA 1G84A 3LKPA 4F33A 1Q9WA 1INEL 1K3ZA 2QQNL 1UJ3C 4FQIH 4JJ5B 3V0VB 3S98A 2WINA 2DMBA 4MDJA 3WUWG 4HH9A 5HVFB 2ILLA 4K8RL 3QFJB 5MERA 3MREA 4U1HB 4YFDB 3QZWG 4JQVA 1CD9B 3QO1B 1EUUA 3RVXD 1MCPH 3DIFA 4P5KA 1ZHLB 2AJYL 3IFNH 2BY2A 1CFVL 5T1DH 4AEEA 3L3OA 1QSZA 2F8OA 4S0TD 5C08B 4BFIA 3IFOB 1CBVL 4LLUA 4G9FD 3VW3H 4M61A 5KW9L 4KJYA 5I8KL 5LQBH 5IBLD 1KN4L 1RMFL 3X17A 3LY6A 3VXRB 4P57A 3GSNB 1EO7A 3WNKA 1PSKH 3GSQA 4G80A 5C0CE 5CZXC 2OXGA 1S7RB 2JB6A 1L6XA 3GSOB 2G60L 3DV4A 1FSKC 4JRXD 5EU3A 3QXTA 5GS2D 5I1LB 3KJ6H 4NDMA 4KMLB 4MNHA 4Q6IB 2JJTA 4P2QD 4S2SB 1GAFH 4ZMAT 1M05B 1WIPA 5FYLL 3WS6C 4I18C 2PNDA 1UA6L 3SCMD 1NC2D 4WI4A 1EV2E 1MAKA 2HRLA 2WBJA 1XCQA 4KMTH 4K94L 1S7SA 1G7QA 1CTOA 3OXRA 3VG9C 4E5XA 1KELH 5J12B 3I9GH 1GOGA 2DI9A 2FX8H 4G6FB 4F57L 2DIBA 1WCBB 3V95A 3SY0A 4UV4L 4NC0B 2OTUB 1QLEH 1FVDB 1JVKA 3O6FB 4WGVB 1N6VA 4Y8AA 2Y7QA 1EDQA 1ZANL 1LO2L 3S37L 1HIMH 2HVKA 4PLOB 5E9DD 3FB8A 3BPCA 4N5ED 2J4WL 2ARWA 1KYOJ 4OZHF 4X80H 5KSBA 3BYYA 4C54A 2X4UA 4CNIA 4MHHG 1U8PA 4JFDA 4RGMB 3SQOL 1N0XH 5L2KB 1AO7E 5F7YC 1OPGH 3RZCC 4JFPB 1DBJL 4P5MA 1MWAH 3AREA 4YHKH 4M7LT 3FO1A 1F2QA 3MRQA 4U6VH 5IK3A 2EDKA 2IQ9L 1NAMH 4R2GD 3FFCA 4AEIL 3G5XB 1T4KA 2DOCA 1F58L 5I74C 1YPZE 4X6DB 4OCYL 4PY7B 2FWOA 2OL3H 3MJ6A 1HEZB 1GZPA 1DVFA 1T7VA 4PJDF 1AR1C 1TZHB 4OZFA 2EDYA 5EORH 2Z8WC 5FO9A 5ANMB 4F7MA 1L0QA 5I30H 3ARFB 2F8XC 5IVXE 3TBTA 1J86A 3DETD 5C0IB 1YUHB 1QVOA 3O2DA 4ZFFB 3KYNB 1UZ8A 4BELD 1JRHL 3PL6C 5L88L 1XF1A 4LVEA 2A9NH 2Y4SA 4O02L 4MQSB 4CVZB 3IXAB 4HWZA 4CL7A 1E6OH 4NRZA 4K55A 5KJRL 1BP3B 5BJTA 3EHBC 4U7MA 1B0WA 3FONB 3P77B 4P48A 2FD6H 3KS0J 4MJIE 2R0LL 3NH7H 1RK0A 5I1HL 3PE9A 4WW1A 4JN2B 4FP8H 2UZIH 3QEGH 5A43C 3KYKL 1K8IA 2DQFB 3OF6D 4I77H 3H42L 3L3HB 1WISA 2YPLA 4KUZL 3O2DL 1MREH 4C83A 5JORB 1J87A 3QSKB 4D9RD 4H8WL 5A2LH 5I16B 1BPVA 4LF3A 3IKKA 4XPAH 