1NCAH

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDTATFFCARGEDNFGSLSDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH02
1OT2A 5IJKC 3RL1B 3FONB 4DAGL 3V6FB 2BVUA 1BLNA 2X41A 5IMMB 4PUBL 1DP0A 3RWIA 4NUGL 1OTUD 4LL9A 1X5LA 4PG2A 4X5WA 2NY6D 2F5AL 2GJ6E 4F33B 2BHYA 4WY7L 3C60D 5BVPL 4PY7B 4WHTA 2UZYB 5CILH 2ZCLH 1KCSL 3WUWG 1ONQA 3C5SA 4O2EB 2A9NH 2QADB 2VAAA 3QDME 3G5XA 2ZSVA 2FIKB 5HHXH 4G42B 1N8ZB 4K9EH 4OM1L 4PJ8D 3HAEH 4NZTH 3OMZA 1FZOA 5I8OL 3LD8B 5KANI 2UY6A 1JPST 4HBCL 1CT8A 2FZ3A 4QTHB 4HGWB 3G04A 2VXQL 4U6YB 1UZ6F 3ZDYE 5D7JC 3HE6B 4NWTH 4E42B 3MRNB 4JZOA 1KELL 2N1KA 3MNZB 3QUYB 3WKNA 5FV2A 1XF3B 4GG6F 1W72L 4KTEL 3FKUS 4XVJL 1WCBA 1AGCA 1RUMH 5I71C 5JQ6H 1FV1A 1IEBA 5C8JA 4HC1H 4JAMA 4FQIL 3VFMB 1P6AB 3HC4H 5F89A 4JDZA 3T2NH 5EUOB 3ULSB 5E99H 2NY6B 1IC1A 4I3SH 3T65A 2Z8VC 4ZO7A 4PLOB 3NOIA 3C60B 2FATH 5JUEL 1IGCL 4XC3H 1EAPA 5GRZA 2D7NA 3KLAB 1YNTB 3OXRB 4KWUA 1W2KT 2P46B 1ZLVK 1G0XA 3W5NA 1IEHA 1IGYB 1UM6H 4LNVA 4QNPF 5FAAA 5KN5A 3OTTA 4PLKC 4PJ8B 2AEIT 2FGWL 3QEHA 4QHUA 1IZJA 3TCLB 5CEZH 5GS0L 3MRJB 3MR9A 2QKIA 3VMPA 3OGCB 3LIZH 4FQXD 2KZ1B 2BSRB 1LEGB 2E8ZA 5D5MB 3ZZ1A 5T1MA 3GK8L 1ZGLM 1VGKA 3DTXA 4K71C 1Z9OA 4L8SB 4OLZL 3CX2A 3WFCH 1NLDL 5ICZA 1A3LL 4HT1H 1YDPA 3N85L 4HUWA 3UTQB 1FZJB 2XACC 3GB7A 5I1HL 1OAUH 5FO9A 5FYJU 3WUZA 4Z7VF 4PJAB 4P3CL 4JHWL 3WUWA 5D96B 2D0FA 4YDVA 1F6LL 2H9GA 3EYQC 5JW5A 2HLFD 4G8IB 4LLAA 2A9NL 4MS8D 1OTTD 1UZ8B 5DDHA 1MFEH 3GMOB 1WAAF 1SYVB 2X4TA 1K6QH 2EDRA 3NPSC 3MOBL 4QCIB 2H2SC 3CSBA 4KQ4H 2MQCA 4U6VH 3SCMA 2CKBA 2COQA 4PV8A 1RZJC 1UM4L 4HIXH 5IB5B 1D5XA 4NQCA 5IEHB 3NBNA 4FQXB 1KJ3L 1CGVA 3QULA 1JGEA 1MRDH 2FJFB 1JZ3A 4I9WD 1FYTA 3W9EB 2HRLA 1DTUA 1V3LA 4NWTL 5EIQA 1JGUH 2P8MA 3KXFE 4PJ7F 3AREC 4NFCA 4ZXBD 3NABH 1F3JB 1T22B 1RUML 1ACYH 5FO8B 3GJFA 5KVFH 5IMOB 1A64A 2Y25A 4HC1L 3V6ZA 5A16A 5JXED 4KK6C 3H9YA 5DZLA 1IC4H 2X70B 2CJUH 3ES6A 3ZTNH 2DI7A 3PGCA 4I3SL 1O7SA 1DUZB 4GT7A 2E8YA 1BQHG 1YY9C 3LZFH 4QRRA 2EYSA 3EJYD 4XC3L 3TIEA 1JWSA 3GHBL 5E8EA 3O3DA 1WIOA 3TM6A 1UM6L 5IB4A 4E41D 3TJEH 1JNJA 3G5ZB 5CEZL 3UYRL 3VA6A 3OKMA 3QWRD 1P1ZA 2VERN 4ONGH 1J0YA 3GHEH 1MHHB 2B1HH 3LIZL 3U83A 2OLDA 5FKAA 4PJ9D 2GYSA 2B39A 4OT1H 1S7UB 3MXWH 1FL3A 1CFBA 2ZJSH 4MX7A 1ZGLB 1Q38A 3S96B 1I9JL 3VXSA 3WFCL 4JG0L 1OLLA 4AH2A 4FMKA 3LS5H 1BQLH 4KI5C 5INDA 2HVJB 2P5EA 4ZXBB 3L3DB 3ZE0E 2R0KH 2EXYC 1PQZA 1OAUL 3K8LA 4X6BA 4XC1H 4BFIA 5BJTB 5KOVC 1ZEAH 3SE9H 3Q6FB 4QY8B 1X5FA 4JRYE 1H9VA 4YE4L 3MRGA 5DRWA 1CLOH 5EN2A 3H9HB 3VI4E 1Z5LA 2VZVA 4WTZG 4HZLB 1NMCB 1MFEL 4JFZH 3U9UB 4E41B 1K6QL 2FJHA 4NKOA 2J8OA 5CSZA 1L7TH 4U6VL 4HXBH 1CLYH 3FB8A 3REWA 4HIXL 3GUTB 2AGJL 2GCYA 4PJ9B 4U05A 1MRDL 4LCWA 5KTEH 4HZAA 2EH8H 2F53E 3DVIA 4ORGB 5HHOD 4CW1B 4YZFF 4PJEA 4YHNB 3UTTE 5JIIA 2VR4A 3VFVA 1TZIA 3BIKB 1UXSA 1ACYL 5KVFL 3FT3B 2MFNA 3QXDB 4X8XA 1G9MC 1BQHA 1CFVH 2DBJA 2CJUL 1JP5A 3ZTNL 3WFZA 3RZCA 5CD3B 5D1QD 4OSUH 3LRHA 4PV9B 5IB2A 5BOPA 1EEZA 3E8UH 3JUYA 3CMGA 1FRGH 4P0DA 1S7QA 4F7PB 3SO3B 1EVTC 1X5ZA 3S37L 4OF3A 2G5BB 1T1XB 4ONGL 1IAIM 3LKSA 4LVHB 3HNSH 1EEQA 2DJ4A 3OAZH 1MRCH 3MXWL 2ZJSL 1U3HA 2R2BB 4IMKC 4QLRA 1YPZB 4QO1A 1HSAA 4W6YB 4G6KH 4Z0BL 5HHOB 5ANMA 4W6WB 5FO7B 1HILA 3LEYH 1JHLH 2YA1A 3LS5L 1BQLL 5L8KB 1MFAH 4FXGB 5HYEA 2OXGA 3CFBB 5GPRA 3P9MA 5I2IB 3ZTJG 3SE9L 2DQUH 4WTZA 1G84A 3F5WA 4I0CC 2W0FA 4Y19D 4UQ2A 4UTBL 5D5ME 1JGVH 1U8HB 4QT5B 1CLOL 3QDGD 4Y5XB 2FLRT 1ZA3B 3CFDB 5D1QB 1S9XA 1HHGB 4HWZA 3V5KB 1U8LB 2Q6WA 5B22A 2F8OA 4MA3A 3R0NA 4C54A 5D2LB 4S11A 4JFZL 5C3LD 3WIHA 1QFWH 2J5LC 4U1IB 3GSVB 4HXBL 1CLYL 1OP3H 1A14L 4G80B 3BZFA 4F3FB 5AG9A 3OPZH 1NBZA 2X10A 2FO4B 3B9VA 4Y4KC 4HJJH 1NGXA 1KYOJ 5KVMC 4TPRH 1OPGH 5DMIL 4X9HA 2Y4SA 2ITCA 3G5YB 4ZOAA 1G0DA 3WHXB 1CDBA 4E5XB 1CFVL 4ODXA 1H15A 3TH4T 4Y19B 1CD1B 4ODUA 3PUCA 4X4ZA 3QDGB 5EZJA 4ORZC 3VGBA 3EYUH 4HK0B 3O8XA 3E8UL 5IJVB 1FRGL 1K8IB 1LE5B 5ESAA 5CEXB 1I8LA 2GTZA 4PRHA 5LKNA 1T5XB 2FH6A 2XZQL 1MCOH 3HNSL 3R0MA 2YUVA 2H45A 4X4YB 5A2LH 3A67L 1Q9KB 1D5ZA 3ZL4H 1Y0LB 3Q6GL 2QTEA 4NNXA 5FM5M 3K3QA 1BD2A 2R2EB 4G7VH 3C6LA 1JHLL 2DMBA 1GOGA 5JW3L 1FG2A 3OKOA 1YQ2A 3S5LA 3OKKA 1GOHA 4UILH 5HPOA 2DAVA 2H32H 3S4SG 4F37F 3JSSA 3WLWC 4A6YH 3NZ8B 4YIQA 3W2DH 2ZKHH 3D9AH 4UT6H 4XMLH 3SJVD 3VXQB 3DRTB 4LAQH 2APTA 1NAMA 3VFPB 4D0BA 1M7IB 1QKZH 1V3KA 2V7HB 1UGNA 4ODBD 2ADGB 3G08A 4B41A 3UEZA 2BSTA 4JPKH 1KC5H 2I9TB 4HV8B 3VG9C 2OZ4A 3RTQA 3VA2C 4KTDH 5KSAC 1S7TA 1E6OH 1CFNA 1WT5C 2OXHA 1CYGA 4HJJL 1PFCA 2IBZX 4TPRL 2GIYA 2A9ML 5F9OH 1OPGL 3O9WD 3MJ9L 5DA4A 2DI9A 2YD7A 3P2TA 5BV7C 1H3TA 4QHKI 2KQMA 3K7UA 4QRTA 3VDAA 1BZ7A 5L2KE 5IIEB 2EH7H 3QUZD 4IRJA 4OM0H 4XI5C 2XKNB 4IHOA 3IETB 3SJVB 2PTVA 3MNVB 4RBPK 5DEZA 5K9QG 3ZSSA 3SE3A 5CMAB 1RZJL 3BH9A 1T1ZB 5IK3B 2YD9A 3ARVA 2IANA 4NBZB 4IIQA 4G9DB 4NOBA 1A1NB 3QPQD 4KRNA 3DXAE 1VSCA 3OXSB 4L4VD 3WL9B 1AIFB 3ZL4L 4D3CH 3DO3A 3IDYC 4HIHA 4WTXA 3IU3B 3SDXA 1G7QB 4G43A 4G7VL 5EH1A 3O9WB 1YMHA 4JN2B 3S4SA 4RDQG 4Q7DA 1G9MH 3WBDA 3F7QA 4MD5B 4XAWL 1H0DB 