1NCAH

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDTATFFCARGEDNFGSLSDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaH02
2ESVA 43CAA 3AS2A 2A6IB 2VN7A 5FXCH 2HA1A 1WSST 1NL0L 4LQFL 3BO8A 3CFKB 4JFDA 3D39E 1ZWIA 1N3NA 4GKZB 3GIZH 3IDNA 1UACH 4GXVH 2X9YA 3L1OH 4OLZH 2DWEB 4KUZL 2WLZA 3LQAL 1U93A 1H3TA 2PR4H 1I3UA 3MYZA 4M8QA 4M6OL 5IFAH 5HHPA 4WU5B 2EDNA 3LQZA 1QSEA 3GMMB 4ELMF 1WBYB 1RUKL 1RZ7L 1J86A 2Y5TA 1ZS8A 4EBQL 2YHGA 5CAYB 2YUWA 1UACL 1CR9L 4FZ8H 5IHZB 2F74A 2EXYC 2H6PA 4TNWF 5E00B 2X4NA 4HZLB 4U1IA 3F8UB 4P9HL 1FGVL 1MAML 2CIKB 4WIQA 3IDIB 3LZFH 1IAKA 3ZKXB 1BIIB 3EYSL 3ZTNL 3RIAF 3RVWC 3BUYA 1A1OB 4G42B 1FV1A 3I9GL 3AAZB 4YIQA 3FTGA 3OAUL 3S96B 1L7IH 5F1KC 4TSBH 4NO0A 5D7SH 2PETA 4OGYH 3DVNA 3BH9A 1AC6A 3F12B 5HD8C 3EZJB 4EN3C 2IANE 2NTSP 4HKZB 3VE0A 1MREH 4B7IA 3WXVL 4MLSA 3D3VD 3TH3T 5C6WH 3QO0A 4P4RB 1KIUA 2CDEB 1DQJB 5ID0B 4YH6A 1EO5A 2Y9RT 3HB3C 4DKEH 5F6IC 1O0VA 1D5XB 4LEXL 5DR5H 3RZCB 5T1KB 3AS1A 3QXUA 3L5IA 5F8QC 2VQUA 5JXEA 3W5MA 2W1NA 1BZQK 4FOMA 2GITB 3GM0A 2X4UA 2VDML 3PV6B 4XBGB 5EG6C 3VXRD 4UB0H 3K3QA 3DX8A 2O5XL 4O2EB 1BBJB 1BQUA 4GBXC 2A73B 3ZE2E 5JIHA 1NLDL 3W39A 1UADC 1KCVL 1OWWA 1I75A 4GUPB 4PRHA 3V4PL 1T22A 4G9FE 3VXUD 2QJDA 2AEPH 3MGOA 1P2CB 5CJXC 2Z31D 2BJMH 1RUKH 1G7PB 3MLUH 3PHOB 3V5KA 4PP2A 3VXPA 1NCTA 5ESVA 3MV9D 3CSGA 3EUUA 3IFPA 4P4KC 1PYWA 4JFHE 3HAEH 5C0BE 2OM5A 3UPCA 1V05A 3KLSA 5ANMA 4NM8L 4APQB 2ERJB 4QNPF 2FECL 4K7FB 2AV7B 3TF7C 3B9EA 1WTLA 2QQQA 3QCTL 5HDBE 3PHQB 3GMQB 3UJJH 5D1ZB 1ZLUH 3E6FA 4JKPL 4JG1H 5B38B 1L9MA 4ZG1A 3GBNH 1X6NA 5I1CH 5HYQB 2AXGA 2Y4SA 1F4AA 3FCTA 3BAEH 4K8RL 4TVPD 5ENWA 5A1AA 5IHBA 1CFVH 1A9EB 5MEOA 1G7JB 3BQUB 2A6DB 2XA8L 3K4DA 1AH1A 2GTZB 3FB7A 4MHHI 1Y6KR 5D1QB 3I3EA 3RUGA 5JOFA 5F1IA 1CIDA 3PL6C 4MB4A 1JGLL 3PWLA 3ZKNC 4L3ED 4Y4FA 5T3XE 5K93A 3MJ8A 1H3PL 1W0WA 2YC1A 1RK0A 1BD2A 2IG2L 1G9NH 2P8MB 1LO2H 5FOJA 4OZFA 4OZHA 2P5ED 2R0LL 3DVGB 3MBXL 1DBBH 1DQTA 3MFGB 5EZLA 4XPBH 3EYSH 3ZTNH 1KACB 2UWEF 4H8WH 4JO3L 1V7NL 3AMKA 5C0JA 5FA4A 4E41D 4JRWA 2YR3A 2JLLA 5C0BA 2CKBA 2X40A 2EZ0C 4H25B 4P2YA 1IEAB 3GB7B 3G5ZB 3BGMA 1GGBL 2MTPA 1CFNB 3U83A 4EBQH 2AW2A 3GI8L 1JPGB 3MOAH 2EXYD 4P2QB 1MCBA 3EFFA 4YC2B 1T3FB 1NAMA 4G6FB 1MPAH 2DIJA 3VDAA 1PLGL 4YBLC 3VRLE 4KVNL 5DT1L 4N5ED 3NCEB 4FHBD 4PRAB 5FO7B 4YK4C 1U8OB 5L6YL 2WQRA 2HG5B 4K94H 2VABA 4WW2B 1T03H 1FGNL 4P5TB 3RTQD 3L3GB 4MWFA 1NGZB 4CVXA 3U2SB 4M7ZB 3EYQC 4PJ9D 4FTVB 1CXFA 2YA2A 1PY9A 2LU3A 2VDNH 4OD3L 2Z8VC 1OSPL 2XWJB 2F8VA 3BGMB 5IB4A 4GO6B 4JRYA 1DBMH 3W9DA 1F3DH 4DZBB 4HX1A 2Z4QA 5HGAA 1U95B 3UXFA 4F7MB 2VIRA 1KGCE 1RK1B 2EDYA 2QSTA 3SCMC 3DSFL 5C92A 3O81A 2XN9B 1RK0B 1UENA 3U0PB 2Y72A 2PXYD 5C0NC 4X7DC 2VLKE 3PWVA 2XXCB 4HGMA 4PJ8B 1CCZA 3HE6C 1VERA 4MXQD 3SE3C 1H3WM 1CL7I 1OLZA 4JFYA 5C0DB 3S8WA 3RUGB 3BEWA 5JOFB 2GJ6B 5IGXH 1JGVH 4X9FA 3JTTA 3SDXF 1ZGLB 5FUOH 2AKRB 3MXWH 5MEPA 5SWZB 4JFQB 4LSUH 4MZ3A 3IGAB 4XXCC 4H0HB 3U0WH 1I9IL 2AK1H 1NEUA 4KKCC 4K71C 2VYRE 4JM2D 3QUYD 4YX2L 3SE9L 3TPKA 1U8LB 1BOGB 5F7EH 1J7VR 3RU8H 3VWJD 1D5IH 1MIML 1NJ9A 2DKMA 4YEFA 3ALPA 1JZ5A 1TQCB 4C56B 1MCHA 2BNUB 1CL7H 5MHSD 1F11B 4G8GE 4DUWA 1F8TH 2K1MA 4FQCH 3V0VB 3IFPB 4PRPB 3RDTC 2Q76A 4PV8A 5IMLA 1WITA 5D4QA 3L3OA 4PLJD 2A83B 3BZ4A 1CLYH 4NDMA 4OCYH 5KSBF 5J9PB 1KB5B 3PWJA 4JPWL 4O51B 4Z7UE 1D6EA 3B43A 4OZFG 2AJUL 4G6MH 3VXOA 3HI1A 2Q8BH 1AI1H 3VW3H 1VGKA 3AROA 3QIUB 3SDAA 1EHAA 5L2KA 4X6BB 3AFLA 4P3CL 5ADPL 2G75B 4PYHA 4X6EA 1CG9B 1Q8MA 2AABL 4HS8H 2P49B 1C08A 3V95A 2EKSB 4ZMAT 5C0IA 1NEZA 5EC1A 2VL4A 2RR3A 1IEBB 2EIZA 1IGCL 2VDPL 4XWOD 4X4YA 5JW4R 3RDTD 3STZA 1PDKA 1SBSL 3TT1H 1Y6NR 5DWUL 1FZKA 4WEBH 2R1YA 1VADA 1IC1A 2Y25A 2EH8L 1HK6A 1T5XB 3P4NB 4LLMA 2Y36H 2HH0H 5E1HB 3U36A 5J6GA 5GGTL 1KCKA 4XXCA 4WEUD 1LP9E 1DBKL 2VQTA 5CIPA 3VI3F 2VZTA 3BGAA 1KJVB 5BRZD 4MNGB 3DGGA 2H9GB 3FT2B 5E2UH 2R2BA 2V9RA 4N0CD 1QSFB 3C60C 3VH8A 3BN9C 4Y16D 3IJHA 5I8OH 5KSAD 3GUTA 2GK0B 2AJSH 3BIKA 3SGEI 3HZYB 5KBNC 4K94L 1S7TA 1C5CL 3DMMD 1H9VA 3PP4L 3QFJB 3V6ZA 3IFLH 5DSCB 4P46B 3HPLB 2BNRE 1UGNA 2KQNA 