3UTSE 2W91A 5ACMA 2H9GA 2IG2H 3HPLB 2ICWA 4KJWD 4K3EH 5H37H 3DGGB 3LKNA 4IEFB 5HYFA 4KTDH 1JNLL 5F70A 1KCVH 3ROOA 4I48A 5E8EB 4MX7A 2O5YH 4XCEA 2PXYB 4LCCB 2H8PB 25C8H 3JTSA 4KK9D 3HG1D 1Y0LA 2J5LC 4JE4B 1Y18B 1KB5H 1TTGA 4Z7NF 5CJ8A 2EDNA 5T1MA 4XBEH 3AB0B 4P3DA 5ALBH 1DQLL 3F8UB 4JHZA 1A4JA 3CDCA 5IVNA 2HT3D 3NCMA 2VITA 3FQTA 2Y5TA 4R97C 4NQCB 2W92A 1FO0H 4DCQA 1DE4A 1BBJA 2XA8H 4ENEC 2DMCA 4XZUA 4DGVH 5BOZG 5L2JB 1FYTB 4JPIB 1CICA 1RUML 5DO2C 4LPVA 3VFPA 5L6YH 2FX7H 3MTRA 1LE5B 5F7MC 5IM7B 2IBZX 1BIIB 5T1LB 4MD5B 1OT1A 2ITDA 3F58H 5F96L 4HWNA 1YYMH 1OTTC 3NCJH 2BSED 3WEXB 1SJHA 2C4FT 1KENL 2EDTA 3U46B 4RWYH 3SDAA 2WUCH 4NBXB 4OF6A 1YY8A 2A77H 2R1YB 2D7TH 3W9DB 3VWKC 1HH9B 1JHTA 5D1QA 4FMKA 3PDGA 4LCIL 5FKAA 3S34L 4WTZA 1QA9B 4LASL 2JIXB 1F13A 5D70L 2AV1B 4KY1L 4O2CB 2R8SH 4NJAH 3MCKA 2XN9E 3H0TB 3NPSB 4X7EC 5ITFA 3W5NA 3SE9H 5C2UB 4HUVB 4DEPB 3O4LD 5AAWA 5FM5O 4OZGB 4RMQA 3CLFL 3MACL 2DQGH 3JV4B 1FL6A 1MCLA 5JUEL 4P3CH 1LEKB 1MHCA 1KNOA 3PWJB 1FG2A 3RWIA 3O9WC 1MY7A 4X5WB 1EEQA 4HGWB 4LLWB 3T2PA 2YSSA 5DGRA 2IANA 4EUPG 4P5TA 3QDMD 2Q6WA 2ED9A 1NAKL 4HV8A 1DEEB 3O2VH 4JM4L 5LWYH 2R0WL 3SDDC 2A6DB 2H2SC 1PVHA 1XR9A 5DHXB 3EOAB 1F4YL 2R2HB 3ZDYF 4BFGA 4BSWA 5DD6B 3BGMB 4OCRH 4ZS6C 4LSRL 4PRHA 3CX5K 3T4YB 5HGHB 3PV6A 2JCCA 3LKQB 3ISWA 3LRSB 4WI3A 4Z0BL 3C6SA 5IG7A 2FBJH 3QI9A 3WXWL 1NGZB 1VFBB 3JSSA 5T3ZL 4IS6B 4PY8J 2WP3O 3EJYC 4X99A 4C56B 2YK1L 4P4KD 4L1DA 3VXPA 4XPFL 5GGUA 4HEME 4NN5C 4XBPA 1XFPA 2YA2A 2R0KH 4EI6B 3UBXI 5JPNA 2V5SA 2R9HD 1ADQH 1JHKH 4PLKD 5E94A 2PYEA 5DI8A 2J6EH 3DOSA 4X6EB 3ZKNC 3GSUB 3IDMA 4TQEH 1A6AB 3GEWB 1QO3B 3HPJB 4QHUA 5EC1B 4ZD3L 2NW2B 3P9LA 4J4PD 5K9KB 2WW8A 1RZIB 3LEYH 4AZ8A 3T3MF 3E3QE 3GHBH 1OTUD 1QBLH 1TETL 2J7LA 1FFRA 3FT3B 1YECL 4BH8A 3N1FC 5DFWH 2CIKA 4OFYA 4JFFE 3UYRL 1CU4L 5EPMB 4LAJH 4PJ9B 4PJEE 4WI2A 3CXDL 5KVFH 