5F6IB 5IKCA 2AKRB 4OQ1A 3VGGA 4R9HA 5C9JB 1FVCB 2XOTA 2LU4A 3W2DL 5GGRB 2ZKHL 3TA3A 4PRIE 5C86A 2D0HA 4ELMA 1KN2L 3QUZB 4O5LH 3ZYIA 3VDBA 2BY3A 2L7JA 1KIQA 2V5SA 4U7MA 1QKZL 3EDKA 3I85A 1O5DT 1A6PA 3HUJA 3QI9D 4JPKL 2VN4A 1MVUA 3LKNA 3WJJA 4JLRB 3FB6B 3EYVA 2HFGH 4OGZA 4ZAKA 5C0AA 4YHLH 1E6OL 1KJ2B 3QA3A 3DIFB 1OAKL 4UZGA 4L4VB 4QHNA 4WO4A 4Q6IC 3ARYA 5F9OL 3VW3H 1UCBH 3L95B 2UVFA 3MREB 5IVZA 2B1AH 5GGTA 3IGAA 4LEOA 1WBYB 1J12A 1T1WB 2XWJA 3UTSD 3IKKA 5ADOH 1MLCB 4HS3B 4NQVA 5TF1L 3HB3C 3VFOA 3IJYB 5GRUL 2DDQH 2HRPL 3QEUB 4OM0L 1UKQA 4JREC 4DZ8B 4KUCF 3TJHC 2P49B 1FLRH 2FIRT 3QHFH 3EDFA 3GJFK 4CN4A 1NFDF 4NGHH 5D7IF 1FN4A 1XR8A 4LMQI 2IADB 1I7RA 3QI9B 3RY4A 2RCSL 3OAUL 4ZOBA 1YN7A 4TQEH 1T4KA 3SBWC 4NOFA 5LGJA 2P44B 5C0EB 2MQ3A 3L9RB 2FR4B 3BP5B 4HIEB 4XMPH 3O45B 3VXNA 5BRZD 1JMZA 1AGBB 4JB9L 3E3QE 4M1CC 3BYTA 4OZHE 4YHKH 4TULH 4M7ZB 5BZDB 1CG9B 5C08D 3SGDH 3L7EA 4XPTH 1G9ML 4NO2A 3C8HA 5FM8A 4XCCH 3UTSB 4GRMB 2CO6B 1MEXH 3EFDH 5GGSB 1QQDB 3FFCE 3EKCA 4Z0XB 1GGTA 3HG1D 1BIIB 3QEGH 3SDYH 3CMOH 3D39A 5DMKA 3FCTB 1EBAA 4POYA 3TLRA 4JDTH 5H35B 3MZTA 2D31B 4DW2H 2ZOLA 3WSQL 3HA0A 5EBLA 3STZA 3PWPE 2YPVH 1YEDA 1WBXB 3TZVA 2HFGL 2QHRH 4NT6B 3O6LH 3IKCA 4M8QB 1K5NA 5TDPA 4LPYA 3ROLB 2LU7A 1BBJA 1HN1A 1QVOA 5BRZB 4OGAD 4KMQA 5DS8A 1D5BB 5E6YA 1FNAA 3ZKQD 2HTLD 5DYOB 4I18B 2GSIA 4R3SB 4XNUH 4ELKB 1ZAGA 3T1FB 3BGFB 3RVUC 3UAJD 4MVBC 1AGFB 5IEKA 5C08B 5DLMH 3NCJH 4L3ED 3E1F1 2B1AL 1CD9B 2C3VA 3QIUC 1M05A 3NFPB 4P2OD 1FSKC 2JIXA 4UDUB 2DDQL 2NY2D 3MTRA 3D87B 1XF1A 1C1EH 2A0LC 4EDWL 2ATKA 2NY4C 4DUWA 3O2DA 3HG1B 4Y1AA 4D94A 1KSRA 3HI1B 3IFPA 1FLRL 4YHYB 1LWRA 1MUJA 3QHFL 4GMTL 1JN6A 3OF6A 3SKNA 4ZQKB 4NGHL 2GJ6A 4NO5A 4Y2DC 3AVEA 1NGYB 4N0CC 1O0VA 3KG5A 5DT1H 5T5FH 4GG6B 1DSFH 3QDMA 4TQEL 1JWUA 4MXVE 3GJEB 5F6HJ 4BK4A 1C5CL 4XMPL 1KCKA 3RWFA 4UUJA 2YD4A 4CU8A 5IROA 4WEBH 5F3BB 5DXWA 1A4JB 5D1XC 5DZNA 4MQTB 5E8DH 4X7DC 4YHKL 4WFGE 3BESR 2AXGB 4XPTL 5C7XH 4L3EB 4LCIL 4Q97A 3VD9A 1EUTA 3LCYA 4XCCL 2HT3D 2AJ3B 2VDKH 4NM8H 1JMXA 3QAZC 4P2OB 4MA7H 1R5VA 2P8LA 2OI9C 3EFDL 43C9B 4FQQA 1KPRB 2NY2B 1G6RH 1IJ9A 2QQLL 3OJDA 3CMOL 4IM8A 3BSZH 1CLCA 1X4XA 3T4YA 2C3HA 4JDTL 4TSAL 5GSRA 5HPMB 3GMPA 3VFWA 3JWOC 1VFMA 5C0CE 4O51A 4V2CB 3IJSA 5J6HB 5D2NC 5CBAB 1GZPA 3S98A 4D8PB 2QHRL 1AC0A 2I07B 1WF5A 1MIMH 4XBGB 5JOFB 5HGGS 4H0HB 1S7WB 4JHAH 1DANU 4Z7VB 2R56H 3OKDB 3RVTD 4PGEB 1TVBA 2V5YA 2KBGA 1GGBL 5GS2H 2PYEE 1AD9A 4D0DA 5DLML 4L8CA 4EOWL 3DNKA 4FQHB 2M8XA 3JTSB 3WDJA 1PSKL 3O4LE 1HH9A 3RU8H 4YBQD 3PWUB 2JJUA 4IRSD 3JTTB 1N5AB 5HGAA 4GAJL 3QFDB 1C1EL 1WWCA 1CIUA 4APQC 4DCQB 2VLJD 3FOLA 1M71A 3GBML 2A73A 1H5BC 3Q3GA 3TBYA 4DGVH 2YR3A 4TUOB 4B50A 5A1AA 4L5FL 2VLLB 4F9PC 4PJ7B 5DT1L 1JWMB 1DSFL 2FEDD 4ZDHA 3WCYA 3CH1A 3RAJH 3DX8A 2Z31D 4OD2B 3ALXA 4RX4A 2UZIH 3H7LA 5HVHC 3GMMA 5KG9A 1MJ8H 4XCNB 3ZKXB 2N56A 3U1SH 5EU5A 5BV7L 1I7UA 4TN9A 1K8DA 1LE9A 2VUYA 25C8L 3CPLA 4WNQA 4KI5F 2B2XL 5C7XL 4PYGA 1QP1A 3H3KA 1FYHB 4PTUB 1B4JH 4Y5YC 4WV1B 5DJ2B 1UEYA 4U1GC 3KLHC 2C3GA 3F7PC 3KXFA 4HS8H 4MA7L 3VXPA 3KWWB 3MA9L 4IRSB 3RX8A 1YNKH 4IDJH 4M61B 1G6RL 5C0DA 2BFVL 3CXDL 2VLJB 4AENA 1FP5A 4P4KD 1ZT1B 4YPGB 1OP5K 4CAGA 2IQAB 3WFEH 3WE6A 5DK2A 1JPFB 2W9DH 3QH3B 3DJ9A 5EC1A 4UNUA 5FHAH 2GY5A 2GT9A 3K1KC 3QNZA 4H0GA 1EGJA 2Z31B 1MIML 1S7VA 2HT4D 5CWSB 4XGZA 3FQTA 3IDMB 2O5XL 3TO4C 2Q76B 3MRLA 5EZLA 5JW4R 3LPGA 1E6JL 1B0WA 5J1AA 2X4PB 3TESA 1Z9SA 5F7FA 1T2QH 2JB6A 4PBXA 2AV1B 2FYYA 3FO1A 4PRAA 1ETZB 5F7LB 1VADB 3WKMH 5SWQB 3T4AB 1UWGH 2X89A 4R7DA 1CFTB 3LVEA 3RU8L 3L6FA 4JFXB 5KZCD 5J56B 1KUMA 5CZKA 2EIBA 2JTDA 3SDCA 1HINH 1ZSDA 2ZNXA 4PRPE 5CJXC 2XZZA 5F7DA 5FECB 1C8PA 1TZHB 4P4KB 2W0LA 5C0GA 1KTDB 4J1UB 4DGVL 2CR6A 3UDWC 5DF0A 4JRYA 1Q9OA 4XBPB 1NGWA 2HJLB 4ETQB 4V1DE 1OWRM 1T04A 5L9DH 4R90H 2C1PB 2OL3B 3QUMH 1BZQK 4MA1C 3BEVB 1VEPA 1MQKL 3IU4H 4OQTA 5BQ7B 2W9EH 2BY1A 1MJ8L 4G6AC 4LIQE 1H3VA 2O93L 1VFBB 3HG1E 4KDWA 1KJMB 1I3UA 4LHUD 1ES0A 1LEIB 1ODAA 3RDTD 3A6BH 5CS7A 1UZ6E 4GW1A 2WUCL 5HD8C 5DJCA 4MJ5A 2QQNH 1B4JL 2F53A 4BQ9A 4MB4A 4PY7A 1TTUA 1DDHB 5I17A 4N0RA 1WK0A 1X6LA 1OSZA 3BISA 1AXSA 1YNKL 3LDBC 4IDJL 4R4BB 4RFNB 5FGRA 1AGDB 5KZCB 4NNYB 3BZEB 5FYLL 4LLVB 5GS0D 5JA9A 4BQ8A 1PG7L 3HPJB 4X6CE 3UMTA 3LHPL 2BMKA 5I8EA 3WFEL 5I1CH 2ORBH 2JJTC 5FA4A 2JK5A 5FEBA 1T3FB 2W9DL 1QSFD 3IFOA 4DN4H 5DEGA 3ZLQC 1BVZA 5E8PA 5F9DC 5D7SL 2R1YA 1XGYH 2XNAB 2F19L 4YBLB 4J3WA 4WI7A 2YK1H 4NO3B 2MCPL 1YECH 2APVA 3ALPA 1T2QL 2CDFA 4LHUB 1HHJB 3VFMA 4HFWB 3NCMA 2VITB 4L4TE 3RDTB 4DZBB 5C6TH 1IQWL 1Q9WB 5DUBB 1ZT4B 1UWGL 4EXKA 3WLBB 1IFHH 3MLYL 4QRUA 1INDL 5I8CB 1J88A 4YR6B 4PLJD 4PJ8A 1JGDA 1DANT 1HINL 1UFUA 3FRUA 3GSNL 3MRJA 4EI6B 5GXBB 2CK2A 3ZT5A 3X11B 3JWOH 2DOCA 1I1FA 2BSRA 4OZFB 5D5MA 1JNNH 4JRXD 1DUYB 5MEND 2KUTA 1T66C 1QFUL 4U6TA 4F57H 1QSFB 3NA9H 2GJZB 4I4WB 1L0XA 3EOAA 1J8HE 1U0QA 4R90L 3MRBB 5L9DL 1H3XA 1WAAE 3LRSB 5MP6H 3WNPA 1VHPA 1BVLA 5A2KH 2R4RL 4ZUTA 3LQZB 3C5ZA 2NXYC 2AK4D 3CFEB 1IM9A 3QXAB 1K4CB 5CIPA 1FO0H 2R0WL 5JO5B 