4R7NB 1JGVL 2DIBA 1P53A 3UTPE 3VFOB 5MHSE 1S9WA 5DLML 1WC7B 2R29L 3CSBA 4JQXC 3IFOB 1C7TA 4E5XB 3S37H 4R2GC 2YPLE 2WIIB 5KVDL 3PV7A 1X5GA 4C4KT 1DE4A 4AMKH 3FOLA 1CDHA 4AT6B 3HMWL 3E8UH 3O9WB 5JNYA 1LO5A 1CE6A 5BJTB 4UBDD 2ESVB 2EDRA 4ODWB 3C60D 1Q9WA 2ZUTA 2PYED 4OTXH 4Z5RA 3TH2T 5BV7C 3TZVA 1QFOA 1OGAA 1OTTC 4RDQF 3MV7D 1DQQA 3EDDA 4ZO6A 4U1HB 2CMRH 4XP6H 2ZUUA 2MHAB 4I48B 5C1MB 3P2TA 4WW2F 4HF5L 5HGHB 5L88L 5MENA 3S3JA 4I0PC 2NY6B 4KQ3H 1XGRA 4LF3B 1ZA6B 2VXTL 4AT6A 1CD0A 1S7UA 4PLNC 1S9VB 2FJGB 1YMMA 2CLRA 1GPOH 5F7YC 3CH8A 1TLKA 5LBSL 3HZMA 3VRIA 4ZXBC 2FLBT 3DX6A 4P99A 3SGKA 2EEBA 3TEUA 5C8JA 5LGJA 2MCPL 2D7TL 3WFCL 5I1KH 3G9VA 1ZLWH 1ZSDA 1Z6JT 4QRTB 2D31A 4I9WE 4NP4H 4HIXH 4XZUB 2F58H 4F2MA 3T2QA 1UZ6F 1A6TA 2HVKB 3KXFA 3M1BA 5I2IB 1T0NA 1OQOA 3FOMA 2C1OB 1S9YB 4OGZA 4TOYL 1HHHA 3HE6A 4M1DH 1XFPA 3W0WE 3ARDA 1PX3A 4MXWH 4NQCA 1DQMH 4G6KH 3D0LA 5CINH 1Q0XL 4P2OD 5IEHB 1JN6B 1E4WH 1VFAB 2F58L 4XRCB 4LIQH 3TNMB 4JY4B 1X9QA 5C7XL 4I2XE 3LKNA 3ARTA 5IHUH 4YDLC 1DVFC 5MERB 5L2JA 1PX4A 4J1UA 5BJTA 3O3BA 5FYLD 1KBGL 4PIRF 5DVMA 1DQML 4G6KL 1Z0MA 5JXAH 1S7XA 1RZ8A 1M71B 3G6DL 5E9DB 1KG0B 5AUMB 3CPLB 2FZ3B 3IDGA 5FHBL 4R4FH 4DKDC 1WBZA 4KHTL 2A77H 3U6RA 2H8PB 1CVSC 1LEGA 2P48B 1QFWL 1CGWA 4X80H 4NKOB 2YK1H 4GLRI 2VDPH 4D9RD 5T5FL 3SDDB 2YPLD 1B4JL 3UMTA 3ZT5A 4XPFH 4CU6A 3X3GH 4MB3A 1FZMB 2JCCA 5GS0L 4NZUL 1AP2A 4HWNA 5F9OH 2ZCKL 3HLAB 1DBJH 5HHQB 4MJ5B 3RVVC 5L9DH 3PABB 1ZLSH 3JV4A 4NWUL 4YHML 4IDJL 4JVWA 5F6HJ 5LXGL 1A3RL 1RAMA 2BVPB 3BZFA 5GGSB 1IKFL 4ERSL 1XMWA 1A6VL 4XBPA 1A7NL 3BQUC 5KS9F 5J1AA 4R90L 2FX8H 3SPVA 1VGEH 2ZOKB 3WD5H 3JWDC 4GLRH 4QXUH 1KSRA 4YHOH 5F96H 3QDAA 1J05A 1UWEH 1MCWW 3NTCH 1ZLVH 3TN0D 1V3LA 1L0YA 1YEHL 3WMSA 2OQJB 1HZHH 2XG5A 1CXEA 1GHFH 4I1NB 4KY1H 1LO0H 4JCMA 5T1MA 1AI1L 4ZFFA 5DD6B 2IQAB 4X4YB 1VFBA 3HR5B 1RUAH 3QPQC 1FH5L 1FVDA 4O2CB 4G80B 5JHDD 2X9XA 3MODH 1UWEL 1CK0H 3LEYH 3RKDC 4U2YA 4X6EB 3OR6B 4JR9L 4X5WB 2Y6SD 4KV5E 3VI4E 4KGJA 2W07A 2V9TA 3RL2A 1N5YH 3WFHB 3NGBB 4IHOA 4Q9QH 3BX7C 2SEBA 1EH9A 3MLTB 1A7OH 4Q58C 2XRAH 4F9PA 1BQHA 2GTWB 4LOUC 3ARZA 5D1QC 4YHYC 5F9WC 4YXKL 4Z8FL 1N5AB 1IM9B 3T0EB 4JPIA 3PWNA 5E8PB 2OI9C 3IFNH 1QRKA 2BSSA 2GAZB 4N1HB 1YYMH 1NGYA 4EN3D 1AQDA 5BS0D 1F11A 3T0AA 1MCIA 3RNKA 1JK8B 1AD0A 4Y4KA 1BLNB 2X4PA 4MQTB 2OR7A 4YQXH 1WBXB 4ELMA 2GJJA 1NFDA 3UBXB 3KPRE 1MF2H 3CXHJ 2EDOA 1TCRB 1SEBA 2WWMC 4U1MA 4NUGH 4FABL 3UTZA 4HXBL 1X5ZA 3NZHL 1X5JA 1HNGA 1J9CT 2ARJB 5E7FA 1I9JH 4S0TD 5C0FA 4OCYL 3HRZB 3L5XH 4OZGA 4BSVA 2VLJE 5GRUH 1Z9SA 1ZT4A 1GVIA 1Q72H 3ECBB 2CUHA 1QFWH 2BOCB 1ZVSB 4HIEA 1A1MB 4F58L 3FQWB 4XGZA 5ALBH 2DKSA 2ENSA 1F13A 2IANB 4MXWL 5EU4B 3ULVF 3O3EA 3WIIL 4QHKJ 4BH7B 1RIVL 3IXTA 4LVNC 5HI5D 3JBG7 1BWWA 1NAMB 4NC1E 3RWJB 5FKAA 1HI6A 3MLZL 1IGIH 4PRBA 4X0KB 3T0VA 2VIRB 3THML 3IXAA 3CCHB 4BZ2H 5IB3B 1FO0H 3RVTD 1AGCA 1DVFD 4CN4A 2PCPB 3BE1H 3MUGA 4RIRB 5FYKH 5DMGC 4HWBH 4LSUL 5JORA 1WLHA 3Q1SL 3VFRA 5C0CE 4KDWA 5FUZH 2O5YH 1F58L 5CLTA 4YHKH 3HN3A 1W0VB 2VN4A 2CK0H 1TCMA 1DANU 5L88H 5IB5B 2EDTA 3HZVB 3QDJD 5EORL 2DBJA 4JG0H 3O8XC 5IR1B 4EDWL 4RA3A 4MAUL 2X1WL 1MLBA 2CDGB 2AS5M 3RVTC 2V7HB 1IC5H 3S35X 1OAYH 1TPXC 5JLZB 4WHCA 4Y1AB 3H9HA 4U33A 3NCJH 4TYUA 3TO4D 2MJWA 4PJEE 4JY6B 4HCRA 1PZ5A 1OF2A 4O9HH 3DI3B 3VFGH 2YPKB 2ARWA 3EOTH 4NO3A 2NW2B 1KN2L 1JYWA 4Z7QF 3EO0A 3WIFA 4RIRA 3HHRB 1S3KH 3HNVL 4HWEL 1A7PH 5D7LE 4APQA 2VAAB 2DTML 1NCAL 5GISH 4R97C 4EDXA 4R6UA 1S7VA 1CFVL 2R2CA 4M7JH 2C5DC 5MP6H 4P59L 1EZVY 2P43B 5LQBL 1X44A 4UI2A 2CXKA 4FQLH 1U3JA 1N2RA 4JGUA 4Y4KC 1JJUA 2W9DH 3MLZH 4LL9A 5J13C 5FFLA 2VC2H 5JDSA 4AL8H 3MYJA 1TQBC 2EYTA 4JZJB 1KC5H 3BPCA 5JHDA 4YDIH 1X5FA 5DYOA 5CLWA 3O6FD 4NQCE 4GG6E 3BKYL 3K8LA 3ELAT 4GW1A 4N68A 4CW1A 2CO6B 4BSWA 3O4OB 5FUZL 4CRPA 2Y5EA 3GSUB 5ITFA 2GW5A 5EU7C 4HUUB 5JO5A 1DJSA 1MI5E 15C8H 3SN6N 3ZT6A 1XGQA 3VMPA 1KC5L 2W9EL 4NQSA 1AKJA 3QNYA 3LMJL 5B8CC 1S7RA 3CFDB 5C0CD 3ARPA 3RZCA 1U8NA 4QY8A 1RZIA 3MLVH 5DRWB 3MNWA 2DD8L 4L5FL 3W9EB 2ITDA 2B5IC 1P4LB 1GOFA 1BF2A 1FSKB 2CIIA 2W65B 3WNOA 5D5MA 1NCBL 2OL3L 5BS0A 