3CFBA 3WKMH 1NFDE 4PJHE 3GSVB 3C6LA 3B5TA 5C0JB 4IOIB 4LSSL 1CXEA 3MV7E 3KLSA 4PJFE 4XBGA 1CR9H 2NY3D 1UJTA 2EE9A 2QQLH 4NQXB 4KK8D 4D9QD 2FX9H 2P8PB 1UXWA 2DTML 5H2BA 4PRPE 4UQ2B 4LLYA 3VXSE 2PO6C 4NUJB 2JJUA 1I4FB 2AXHA 3QQNA 4MD0B 2WBKA 1D6EB 4GMTL 4F9LA 4W6WB 4LPTA 1YEJH 4XNMA 4JPWL 1MVUA 3KYMA 4R26L 5DQJB 5IBTH 4ELKB 3DMMD 4OLVL 4GH7B 3THML 2FEEL 4RGNE 4NQSA 1HHJA 4XPHH 2D9QB 1SM3L 1I7RB 1CIDA 5C0NC 5C0RH 1YN6A 3SDXB 2J3SA 4UU9B 1NKRA 2PKDA 1S7WA 3QIWA 1HXYB 1J8HA 4WO4A 3VU2A 1XGRA 1MEXL 3QDGD 4U3XA 1IQWL 2E7BA 4GFTB 1G7JB 3TNMB 5DRZB 3M1BB 4XB7A 3RY5A 2ZOKA 4NJ9H 3TPUA 2VLRD 4KAQL 2DAVA 5C0CA 2XNAB 4FTVE 3VWJA 3SBWC 3W11D 3T4AA 3MV8E 4HQQL 4ZUVA 4MCZB 3U4EB 2IALB 3OR7B 5FAAA 5ADOL 3J7HA 4TOYL 1BX2B 1NUFA 4RNRB 5KZCB 5GQBA 3U30B 2IPUG 1PY4A 3B3IB 4M6NH 1ZWIA 4BH7B 3OGCB 4OCMC 3QULA 3BH8A 1EJOH 1WIOA 3O41B 1RZ8B 3BEVB 3DROB 4JO3L 4HH8A 4RA0C 3VGEA 1T1XB 2ICWJ 2NY6B 4OGAC 5JW4Q 4LCWD 5SWSA 7CGTA 1FJ1A 5GGRB 4ZTOH 5J1AA 2CJUH 1CE6A 3IFLL 3GJFK 4LRIC 3L3JA 3LKRB 5GS2H 1NLDL 2V2WA 4I0PA 1G6RB 1JJUA 1AXSA 4KJPC 2EO9A 3PWUB 4NN6B 4NQTA 1MH5A 2D3VA 3ZMRA 5D1ZC 3BVNB 2AXFB 3V7AG 3V79C 1X3DA 4LHUB 4WI7A 4Z77A 1KTLA 4EI5B 6FABH 5FGCE 4IMLB 1CF8L 4Y5XB 5EOCL 4DVRH 5IMLA 1AKJB 3DWTA 1LDPL 3GUTA 2R1XB 4AENA 3FTGA 3BJLA 1HOCA 4IRJC 2DKMA 5DK2B 3O3EB 3H9SD 4GW4B 3OJDB 4YQXH 1XIWC 3SKMB 4K2UH 4WUUD 2OYPA 1H3TA 3PP4L 3QUMA 1RK1A 2ATKA 1AO7A 2L4OA 4KPHH 4ODUB 4B50A 5FECB 4F8TA 1FAIL 5DD3L 5I8OL 1T0MA 4XRCA 1LVEA 4LVOB 4F2MA 5A16B 2VR4A 5C7XL 4P46A 4BUGA 1KJ2H 3TN0B 1BZ9B 4NRYB 3X13A 2HWZL 4UV7H 1L9NA 5FOBA 3QCVH 1Q0XH 1TJGH 4P2RB 2YN3A 2YWYA 4D0DB 4QF1B 2W65A 3SGEH 4IMKC 4XP4L 1NC4D 2E7LC 1FFPB 3GMMB 5I15H 4NKQB 5DRXB 3BO8B 1Z5LB 4CU8A 3PGCA 1U95B 2AABH 4Z9KB 3IKCA 3QUML 3VGBA 3DUSA 4BZ1L 1IM9A 5HGDB 3K2UH 5CGYD 3P0VL 3CVIH 4WWKB 2X89A 4PRNA 5IVXA 4HIHB 2BVPA 