3QO1B 1G6VK 2APBA 3A6BL 1P2CB 4WWKD 1YEFH 2P47B 2M1KA 3SDAA 4LSVH 1F58H 3J7HA 2QQNL 3TNNA 4KTYA 3K2MC 2ZUYA 4G8IA 1KB5L 5DQ9B 2EE9A 3SPVA 2WIIA 1UZ8A 2A77H 3GMOA 3HAEB 4JANB 4CKVX 5DK0B 3MQIA 4HPOH 3QIWA 1ND0B 2P24A 1HDMB 5EO0A 4CVWA 5B38B 5EO1A 2FWOB 1S9YA 1XIWA 1QPXA 3VGAC 2YWZA 5I1CL 1OGTA 2VQ1A 4JRXB 5I73B 5MENB 1MCQA 1TQCC 3GIZH 2NW2A 1YYLH 3RL2B 2ADIB 4I8DA 5CSGA 3HR5B 1LK2B 3FQRA 2SEBA 3U36A 2YK1L 3PDDA 5EBWB 3PG2A 1H8SA 1RULH 4J8RB 3K4ZA 5B8CC 2VISA 1F3JA 1T22A 2AK4B 3RBGA 3B5GA 4PP2A 1YECL 4JFFD 2YS4A 1I3RB 4NP4H 3I50H 1KCLA 4KC3B 3JVGA 3P0GB 4P9MH 4ZO8A 4X7SL 3K81A 3QG6A 3O3AA 4WWKB 2W92A 5C6TL 3AY4A 4NRYB 1LO5B 4ZUWA 2YA2A 2VE6B 5HYSG 2H1PL 3V5HA 4CMMA 1EJ6A 4I0KA 1JTOA 1DQLH 1OP5H 1QSEE 3RGVD 3PWVB 4O9HL 1CGTA 5JQHC 3T0DA 4PJFF 3LKPB 4LPWA 4LCCC 4X98A 1OGAE 2E7MA 3PIQB 4Y4FD 3B43A 2ZCHH 3JWOL 3WD5L 3SKOB 1KTLA 1MJ7L 4WFFE 3RKDC 1MHHA 3MROB 5HDQH 4R0LC 3D0VB 4RQQB 2IAMD 5I1DA 4HKBB 5E1AA 3T0ED 1JNNL 3JZ7A 4FOMA 4KHTH 2X1QA 1HWGB 3PV6B 4F57L 4YJZL 5HYQA 4KUZH 4PP1C 4UOJA 4JKWA 3UJJH 3B9KA 4D0CB 4U31A 1A4KB 3O41A 2HVJA 4G8GE 1NBYA 4F7TB 1I75A 5EOQH 1AKJA 1FFNB 5ELIA 1FO0L 4JFFB 3GSQB 3QDJE 3LN9A 3OKLA 4MAYD 3ARFC 2C3XA 5CGYD 5E70A 3WJLA 4ODHH 1YEFL 3CZFA 3HZKA 2WUBH 4ZG1A 5DFVC 2VDLH 4HZLA 5DD6A 3F62A 3RGVB 3BT2H 4MQXD 2A77L 4EDXB 4M93C 3DVNB 3IVKB 2VZ3A 3EOBA 2DMCA 4YHZL 5I19L 4GRWB 3MRCB 3ZYJA 1OOAA 1IL1B 4Y4FB 5KVEL 5L2KA 4NQEE 1ZLUH 4KKAC 1ZVYA 2Q3AA 4LLWB 5F1IB 3TBSA 1EO8H 1IGIH 4WHCA 5AZ2H 1D6VL 2IAMB 3T0EB 3MRQB 4U3HA 5BVJA 1ZT7A 4ORGA 3BXNA 3MCKB 2AQ1A 2Z35B 3L3JA 2BVOB 5JMRA 4YHNA 3RVWD 3BPCB 3OZ9L 1RJLA 3IXAB 1JZ2A 3FT3A 4KAQH 4PJHE 3H3PL 2HVKB 5ITFA 3I50L 5DRNA 5MI0C 1LILA 4YDIH 5DJZA 5HYSA 4MAYB 1YC8A 4KUCD 1MCEA 2V9TA 4JO1H 4P9ML 3DXAA 1E4KC 2NY1D 1GSMA 5AG8A 3I9GH 2MKWA 4UDTA 3WIIH 1RZ7H 3RPIA 5CJOL 3ZT6A 4RWYL 1UADC 2D7TH 4DEPC 4ALAH 1WZMA 1EERB 1AP2B 1P5UA 4HIJA 4POZD 1YY8B 4S1DD 2ZCHL 4X6FB 1DCLA 1NMBH 1IC7H 2PETA 4UAOB 5DHYB 4M7LT 5HDQL 4R8WH 3UX9B 4PRIA 3QZWA 5C0BD 5ALBH 2UVEA 3T3MF 2DQDH 1WWAX 4ZOEA 2R2BA 1JVKA 4R97B 3PL6A 1VKXB 3UJJL 5FO7A 1ZANL 3EO0B 1WQVT 3V7AE 2WNGA 4NKMB 3ZDZE 3ULUC 3B9EA 4OCSL 3SQBA 5EOQL 4DOHB 4HS6B 5FGCB 5I2IA 3MUGB 3VRJB 2FHFA 4ODHL 4OTXL 4X9IA 1P9MA 2NY1B 4UTAL 1IT9L 5IHZB 4Y5XA 4WGWB 5EBGA 1NFDB 1UM5H 5L2JB 3CFDA 1CDHA 3F7VB 5L6YH 2CR3A 2VDLL 2YPLD 5D7IB 3V5KA 4NHUB 1U8LA 3MV9D 3BT2L 4G9FE 4IOIB 2OS7A 3RI5K 5D2LA 3U0PA 1YNLH 4U1IA 5CD5C 5C0FA 3WFDH 1JHKL 1GGCH 3U4EA 1EO8L 1IGIL 5AZ2L 1B0GA 5D7JD 5C0BB 3WMSA 2FO4A 4EVNA 5M7QA 1CIDA 3VRLE 3QNXB 1INQB 4ZTOH 3GBNL 2P7TB 2R1XB 4XVTH 3F6LA 3UCRA 1A9EA 3F12A 1OF2B 4ODSL 5D7KD 1IE5A 4LQFL 1UH2A 4EN3A 4ZSOE 3G6AB 3EOYG 5H37H 2ZUUA 5ENWB 3VWJC 4H26B 1W0WB 4Y19A 2AAVA 2VOTA 2OTWB 3BQUD 4JFYB 1RIUL 5GRXG 5HHPB 2YPLB 1GAFL 4OZHA 3OR6A 1ERNA 3MV9B 4ALAL 1T83A 1P7QA 4OZ4A 4D2NA 3T8XA 1NANH 1K8IA 1B9ZA 1DZBA 4P2CG 5ADPH 2BVEA 4ZPTB 1MFCH 3DMMC 4R8WL 4Z7QE 1C12B 3FFCA 1FZMB 2B8OT 2BDNL 5ALBL 1EJOH 5D7JB 4GOSA 3KYKL 2GHWB 3P4MB 2XG5A 1Y0LA 4I2XE 4LPUA 1TNMA 2EYTB 5I71B 2C1OB 4WVRA 3F7YA 2RR3A 1EUUA 4TSCL 3PWPA 2VLRD 4YUEH 5I75C 2P5WD 1NUNB 2CQVA 5CEZE 1UA6L 3WS3B 3HPLA 3FOMA 4Y8AA 5KS9F 2ERJC 3EYQD 4MQ7A 4X8JA 2YOCA 4ZFGH 2NNAA 4JE4B 4LSTL 3BP4B 4IMLB 3BQUB 1UM5L 3MV01 3PGDA 4J3TA 1JHTB 5L6YL 3JWNC 3RHWK 1DQJB 4GW4B 4JFDD 4NFBA 3CXHJ 2XTLA 3DI2B 4QGYA 2Q86A 4AY0A 4LASL 2CUIA 2XPGA 2EYRB 2R9HC 1XCQB 4HV8A 1GGCL 3ROOB 4JO3L 3DRQA 5F1NB 3U9PL 4K71B 4AEHH 2QR0B 1N4XL 4NQXA 3FT2B 4QXWA 2KH2B 3LD8C 3X3FH 4ZTOL 4LLUB 4QXGH 1F4YH 3H9SE 3KPSE 3VXRE 4ZTPH 1DBBH 2BNQD 1DR9A 2NTSP 4GFTB 4TNWK 5EZOH 3SGKA 4KK6D 2VLRB 3B9DA 2P5WB 4MXWH 2IH1B 4YBHA 1YY9D 1INEH 3QUYC 3VE0A 2Y5TB 2MHAB 2CIIA 4EUPH 4JKMA 2XKNA 5EU6D 5J4MA 2DLHA 2GY7B 1PLGH 3IETA 3SJVA 5C2UB 3R4DA 1HSBB 3MNVA 3NPSB 3BN3B 4JFDB 3AB0C 4UT9H 1JE6A 3W39A 5C6WH 2NY6C 4XPGL 5EU3A 4X80H 4BQ6A 2EE2A 4OBRA 3U2SB 1MFCL 2GSGA 4HLJA 2Z0BA 1Q0XL 2B5IC 4JJ5B 4NQSA 4EI5D 1EJOL 2ESVD 4FQCH 3GMRA 3WL9A 1AIFA 1MHCB 4NNPH 3ULVD 1X4YA 1PEWA 2HFFA 3IU3A 4OZIF 1G7QA 3EDJA 4NQDD 3BRGC 1U58A 1JK8B 4OBSA 2BNQB 1JJUA 2EXYD 4JN2A 4Z8FH 5C0CA 2ED8A 2R69H 2H8PB 3MFFA 4L9LA 1BIHA 1JRHH 3BKML 2X5PA 4L8SC 1QFWI 2OJEB 1UWEL 5LAXB 5C9JA 4JRWA 3E6HB 5DWUL 1GGYA 4KJYA 4ZFGL 4LSSH 2XY1A 4XXCC 5EU6B 4EZMA 4WI2A 4WDIA 2PYEA 3KHQA 5IQ9A 2OQJB 1CD0A 5IOPB 5D4QA 2R23B 5D96C 3V5DB 2YHGA 4OLYH 4WUUD 1S9VB 3DSFH 1YA5A 3HC3H 5BO1H 3WO3B 5C07E 1OL0A 3DUUB 3GMNA 3T77B 4UOW1 1IARB 3O4LA 5FGCE 2UWEB 2EIZA 4C83A 4EI5B 2MOVA 5CP7B 2ESVB 1KJ2A 1AXIB 1OARH 2IC2A 2GK0A 1ZHNB 3NTCH 2VIRA 4QXGL 4ZTPL 4NQDB 1JFQL 1R3IH 4YGVB 5EZOL 1MCHA 4HJ0D 4FQXC 4Y16D 1D9KA 5D7LD 4XBEL 1LO4L 2GITA 1RJZB 2QSTA 4MXWL 5I1JH 3QIBC 4Q2ZB 4FQJL 3LMJH 1INEL 2VDRH 5E8NB 1A1OB 2VXUL 1R0AH 5TQ0H 3TPKA 1PLGL 5F3HA 2EKSA 2Z4QB 1AY1H 4CBPA 3BRFA 2HH0H 2E7LA 1FJ1B 2DYPD 4UT9L 3GRWL 4LARH 1R6VA 2YA0A 4H88H 4WUUB 5TH2B 4X80L 3MYJA 4L3CB 3QI9A 2YZ8A 1DJSA 2HLFC 1TZGH 2IBGA 2DB8A 4MS8C 4IBLT 2HT2D 1OTTC 3BPNC 4XCYA 4C56E 