2JTDA 3BYTA 2P8LA 3DV4B 3OXSB 3BW9A 5I66A 4GRWH 2B1HH 4BYHA 4ZXBB 5HYJD 4UV7L 1EGJH 3FQRA 5DJ2B 5J1AB 5C0GA 1H8SA 1SY6L 2BCKB 4Z7VA 5HVHC 3EFDL 3T77B 1RQ5A 2Z35B 4YIQB 5D7JC 5BVPH 1NC4A 1SHMA 5DRNB 4K3HA 3QG7H 3MOQA 4PRDB 2XY1A 3KPMB 4WI7A 4F3FB 3SDXA 4XT1C 4LFHD 4O2CA 4UT9L 3CSPA 1FZMA 1UQSA 4G8GA 3MV8A 3GSQA 3F7YB 2CLZB 5CBEB 2XWTB 4I5BA 2DF3A 2D3VA 1CF8H 2HT4D 3THMH 1AIFA 2JK5B 5DJDB 1AXTL 3OV6A 3BE1L 1FO0L 3IDGB 2FZ3A 3QUZB 2Y7QB 1UJ3A 5EZIH 1KCVH 3B8SA 1FQ9C 5A2KH 2H8PA 3O0RL 1RZ8B 3F62A 3O9WC 5FYLL 2VERN 5K33A 4U1KB 2NLJB 3IDNB 1QLRA 4OM1L 5E2TH 3V2AR 5TQ2H 4KRPD 3QUXA 5T1LA 5IG7B 2QADD 2B39A 4NQDE 1J88A 4NUJA 1UXWB 1B0WA 5EZIL 3WO3B 1XF2B 4EI6A 1JV5B 2W38A 1EHNA 1FV1B 3S36L 5C2BL 4D3CL 3HUJF 3JWNC 1K6QH 4HMCA 4PTTA 5CWSA 1AGEA 2HFEA 2YKLH 2DTSA 4LASL 4PLKC 5DMYA 2ARJQ 1U3HB 1FJ1B 3BGFC 2FNBA 2A74A 4ZDHA 4BQ9A 2EDXA 2P7TA 3LS5H 3SE4C 1LEKA 4PJDB 2BFVL 1DBAL 5GGQH 4AQ1B 1YEJL 4JN2B 3GIVA 4ZFGH 1JHLL 4WFGE 3DLQR 2MOVA 1ED3B 1WISA 4WU5A 5DGRA 5HGDA 3UTSA 5CEXB 1MVUA 3DTXA 4BZ1L 4CL7A 2PO6B 2L0DA 4JPKH 4P2CG 3DX6B 1T6WA 1QO3B 4YWGH 2JIXA 4KK9D 5HVWA 3CFBB 5GRWA 4KHTH 2P1YA 5C0ND 3QUYA 2G9HB 5DJXB 1QHOA 4D2NA 3HUJE 2APBA 2UWEA 1ZK9A 1RD6A 5C9KA 1BVKA 2YRZA 4HUNB 5KJRH 4Q9QL 1KPRB 2JJTA 4QRSB 4RMWA 4ZDHB 3UEZA 5HVGB 3VD7A 5D2LF 3NPSC 5C0AB 5GS0H 1A6WH 3VGAB 3B9KC 1G7IA 5GSVA 4MQXD 4XMLH 2XKUA 1BAFH 3L3KA 1KPRA 4Q2ZB 1L9NA 2HKFL 2EH7L 5EWIL 1BBDH 2J1KA 1TVHA 2BRQA 2AJZB 4I18A 3RPIA 1BVLB 3FO0H 5EUOA 1KPVB 3ARFB 1KCUH 2E9WA 2FATL 1I1RA 2VXUH 2X4RB 35C8L 3Q5TA 1ED3A 1NBVL 5JHLH 1JF1A 1QPPA 4I4WA 2APWA 4MQ7A 3VWJA 2RGSA 2Y7QA 3QUZA 4K55A 2R15A 3VA2C 1KEMH 4L1DA 1CWVA 1AIFB 2JK5A 2DQIH 1LEKB 2DM3A 4MJIB 2YD9A 4CN1A 4QWWD 3IDXL 3FO9A 5D7IA 4ODBD 4W4OC 4LCCA 1Q0XH 3T1FB 3CC5B 5TDNB 2OSLB 5IKCA 1S7QA 1SJHA 1OM3L 1NANH 4IMKC 3BESR 1BEYH 4RA0C 2NTFA 2XY2A 2MCG1 1XF2A 1U36A 2F19H 2ZPKH 4PGDA 2G5BA 1W8NA 3IFOA 1CXIA 1E6JH 5SX5H 4F7TA 4ZFOL 4HJ0D 5CEZD 2VO5A 4PJ5A 5HHME 4NCC1 4Z8FH 5LAXA 1NAML 3KYMA 1MHEA 4B41A 2HKHL 3P77A 1BJ1H 3QFJA 1VADB 5AD0A 3L3IA 4I5BB 2XWTA 2EKJA 3B9KA 4N0RA 4X6FB 5FF6A 3EDKA 2GUOB 2VZUA 1TTUA 3IAGC 3WHXB 3DRTA 5KW9H 3ISWA 5C71A 2XFXA 3SCMB 2QR0A 1NC4B 4HK0B 4PJ7B 1C08B 4QHLB 2BVYA 3K2UL 2R2BB 4G9FA 3KPMA 3QIUA 2X09A 3GSUA 4IRJD 5CJOL 2D0FA 4NT6A 2GHWB 3SDAB 4LSVH 4AEHL 4QRRD 2NY3D 3R0NA 4OM1H 5E2TL 1LHZA 5FAAA 5IQ9B 4YHYB 5I16A 5CINL 2WBJC 2IFFL 35C8H 2X42A 3DO7B 2AGJL 1JHKL 3D0VB 3NTCL 4HFWB 3O8XD 2W0KA 4TUJB 2D03L 1T7XA 3P4NA 5J9PA 1AD9A 4GKNA 3I6LD 5CJBA 1NH6A 3W9EA 1N2RB 5EU7E 3O3AB 4M93B 5DTFA 2Q20A 3L3OB 3FRPA 5IWLA 3AB0B 1HH6B 2EE6A 2B1HL 2Q76B 4PV8B 4XNMB 4XP1L 4YK4B 5DQJA 1F6AB 4QTHA 2NXYC 1DZBA 1A6WL 2VZVA 12E8H 3GIZL 1X7QB 3NZ8A 5DHVH 4MJ6A 2DL2A 5M94B 4YAQA 2O5XH 2VWEC 4AEIL 4U1GB 4PY8I 1FDLL 1EJOL 1EO8H 1ZGLM 4YHZH 2B4CH 4ONHA 2A0LD 5A43C 2P5WD 1J5OL 2FSEA 5MI0C 3SKNA 3UROR 4ZPVB 1UZ8B 5HYSB 4OCLC 4F15C 1I9RL 3W0WA 3O2VH 2F53D 5D72H 4LHJB 4NGHL 4L3EE 2R0KH 4J4PC 4OLUL 3IRPX 4Q0XH 4HPOH 1MCOL 3FB6A 5TJWK 5JW4M 4IOSD 3VD3A 4ZS6C 1TITA 1R5IB 4MD5B 4WW2C 1CQYA 3UTPD 2H2SD 1S7VB 2UYLB 1I8MA 3ULVL 1UEMA 3F65A 3QBTB 3MRRA 2DQEL 3BPLC 4MJIE 4PJHB 4MA7H 5E99L 4MCYA 2R0WH 4QRQA 3OJ2C 2C3WA 4P23B 4ACPA 2FWOB 4JO4H 1MCEA 4AMKL 2NW2A 3QJFB 4IRZH 3GHEH 5E08H 1KIQB 2VDNL 1G9NC 1PVHA 1F4WH 4M9PA 1T2QH 3L95A 5DA0B 1XZ0B 3OMZA 4MWFB 1C7SA 2A6KA 4NBXB 3KJ6L 4R9HA 4LBEA 3MRFB 4H1LB 3VXSD 4X7EC 2ZZUT 3HNSH 3GSNA 2JB5L 3BEWB 2NR6D 1F5WA 1EEQA 2I9LA 4PD4J 1A02N 4L9LA 1IFHL 3NACH 4FQLL 1YEFH 2HN7B 3EYQD 1M7DA 4PJ9C 4Z7OE 3C5ZD 3HZVA 3GSNB 2BC4A 5TF1L 3U0PA 1YEHH 5B39B 4NNYB 4BZ2L 2HJLB 5LCVL 4JM4L 1OAXL 3U9PH 2WINB 4I0PD 5I8CA 2FEDD 3NH7L 3SKOB 4ETYA 5IQ7L 4Q6IA 4WJ5B 5TE6H 2GYSA 4TNVF 3UX9B 8CGTA 4O5LH 4UZGA 1YZZA 9CGTA 3WO4B 4F9PC 5FYJH 1QSVA 4PJHA 2D9QB 3BKJH 4ZFOA 4P0DA 5EORH 1CXLA 2ZJSH 4CJ0A 4J3OC 3KPRA 1CU4H 1NAMH 1I9RH 5I8CB 1BM3L 3QAZC 1EFXD 5I1EL 4P5TA 1AGBB 3SGEH 4D0DB 3W0WD 2UYLA 3MLVL 4OZFB 5DMIH 1OCWH 4Y4FB 2GAZA 1NBYA 3MRGB 2DD8H 4L5FH 3MRBA 3ZTJH 5F6IB 5A2LH 1UB6A 4Y19B 1T3FA 3CLFH 1K4DA 