3IDYC 2NXZD 1FBIH 1I7UA 3SDCA 3VFTB 1A7QH 3SHSA 1VGKB 2ZUWA 3RUGF 3DRQB 4RBPK 5J11B 1Z9SA 5FUZL 3VFMB 2X4OA 5E95B 2VZUA 4GAGL 2EDJA 3MLZH 1KJMA 4LOUD 3FQWA 4MJIA 1D6VH 4JFOB 1I8MB 4MS8C 4NZUL 4GMSL 4OLYL 5DMKA 5MENA 1GRWA 2FJHB 1MLCA 3BH9A 1XGUA 5CSZA 4R7DA 2NNAA 2YD7A 3KLAB 3CSYB 3RJDA 2HLAB 1MCRA 4JQIL 4KRPC 4L3EB 1QLRA 1VEMA 3ARGC 4Y16A 4OUUB 3NFSL 4HJ0C 1M6OB 3QDJA 1IL1A 1Z3GL 2VDLH 3IDGA 2F5AL 1GZQB 3STLA 4UT9H 3GNMH 4OUOA 2J8OA 2ENSA 3Q3GB 3O3AB 3A6BL 3VXNA 3QPXL 1LP9A 4XVUD 5JDSA 5I1DB 3QNZA 3GJFB 4TTDD 2CKBH 4E41A 1OARH 4FNLL 4I3GA 5IHLB 3MZGB 1FNSL 4CW1A 2DIJA 5DQDL 1X7QA 3O6KH 4GRMA 3X3FH 4K71C 2QV2A 1OQXA 2R1WA 1VACA 5C0FA 3ARDC 1D5MB 5HHOD 1ZHBA 3L5JA 4Y4FD 3VXUD 5EBWA 2YMXL 2ED8A 5FYKU 2OMNA 5DQ9A 5AG8A 1IGTB 5F8QC 2X70B 4JRYA 3ZTNH 4DUWA 4QOKD 1OQOA 3LDBC 4JG1L 3G6JB 3G5ZA 1A3LH 1F4XL 4QNPF 1JNNL 3MRBB 4NKOB 3C09C 4PJDE 4N90D 1ZGLM 4OAWA 4Q2ZB 4HXBL 5CAYB 4HF5L 1S7TB 3VFWB 3PHQB 5DEFB 1JE6A 4UDUA 1MJ8L 2YR3A 2ZZUT 5HPMA 4TVPL 2Q8AL 3TA3A 2DYPA 3DVFA 4XGZA 3FOMB 3HI6H 4MWFB 5ISZA 5KS9F 4L8SB 1ZA6A 3D85A 2HH0H 5D2NB 1BOGA 1NGYB 5M7QA 3S5LA 3B43A 1NBZA 2ICEA 3H3KA 3VMOA 3HZKA 3OWEA 3S36H 1KJ3H 2UV3A 3JV0A 4K7FA 2Z31C 1KN2L 4N0CD 4K9EL 5BVJB 2RFXA 3HZMB 3MRCA 4G8EB 1KJVA 5EBMB 1OTSC 4JZJC 2X09A 5CMAB 2VKWA 5C0EA 3PG2A 2BCKA 3Q5YA 4GKSA 3EFFA 3DXAE 3LS5H 3GMLB 3OX8A 1Z9LA 3SE3C 1S9WA 2H1PH 3WFDH 3N06B 5C07A 4G8FB 1AD9A 4HS8L 3X14B 3BZFA 2X4PB 4WY7L 5CZXD 4NUGH 4U1SB 2GFBA 2L0DA 2CK0L 1ZAGA 5E5MA 1FIGL 1RIHH 1I8KA 3QXDA 3LV3B 4XNQA 1UCBL 1U58A 3PWPE 4J3VA 2HT2C 5GRYA 1YMME 3RU8H 5BS0A 1A0QH 3ULUF 3MO1A 3BKCH 5DC4B 5BXFA 3KPOB 1IC7H 1W8NA 2GHWB 1YEDB 3OQ3B 5EOCJ 2HVJB 4Z95L 5IFAH 3WFZA 2DWDB 4KH2A 2Y36L 5J6HB 4MXWH 3MXWL 3QG7L 4E0RA 3WNMA 1DQJA 1XGPB 1Y6KR 1UCTA 4BKLB 3BISA 4XMLL 1DVFC 2VL5A 3U0TB 1FE8L 3D3VD 1MI5D 5D7IB 1B0GA 3CVHB 4GG6B 4S1RL 