5C0EA 1KNOB 4QHLA 3IDNB 4NM4H 4FQCL 3ARRA 2AXHA 1FQ9C 5E6IA 1PGRB 5F7UA 4NNPL 4CU7A 1FCCA 3L3KB 5GIRA 3L5XH 3VFNB 1EEYB 4PJGF 4Z8FL 2MSPA 1E4JA 4N1CA 3V9FA 5JMOC 4Y16B 5D7LB 5IV2B 2R69L 1JRHL 2HFEB 2D9QB 3S34H 4CADA 1EGJH 2VKXA 1A2YA 4OUUB 1FNGA 4L29A 5DRZA 5GGSA 4NKQB 4ZXBC 1MLBA 1U8KB 2V6HA 3M8OH 3UJTH 4ZO6A 1J86A 2PNDA 2WK2A 5IM7A 4FQLH 3IF1A 5JXEC 4Z7OE 2DYPB 4P5TD 5E2WH 5EPMB 4OLYL 3DSFL 3HC3L 4JEGB 2HYMA 1J7VR 1LNUA 3EJYC 5HGHA 3ARDA 1G0YR 4NT6A 3HCVB 7FABL 4Y2OA 1NMCC 4O4YL 4A2MA 4CJ0A 3MV11 4XXDB 1OARL 4PRPA 3ROLA 4PR5A 2FL5B 3TT1H 3BJ91 2DN7A 2W9LA 3BO8B 5AYQA 2HKFH 3QNYA 2HP4A 5C2BL 4I18A 4R3SA 3ULUL 5GRJH 1YZZA 2VL5B 1DN0B 2WINB 4L8DA 4V1DA 3MJGX 1A8JH 3WV0A 1W8NA 3KYMB 3TCXA 3P77B 3QP3A 4MGXA 5IF0B 1P4LA 3VJ6B 5I1LA 1Y18A 2J8UB 1XF4A 3GKWH 1L6ZA 4X9BA 3DHJA 4LGSB 1R0AL 3HG1A 3O0RH 5TQ0L 4AG4L 1MCSA 5SX4H 2YD1A 4L1HA 1BZ9B 1U3JA 4HDIB 2HH0L 4RGMB 1IAKA 2J5LB 1NSNH 5DD1H 4P5TB 1BOYA 1VERA 2WP3T 4KPHH 3PWNA 4H88L 4J6RH 2ITDA 5EG6C 3TYFA 1CQKA 4KROC 1MRFL 1UQSA 5HHNB 2BNRD 3GJEA 3EGSA 4MMZC 3SO3C 5ETUA 1PD6A 3NZHL 5JPNB 4X6CA 4F15C 4P23D 5T5NF 1UKTA 3REVB 4GG8B 5KAQF 5EU4A 1SY6A 2G60L 1L6XA 5J6GA 4JQXC 5ID1B 4P5MB 3S34L 3WLWD 3GSRA 2W60B 2HLAB 4K23H 3HTLX 4ZUVB 1ADQA 3H42H 5E00B 3MLRL 4RAVB 2AP2A 3LN5A 3M8OL 5L8JB 4U1SB 4R7NB 4BK5A 4L4TA 1R5IB 3UO1L 1D6EB 4OD1H 5C09E 5IB1B 5HYJD 5FYKE 3CIQA 5DHXB 2NYYD 3UPRB 2X2YA 1BMGA 2ICEB 3H0TB 2BNRB 2LVEA 2I07A 1S9WA 4XHJD 3VFTB 2R0ZH 5JOFA 4XNMB 4YWGL 3GMQB 4LF3A 1S5IH 3EJJX 5LXGH 2HKFL 2C7UA 4P23B 3HZVB 2YUWA 1KG0A 2X4RB 5GRJL 3D0LA 4CNIB 4K7PY 1DVFC 3ZMRA 4TOYH 2YUZA 5EWIH 5AAMA 1UACH 1V5JA 1J8HA 1HHHB 3NGBB 2HTKC 3ARGA 1NKRA 2Y72A 1WAAA 3P11H 3JTSA 1S7XB 3U48A 4XI5D 1RIHH 4MNHB 3GKWL 5F9AC 5DK3A 5E2JA 4DCQA 1SJHB 3O0RL 1LK3H 2ZOKB 1J1OL 2O26U 3SDDA 1UWXH 4KI5E 2HJFB 1NSNL 4L1DA 3ECBA 4D9RD 5DD1L 3BW9A 1B88A 4J6RL 3TN0A 1I85A 2QL1A 2VLKE 2XTJE 4PJ7A 4I77L 1CXFA 5HYJB 2BJMH 2A6JB 3DX7A 4PTTB 3SGDI 4ZD3H 1JYVA 1A7QL 4WW1A 1RFDL 2PCPA 3QQ4B 4JFEE 4ZS7H 2LAGB 4XCNA 3GI8H 5BV7B 5BW7A 1AJ7L 3DV6A 3MPCA 4PTUA 1D7FA 4OJFL 4PJFB 1RD6A 4WW2B 4K23L 5MEPB 3KWWA 3H42L 4IRSA 2BP3A 4P2QD 1G6RB 3QFJD 5CEYA 4JDVA 1F90H 2VN7A 4WU5B 3V0AC 1WTLA 3PP4L 3QPXH 3DYPA 4HWBA 3FB7B 3NFNB 1LEKB 3PP3K 5F8QC 3EYOA 3U4BH 2BXYA 4Z7NF 2DQFA 1QSEA 2R0ZL 5IW1B 3A6CH 5CWSA 3IJHB 2M26A 5D8JL 2Z92B 3ARWA 5DFWH 5LXGL 5JDJA 5A3IC 2X4PA 3QR2A 1VA9A 2XG4A 2AV1A 1S7SB 2E9BA 1ITCA 2O5YH 5EWIL 4PJXE 3KNBB 1UACL 3HB3D 2WZPD 3P11L 4S2SA 1CFTA 4M48L 5KVDL 4P5KB 5F7KC 4X83A 3D25A 4G8GA 5FYLD 4P2QB 3P30H 3QFJB 4EEEA 1LK3L 1NEZG 2F5BH 1H8OA 3QDJA 4J4PD 3VH8B 4WHDA 4B0MM 1MI5E 1Q94A 4XBPA 1TFHA 4ETQA 3AU1B 4U1MB 5JHDD 1I1YB 3KPQA 3U0WL 2AJZB 4ZD3L 1CL7L 2D0GA 2YD8A 3NCYP 2OL3A 5EU7C 3LB6C 4OZFG 2V2TB 1N59A 4JG1H 5GSVA 3UYPA 3BEVA 4PJ5E 4M1CD 5GGVY 4ZS7L 4Z7WF 1NDGB 3WIFB 4DKAA 5B39B 4NQEA 2WANA 2EZ0C 4ZFOB 5CJ5A 3GI8L 5ESQA 1KEGL 3QQ3B 1HHIB 5HY9B 1I8LC 3QCUL 3ULUF 1PKQE 4GKSB 1YEKL 2ATPA 3O9WC 4JREB 1CBVL 1V05A 2PR4L 2IMNA 1BBDH 1ZMYA 4X0KB 1AGDA 5F72S 1MAMH 3BZEA 4PJDE 4PJHA 4LLVA 1WC7A 1TPXB 3VWKA 3I2CH 5F6IC 5EO9B 1ZLSL 3HPJA 3HAEG 5ERWB 4P57A 1OVZA 2DIBA 4PJIB 1NC4D 5A43C 1FG9C 4NO0D 5JHDB 4XB7A 5B38G 3MV8D 1U8IA 2EEBA 4AQ1B 1I1AA 1OAQH 1W72A 3QQ9C 3CNKA 1FNLA 5EIIB 4X4XB 1CFSB 3CAFA 4MVBD 3QEQD 2C5DC 1J0ZA 3U7WH 2VITA 4BH7B 2VZTA 1NL0H 2CIKB 5J1TC 3QIUD 3VDCA 1ORQB 2O5YL 1SQ2N 1RAMA 4PJCF 4U1HA 1NEZA 2A0LD 5I8CA 2NY4D 5ID0A 4YPJA 1X4ZA 3RWDB 1EEUA 3UPAA 4F2MA 3P30L 2F5BL 3GSNB 1S7RB 4M4PA 2QQKL 4JFQA 4K55A 4OKDA 4OZFA 1RUAL 5IBLD 1NC4B 1B4RA 4LKCB 4NO0B 3S9DB 4BZ1H 4NN7B 3V0VB 3MV8B 3NVQA 4G9FA 4YXHH 1MPAH 4MJIB 2FX9L 8FABA 5E4IA 4QXTB 4CRPA 4LDEB 1F6AA 5HHVH 4FA8A 4KMTL 3LQZA 5K93A 3TBVB 3EDEA 2V9RA 2H2PC 1R24A 2Z93A 3BPOC 5F97E 3QXAA 1K4CA 1MCWW 3QEQB 4UINL 3QO1A 3SE3C 2NY0C 4NPYA 3B6SB 1P2CA 3T0WA 3WFBL 3ISWA 3QIUB 4OCXH 5KSVA 1FFPB 5CJQH 3EW3B 5I1IH 3D85D 3GSWA 3LEXB 3TIDB 3O2VH 4UIMB 1EFXA 4QEGA 4OV5A 2J6EH 4ZO9A 1KB5B 2ED7A 3CX5J 2NY4B 1A6WH 2V5TA 3ARXA 5IHUL 3QUXA 4M7ZC 1BBDL 3HAEA 1MAML 1XGQB 5DK0A 1PZ5A 4N8VB 4Z6AT 1ED3B 4ZSOA 1ND0A 1N2RB 1X9QA 3I2CL 5DC9B 1P4BH 2Z91B 3D69A 3HN3A 1WBZB 1OB1A 1JPSL 4P46A 4P4RB 5L0QB 3GM8A 3X12B 2ZZUT 4JPVH 4EQ2A 2ADIA 1FL5B 3HR5A 4PJFE 1WZ1H 1LK2A 3WEXB 5SV3A 2NTFB 1UB5B 3CDYA 2BHUA 5CFHA 1OAQL 5M94B 1UC6A 2DKUA 2I27N 2XZCH 3SGEH 3KYOA 5DI8B 1I3RA 4HC1A 5E5MA 4NSKB 4M7JH 4YXLH 3BZ4B 4DVRH 5MEQB 1IM3A 1Q72H 3CSYA 1JUFB 1FNEB 4JFPB 3HS0A 4ODWA 2MTPA 3D85B 1PAMA 2A1WH 4I2XA 3O3BB 4KK9C 4JZJB 4APQD 3AS2A 5IB3B 1ZA6B 2YMXH 3P3YA 3OJVC 1QRND 3TF7C 3Q5OA 4PREA 4QRPD 3AM8C 1EDQA 3PP3H 4GBXA 4ZODA 3UP1A 3DUSA 2CDEA 5K9KB 5E8OB 1T1YA 5EUOF 1GGIH 1JI1A 4BZ1L 4I5BA 2C4XA 4CVZB 3RWEA 2APXA 1RK0A 4YHYC 4DGYH 1MPAL 4QYOA 3ZKSD 4GJTB 2NW3A 4R4FH 1QA9A 3L3HA 5J89A 3MLSH 4F7TA 4LOUC 3MMEB 3DVGB 4XRCA 3GBLA 2XA8H 3FTGA 1U8NB 1FNHA 4J12A 2Q8AH 2J4WL 1GC1C 4KY1H 4X6EB 5AAWA 4OCXL 4OCRH 3N1GC 4XWGH 3U7AA 2BOCB 3A0OA 3O2VL 1SBSH 3CXHK 3H9SA 3KPSA 3VXRA 