3OF6D 3HKFA 3IDMB 2PW1B 5J0BA 5DDHB 4PJFF 5L7XL 4XVSL 1RULL 5T1LD 8FABB 1A7RL 5DS8A 5E0QA 1FFNA 3BSZH 4X98B 3L95B 3V6OC 3VFNB 1P7HL 2IADA 3HS0A 3QJFA 1CLZH 4XX1E 2FLRT 1SEBB 2GT9B 4BJLA 2AXGB 3C6SB 4WHTA 2H1PL 3MLXL 2G60L 4QXTB 4TTGA 4QHKI 4R0LC 2E7MA 2ZUXA 2LFGA 4MVBC 5FA4B 3KG5A 4OLVL 3NZ8B 1S78D 4AENA 3EGSB 3KVQA 3LRSA 5FKPB 1ACYL 2DMCA 4NO5B 3D3VE 4LSTH 4EUPG 4LMQE 5F3BA 5J1SC 1JK8A 5ANMB 1MEXH 4MXVF 4KZDL 3Q5OA 3L3JB 5JUEL 25C8L 1HQRA 1YA5A 4G3YH 3PWPB 5DQJB 1BP3B 3TM6A 5K9JH 3MLUL 3QRGL 5JZ7C 4F58H 1J05B 4QHMA 1HILA 4GRMB 3N1MC 4ZTOH 4HQQL 5HDQH 1YEDB 4K3DL 1EA9C 4UTAH 4TUJA 1TVDA 4YX2H 1EXUA 3OF6A 4XTRC 3P9LB 2NY1B 3CVHH 4IMLA 4QLRA 1EEYA 1BBJA 1FLRH 1F3DJ 1SVZA 3QZWG 4KWUA 3SGDI 1MCKA 4HKBA 3CFEB 3MJ6A 4I8DA 4TUKH 4L8DB 4RCAA 3HE7A 5DVOA 4K8RH 3S36X 5I76B 2PKDA 3IF1B 2JCCB 4F7CA 2DQCH 2DLIA 3BWAA 3B9KB 4KKBD 3X14A 3ZHDA 1QSZA 5DZNA 4HV8B 4TSBL 3P77B 4I9WD 5AWNL 4LHUD 4JG0L 4JPWH 5HI5C 1JGLH 4KI1A 3BPNC 4WNQA 4GT7A 2Z92B 3P11H 1JHLH 4L29A 3DIFB 5K59E 4GKNB 1WBZB 1CZ8L 4PV9B 4TQEH 3BKML 2VDQL 1HINH 1DDHB 1MREL 1F2XK 2PN5A 2BERA 5E08L 3MFFB 5EBMA 2CD0A 5FB8B 4F7TB 4KROC 3ARDC 4PJGF 2DQGL 1MCSA 5GS2H 3MV01 2VLKD 4AK1A 5IHUL 2NTFB 3Q5YA 3DVNB 1HQ4A 4XBGA 3WN5B 1HCVA 4U7SA 3TNMA 1J87A 1PAMA 4H20L 4IRSB 4KK5C 2KZ1B 3BP5A 3G5VB 2V2WA 1NGPL 2AQ3A 3S4SB 4PLKD 4YBQD 1RSFA 4WUUB 5HTSA 3V5HB 1KTDA 4M6AA 5IJVB 3T1FA 4MJIA 1LE5B 4KGLA 2Q6WA 3RL1A 1BBDL 1MHEB 1PLGH 3T08A 4WWKD 5L8JB 1DQDL 3EOAB 3TP4A 3S3PA 1XGTB 4QHUA 4F37K 2CGRL 4U6TA 6FABL 2VLME 4U7MA 3LQZB 3VWJB 4PJGE 4D0CB 1S7XB 1ZXQA 2VDKL 1MHPH 1KB5L 4J3XA 3LKRA 5FM5M 5CZVL 3VFTB 4ORZC 2HJKA 5ISZE 4XPAL 4N90E 3RAJL 3MV9A 2GCYB 3C8KB 1XH3B 5HGHA 3PWUB 3QUZC 1A1OA 4G42A 1GJIA 1T89A 2QHLA 3MA9L 4QNPE 3OR7B 3P9MA 3FHAA 1IAKB 1EFQA 1JNNL 3QXTA 3KPNB 4K9EC 4RFEA 2R2HB 3LN9A 5I9QC 4YHNA 3VFUA 2MPAL 3MOBH 5BMFH 3QA3B 5INDA 2XTJD 4CADB 4JQXA 3B5GA 4FQJH 3HE6B 4OKVB 1GGCH 3F7QA 1MHCB 3O4LD 2D31B 5I1HL 1QLEL 1IQWL 4OF7A 5GS2D 3MCG1 5F9JB 3OKNA 3GSRB 4KJWD 4Y88A 1YN6B 2CH8A 1A14H 3VFTA 2VXVH 5D7JB 4ZTPH 3ARDD 3N85L 4I4WB 4K07A 3S34L 2AJXL 1HWHB 3CU7A 2ORBL 4J3WA 3WNNA 4JHWL 1QO3A 1S7UB 3UTSB 3WLBA 2X4SB 1YN6A 4ODVL 1YEKL 2CLRB 1F02I 3RJDA 4PJFA 5HYIA 1QSED 3O3UN 1AHWC 4Z95L 4PJDA 1DQLL 4M8VA 2D7OA 3VWKC 3AM8C 3GIVB 3GJFK 5I75C 1MHCA 5LJYH 1DANT 4RFEB 4M62L 3RWCA 2AEIT 3UAJD 3WUZA 4W4NA 4HW6A 3BIKB 1FZJA 1IC4H 1N0LA 4KQ3L 2CDFB 1JV5A 2EE2A 1UB5A 1R24B 3OR7A 5T5NF 3SEPA 4OZGE 1FYTA 2WIIA 2M1KA 3IS1X 4K3GA 2OX5A 5HPMB 2ZSWA 2D7TH 3WFCH 3H9SD 1QSFD 4WO4A 1AKJD 5EBMB 4O4YH 4HS6A 5DQDH 4PJCF 3EOAA 1QUNA 3QDMB 1XGPB 3CXDH 3RL1B 4XP4H 3CGTA 3MA9H 4MNQB 5CILL 4WHYH 4LCWE 1LO4H 4WI4A 2FL5B 1IAIM 3D3VA 3HZYA 4O4YL 3KYOB 1EHXA 5DJ6A 1EK3A 3GBNL 5IV2A 3MOBL 4G8GB 2PYFA 2VLJD 4LKCB 3KPSD 3F58H 3O3DA 3FONA 3GUTB 4OB5L 1T7WA 4Y19E 3QDGE 1ADQH 5IROA 3ULVD 1F6LL 3HMWH 3SKJL 1I3VA 2BSRA 4CDGC 2BCKA 1JNHB 4XVUD 1H3UA 4YO0B 1OQXA 4MNGA 2ESVD 2X6MA 2APFA 1U91B 5FHBH 5I8EB 2J12B 4KJYB 2VLRD 4PGCB 1DR9A 3CZFA 2NLJA 4F8TA 2VXSH 4Y2OA 5J6GB 1OOAA 3KPQB 3VFMB 4DGVH 5SWZE 2ADGB 1P9MA 2VR9A 5D5MB 5DZLA 1XCQA 4WNQB 5KTEL 4QHMB 3S5LA 4LLMB 4HFUL 5D1ZC 2VLKA 5IVNA 3TT3H 1T03L 4MAYB 3WJJA 4WCYL 1LO3L 3UBXG 3V0VA 5ACLA 1EPFA 4I0CC 1A7QH 2NY6D 2OP4H 1OAQH 4F7CB 5BOZG 5HBBA 5KS9E 4JRYE 3FB5A 1FVEA 4P9MH 1RZFH 4RNRA 1EEYB 3SBWA 2XT1B 1ZHLB 1CG9A 1D5BB 4HKXB 1XF4B 3SE9H 4HIXL 2DI7A 4WHTB 4WWKA 1U8MB 4HIHB 3ZDXF 1RUQL 1FP5A 5JMOC 4MVBD 2I60H 1YNTB 2D4FA 3QUKA 3RWDA 2PUQT 3T4YB 3OXSA 2DQUL 4Y89A 2APVA 4TRPH 2NW3A 5E2VL 3GK8L 2IMMA 4XAKD 2BHYA 3BDYL 2A83A 4NYLB 5GGSY 5E56A 5E8NA 2PTTB 3TIDA 3HNTH 5CEZL 1UM5H 5FOBB 4ZNEE 1YEGH 1SM3H 1UM4L 4JPVL 1A6AB 5EA0H 1A3LH 4PY7B 5FGRA 1T7VA 1HEZB 1P7QD 5EZJB 4D9QD 2VAAA 2R0ZL 2LVEA 2LABA 2JB6B 4G7YL 4KROB 2OJEA 3QRGH 2PTUA 5D2NA 4NNPH 4GW1B 1ZVYA 1QTYT 5KG9A 4K8RD 5A3IC 4L8BB 4UDTB 3TYGH 4FQ2L 2WUBL 3EDEA 3J8F7 2FEEL 5IK3A 3U1SL 2OTWB 4OJFH 4WW2A 4NQCD 3MRGA 2CK0L 4MD4B 3BRDA 4LLUA 2QQNH 5I1LB 2FBJH 2EYRA 3TA3C 5FA3A 5J56B 3CK0L 5AYUH 4LKXB 3WUWB 1U42A 1FVCA 3MNZB 1CGVA 