3E8UH 5KOMC 2E6JA 1V05A 1AQKH 4ETYA 1X5ZA 3Q1SH 2AVGA 3MLPA 2F53D 4NYLA 4YHIB 5EWIH 3CCHB 3LMJL 3U6RB 5EG6C 1J1OH 4U1NA 4ZXBB 3ALPA 3W2DH 1UFUA 3BP5B 4JFFA 4PGZA 4PJ5D 4D8PB 4RCAA 3ARBB 3QAZC 1XH3B 4I4WA 5CD5C 4QXTB 4OV5A 1EXUA 4FFWC 4XTRC 2FLBT 4CN4A 4OI9A 4JVPA 1CG9B 3D0LA 2WQRA 2XQBL 3MRDA 1GHFH 1JGDA 5F71A 3RZCD 1B4JL 2Y6SC 1MCDA 1BD2E 2BFVH 4FXGA 3VG0H 5EZIL 2VISA 3OKKA 4M1CC 3LQZB 3TH4T 3WIHH 1G7LB 1H9VA 5AZEH 4LNVA 1H3PL 3W0WB 3VXSA 2IH3A 2HMIC 1I7ZA 1JV5B 2WLZA 1OAUL 1UWGL 1QFWI 2ARJB 3ES6B 2YRLA 4UDTB 5JHDE 5C8JA 4HJJH 1BQLL 3MOBH 4HIJB 3D1MC 1ZLUK 4U6HB 4LGRB 3BIBX 1AR1D 2A74B 5TJWK 1P2CA 4NM4H 5CILL 3ILQC 4OZIB 2P24B 5JXAH 1E4KC 1NUNB 3GO1H 3B9EA 1NANH 2GKIA 3BZEB 1LO5A 1RHHB 1E4XH 4KJQC 5K9OB 4ONOA 2GY7B 4XMKH 4HZLA 4KXZH 3ZDYE 1UACL 3PL6D 4WU7A 1RUKL 4QYOB 3T0EE 4NBZB 3SN6N 4F7CA 1XMWA 4BQ9A 1JTTA 4RAVA 3UJTL 4Y1AB 5I17B 4YDKH 4Q9BA 5GRXG 3RI5F 5IB1B 1H3XA 1ZOXA 5E08L 5BZDA 1ORQA 1NEZA 4KQ4L 3HAEB 1FNLA 3CFCH 1N6QH 2R2CA 4KMQA 4WV1A 3T08A 4XCFH 4P9MH 3RDTA 5C0AD 4XAWH 3UJIH 3BP7A 1F3DJ 2OSLA 4N9GA 2DI7A 2MQ0A 5CIPH 2ZKHH 5FUOH 3PP3K 2V7NB 2AJ3B 4U6XB 2I5YL 4JO1L 5CJXA 3B2UC 1OP3K 4I13B 4GSDL 2X1PA 3NIDE 5D6CB 5DMJB 4X8XA 2XQYK 3LKOA 5E8OA 4AMKH 5T1KA 4PB9L 1KYOK 4AL8L 4LDEB 4LSUL 4U7SA 1MJUL 1PQZB 2NCMA 4LPXA 2AJZA 3LSOA 1KG0B 1FL3A 1H5BB 4GQPH 3RQ3A 3FCTB 3VI4E 5I75C 1YN7A 1TQBC 5D5MB 5BMFL 3VI3F 4N5UA 3VFRB 1YZZA 2DQCL 2AKRB 5GGSY 3MRFA 1P84J 3PDOA 1OAYL 2YRZA 2R4SL 4MLIA 5I1CL 1BFVH 1K5NB 1VKXA 4LPCA 1KLUA 4F7TA 1BHGA 4M7ZC 3REWA 3PQYE 4WFHE 2NR6C 4ETQA 3KPTA 4UAOB 4XMPH 4Z7OF 4ENED 3RGVD 3WHXB 4NWTH 4WW2F 3DX6A 1TJIL 2VSCA 1GGBL 3FZUC 2ICES 3MLXH 3WSQH 4FXKA 3L9RB 5DO2D 1NBQA 4A2LA 5JHLL 4WHDA 4WWID 4MNQE 3EYSL 5C2BH 3QUYB 4LSTH 5HYIA 3IU3A 3REVB 4F9PC 4P9HL 1BVZA 1WFNA 1XF2A 1PGRB 3I02A 5KSVA 2LU4A 3CFEB 3X3GL 1IGYB 5E7FA 2I9LB 