1E4XH 4Y4HC 2HTLC 1AO7D 4APQB 1A6WL 1XF2A 3KPMB 5JHLH 4NKDB 5T1LA 4EDXA 2VDQH 4AMKH 2JCCF 1FZKA 1H5BB 3UAJC 4QRPB 4RFOH 3L5HA 2YSSB 4P2RE 1IL1A 4Y4FA 2YBRB 4L9DA 1MH5A 4P2OC 5T3ZL 3UROR 3MGTB 4PJAF 4BFEA 3R1GH 1T0NA 3C2AL 4OZIB 3T0EA 1FYTE 2NY2C 2DLTA 4RAUB 1TQBC 4JPVL 4BUHA 3KPLB 1CZ8H 3WNNA 1G7PA 1RZIA 2Z35A 4N0YH 2BVOA 2D3VA 2VXTL 1WZ1L 4JY4A 3I6LD 4R4NC 5I76A 2XZCL 3RGHA 2CK0H 4KHXH 3T3ME 2X4UA 1NFKA 4YXLL 1J10A 3MFGB 4DVRL 5DHVH 1Q72L 1K2DA 4U1GB 3QO0A 1FL6A 2H3NA 3CCHB 3HZYA 1J5OL 2R2HB 4JCLA 4HKZB 1N64L 4IRZL 1AO7B 2PW1A 5J9PB 3F65A 3DO7B 4M7KH 1XR9B 1P53A 4RCAA 3GMLB 4X6FA 1H3WM 1Q0YH 3VMOA 2HT3C 3CFKB 4HKXA 5FHBH 3WXVH 4C57C 2AJUL 2YD5A 3LKRA 4HPYH 4N0UE 1UXWB 3O4OB 1KGCE 3UTZA 2I9LA 1KIRB 2BCKA 3PHOB 2P42B 1VKXA 3BHBA 5TGBB 2NPLX 3NIGF 4RNRA 4DGYL 1MCNA 4R4FL 4GS7B 1I9IH 2WAHA 4WTWA 1MHPH 5C07A 5ACLA 1WISA 1U3ZA 3WIHL 1MJJA 4ERSH 1R3LB 5HD8D 3F58H 2DWEB 2XA8L 2E9IA 1KJ2H 4XNZB 5F93C 4QOKE 1IGMH 2E3VA 2VR9A 4OCRL 4XWGL 4NDMB 1NUGA 3B8YA 4FFVD 3AXLA 5JXAL 3TVMD 3RVTC 3ZKXC 4Z76B 2V17L 1E4XL 3J8F7 4NHUA 1OT1A 4WI9A 3SHSA 4FNLH 4MJIE 5GRWA 2GUOA 5F7WC 4RFOL 3HMXH 3WDIA 2QJDA 3STLA 4M3JA 9CGTA 4GQ9H 1OCWH 3R1GL 5A2JH 3CC5B 3VFRB 1MY5A 4PJGB 3QNXA 5FGBC 1CZ8L 4N0YL 5IJKA 1MWAB 1IEAA 4WFED 2P7TA 3MBXH 4XPAL 5DJ8A 2CDGA 4HFUH 4TUKH 4AK1A 4HUUA 2Q7YB 4FG6D 4KHXL 3D3VD 3G6AA 2VC2H 3ORJA 4C56A 1MCIA 5I1AB 4O2CB 3VXUD 3ZT7A 2Z31C 5IBTH 1HYSD 2BC4B 2RGSA 4G8EB 3GI9H 1RHHB 3R06A 3QJFB 1U8OA 1SEBB 3LDBB 3TVMB 1MCPH 1QBBA 1G7LA 1AR1D 1F8TH 4WI5A 3MBEA 4M7KL 4ZPTA 2PUQT 3HC0B 4UT7L 5KS9E 1Q0YL 1WEJH 4IEFB 1KTKE 1HXYB 4H20L 5FHBL 3WXVL 1C12A 4HPYL 1M7DB 3RNKB 4YHPB 3FL7A 4HIIA 4S1SH 4M6ML 3P4MA 3P9LB 4Y7MA 2VTFA 5HI4C 2F58H 1TXKA 4P4KC 3NH7H 2EYTA 4MJ6B 1NAML 1I9IL 2EDNA 3TH3T 3DROA 3VGFA 5C92A 1MHPL 5ESVB 5CBEB 1KJVB 6FABL 2VDMH 2HKHH 3DYOA 3P0VH 4NN5C 3F58L 2IQ9H 1X7QA 1N3NB 1T21B 3D3VB 1PW3A 3PDOB 4LRIC 3VXUB 2FECL 1IGML 2X1WL 5HGBB 1UVQA 5D2NE 4DGIH 3BP4A 5BZWB 5F7EH 4YHOH 2BVQA 3PWJA 3LH2H 4PRDA 3SKJH 3GGWB 1Z3GL 3HMXL 3MRRB 5IMKB 3L3OB 4OI7A 2OR7A 1XCQA 4FP8H 5JORA 1GPOH 4JPIA 1M4KA 4GQ9L 5CJBA 1RK1B 1QFWM 2WIMA 4RFNC 2DKSA 3U79A 3WN5C 2BVPA 4BSVA 1DQML 3IYLW 1FAKT 4HWNA 1KLUB 2H26A 2ZCKL 3MJ9A 2OM5A 3U46A 3M1BB 1NC2D 5HVWA 1WICA 1AGEA 4J23A 5BXFA 2VLRA 1GC1H 3W0WD 2IH1A 5LG1A 4GMSH 4YDJB 4CMHB 4KH2A 3B3IB 1G7MA 5IBTL 2YPKA 2VJXA 3GI9L 4JGMA 5FK9A 2VABB 5C0NC 1S5HB 5IG7B 1YN6A 5DQJB 1A1MB 3I02A 3P0YH 3TYGL 3BPLC 3CZJA 1XZ0A 4U1KB 3RDTC 3HI5H 3HMWL 5FCUL 3MXVL 2EXWD 4GXUM 4Z78A 5JTWA 4WRLA 4NHCH 4BQBA 4PGJA 3VGAB 2L4OA 1J05A 1G7IB 2DQGL 5I0DA 3W9DB 3MA7B 1BECA 1WEJL 4PJEF 5CP3H 2IF7A 1T6WA 5KSBF 4DVBA 1UB6A 1AD0B 1TQCB 2F9BT 4XPBH 1WFTA 4L8BB 4PP1D 1FAIL 1ZVSA 4S1SL 3S35H 4KZDL 2PYFB 2F58L 1QLFA 1TETH 4H25B 3AREA 3JBG7 5C3TA 5ACZB 3W11D 5C09A 3NH7L 5FUCC 2BNQA 5F8RC 1AO7E 4LSQH 2B0SH 1NC2B 3TPUB 1XGPB 1RV6X 3ZE1F 2VDML 1P7KA 2HKHL 1C5BH 4FTVD 1FVEB 2GTWB 3QYCA 3UBXB 3P0VL 4LCYB 3BH8B 1EZVX 4MQSB 3W0WB 3RZWA 2H32A 2IQ9L 5GRVK 3MV7D 5MERA 2X9XA 4A6YA 3HRPA 4R96A 4RISH 1MY7A 1OWWA 5K9QI 4DGIL 1JV5A 3SKMB 3DETD 2VYRE 3PHQB 1IRAY 4H8WH 4WFHE 4KRMB 4XH2B 1CFQB 3QB7C 4LCCB 3T0VA 1MELA 4HF5H 2VAJA 3LH2L 2ARWA 1QO3B 2AK1H 4KKAD 5INCA 1VACB 1S9VA 3BMVA 3KGRA 3PABB 3DPBA 1MFDH 3QHZH 5FOJA 4R0LB 1EHLL 4UU9A 4DFIA 3JV5A 1GPOL 2H6PB 1A9BB 1J9CT 4QRSB 5ILTL 4Z5RB 4RA0C 4ZFFA 2ESVA 5IFAH 3LKOA 4PLJC 3OKEA 3EO1A 1GHFL 4UV4H 5IR1A 4X6DE 1T20A 2QSCL 4N0FB 5DQDH 1NGZB 2CPCA 4JVPA 5CINH 4YGVA 5IFJB 2MPAH 1JZ5A 1I7TB 2VLKA 5I73C 2QLVB 1QR1B 5DJXB 1NANI 4FTVB 1GC1L 1BVKB 1YMME 3RVVD 4KRPC 4QRQB 4AQOA 4QXUH 3MV7B 3IDGB 4KKLC 4JFEA 3KS0H 3GSOA 1LMKA 3C5JB 3UTPE 4OFVA 3S36X 3GM0A 5ECJE 2XKUA 3KJ4C 4PRBA 2LV4A 2IFGA 4M93B 4I3RH 3P0YL 4MXQD 4F37K 1CU4H 1U92A 1F4WH 2EDJA 5KBNC 1FJ1A 1HIMH 3HI5L 2GFBA 1F6FB 2I24N 4NJAL 4XCFH 2P4AB 2PXYD 4WUUA 3FT4B 1TVHB 5F70A 3QXUA 1T2XA 5DMGC 3CU1A 4UBDD 3IDJA 1KNOA 4XPBL 3UZVB 2VLMD 4X7TB 3S35L 4S0TD 1TTGA 1TETL 1CTNA 1ZTXH 3ULUD 4ZPVA 2HMIC 1EEYA 3MLTB 4LSQL 1IVLA 2FHCA 1S8DB 5MI0B 1OP9A 1C5BL 1GL4B 1BFSA 3EHBC 1XGRB 4PGDA 15C8H 4TVPD 1HQ4A 1B6DA 1QSVA 3OHXB 5K9OA 2HG5A 3QXWA 1RMFH 1CVSC 5DJDB 1XGTB 3VCLB 2D4FA 3BI9X 5EOCH 1DLHB 2JB5H 3EOTH 2O5ZH 3C5ZC 1NPUA 2P8PA 1CGYA 1TCRA 4PJXA 2X1PA 3HUJE 2AI0L 1JF1B 2PXYB 3L5IA 3QHZL 4F9LC 4KK8D 1KLGA 3RWGA 4Z7WB 1OLZA 5FF6A 1CGSL 3RGVC 4M1GH 4IMKA 4LDLB 5IFAL 2AEWA 4XXDA 1G9NH 4YO0A 1R3JB 4NRXA 5H2BA 4ZYKB 1JF5A 1KXTB 3MRKA 1A47A 2ICES 3C8KB 4JY5L 3RWJA 1F5WA 4JFHD 1C7SA 4DN3H 4F7EB 1MI5A 5CINL 4BH8A 3NPZB 2MPAL 2IAMC 2F74B 1IGJB 4ODVL 4HKJB 5I1KH 2OL3H 1N7MH 3X13A 3H7BA 3VWJD 3ZE2E 4QHMA 1XIWC 4PJ5A 5FM5O 3QWOA 1FCGA 1R3KB 2XWTA 3AS1A 4PUBH 3RPKA 3TBTA 4OCNC 5T1KD 4RMSA 2A6KB 1IILE 4NUGH 5KSUA 1HHKA 4GAYA 1J0HA 4I3RL 1CU4L 3KDMA 1F4WL 4HD9A 1IAMA 2W65B 2VH5H 4MAYC 3HNTH 2R0LH 4N90E 3T0AA 2V5MA 2G75B 4XCFL 5FDWA 1KCSH 2R8SH 1BQSA 1PKQA 2VWEE 4Q58C 4OM1H 5HHNA 3U0TB 4Y4KA 3LQAC 1PYWB 1Z6JT 3RIAK 1NFIB 5I8OH 3AY4C 4PJDA 5C1MB 4LP4A 