2CDGA 1KULA 4D0DA 1F6FB 4KTEH 2ITCA 4P9ML 3E3QE 3W9DB 1W0VA 4G6JL 4PG9A 5F9WB 3TH4T 1WJ3A 1FGNH 1CICB 3AU1A 1UM6L 1AO7A 4C56E 2XWJA 1FE8L 3PGCA 3KPPB 1CGSH 4UOJA 5SX4H 1MI5A 3RKDD 4NO3B 1LD9B 1T1YA 2F54D 1F4XH 1RJLA 3TGXA 1NBQA 3QG6B 5JORB 4DVBB 3MRRB 4NQEB 4UOW1 1FNEB 4GG6A 4QRRE 4MYWB 3JV5A 5SWSB 1LDPL 3EO9H 4M6MH 4HIJB 1FO0B 4YHPB 4NQVA 4M6NL 4X0KA 2EDQA 1OW0C 4TUOA 3JTSA 4LNRA 4PFEA 4PR5B 1YN7A 2DQHL 4H26B 2ZCHL 2Q8BL 3LPGA 2N4IA 3A6BL 4HGWA 5E94A 4BH7A 3LH2L 4HWUA 3MRDA 1JI1A 3IDUA 2A6KB 3SKJH 4ZTOL 1JPGA 1E6OL 3D2UD 5SX4I 1IM3A 1VA9A 2H2PC 3CX2A 1ZT4B 2LAGB 3E1F1 3U7YL 4PJ7F 1G9MC 5EUOF 4C58B 2CKBB 1WQVT 3MCKB 4YDKH 1IM9D 4M1GH 4NNXA 4OCNC 4RDQG 1QEWA 3UTZB 4S0SD 4ELMB 3PGCB 1OGTB 2RBLA 3TWCL 5IB3A 4XNXL 2WUBH 4N0FB 5FUCE 3K4AA 4P4KD 4PRID 4PRBB 2JELL 3TIEA 3GMNA 1BQHG 3CXHK 2GSIA 3WUWA 2NY0B 3WFBH 2FBJL 4JY5L 4RISL 4N0YL 2RB8A 3VXPB 4MXQC 3K2UH 2FD6L 1T0MA 1A1MA 2NXYD 5B39G 1FLTX 2ZUQB 3VDCA 1T83A 2CKBH 5F1IB 2W60A 3GKWH 1W72L 3CVIL 5BQ7A 1E4XL 4LEOA 4J8RB 4O58H 3MRNB 2J3SA 3EJJX 1P6AB 3U30B 3IVKB 1RZKC 3OKEB 3AREA 3DBXA 3BDYH 2D7QA 2VXVL 5KSBA 1HEZA 4A6YL 3UTTB 1NQBA 2VR5A 3RNKB 4PJ9B 1SM3L 1Z9OA 4I3SL 2F54E 4KKAD 1F90L 3E0GA 3GMLA 1WAAF 2E7BA 3G9AB 1VPOL 4J12A 5HDOA 5GGVL 4XNZB 5C6TL 4EI5C 1JPTL 4OIBA 4UIKL 1K85A 5T3XL 4B50A 5D2NC 3IU4L 2XNAA 2A6JA 4GUPA 5I8EA 3DO7A 5D70H 5K9QI 4YO0A 2DOCA 4JCLA 1ULVA 4NKDA 2QSVA 4PJ7A 4QHLA 4WU7A 1KNOA 3UJJL 4C83A 3WDJA 4V1DB 1UVQB 3C6LD 3HLAA 2AAVA 3UJIH 2ZWLT 2QR0B 3ARQA 2NYYC 3PHSA 5DQDL 1R6VA 5IF0B 4ZAKB 1J0HA 3JUZA 3RWIB 2H32B 2YPVH 4OCXL 1HHKA 4ZS6D 2NXZB 1NGQL 1X5XA 7CGTA 2IFGA 4WI5A 2HFGH 4GXUM 1FYHB 2W0FB 1G0XA 2DLTA 5ETUA 4RAUB 2WK2A 1VGEL 1MCFA 1HH9A 4HS6B 3CDFA 1CQKA 4KMQA 4M4RA 3VJ6B 3G5XB 3GNML 3ULVC 2J4WL 5C0RL 3EYUH 4WWKC 5DJ8A 3C5SA 3FQUB 4PJIE 3SKMA 5CGMA 1LEIA 4U1GC 1JNHA 3V5DA 3FTGB 1NCUA 4XNXH 1V7NH 4R4NC 1AXIB 3QIWC 5FECA 1WAAE 1BIIA 5T33H 5A16A 1GGIH 2CDFA 5DJCB 4PB0H 2PW2B 3ZKMC 1PQZA 2QHRH 5BZDA 2GKIA 1EBPA 2NY2D 3ZE1F 2BVOB 3QNXA 2E27H 5JOPE 3SDDA 3HI6H 4KJPD 3F5WB 1QBML 5F7FA 5DEFA 2HKHH 1UCBL 2FX9H 1FL5B 3ZYOA 1KENL 3WFDH 2ZKHH 4JFXA 5AZEL 4NM8H 1ZHBA 3OAZH 2XRAL 5FYJE 1MHPL 1SYSB 3O45A 4FMKA 3E2HB 5D72L 3VRIB 3B2UD 3O2VL 3DX7B 1KPVA 2BY1A 4GRLD 4PJFB 3U4EA 1XGUB 5C8JB 3CFKA 1UA6L 4D9LH 1IJ9A 1MVUB 2CRZA 2ADIA 3LDBB 4TSAH 3X3GL 4YDVB 3O45B 5I1CL 4K7PH 5KZCB 4RGNC 3LS4L 2E6PA 3GSRA 2W59A 5JW4Q 4RMRA 3TA3B 1ZT7A 5A2JH 4LPVA 3CSYA 5FCSH 4JFED 4N0YH 1KEML 3EJYC 2OZ4H 4LPCA 2IFFH 4JO1H 4KUCD 4G9DA 2PNDA 5FDWA 1I7ZA 4TOYH 3TJHD 4MDJA 4Z5RB 1A14L 3BHBA 1I1AC 2IAMC 3L3DB 4PJBE 4ZXBD 1JTTA 2UZXB 3FHQA 4LCWA 5F96L 3C87A 4L4VE 1FAKT 1IGTA 1ZSDB 4ZO8A 2R4RL 3MGTA 2XTLA 3ARBD 2G60H 5EN2A 3JXAA 4WHDA 5KN5B 4DKEL 1ZHBB 4HHAB 4CUCA 5MEQA 4H88H 4JRXA 5FYKU 4JRXE 1FL5A 5ETUB 1ZA6A 2VE6A 5DMJB 3BPOC 1P9MC 5B38G 2BVQA 2VXQL 5DWUH 5IVZA 1AJ7H 2CLZA 1OCWL 5TGBB 5D93B 4O2FB 1T1XB 3QUZD 1CFSB 2A74B 5HYJA 1DBKH 2V2WB 1QNZH 3JWOC 2MFNA 1BPVA 4PRDA 3IU4H 2Q86B 3QI9B 5ESQB 5CJ8A 1XH3A 2HFFA 1RZKL 1G6RB 1MFEH 4M7KL 3WS3B 3GJFA 2ZJSL 1NGWB 2GY5A 3FOLB 4U1KA 4ZXBA 3FQUA 4K71B 4HDIB 1EHLH 3VJ6A 3KPLA 5FO8A 4LASH 4D0CA 2ENYA 2IH1B 3WKMH 1JWUA 1MWAA 1BGXL 3IDXH 5DC0A 1T89C 3I9GH 1SJEB 4J3UA 4NZRL 2MQCA 3IFLL 4MSWB 5ANME 2Z8RA 5C2UB 1YEJH 4XX1G 1F3RB 1LE5A 3EW3B 4MAYC 4BH8A 5IVXE 1T4KA 2EIZB 1HHKB 1JPSL 5I1AB 1OM3H 1I8LA 3D1MC 3K8KA 3STZB 1Q0YL 3W2DL 3VW3L 3SO5A 3V0AC 5H94B 4PJ5E 3TBTA 2MWCA 43C9A 4PGEA 4NHCH 1AO7E 1IGFL 5DRNA 3BKMH 1PKOA 2OL3A 3VXSE 1VSCA 1HWGB 1X4ZA 1XT5A 5KSBB 4F3FA 4JFOB 1WFTA 4NKDB 3DBXB 2HTLC 3ZE0E 4F33A 1VGKB 3VXUA 2XTJE 4QRPA 3QHTC 5L2KB 4F9LC 2FEDC 4N0UB 5IM7B 3VXOB 2IMNA 1L0XA 3STBA 3V8OA 3E2HC 4FQ1L 2NXZC 4J6RL 4POZC 1U8IB 1KJ2H 2J5LC 4YGVB 3WNLA 1EXUB 3KDMA 1HCFX 1X5IA 4U0QB 4LCIL 1N4XL 3QEQB 4XHJC 3U1SH 4BK4A 5T3XH 3ARSA 3KS0H 1IGIL 5GGUA 3ZYZA 4DGIH 5F89A 4QY8B 4I3RL 3UC0L 5I1GL 3BGFB 4K3JL 3UTTA 2X7LB 2BZDA 4YE4L 1IEBA 3QXDB 4Y2DD 3QIWB 4UTAL 3I85A 4Z76B 3J7HA 4KK6D 3RGVA 4AENB 5CD3B 3B2UC 2Q7YA 3BP7A 4OGXL 4U1SB 5I8KH 1VEMA 3HE7B 1GL4B 4JO2H 