4GW5B 4HFUL 1SYVB 4MDIA 3D69B 1UM6H 2G2RB 5FHAH 5BOPA 5F7NC 2BHYA 1OTTD 3IGAB 4QRQA 4HIXH 4X6CE 1U91A 4YE4L 4YUEL 2HRPL 1OAXL 1SBSL 4CJ1A 3I50H 4G6JH 4YDVA 1WWWX 5D72L 5E2TH 3IJSB 2XZCL 1JGVL 3E6HB 3N9GH 3VWKD 3LN5B 4P0DA 5CEYA 5BZWA 1TQCC 1FPTH 1AGCB 5LCVH 1JNHA 4Q9QH 3OJ2C 2XZAH 4J8RA 3QEHA 4IHOA 3GGWA 5F89B 5BVPH 2NY1B 3OKEA 5IB2B 3FMGL 1Q72L 5DTFB 2RCSH 3TZVA 5EO1B 3U1SL 2PYFA 3V5HA 3VRJB 1J0HA 1A6ZB 5CBEB 3K80A 1R3LA 5IJVB 1U3HA 3FFDA 5ADPH 4Y4KC 4UI2A 3O9WD 2V9RA 2SEBA 3G5YA 1JGEA 4PJIE 2AI0H 3O3UN 3C5ZD 3WNLA 3NFNA 3HC4L 4ZUWB 4GKZA 1RJZA 4JB9L 1FZOA 4NNXA 3TYGL 5FO7A 1BLNA 4G5ZH 4YEEA 5CKGA 5DUPL 3SDDD 4HWUA 3K0WA 5D7LD 1IC4H 2H2SD 3LN9A 4LCUA 3QFJE 5GJTH 2QADB 1SBBA 1NSNL 1WFOA 4O4YL 3MRJA 4KROB 5IOPB 5IWLC 2QL1A 1IM3B 4M43H 4FQXD 4M48L 5D7SL 1IAOA 4BFBD 1C5CH 2XOTA 4WGWB 5DJYA 3OB0K 3K8KA 4N0FB 3WV0A 5ETUA 4HJGB 2J8UB 2VLMD 5C08E 3G9VA 4MQXC 2ITCB 4U2YA 4JM2C 4N0UB 4NZJA 1BJ8A 3OG6B 5FYKH 5D96B 1DSFL 2EDOA 5FKPA 1AXTL 1UYWH 5F1IA 3A67H 2XYCA 1M7DA 2PN5A 3WD5L 2FO1A 2VDQH 4HS6B 3TV3L 3LEXB 5J6GB 3BGFC 3VXRE 1HH6A 1BQHA 1HNFA 1A7BA 3MODH 3MNVA 4ODVL 3O3DB 1EZVY 3EYFB 3RTQC 4QEGA 2ZUQB 2NX5B 3L3DA 4OKDA 1KIQB 5I1IH 3P40A 5JW4N 4XPGL 1NCCL 1Q0YL 4GKNA 4HUXA 4S1QL 1WAAF 2O5ZL 3KPRB 4BJLA 3MYJB 5MEOA 3AS0A 4RAUB 5HYQA 5IHZB 1FVEB 3S88L 1U8OB 4CU6A 4XHQA 2ED7A 5IIEB 2ZSVB 3AMKA 3HMXH 3QIWC 3VXQB 2OM5A 5C0BB 3IETB 1C5DB 3S8WA 4LSPL 1PJ9A 2EDRA 5J13C 5E1AB 3HE6B 3NTCL 4XC3H 3VFUB 43C9A 4OZ4B 4FQ2L 1YNLL 3QWOA 5EU6B 3F12B 5BV7B 4Y4HC 3GB7A 4WFEE 3UBXA 2VXUL 3HI5H 3HRZB 1A6TB 3JWNC 4Y2DC 4AT6A 1FFNA 1IKFH 2PO6D 4HK3N 2QR0B 4DTGH 3BW9A 4KVNH 1AP2A 2CD0A 5DJAB 1CFNB 5IV2B 4G3YL 1NMAL 5KBNC 1MUJB 1TMCB 2IEPA 3OHXB 3RL2A 3T2QA 3UTPD 4APQC 3E2HB 2FGZA 3QR2A 2ADFL 3EDFA 3BZ4B 1CLOL 5L2KE 4L9LC 1LGVA 4LP5A 5HYJA 3NIFF 1FNEB 1FGNL 5F1NA 5FDWA 1R6VA 3DX8B 5C0ND 