1AFVH 3KPPA 1CGXA 1T0MA 2WV3A 1ZTXL 4HBCH 4NYLB 4GG8A 2X4SB 1K4DB 4K7PH 3VD3A 3CLFH 2BXZA 3MRPA 1H3UA 1JI2A 1KELH 1ZLWK 3VWJB 15C8L 1KIUA 4HW6A 2UV3A 3JWDC 1RMFL 4OF0A 3RVWC 5E00A 4RAVA 2DQHL 1VFAB 2X44D 5T1KB 2I5YL 4OAWA 5EOCL 4R7NA 4I13B 3EOTL 2O5ZL 5I1GH 2F54E 5IWLA 1D6EA 2R9HD 2NY1C 1IGCH 5IHLB 1U41A 2FJGB 5GS1A 2AEPL 4ZUSA 1L7IL 1CXEA 1NDMA 3V6OC 2FGWH 2BNRA 3FO9B 4M1GL 1IBGL 1BFVL 2BVYA 2HN7B 5F7MC 5HVFB 1P4IH 3P9WB 3ARQA 4POZC 4RZCA 4H1LB 4S1DC 4F7CB 1YC7A 4DN3L 2NQCA 4PRNB 3GK8H 5LQBH 3BDYH 4MZ2A 1C5DB 4W68A 1N7ML 1UJ3C 1HHHA 3L7FA 2ZUQB 1A3LH 4LFHD 3BEWA 4Y8DC 1HOCB 1J1PH 3BIBX 4I48A 3G6DH 4WHYH 2EDTA 5E94A 1AQKL 5EFIB 4Y1AE 1KOAA 5I1HH 1XF5A 4FFZH 3TT3H 1G1CA 4P3CH 4JHWH 3LS4H 2ZOKA 1CE6A 1OQOA 2BNUA 2AJVH 3O6FD 1IAOA 2VH5L 4PB9L 2A38A 1WFNA 3HNTL 2R0LL 3LKQA 5SWSE 3RUGE 1G7JA 4LLDB 5JOPE 3GIVB 1NAKH 2R8SL 4HG4J 3S3SA 3TH2T 4PTTA 5KSAA 2ARJB 3MJ8B 2KDGA 4H5SB 3RIFF 3MOBH 3GO1H 1T5WB 5IVOA 3MRFB 4JFOB 2IH3A 1AFVL 1UM4H 2CH8A 2Q7NA 1KJ3H 3BGAA 3OKNA 4OZGE 3FO2A 3VFSA 2VDPH 4J3VA 1A7PL 3IAPA 4K7PL 4Z7NE 1RVFH 3CLFL 2ZPKH 3RNQB 2AXFB 2EO1A 4TRPH 1X3DA 3OAZK 1ZHLB 1CQYA 3OX8A 3CX5K 3V4UL 1QFOA 2NR6D 4PJFA 5E7BA 2XT1B 3L3GA 4ISVB 5E9DD 3SO5A 3PL6C 1G6RA 1HI6A 3DX9A 4HLZG 5DRXB 1N0LA 3AB0B 4I0PA 4LCUA 4DTGL 4BUGA 4D9QE 1LP9B 3MOAL 1KN4H 3O6FB 5I1GL 2ICWB 1G7HA 2B5IB 2XN9E 3GHBH 4K94C 3BQUC 3T08A 4AEFA 2KKQA 1MCJA 4X99A 5E08L 3VI3F 4JM2A 3CVHB 4U4BA 5JNYB 3MO1B 1P9MC 1SMOA 1WIPA 4KK5C 3UYRH 3O3EB 5D72L 5J8OA 4MDJA 3VXOB 5D6DC 1N5YH 5GGVH 1CXLA 1P4IL 1U8PA 2Z92A 2GAZB 1RZ8A 1T7VA 4BSWB 1MCBA 1ZS8B 5SX4I 5LQBL 4LLYA 4NCC1 3BDYL 3QIBD 1OP3K 5DVLA 1E27B 3BVNB 4U1JB 1I9JH 3GSXB 4Z7UB 2ZP0T 4JG0H 2JCCB 5J06A 1J1PL 1ORSB 3G6DL 5IMLA 2V2WB 4KKNA 2V7NB 4P3DB 5E9DB 4FFZL 3TT3L 1MIEL 4IDLA 1HYRC 3LS4L 3KPOA 1ZHBA 2AJVL 4YE4H 1NH6A 1BLNB 5GGUA 5E95B 4Q6YA 2DQTH 4O2FA 4ZFZA 2ID5A 1NAKL 1QR4A 3X14A 3AU1A 3RWIB 2FB4L 3KPRE 4LBEA 4AT6A 4X5WB 2ZG1A 4GUPA 3T3PF 2NZIA 5GS3A 2K7QA 1KPUA 1ONQB 3C5SB 5IQ7H 4YFLI 4GRWH 3GO1L 2VAAB 3G5XB 4Q6IA 3E3QC 4HK3J 3FQWA 3MLWL 2QV2A 2R39A 4P2RA 4K3HA 2AJYH 2AGJH 4OF5A 1FZOB 1HQRA 3QQ3A 3AC0A 2VDPL 4R2GD 4EIGB 1RVFL 5F6HI 3QIBB 2ZPKL 4I3GA 4LPXA 4TRPL 2FZ3B 3G04B 2EDQA 5TDNA 2XIDA 4G8FA 4JZOB 4XPFH 3CLEL 4LDOB 5ISZE 1YEEH 2YRLA 1WCBB 5F88A 5F9JA 5J1SC 3DHMA 5EO9A 3FQNA 1AGCB 1KT2A 1FV1B 1KN4L 5C8JB 5JLZB 4OFYD 3N1QC 4ONHA 4JAMB 4PJCE 5F89B 4JDZB 1KIPA 3DGCR 3BUYB 5F21B 3T65B 3BPNB 4IJ3B 1CR9H 3ARBC 3S37H 1EAPB 1N5YL 5GGVL 3FHQA 5KN5B 2WSKA 4GW5A 3FB5A 3BFOA 1ZLWH 3QEHB 4MNGE 4QHUB 3MR9B 2PW2A 5GQBA 1FFOA 4N0UA 3SCMD 4G3YH 3QCVH 4EI5C 4R2GB 5B4MD 3VXTA 1ORQA 4NC1E 5LVEA 2DWDA 4NQCD 4Z0BH 5HHMD 2Q3ZA 3ULVC 4OCLC 1VGKB 3DTXB 5D1ZC 1QD0A 5HYIA 4TUJB 4JVWA 5DMYA 4LNRA 1IZKA 1CDUA 5ICZB 1YDPB 4HUWB 4JO2L 3EYSH 3FMGL 4NZUL 4LLMB 4UTBH 4RGND 3NACH 4XP9H 5E03A 2DQTL 3SGKC 4QOKA 5FO9B 1UEMA 2OMBA 4KROD 1BQUA 1HK6A 1NC4A 4OKVB 5TFSH 3V0VA 4JN1L 4YDVB 4QRRD 3QUMA 2H9GB 2EDEA 2IBBA 4MJIA 4OCWH 5JW5B 2NLJA 2X4OA 5IQ7L 1NLBH 3I6KA 1WV7T 3SGJC 1A14H 5DDHB 2RAMA 2WBJC 2X4TB 2AJYL 3D18A 3B6SA 3SCMB 1IGFL 2AV7A 3S37X 2CKBB 4IS6A 2WBKA 1D5XB 3PQYD 2EC8A 4NQCB 3NCEB 3QULB 5HHMB 5DMIH 4R6UA 1JGEB 4GRLA 1S78D 5IVNA 4FFWD 3VXSD 4HJ0C 4Y16C 4XPFL 4KVCL 1ED3A 2P5ED 1YEEL 2FO1A 3M45A 2Z91A 4Y2DA 4RGNB 5GZOC 2E6QA 3V6ZB 5A16B 4KROB 3MUJA 3ES6B 3LQAL 3PGCB 1EXUA 1HCVA 3U6RA 4P49A 4LU5H 1X6NA 2UYLB 12E8H 4NN6B 4HX1A 4QRRB 2EYSB 1CR9L 3TIEB 5T33L 1JWSB 1LDSA 2GEEA 5LJYH 3I6GA 5D1XA 2X4NA 5E8EB 4F15B 3O3DB 4PGBB 2XZQH 5KS9A 5IB4B 4BZ2L 1DVFD 4G7YH 4M6OL 1QBML 3A67H 3P73A 5EUOE 3DBXA 1P1ZB 2HTKD 3Q6GH 4G3YL 1A6TB 3QCVL 2HT2C 1FNEA 2MCG1 3PQYB 1I4FB 4AYFA 3JWDL 4LCWD 5JW3H 4MX7B 5C0IB 2CRIA 4BA8A 1U95A 3VXSB 2X7LA 1S3KL 4AH2B 2GW5A 3BN9C 3EYSL 4KXZH 5HGDA 5INDB 2P5EB 2BSED 2RHEA 3MGOA 5HBBA 3NACL 5T3ZD 4XP9L 5E24E 1D9KC 1PQZB 4BFIB 4X6BB 1WFUA 2DIAA 5D2NA 2AJXL 5TFSL 3MRGB 5DRWB 4CVZA 1IC5H 1EX0A 3V2AR 1QNZH 4OGXH 2WWMD 4RGMC 1Z5LB 4OCWL 1NLBL 4S10A 4P5TC 4MHHG 1MCWM 1T7XA 43CAA 4AIXA 2QSQA 4YNYA 4PJAE 1CE1H 1CDIA 1FO0A 2FJHB 4NKOB 1DVFB 5CSZB 1NCNA 1U8QA 5CLTA 2D7QA 3FB8B 4GAGH 3REWB 1IMHC 1N6QH 1YEIH 3CVIH 3S6CA 2A9MH 3L3IA 3N1MC 4XP6L 2GCYB 3MJ9H 3DSNA 1RZGB 4LCWB 4JKLA 4U2ZA 4KV5E 4NKDA 1BOGB 4PJEB 1H5BA 4FHBD 5KSBB 4P59L 5D9SA 3VFVB 1K3ZA 5AZEL 1UXSB 4F9PA 2EDXA 1T89A 2K7PA 5T1DH 4JGUA 1KCVH 4XAKD 3DOSA 3VG0H 2GQHA 4LU5L 12E8L 1RZJH 3D2UA 2J88H 5A3ID 2P43B 1EEZB 5D6CA 1BF8A 3V0WL 1S7QB 5HI5C 4K2UL 3OGOE 4MD0A 4G7YL 2I26N 4KMLB 4YX2L 4Y5YA 3LKSB 1HXMA 3EAKA 1OM3L 3I3DA 4KVNH 4W4NA 3ARDC 3FZUC 1RPQA 2R2HA 4M5ZH 3MJ6A 4P23C 1NUFA 5E56A 1XGUA 1AO7A 1HSAB 5ANMB 3O6MH 2A6IB 2LABA 4XAWH 4B7LA 5L8LB 5DUPH 4MDIA 1SVZA 3NGBC 4RWHA 3GMLA 1Q8MA 3G5VB 4HAFA 3T2QA 2W1NA 1U6AH 3C08L 4K94L 1KN2H 5EUKA 4M7LH 4YQXH 2CO7B 1C16A 5HDBE 5C0JA 4I9WE 3F5WB 1NJ9B 2W0FB 3LB6D 4KFZC 5L88L 3WFHA 1TCMA 1WLHA 4UQ2B 4BELD 3M17A 1IC5L 3LSOA 4WI8A 3VMNA 3BE1L 4ZOCA 1QNZL 4OGXL 1S9XB 5DA0B 5KW9L 4F80A 3FAWA 1I8KA 