1ORQB 1IAIH 1T1ZB 5K9OB 4OD1H 2H26A 1PKQA 3RDTA 1FLRL 4HKBB 3TV3H 2X05A 4MDIA 1KLUA 5I30L 3HNVH 3C6SA 4Y4HA 5F21B 3SQBA 4Z0BL 5DYOB 2VITB 5D6DC 3QP3A 1NSNL 5J3HD 2GT9A 2EYTB 3N1FC 5I1JL 4A2LA 1FBIL 3G6AB 2W60B 5DS8B 4I13B 4U6XA 1D6EB 5SWZA 4ZUWA 4HC1L 3H7BA 5BRZE 5LWYH 1ERNA 1TZGH 5F7LB 1OVZA 2F53E 1BFOB 1ZHNB 2DM2A 5I73B 1QSFE 2VZSA 4FFWC 2H1PH 3MLXH 2YD1A 5F9AC 5IB2A 5CKAA 3DROB 5ADOH 4YJZL 3DXAE 5F7UA 3DX9B 1OSPH 4ALAH 1U92B 4IOFC 3KXFD 1OB1B 1EX0A 2R2EA 5TE7L 3SQOL 5FKPA 3O6KL 2K7PA 1X5LA 4RX4D 3T8XA 1NMAH 5HHMD 1NMCB 2KDGA 2E7CA 4L9LC 1U9KA 3QHFH 1KN4H 4NNXB 4OV6F 4ODUB 2BX5A 2G5RA 5E6YA 1BZ9B 4IIQA 1OGTA 5ADOL 2QL1A 4G43A 4KMTH 1J8HD 4YDKL 4JRYB 4EJ1C 3MUGB 2I9TA 2DDQH 5FYKL 3ULVE 3DMMA 2AI0H 2RCSH 3SDXE 2X1XR 3U2SA 4CVXB 2P46B 1Q9LA 5E8DH 3PQYD 5IGXL 4RGMB 5DMGD 5HI3C 2B5IB 2ICWB 2VXSL 3HR6A 4GAGH 5IMKB 1UB6B 1JGEA 3SCMD 2HMIC 3MRDB 4UQ2A 3S6CA 5JPNA 1YN7B 5IESL 4HIIB 3IDYC 1A3RH 1PG7L 4GQ9H 4N8VB 1FHGA 3IB4A 1FO0A 3PGFL 1YY8A 4FNLH 1G7LA 3RHWF 1MLBB 5JR1H 1WZLA 1TZHB 5DMIL 4JFFB 1FNEA 1ZOXA 4GG6B 2WW8A 4PS4L 4JO2L 4N8VG 3C6LC 4HIJA 3VFWB 4RFNC 5HGAB 4NO2A 2XTJC 3F7PC 3X13A 1QHPA 4XB8A 3S5LG 1FNSH 4O02L 4X6CB 3QCUL 5T5NG 3BMWA 2ZG3A 4NOBA 4Y8DC 1MCWM 3UTQB 5KS9B 2FWOA 4JZJC 3DXAA 5C0BB 3T8XB 4FTVA 4GOSA 3F7VB 1KPUB 5FKAB 4Y4KB 4PG9B 5ESAA 2P8MA 1NCBH 2IALA 2OL3H 1VKXB 3RWHB 3DVGA 1C8PA 3Q6FA 5C0EB 2BC4B 1R5IA 4MD5A 3RPKA 2DAVA 5GZOD 3HFMH 3DYPA 2HRPH 1T66C 4M7LH 4X8XA 5I18H 3AXLB 5FA3B 1J5OH 1UZ6E 3ECBA 4NYLA 3MJ8B 1OGAD 4PBWD 4DEPB 2GTZA 5C3LD 5C86A 4ORGA 3T65A 5J8OA 4G6FD 1YEKH 1YJDC 1CICC 5HI3D 2V17L 1IT9L 3VG9C 1K8DA 3SY0A 4OCWH 2FSEB 1I8IB 3TVMD 2OTPA 1U8MA 2QQLH 3FRUA 4ONGL 3B5HA 4BKLA 1D5BA 5C09E 3R06B 4GRWB 2F5BL 4EZMA 3BRFA 2NPLX 2OK0L 1AY1H 5ID1A 4R90H 4HPYL 4JFZH 1PEZA 2X7LA 5I6XC 1OWRM 5DRZA 4JREB 2Z93B 4FRWA 4XNMA 4ZFFB 4CKVX 1D5ZB 1EHLL 5DURB 4U6YA 1E4KC 3T0EA 4HGKC 4PP2B 5F7NC 3QDGD 3O3AA 4XWGL 3D5OF 4KDVA 5E8NB 4EI5D 3UYPA 3T09A 2IPUK 1G7PA 3QEQA 2IQ9L 4QRPE 4NWTH 2NY1C 3WBDA 2X89A 3FN0H 5B3JF 5MENE 4WI9A 1QRNB 1CXKA 5KANI 1G6RL 4WFHD 4PRHB 5GPRA 4NSKA 3D25B 3UJTH 3HAEA 3JZ7A 5E6IB 1FBIH 4NQUA 5GGSA 2CPCA 5DMKB 4N9GB 1MRCL 4KDTC 4PREA 5IQ9A 2EXWD 4U1JA 3FO1B 2J88H 4NT6B 1WGOA 3DVFA 1OW0A 3LKQA 5K9OA 2X1QA 1YNLL 4GBXD 2AJYH 1AR2A 3NCFB 5I19H 4JFDD 3CMOL 4QTHB 2QHRL 1I1FB 1T83C 2OQJA 4KJQC 5AD0B 1OAKH 5T1KA 1UG9A 2CDEA 1RZ7H 4HT1H 5DFWH 4A6YB 1E28A 1AJ7L 1Z5LA 3PIQA 4DKAA 2AEPL 4XBEH 4HUWA 3AS0A 3VFMA 4WGVB 3I6GB 4NQTA 1YDPA 3KDMB 5IW3A 3S88L 5FO8B 1B88A 3TBVB 3I50H 3BZFB 4PJHF 1HE7A 4HKZA 4XP9L 2VZ3A 1D6VL 1RUML 4MA7L 3VFPB 5ESQA 3OPZH 1W72H 3LKNB 3EJZC 5JQ6H 2C1PA 4ZFZA 1MRDL 3BT2L 2F5BH 4KTDH 4L4TB 2CIKA 1S7QB 1JZ2A 1YMHB 3H9SE 4U1NA 1L0QA 5FYKE 2G2RA 3ZKQD 3PQYA 2B1AL 4FFYH 4PJAE 2AEQL 3AY4C 1ODAA 4U6HB 1VB9A 4X4XB 5IT2L 2ICWI 4JZNA 1NKRA 2J2ZA 2FJFA 3QIUD 2C1OA 6CGTA 1EAJA 1LO0L 1A1NB 4D9QE 3BXNA 3U6RB 4HK3N 4YHMH 5BVJB 4DAGH 3KPSA 5LXGH 4NJ9L 3GKZA 4LSPH 4HHAA 1IL1B 5AZ2H 5E2JA 5EOTA 1UC6A 4FQXD 4XHQA 2B0SL 1FORH 1A21A 1YMMB 1T1WA 2YBRA 3DURB 5LVEA 3KS0J 1JZ8A 4JEGB 3TBSA 1BVLA 5EUOB 1TVHB 3RUGE 3RX7A 3QULA 5ADPH 3AAZA 4KVCH 3S96A 5JA8B 1RVFL 3PWPD 3IDYB 5ISZD 1GGYA 4ODSH 1GSMA 2RJMA 4ISVA 2DYPB 5DJAB 5DJ0B 5GRVK 5BCAA 4YHNB 3KPTA 5FUCC 1KBGH 1T5WA 4HUMB 4DOHE 4S1SL 1JHTA 1P1ZA 5BRZB 1F4YL 1R3KB 3V0WL 1D9KD 1MRFH 3VWKD 1UWGH 2ADFH 5I2IA 3MUJA 4QRRA 1L7IL 1CTNA 4ELKB 2IQ9H 5DHYA 3TPUA 2UUDH 5BXFB 3GMMA 2QQKL 3GMRA 1WFOA 2QQLL 2DWDA 1FFPA 3KLAA 4NRZA 3G5YB 5IMOA 1BJ1J 1QBLL 5LGJB 4LSQL 4OIAA 2FJGA 1FC2D 3WLBB 2WWKT 4MS8D 4QF1B 2EDJA 3BN3B 1A7RH 3DI2B 2D0HA 2DWDB 4NKMB 3BOVA 2NY7L 2EEAA 4JJ5A 4I48A 1G9ML 2OJZH 4LCWB 5BXFA 1KCRH 4Y5XB 2XZCL 43CAB 5FEBA 5MENB 3OTTA 4LNVA 1TJGH 1U8PA 4Y5XC 1HSAA 4Y5VB 1S7TB 1A7NH 4X5XB 2P7TB 5DXWA 5GISL 3BEVA 3NABH 4OSUL 5DA4A 2DLHA 1TJIL 5JPMA 4BQ6A 3NAAL 1P7KB 4AG4L 4OFDA 1BVKB 1U58B 4OQ1A 4DVRL 4NBYB 3AC0A 3QDGA 1MUJA 1U8JA 3EFDH 5EOQH 1BFTA 3GBML 4K23L 5E2WL 1LO5B 3NIDF 5LQBH 3ES6A 5HY9B 4M6NH 2P5EB 1S9WB 4U31A 1N26A 4K3DH 2BSED 4HPOL 2R9HD 1NFKA 