1KLGA 2F54A 1HSBB 2R2EB 5DGQA 4JAMB 3OPZH 5ICXB 4KGLA 2AXGA 2YD2A 1S3KL 4NO3B 1HHKA 4G6MH 3EIFA 2JJSA 4WUKH 1NCDH 4OFDA 4IIQA 4X6DE 2IADB 2A6IA 4G7YL 1XCTB 1RZGB 1NMBH 1VGEL 3NCFB 3X12B 5IQ9A 2GI7A 3MROB 2IFFL 4EZMA 1K2DB 5ANME 5GS0H 4ZNEA 5IEHA 4R6UA 3FN3A 1ZGLB 3QEQA 4I8DA 3MRKA 3PWPA 2BDNH 1V7ML 1OP5H 1YMMA 4WHYG 5TDPA 5TE6H 1T3FA 4ZUTB 2A6KB 1CGSH 4P46C 4ORGA 3FKUS 4MB5A 3HC3H 2HKHH 4YBQC 2QSCL 1FFOB 1P5UA 4GS7C 2ZUUA 4PBWD 4XP1L 3TO4A 5CZVL 4OGAD 3KPSA 5MP6L 1DBBH 4I5BA 1K8DA 4ODTL 3HS0B 5GZOD 1RZKC 3MFFA 1RULH 2R69H 4D0CA 1BGXH 3ULSA 4RGOH 5F1KC 2P7TB 3B9KD 3RL1B 2VZOA 4OI7A 3GJFH 1FC1A 4GRLB 3WLBA 1DL7L 3DYOA 3WIIL 4KJPD 5KANI 5E8DL 5SX5H 1OLLA 1I1RA 5D1ZD 4NQUA 5F7FA 1CFTA 4DAGH 1FDLL 4PJ7B 5JW4M 3P4MB 1UWEH 5DD5H 2LTQB 2AV7A 4K3HA 4HH9B 3UTTB 3GKWH 1A21A 2V5RA 4ZDHB 3IDJB 5JMOC 3O4LB 1I9RH 1XIWD 1A6VL 4EN3B 4HHAA 4WFGD 1WT5A 1YEKH 5FM4A 1JWSA 5JIKA 3HLAA 5TDOA 1QTYT 1A7OL 3MV9A 5IMOA 3DIFB 2B1AL 2J88L 1AGBB 1EHNA 4DOHB 3NGBB 3FN0L 2HKFL 4FXLA 1T22A 3L3OB 1JHLL 2IPKB 3MV11 3N1GC 4NO5A 4LLUB 4ZG1A 1MOEA 1QSFB 4HMEA 2GAZA 4F7PA 4G8GD 1JP5A 4M61B 3SPVA 1L9MA 1X5GA 2VO5A 4KI5D 2FSEB 1T03L 4QWWC 1NCAL 1ZEAH 1INDH 3PABB 4NQCE 5JHDA 4Y16C 2Z8SA 2EXWD 4G7VH 3UZQA 2HTLC 1BWWA 5FB8A 2IPTH 1MHHB 1JBJA 2D7NA 2JB6B 1FYTE 2EZ0D 1BAFH 3GBNH 2VWEE 3DV4B 5EU3B 4O2FB 4XNYL 1KCSH 3G6AA 2NLJA 4PGJA 1G0YR 2FZ3A 1CI5A 2B1HH 1P7QD 5B3JE 4NQDD 5EU5A 1AJ7H 5DXWA 3BN3B 2KDGA 3Q2CA 2BSSA 4Q9RL 1PEWA 5DHVA 4RBPH 4A6YA 3UPAA 4LIQH 2Z91A 1WFTA 3PF2A 5E8NB 4PJXB 1CDJA 3FO0L 2XZQL 5EN2B 3NZ8B 3KPMA 3W9EA 4MS8D 3ULUE 1JPSH 2AJSH 2GSIB 5HDLA 4UIMA 4ZODA 2BRRH 3ZL4H 2X4QA 4M9OA 1KCRL 4AJ0A 2Q7YA 1LK3H 4KRPD 3SY0B 1NFKA 1KIPA 5LG1A 1CK0H 1CS6A 1IGMH 5B39A 5EUKB 1CLCA 1T7ZA 5M94B 2BJML 2OS7A 2Y7QB 3G04A 4HJ0D 4WRLA 4A6YL 4RDQG 1RY7B 3BPCB 4IJ3C 4M93C 4JDVA 4OZGE 4PJBB 3IJHA 