2CLZA 2G9HA 4HWZB 3IAQA 3TO4A 2EZ0D 3O8XD 2Q6WB 1A6AA 4MA3B 1II4E 1E28A 1LO2L 1CE1L 4Q9QH 2NYYC 4PRHD 5DC0A 5BS0D 4HWUA 1OAKH 2K3TA 3U7YL 4GAGL 4XHJC 2V9QA 3BZFB 4M6AA 3ULVH 1N6QL 1YEIL 3CVIL 4RRPG 1NBZB 2VXSH 4X6DA 4NCDA 3CFJB 3KHOA 1NGXB 4B53A 3ARSA 5AUMA 4E41E 2BSSA 1BD2D 5CJXA 1CICA 3C6LD 1MREH 3V52L 5KVGH 2CLRA 2D2OA 2EC9U 3LY6A 3UDWA 5TF1H 1YMMA 1LDPL 5JZ7D 2K9UA 2ITCB 1LD9A 1QPPA 4WW2C 5GRUH 2HRPH 3TNMA 2EDDA 3SGEI 1XH3A 5T1DL 3S3PA 1KCVL 4W4OA 3VFRA 3FQXA 2X4QA 1MHEB 3VG0L 2QBWA 4DQOH 3QQ9D 1FVDA 5EZJB 2Y36H 4DK6A 2J88L 5KAQG 3O8XB 1P5VA 2RCSH 3OAUH 5HXMA 4JKPH 5ESAB 4XB8A 1KENH 4GRWF 4UV7L 2GTZB 4PRHB 4PLNC 1YEGH 4NRZA 5DHVB 1BX2B 5BS0B 3RTQD 4BKLA 4JO4L 2VNCA 1RHHA 4M62H 4JB9H 4TTDC 3TBWB 4KVNL 1JBJA 5I6XB 1UCTA 1D5ZB 5H37G 4M5ZL 4DKEH 5FA3A 5J13C 4NNXB 4U3XA 2AABL 1J11A 1BD2B 3O6ML 3C6LB 2Q1EA 5DUPL 3OB0H 5K33A 4Z77A 3OKOB 3S5LB 4MA8H 4XNYH 1U6AL 1AHWA 3QJHA 4FQ2H 4M7LL 5FYJD 3KPNA 4YQXL 4NC0B 2Y7QA 4OLUL 1YPZE 1BJ1J 5SWZD 4AIZA 4YIQB 2W38A 5HHOE 5E2VL 4IRJD 1OQXA 2H2PD 3WSQH 3H9ZA 1E4XI 1NAMB 3K0WA 1CXIA 1AR2A 5ESVA 2NY0D 2ZSWA 3SDDC 4LHJB 5I8KL 4RRPA 4Q9QL 3MRIA 3G08B 2E7CA 2BSTB 4E0RA 3OR7A 1IQDA 2IBZY 3ARTA 3ULVL 2IAND 3RTQB 3UBXG 4HGKC 4PGCA 5MEOA 2VXSL 3SE4C 1I7ZB 3HNVH 3DGGA 5D2LE 1KBGL 5FFLA 1MREL 5KVGL 4KGJA 5EORL 4GKNA 3B2VH 5I30H 5AD0B 4XVSL 4WJ5A 4K3EL 2WBWB 4QRTB 3TO2A 4EDWH 3I3EA 5ICYA 3Q0HA 3IXTA 3H2WA 1Y6NR 4HH8A 4GMTH 1JZ7A 2W07A 5SWZB 3TA3D 4PG9A 1TPXC 4DWHA 1AE6H 4DQOL 1TTFA 3WO4B 4IRJB 4J4PC 1ZGLP 5DJ0A 2Y36L 4IHOB 5T3XH 2A6DA 3BPOB 4XWOC 3ZO0A 4CVXB 1SYSA 2ZNWA 4JKPL 2NY0B 2V2XA 1KENL 1C5CH 4UIKL 2AJSL 3BH9B 4Y19E 3QQNA 1YEGL 2DIJA 4ZAKD 1L0QA 5ITBL 3QDGE 4KK9D 2IANB 4M62L 5C0AD 4IIQB 4M8VA 2YEZB 1V8HA 4FABH 5DQJA 4DKEL 1G9EA 2LVCA 4HIHB 4WO4D 3VFUA 5MHSD 3ZE1E 3SDXB 4EUPG 4LCIH 4G43B 5IT2H 1A6UL 1U2HA 3JV4A 3NN8B 1YMHB 3S4SB 4RMTA 3ILPA 3MA7A 4MA8L 4XNYL 3CU7A 1QEWA 4FQ2L 3PXHA 2QQLH 5IKCB 4XP5L 4L8BA 1CS6A 4F7MB 2ENSA 4TSAH 1Z0MA 1JNHA 2FECI 3TA3B 4ELMB 5CHNA 3O11A 2F54A 2E7HA 5ACZA 5B8CA 4LOUD 4R26L 1KIQB 2XFXB 1DEDA 1XGPA 3TGXA 4HCRH 4NN7C 2GTWA 5ICXA 3UBXA 4LCYA 3FN3A 1I8IA 1D5MB 1OY3B 4NZDA 2ICCA 3LKNB 1MVUB 2WW8A 5EOTB 3EYVB 4ZAKB 1A5FH 4Y4HD 5DJAA 2KZWA 4XVUC 5C0AB 4RMQA 4LGRB 1GGBH 3QA3B 3HNVL 1BM3L 4QHNB 4XH2A 4EOWH 4LCCA 4WO4B 3C2SA 2L0DA 3B2VL 2NY5L 5I30L 3PABA 1PSKH 5TF0A 5IVZB 2CD0A 4GAJH 1HE7A 3IGAB 3WXWH 1A9BA 4LEOB 2XWJB 1A21A 3DX6A 1DQQB 3HI6H 4BSJA 3GBMH 2WWKT 4NQVB 2OK0H 1A6VH 1YEJH 2EDOA 3VFOB 3MLPA 1AE6L 3FFDA 4R4ND 1H3PL 3D39D 4L5FH 1F2QA 5SWSA 5T3XL 3RUGA 2LTQB 5EA0L 4WI4A 1I7TA 5L0QC 5IBLC 1SBBA 3ARFA 4S0SD 5FM4A 2EC9T 1FN4B 1BVKA 1XR8B 4XZUA 3IFLL 2ICWJ 5HJ3A 3TZVD 3HE7A 3BP7A 1T4KB 32C2A 4Y4HB 4EUPA 5LGJB 3SJVE 5BV7H 2DM2A 4FABL 5ALCL 3EO9L 25C8H 4OZGA 3VXNB 3NAAL 3RWCA 2B2XH 3MACL 3TV3H 5IT2L 4OI8A 4F58L 3AROA 5DJYA 4JY6B 1U8JA 3MA9H 4NO2B 4JZJC 4YGAB 4WENB 4K7FB 1TQBB 3C6SA 2BFVH 4OF6A 3CXDH 4M9OA 3VFGL 1PZUB 2IPKA 4FS0A 3RWHA 2JIXD 3ALWA 1AQDA 2MMXA 2EDKA 2R1WA 5HTSA 1H8NA 3D39B 1T7ZA 5DMKB 3BOVA 3MLTA 3OF6D 2XN9A 5AYUH 1S8DA 4HCRL 2GJ6D 2ZOLB 1CI5A 1RJYA 5JIHA 3ZKMC 1E4KA 5EBLB 5JPMA 3STZB 2ZUTA 3QDMD 1YEDB 3INUH 2O5XH 3TZVB 2CGRL 1YQVH 1A5FL 1E6JH 3T0XA 3DVFA 1XGTA 3IFNL 4YAQA 1K5NB 1UG9A 2RFXA 5TDPB 3S8WA 3S88L 2JJSC 1BBJB 1QVOB 1X44A 5DS8B 3SKUD 5B3JE 4Y5VC 4CL7A 2GSIB 3LV3A 1NEUA 2LU3A 3F8UB 3GKZA 3WXWL 2OK0L 1NCWH 3HI6L 5E4EC 4L4VE 3MOQA 1A6VL 5EB9A 1HEZB 1YEJL 2JIXB 4AL8L 3C8KA 3NFSL 2ATKB 4LIQL 1ROWA 4K9EC 2J8HA 3IFPB 1CDYA 1JN6B 3KPRA 3SKNB 4H1LG 2GJ6B 4JZNB 3BD5A 3PNWA 3O2WH 2N7AA 1P6FA 4GXUN 4ZUUA 1MQKH 4P46C 3CDGB 3MUZ1 3QDMB 1UYWL 1JWUB 5EBMB 2UWEF 2FBJH 3MJ7A 3DUHA 4C4KT 1URLA 4XCEB 3RWFB 3ULVF 2WUCH 1QSZA 4Z95H 3TV3L 1I1RA 1EVUA 4RMWA 3DARA 4HLZH 4M3KB 3WS6C 4UOW0 4JJHA 4L4JA 3BP6B 1QG3A 5FYLH 1QACA 5D71H 5HI4D 4M43L 2P1YA 1NFIA 1XCTA 1R5VB 2P8LB 1PG7H 1HH6A 1XEDA 5ISZA 3LHPH 4FQQB 1VESA 4MXVF 2CUHA 1VCAA 3OJDB 5IW6A 4PJCA 1A7RL 5AYUL 3O4OC 3VFWB 5D7SH 2IALA 3HHRB 3MRDA 3EFFA 3UTSE 4JGJA 2F19H 3TFKC 3IJSB 3VD5A 2G2RA 1KXVC 3INUL 2MCPH 1D3CA 3BGMB 1YQVL 2AXJA 4GS7C 4BM7A 2V5RA 4LFHG 4RX4D 1VFAA 4MNGA 4U7KA 1IQWH 3KVQA 1F4XL 1TVBB 4HUNB 4XNZC 3MLYH 3DMMA 4U6XA 1AD9B 1INDH 3CSPA 2FJGA 1JTTA 4D0DB 4L8CB 2PO6A 3EUUA 2VQTA 4JM4H 3FO9A 1BFOA 1W0YT 1NCWL 3KXFD 4NFDA 3GSNH 1KEMH 1HH9B 5BRZE 3ARZA 5HGAB 5IFHL 3FOLB 4PJBF 1M71B 5IGXL 4Q9RL 4PRNA 2A73B 3W82A 5C08E 1QFUH 2FDBP 1ZLUK 4G6MH 2OTPA 4NN5B 1PG7X 3LRGA 2EICA 3O2WL 4RMVA 4KJWD 1VFUA 1HOCA 2R4RH 3L1OL 5GGQL 2BHZA 3RL1A 3FONA 5C0ND 3AS3A 4LSRH 3V6FA 4XNQB 3CH1B 5EDXA 2FBJL 3DX8B 4ZFOL 5IMMA 2R0WH 3Q5YA 3MRHB 4OLVH 3GMMB 5KG9B 3VD7A 2M2DA 4Z95L 4F33A 2XZAL 4KJPD 1I7UB 4GKOA 1E0OB 3GIVA 1RURH 1K8DB 1LE9B 4O2EA 4GG6E 3NIDF 1KB5H 2FIKA 4FFVC 4G42A 3TVMC 1N8ZA 1GH7A 5D71L 4OIIH 3WN5B 4H5SA 5CKGA 4AZ8A 3KXFB 3VXPB 1DBAH 2J8UF 4JQVC 4RGOH 4MZ3A 3SDCD 5C0DB 4QTHA 4AENB 4HGWA 4PY8J 2PKDA 4U6YA 4L3EE 3SQOL 4JRYD 2ADJB 4G5ZH 4QNPE 3HE6A 4E42A 3MRNA 3WE6B 1ZHLA 2JE8A 