2PYEA 3CUPB 1T5XA 1E4JA 2K7QA 5KSVB 2R1XA 1WT5C 2V2XB 3RGVD 2B8OT 5TF1H 4OTXL 3AB0C 4CVWA 1XEDA 2NCMA 2XZAL 3MACH 4WTZA 1NEZB 1WK0A 3EO1B 3G5VA 5FHAL 4P2QD 1BX2A 1SJXA 4ZUUA 5T33L 1YMHA 4XPTH 3BIBX 3ME0A 3GSWB 3T77A 5B3JE 4F7EB 5GSRA 2XYCA 4R3SB 2EE3A 2QTEA 2VDRL 5EU6A 5C0AD 1S7SB 3U46B 1MH5B 2VDQH 3O11A 1C5BH 3BISA 2YUVA 1UKQA 2F54A 1UJ3B 4NP4L 5CHNB 5DFVC 3HMXH 3KGRA 1MI5D 4NN7B 5TDOB 3HCVB 4G5ZH 4PJXE 5I9QB 4KKLD 4YGAB 2VDRH 2R0WL 4JZOA 1OD9A 3PP3H 4YPGA 1K9TA 1YC8A 3BSZL 5L8KB 3VFSA 1HXYB 3DNKA 4MCZB 3EGSA 3B6SA 2XOTA 3R8QA 1FCCA 2AK4D 2HLFC 2J8HA 4PJAA 1UWGL 2VOTA 3U82B 5D6CB 2W9DL 1XGQB 2FGWH 1QKZL 4WU7B 1A0QH 1KJ2A 1N0XH 4WY7H 1NEZG 4R8WH 1PFCA 2IADB 3F7RA 3HS0B 4NQDA 3TT1L 1KFAH 4YHZL 4LGRB 4MNGE 1BJMA 2XNAB 4JZJA 4X98A 3I6KA 2J8UA 2WAHA 3I6LE 2YMXH 4KRLB 4HJGA 1K4DB 1DEEB 4JM4H 5HPOA 4CMHC 1I1AA 2IAMA 3HC0B 5D93C 3QEGH 4RGNB 4U6YB 1TJHL 2ITDB 4R8WL 4XNYL 3P0VH 4KRPC 2WANA 4KHXH 4GQ9L 1OARH 3K8MA 1S7RB 3CFDA 1BOGA 3NAAH 1E0OB 1NJ9B 3O6FC 3TN0B 3CFCH 5C09A 1U8LA 1LQSR 5I15L 1JRHL 1B0GB 3BN9D 3IGAA 3VWKA 5IB4B 2ZUYA 1C5CH 3EO0B 1JYNA 1NPUA 5E99H 4Q6IB 1I8IA 4WJ5A 4ORGB 5JHDB 3VFNA 3JTTB 4B53A 4C54A 3HUJB 2MQ3A 4NQDD 3CLFL 5EU6D 8FABA 1F4WL 4LLVB 3ZYJA 2Y07H 2CLVB 3QXVA 1KCLA 3C60A 4P3DA 3PWVB 2NZ9C 3QEQE 5CEYA 3EOTL 3SBWC 1AGBA 3Q1SH 2QV2A 3QUXD 4QXGL 1P69B 1J8HA 3LSOB 1FZOB 5ERWA 3C08H 4GAYB 3IKCB 4M4PA 3F7VA 5FUOL 3WKNA 4TULL 3DV6B 5IR1A 1M6OB 2JIXD 3DWTA 4ZFOB 3T0ED 5IBUG 4QHNA 3KPRB 2GSGB 4NHCL 1SBSH 3C5JB 2I25N 4Z6AT 4QRUB 1EGJL 3V7AE 1BIHA 1D9KC 1AO7B 4GSDL 2P8PA 5C0JB 4ZUVA 1YNKH 4H5SA 1JYXA 1CDUA 3UYRL 3DO3A 2A9NL 1OF2B 1AGCB 5EU3A 1HI6B 4ODHL 1NGZA 1U8OA 2L4OA 4LKXA 4OBSA 2X44D 3C6LA 5DFVD 4NM4L 1BWMA 5CEYB 3O4LA 1F58H 2J7LA 4HWZB 2IANA 3UPRA 4PUBH 2V5YA 2CGRH 1VEOA 3IXTB 3AVEA 4M43L 1TQCC 4TUOB 2ZUSA 2OTWA 4RMUA 5DVLA 3MBED 3FQWA 4XGZB 3OBAA 3O6FA 4BSVB 4NWTL 3GSVA 1DBAH 3D39D 5GGQL 3G5ZA 4DVBA 5HHXH 1TVBB 4YHIB 1CVRA 2GEEA 4HBQA 4R26H 4EQ3A 4M02A 4JDTH 2UWEE 1IEAA 3GB7A 4JO4L 4QT5B 1NMBL 4X7SL 1F3JB 5H37G 3VFRB 1B4RA 3GMPB 4UV4H 3UBXA 4P46D 1G7HA 5AG8A 2BNQD 3V79C 4JDZB 4FZEL 1FIGL 1XCTB 3ULUD 4BUGA 4UINL 4PJ8C 1W0WB 4XMPH 4ODXB 4RWYH 1RUAL 3QUYC 3QWRD 1ZEAL 4AH2B 4R4ND 5KJRL 1GAFH 2EYRB 1IKNC 3DROA 5D1QA 4WCYH 1WWBX 4RZCB 5B21A 1PW3A 1AD9B 2DTMH 5KSAA 1BAFL 3H3BC 4XMLL 3C5ZA 3OJVC 3QDJB 5HYSA 1QR1B 5BO1H 5EWIH 3QUKB 3VG0H 1TZIA 1OP3K 1OL0A 4U6XB 2R0LH 4S1QH 5ENWB 2XZAH 4OF0A 5D1ZA 4J3TA 3WKML 5D2NB 5ITBH 2GJ6D 3VMNA 2NY5H 4HXBH 1QR4A 4YDJA 4UNTA 4LCYA 1ZT1B 4YAQB 3SJVE 1DBJL 3MBEC 3SO3C 4IBLT 1AFVH 1PSKL 5SWZD 3MXWL 4PJBF 5F88A 5I71B 3QIWA 5L0QC 1AD0B 4MJ6B 5I73C 3WHXA 5CD3A 4KKNA 3BJLA 4PJ5D 4QKXB 1T66D 1CXHA 4QO1A 1M7XA 1OAZH 1JTPA 3NN8A 4XPHH 2BSSB 3TFKC 5JIIA 1Y6MR 5J89A 2FIKA 1CFBA 3QCTH 3KHQA 3KNBA 1JRHI 1WZMA 2BDNL 3PDOA 4DAGL 3U46A 4S2SB 1B3JA 4HG4J 3TBWA 2C7UB 3IYLW 4N0UA 5IM7A 2W9LA 3MRHA 3U4BH 2NQCA 3JVGA 4P2OB 5DK3A 3WFEL 4ODTH 4PP1C 2E8ZA 4JFOA 3MREB 2C9AA 1FIEA 2BVPA 3LEYL 1CF8L 5D8JH 2Y06H 2UZYB 4GAJL 4LSRL 4ELME 1HHJB 2DQFB 3PJSB 4XMPL 4S1SH 3TBTB 43C9B 2R1WA 3D3VB 2FL5A 1J1PL 3ARUA 3C09C 1ZEAH 2FO1A 4Y5YC 5E5UB 2WBJB 4OF8A 4PGBB 3V52L 2Y5TB 3S88H 3ZKSD 5JQHC 4YBHA 4G6AC 5E4EC 1MCNA 1JF1B 5D1ZD 3P0VL 3A0OA 1YQ2A 4LSDA 2ZSWB 2OTUB 3O3BB 4KJYA 1OTSD 4BFBD 1FYTB 4I18B 3QI9A 2V17H 2YD4A 4YXLH 5F3HA 2RFXA 4WHYG 2Y36L 5MERA 5H37H 2PTVA 1BFVL 5IVXF 5IEHA 2Q86A 5DQ9B 2X70A 1RPQA 4JY4A 2C3VB 3SGJA 1G1YA 4BZ1H 5IKCB 3WIHA 4QRSA 4I77L 1IKNA 1OAZL 1TTGA 5IFHH 1MY5A 1ZA3B 5IHZA 1IZKA 4WUUE 2VE6B 1M7IA 4JJ5B 5C08A 1HYRC 2V7NB 1DLHA 1J0ZA 4M8QB 1F00I 1LILA 3S37X 2BVQB 4U3HA 3RBGA 1HXMB 2Q8AL 3PGDA 1KXTB 4XZUA 4MXVE 2FHCA 4PJHE 2YUZA 4LARH 5EN2B 1UM6H 5EBLA 4FFWD 4RFOL 3FQXB 4LSTL 5ICZA 5GIRB 1XGRB 1U8KA 1QVOA 3C08L 3L7FB 3REVA 2AJZA 4OUOA 4OM0L 4H0GA 1JZ3A 4HC1A 1JPFA 4GRWF 2HRPL 2VRAA 2R69L 3ROOB 4M61A 4C57C 1V7ML 2F53A 1SBBA 3L3HA 1FJ1A 1JCKA 3LKSB 1HKLL 4I2XB 5C0AA 3QWQB 5J7CC 3RWCB 4PTTB 5CWSB 5HSFA 4JAMB 2H2SC 3ZL4L 4XPTL 3PF2A 5CSGA 3CFBA 3EHBD 2PF6A 2J6EL 1WZ1H 1XIWA 1RIUH 3TCLB 