1S9XB 3MA7A 1GPOL 3L3GB 5SWZD 1N5YH 4TSCL 4W4OA 2X4UB 1EUTA 1U8PB 4JFDB 3RHWK 1RUQL 2JF1A 4NC1C 3WXVL 5DZOA 1YEGH 3JWOL 4P5MB 2O5XH 5F88A 1F02I 1V7NH 1A9BB 1I3GL 3MRQB 3DX9B 1N6UA 1MQKL 5F7UA 1MAMH 1DN0A 4KQ3H 4MAUH 3ARDD 4MCYA 1T4KB 4XVSL 5E5UB 2OP4H 4HWEH 3CVHH 4W81A 4WFFD 2EDDA 1QUNA 3F5WB 3K8LA 3PIQA 4OF3A 3G9AB 2WNGA 4KVCL 1FCGA 1G0XA 4MVBD 4MNQA 4NO0B 4C56E 4CMMA 1HXMA 3OMZA 5FO9B 4GXVL 4POYA 4LKCB 2G9HA 3HC0A 2E7CA 4B53A 5I9QB 4N8PA 3TM6A 3QDGB 3SQBA 2XV6B 1QBMH 1JUFA 2NY5H 1P4BL 2NYYC 2R29L 4QGTA 4EOWL 3WN5A 1DBAH 4HLZG 2UY7A 1UZ8B 1MFBH 4TRPL 3EO9H 5LJYH 1TNNA 4PJAF 2VLRB 4OGXH 4OTXL 1BVLA 1IGJA 1S9VA 4X6CA 3LEVH 3U7WH 4HWZB 2VDRH 3KJ4B 3TNNB 5A3IC 1A64A 1MPAH 3T8XA 1M1SA 3H3PL 4H0IA 4NRXA 1DQTA 3D25A 4HSQA 4NCC1 3WDHA 4WW1B 1GGIL 3MRIB 5IP4A 5HI4D 1EBAA 1W72B 2IGFH 5D5MF 2YPLB 1A2YA 3MFGB 1I1YA 2DQDL 3P4LA 4X9GA 2YD1A 5HGAA 5EC2B 2W0LA 3WJJA 4K7PY 3C08L 4I48B 1OTSD 2GIYA 4L1HA 3IDIA 1D9KC 2XKUA 1XT5A 4XCEB 5F6HI 4JPKL 3JTSB 5HVHC 1Y0LB 2N56A 4JJ5A 3FRUB 4AYFA 2DWEB 4MXQC 4U1JB 4YHNB 3QFJA 3O0RL 5JW3L 5E5RB 3INUH 3QIUB 5DT1H 2Y5TB 2Z35A 3SE8L 3QO1A 4YX2L 1ZHLA 4OGYL 4XZUB 3V4PL 4TNVF 4H25A 2R4RH 4AIOA 5C08A 2ZCLL 3DSFH 3IFOA 4FQ1L 1U8NA 3ARED 4MLSA 3DRTA 1GC1H 4NCDA 3L3KB 4L3AA 4Z7OE 3FFCD 2UWEA 4LVNC 3OV6A 2R0ZH 4JHWL 3V52L 3VXRA 4TUJB 3HUJF 1NBVH 1CDUA 3QCUL 3GSNA 2ZP0T 4OSUL 5J06A 1EEYB 1DVFD 1S7RA 4JZNA 3A0OA 3T2OA 2LVEA 4QCIA 4RGNC 3SDAB 5C6PB 2GCYB 4ONGL 2W9EH 2ORBL 5I1LA 4XC1H 1ORSB 1A6UL 4Q6IA 2F19L 1BM3H 1A5FH 1JHTB 3CUPB 4S2SA 5FKAB 1M05A 5FYKE 1B88A 1U3YA 1DQDL 2D0FA 4HWBH 4ZFOB 2LABA 4XTRD 1T89C 3SOBH 1SJEA 2AQ3A 3GSNL 3MCKB 4ERSL 1PDKA 5ITFB 1XGYL 4ZFGH 5DMIL 5E4EB 3FRPA 5T5NF 1E28A 2PF6A 2Y6SD 1LWRA 4UTBH 5IHUH 3RWIB 1MHCB 4TULH 1KNOB 1FG2B 2W0KA 3VGHA 1GGCH 5D7JC 1WCBA 1QKZL 4M1CD 2XA3A 2IANB 2J8UF 3BUTA 3EBAA 5EOQL 1HNGA 2OTUA