3MNZA 3QUYA 2Y23A 1XF3A 1FPTH 4GKZB 3K2UH 2BRRH 2GT9B 2X40A 3QNZB 3BPLB 5L7XL 1S7VB 5DRXA 4XGZB 5EUOA 4X7SH 3ULSA 4FG6C 4P3WA 5EZLB 5J1AB 2D7MA 3C60A 2H1PH 2JB6B 1HYSC 2FYYB 3EYFB 3FO1B 3KLAA 1YNTA 3OXRA 3GEWB 4TNVK 4O9HH 2F53D 1IGYA 2IG2L 3KJ6H 5EULV 4JM4L 4MJ2A 1AR1C 4FQPA 4Z7VE 3TCLA 3MZGB 4R7DB 5D70L 3UTTD 1KEML 3OAYH 3VXOA 3L6FB 3WD5H 1CK0L 3OGCA 1MJ7H 1YYML 1LEGA 3SDCB 1ZSDB 1CWVA 5F7DB 4ONFH 3N50A 5C0GB 4G6ML 5F96H 4JRYB 1Q9OB 4L8SA 3T3PE 4KRPD 1NGWB 3WDHA 4KKLD 3UTQA 1FZJA 1T04B 4LSRL 2V2WA 4XXCA 4XX1E 3NCFB 4F8TA 1P84J 2DI8A 4PJAA 4OLVL 2C9AA 2DF3A 1KB9J 5GZND 4CMHC 2X1XR 4MB5A 5DTFB 2ED9A 1ES0B 4PJ7E 4UB0L 1RURL 5DMGD 1N6VA 3OBAA 4GW1B 3V4VL 3AGVA 5DJCB 4MJ5B 2F53B 5DD3H 1SYVA 4OIIL 5I17B 2IPTL 4YHZH 4QCIA 3K1DA 5DVOA 3S7GA 3UTTB 4KJQC 4EIZC 5I19H 1DBAL 5KVEH 2BY2A 1OSZB 3JUZA 5E0QA 1AXSB 2HMID 2DRUA 5IB5A 2JELH 4RGOL 5IEHA 1D6VH 4FQXA 1KYOK 1EK3A 3MBEC 1DBKL 1FDLH 2FJFA 3EHBD 2CMRH 3QIBA 3W9EA 2BMKB 4G5ZL 5I8EB 5FA4B 4KRPB 2JK5B 5C71A 3IFOB 1FPTL 3OZ9H 2EEAA 5DEGB 4N5EC 5E8PB 5FO8A 3K2UL 1PX3A 2BRRL 1AC6A 4WIQA 2R1YB 5IMOA 3KJ4B 5DO2D 3H3PH 5J12C 2VLJE 5FB8B 3C5ZD 4DJMA 1RUQH 2X70A 3BWAB 1IM9D 3HKFA 5JLZA 1DUZA 1K85A 1REIA 2CDFB 3MX0A 5CJOH 4RWYH 3SDAD 3BUYA 1DEEB 4X6CF 2XWBB 4OGYL 3KJ6L 4WW2F 3G5ZA 1BEYH 4QRUB 4W6XB 5GISH 1UH4A 2IGFL 2EXWC 3V8OA 3QBTB 4QGTA 2EDLA 5I18L 1JGDB 3QIWD 3IDIB 5D93B 2DQCL 2N7BA 1S7UA 3FRUB 4ONFL 3RY6C 1OAXL 1ZGLA 5F96L 1XIWD 2E6JA 3QG7L 3S96A 1JZ6A 1GCFA 1I1FB 2XV6B 1H3GA 3B5TA 1ZANH 5GRVL 3EOAB 1QBLH 1WSST 3IDUA 3L3DA 4TUJA 3W11C 4ZXBA 4OCSH 3V4PH 1BVLB 5BJTA 5JXEA 4MMXC 3Q6FA 4ZUTB 3C5ZB 4Y0GA 4LLMA 4QY8A 4OTXH 4UTAH 1IT9H 1IM9B 5CIPB 4YZFE 3H9HA 4OFYA 2WQRA 1F13A 4OKVA 1RJCA 3SDAB 3DETC 4L3AA 3TNNB 5DD3L 3U9UA 1O7VA 4E41A 1KACB 5CILL 2ZCLL 5BMFH 1FFRA 5HHXL 3SPVB 3QWRA 2WIIB 1JHKH 4K9EL 3HZMB 2NY3D 4NZTL 3GUTA 2JELL 3NCCB 3QIWB 4PJ9A 5E1HB 1FDLL 1BFTA 2P24B 5EO0B 2CMRL 5EO1B 3CGTA 1S9YB 1DL7H 1WZLA 1XIWB 1VGEH 5SX5H 2XYCA 4CW1A 4FXLA 3GBNH 1MWAH 1OGTB 2VQ1B 1C08B 4UQ3B 4FN0A 4ODSH 2EECA 2NW2B 3BIKA 4U1NB 3B9KD 4LQFH 3BD4A 3H3BC 3QXDA 3FQRB 2SEBB 5E2UH 3U36B 4OLWH 1A02N 2P45B 1RUQL 1CN4A 2VISB 5JQ6L 1AKJD 4EXPX 4PP2B 3RVVC 5HI3C 5CD3A 3N9GH 1RIUH 4PV9A 3HC4L 3T2NL 1GAFH 4ONOA 1MCRA 5E99L 5B21A 3QG6B 3O3AB 2UYLA 4F7PA 4ZUWB 3B2UD 2FATL 4MXQC 1JPGB 2DQEH 3V5HB 1BEYL 4CMMB 2NZ9C 3H6JA 1XT5A 2P48B 5GISL 2G5BA 1T1XA 2NY7H 3C09B 1F02I 4LSDA 4PGBA 3ABZA 1CDCA 2GK2A 2PXYC 2NY3B 1PBYA 2BDNH 4X98B 2NXZC 5L2KD 3BDBA 2CRMA 3KYKH 4JQXA 4UBDC 1YPZA 1A6TA 1KTLB 2R4SH 4PJIF 1F3DH 3VGDA 5HHOA 5I1DB 3PQYA 5E1AB 1I4FA 4LVOB 5C0IA 5HYQB 4FXGA 2EDWA 1QBLL 3ELAT 4TSCH 3V4PL 3CFBA 3B9KB 1UA6H 4HT1L 3O41B 1WJ3A 3IS0X 3ZYOA 1NBYB 3X17A 5FUCE 3PGFH 1AKJB 1U8HA 4LSTH 4QT5A 2QQQA 1EFQA 1ZA3A 2WP3O 2XTJC 5H94B 3OKLB 4O00A 5D1QA 1QSFE 1HHGA 4KKCD 1T7YA 3DXAD 2PN5A 1JL8A 2YUXA 3CZFB 3HZKB 4LASH 1DE4B 3BUTA 2FLBT 4PBVC 3GSVA 5DD6B 5BMFL 4G80A 4JO3H 4F3FA 4KK8C 3U9PH 3EOBB 1DVFA 5DD5H 4U49A 4URTB 5FOBB 1N4XH 4KQ4L 2BZDA 5L2KB 1UJ3B 3TBSB 1DL7L 1B6UA 1VGEL 5DSCB 3ILQC 4PRID 1MWAL 3M07A 1RZGA 4XTRD 2J6EA 3PL6D 5CCKH 5BVJB 1ZT7B 3BXNB 3L3JB 3G5YA 1JGUL 3WHXA 1BOGA 4E5XA 5KSBA 5E2UL 4OLWL 4MCZB 1RJLB 3NABL 1CD1A 2YD3A 5ITFB 4JRXE 5DRNB 3QDGA 4YK4B 3N9GL 5DJZB 5MENE 5HYSB 4OCMC 4N9GB 4X7FC 1IC4L 1CVRA 4HK0A 3DXAB 4KK5D 5IJVA 4U3CA 1LE5A 5J11C 5CEXA 3LZFL 4XPGH 1LO0H 2MQ0A 2DQEL 4UDTB 3RPIB 1T5XA 3PHSA 2AK4E 2NY7L 7CGTA 1Q0XH 1X5XA 4MWFB 3TJEL 4X4YA 4HIJB 1Q9KA 3I3BA 2HWZH 3MLZH 2R4SL 1A0QH 4C59B 1EAJA 3GHEL 2B1HL 4PJHF 2XI9A 2DMKA 2R2EA 3QZWB 4PRIB 4OT1L 4C58B 3PL6B 3JXAA 3BKMH 2A6IA 1Z9MA 2FSEB 3QCTH 4Z18A 1UWEH 1M7XA 2ZUQC 3MCG1 5DWUH 1DQTA 3G5VA 3NZ8A 2R0KL 3PGFL 1OW0C 1XMWA 2D03H 4EN3D 3ARUA 4XC1L 3QUKB 1ZEAL 3DRTA 3VXQA 3KLSA 1NJ9A 3S5LG 3VFPA 5F9WC 1ZLVH 5J3HD 1M7IA 3SN6N 4WEUD 4PPTA 4O58H 2V7HA 3PF2A 1DN2A 2ADGA 1LQSR 1MNUH 5ACMA 2I9TA 1P7QD 3UPCA 1BPVA 4JFFE 2XXCB 4AEIH 3U0PB 5DD5L 5DJ6B 5C70A 2RB8A 1L7TL 5C0FB 3ZDZF 3ME0A 3FFCD 3U4EB 1I8MB 1B0GB 4OFKA 1JNLH 3WHE1 1JFQH 3CFJA 4EVNB 4OLXH 5CCKL 2FCBA 3AAZB 4XBEH 5KTEL 1LO4H 2EH8L 5TE7H 4GRWE 3W5MA 4FQJH 2J7LA 3C8DA 2CKNA 5IIEA 1QBAA 1A9EB 3F12B 3PWPD 2VMFA 3BRDA 4HUXB 2VXUH 3T0EE 4EN3B 3K80A 2CXKA 2DTMH 1TMCB 4X9GA 2W0KA 3ARBD 1MHEA 3GRWH 1LO0L 4OSUL 5CMAA 3FJTA 3O6FC 3G9AB 3MYZA 4OZHB 3OR6B 3VRLF 1T1ZA 5IK3A 2AS5M 1P7QB 4OZ4B 3T8XB 1QZ1A 2PTTB 4G9DA 4N8CH 1A1NA 5IWLC 4KXZI 3OXSA 2HWZL 3MLZL 5DHVA 5BS0A 1A0QL 1BX2A 5GS1C 4KDTA 5D1ZD 3FFCB 1Z2KA 3TBWA 1MRCL 2VDOH 2F15A 3O9WA 2RQ8A 4NC2B 3WNOA 4G6KL 5JW4M 1VEOA 4MD5A 3LEYL 1H0DA 3Q48A 3QCTL 1MFAL 2AKRA 3F7YB 2G5RA 1FVCA 5FYKH 3PWPB 2VZ1A 4YHIB 5GGRA 2NR6C 2D03L 3QUZA 3HPLB 2YXMA 3FOMB 2DQUL 1BREA 4MQ7B 4X8JB 1F97A 3ARBB 2NNAB 1JGVL 4Z7QF 4O58L 4LQ1A 3PGDB 3DLQR 3KS0J 1Z0NA 2WBJD 4HBQA 4WFGD 1MNUL 1UWXK 3ZHKA 4JLRA 4DOHE 5HVGB 3FB6A 2OCFD 2QHLA 4PG2C 7FABH 4AEIL 2Q86B 5I1EH 4O4YH 1QFWL 2XPGB 1ACZA 4Q0XH 3EZ8A 2A74B 2BK8A 3DIFA 4L4VA 4DFHA 1HKLH 4PS4H 2CSPA 1NFDE 3DRQB