2AI0L 5IG7A 5LGKA 3QCUH 3QISA 2BOBB 1G7MA 2P44B 3MO1B 3O2DA 1BQLH 1G0DA 3PGDB 3G5YA 2HH0L 1XGUA 5IMOB 1YJDL 5ALCL 1E27A 2V7NA 1KTLB 1SYSA 2R8SL 3FFCD 2C26A 3TPUB 2YZ8A 3M8OL 1RULH 3VFOA 1YUHA 2I07A 4XCYA 5JR1L 4FNLL 1PQZB 3FL7A 2EO9A 5DUBB 3M45A 5I1JH 1U3HA 2ICES 1X5KA 2G2RB 5JTWA 3SE8L 4JHAH 2KUTA 3RGVC 2V2TB 3TZVB 5JIPA 3FN0L 4TN9A 5FECB 3W82A 1UXWA 3WN5A 1VFMA 3R0MA 1G9EA 3GMOA 4HH9A 4YFEA 4W70A 5DJ8B 1A4JB 3MJ9H 5F9DC 3QEUB 5CBAA 1HKFA 1N0XL 5CIPB 1JPTH 4UIKH 3SKMB 4QOKB 4UDUB 5GGVH 4P5TD 5JUEH 1H0DB 3ARFC 5FGBA 5E03A 2P8LB 3DV4A 1YPZB 4R7DA 1YDPB 5DLMH 3ET9F 2CK2A 3DYMA 4JVPA 1IL1A 1K8IB 1Q94B 3HE6D 1S5IL 1KTKE 2XZQH 4E41E 1HHGA 3DETD 5E2UL 3AM8A 4KRMB 5CMAA 3BP4B 4ZNCD 5DJDA 2NX5D 1KIRB 5KAQF 3BKYH 2R69H 1YQVH 5CFHA 3ROLA 2DQFA 3PJSA 1KTDB 1NDGA 3MR9B 3IF1A 5EUOE 2R39A 5DVNA 5GJTH 1S7WB 4WUUA 3VXQA 3DMMC 3QNYB 4U1NB 2XZQL 1ROWA 3IJHB 2E6JA 3N1PC 3SDYL 5ACZB 3QCVH 4JKWA 1AR1C 3NFNA 2EC9U 1WIPA 3FQRB 4IIQC 3CJJA 4IMLB 3MREA 5DJ2A 5AWNH 3DOSA 1OLLA 4Z7VB 4GMSH 3H3PL 5D2LE 3MCLH 4U6VH 5DK0A 1JZ7A 4P2OA 4Y16A 1KB5A 2OLDA 1HDMB 2O5ZL 4EUPA 2CIIB 2W65A 4ZAKC 3UTOA 1MJUL 2YS4A 2DJUA 3B2VL 4OLYL 3NIGF 2DL9A 3EYOB 3RWFA 2AK4A 4UQ3A 5DRWA 4A6YA 1IGML 5IW6A 4R2GD 3LB6D 2UZIH 4XNQA 2IG2H 3LEXB 5ACMA 4LHQB 3ARGD 3GMLB 3PNWA 1AKJB 2XI9A 2EIEA 1I4FA 4UT7H 4HUUA 4U3XA 1CDJA 4GG8A 1LK3H 1KEGH 5DGQA 4NQSB 4PRPD 4QXTA 1KJ2L 4J6RH 4P2RE 2VKXA 4YDJB 4YDLB 1TZIB 5HHOD 3IVKA 4B7LA 1FFNB 5DHVA 2IC2A 5M95B 1BVZA 3T65B 2VLJB 1NC4D 1QRNE 3ORJA 1R3LB 3PE9A 1FDLH 1SMOA 1IC4L 4MA3B 5CIPH 1AGDB 4JFYB 3WJJC 3LIZL 3ULUL 5KSAB 1VESA 4KJPC 4PJ8A 2XPGB 4FQQA 5DT1H 4W6XB 1YQVL 5C09D 3F6IA 4XPGL 3RFZC 2V6HA 1CE1H 2BNUA 1SQ2N 5BV7L 3MUHL 5F3BB 1P6FA 3O4OC 1RIUL 2J6EH 3GDBA 5AYQA 2ED7A 2R4SL 4ZQKB 1QEWB 3KJ6H 5HVHB 1HN1A 3GMPA 1TIUA 1X6LA 2X9WA 3MV8E 2VNCA 5EZOH 4Y8AA 1F3JA 2VISB 1I1AD 2IAMD 5EULV 4YXHH 5H2BA 3OB0K 4CNIA 1ITBB 2XQBH 2YN3A 4CU8A 1JPSH 3PWPE 4PJCB 4YHIA 1RIHL 4QGTA 1NC2B 1GH7A 3CVHA 4X5LA 3FZUC 2AV1B 3F58L 1EMTH 3IJSA 1LK2B 1ND0B 4GAFB 4R97B 3MV7E 2BY2A 4K2UH 4HWZA 1FYTE 4HIIA 2ADJB 2Q1EA 4XHJD 1B4JH 3MRBB 2UZIL 2Z31C 1BREA 5D7IF 5FO7A 4JPVH 3BVNB 1J8KA 4XCFL 1WZKA 3MRFA 4H1LA 4OZFH 1YNLH 3SE4A 3CVHB 3VXMD 4FN0A 4NQVB 1XZ0A 5ESAB 1HOCB 3QG6A 3DMMB 4RBPK 5JZ7D 4TTDC 2WBWB 5C0FB 3G6JA 2FO4B 1MQKL 4P23A 2X2YA 2HYMA 4ZS7H 2E8YA 4QEGA 3OAUH 1WF5A 1C1EL 3WFZA 1CI5A 2XZCH 4JFHD 2FIRT 1CICA 2P4AB 4KXZH 1NLBL 4OZHB 2UVFA 4P2RB 3HI6L 5L6YH 4RSVA 3MSPA 2VABB 3WIHH 3O9WD 3MRMA 3O3EB 4HUVB 2YC1B 4KKCD 5D2LA 3QFDB 1TNMA 3NABL 4KY1L 3C60B 4PD4K 3KYAA 3PWNB 5C7XH 1AGDA 1EIBA 4YZFF 1OY3B 1JMXA 2DQIL 5CZXD 5MEOB 5IK3B 4JDVA 2ARJA 2FD6H 4OZGB 2C3XA 3HPJA 4UOW0 4OFKA 4Z7WA 5EIIA 3E6FB 1NFDB 1H3VA 1FAIL 2AJXH 3QQ4B 2YWZA 4JO1L 5E5MA 1CDCA 3Q3GB 4PRIE 4GS7B 4BZYA 2Y06L 4D9RE 1NBZA 4LSSL 1B90A 1RHHB 2HTKD 4HJJH 4X7TA 1NCNA 4NZRH 1CICD 2ZPKL 4KI5E 2BRRH 3TNNA 2NNAA 4HMEA 1DN0A 1NGYB 3WL9A 4K23H 3EYFB 1N5AA 1A5FH 1EJOH 3QIUC 3NCBB 3L9RB 2RAMA 1CLOH 1T22B 1VPOH 3FB7B 4YQXL 4NQXB 4KQ4H 1T6VN 3W0WB 3W39B 2GJZA 3RL2B 5IUSA 4NFDA 1EDQA 4GAGL 1MQKH 2MNUA 3F6LA 4Y4FC 4Y0GA 5EO1A 5HHNB 3VXUB 3P4MA 1WWAX 4JG1L 4G80A 2H26B 1RZFL 4LLQA 4B5EA 3EHBC 1DQDH 3CXDL 4ENED 4JFFD 4YPGB 1FPTL 1B0RB 4BFEA 1C16A 3CVHL 3H6JA 4YPJA 4DN4H 3LS5L 3QIBD 4BH8B 5DD6A 1A8JH 4NCC2 2AXJA 1K4CB 1U3YA 3QO0B 2YPLB 4MAYA 3PL6D 4HAFA 1QOKA 1DQJA 2CKBL 2VZOA 4OT1H 5AUMA 4CN6A 1ZAGA 3MZTA 4YXHL 4XBPB 4RFOH 1U8IA 1GAFL 3K7UA 3NA9L 3TJEL 1XR8B 5CBAB 1G6RA 3JWOH 4RMTA 4O2EA 3F12A 3QIBC 4NPYA 3P11L 1TFHA 4MJ5A 4AL8L 3PV6A 4ZUUB 1KELL 2MMXA 4OZ4B 4OLVH 4OLEA 4RGMC 2HLAA 5FYKD 4JM2C 3H8NA 5HYJB 1FG2A 1F4HA 2B4CC 2CUIA 3I75A 4HT1L 3EKCA 1CBVH 1I7RA 2DQGH 1LMKA 1JIBA 3OWEA 3DUSA 4ZO7A 5IV2B 1H3PH 2A0LC 3VXRA 4MNQA 3T0EC 1N7ML 2VWEE 4OGYL 5D7LD 4A2MA 2HVKA 3M1BB 5GGTH 2JKXA 1NMCC 4WTWA 1CD1B 3NIDE 3ZTJG 1WBYA 4JRXB 1U8QB 4PJEF 3NGBC 2DWEA 4LCUA 4WO4B 5SWSE 5E9DA 5D1XB 2G5BB 1GZPB 3JWDH 3RPIB 4XMKL 5HY9A 1HHIB 3HC3L 5BO1L 1KUMA 5HD8D 3LOWA 1U58A 1NANI 4JFEA 1EO7A 2NZIA 4Q2ZA 3QDGB 4K3EL 5B22A 1INDH 1WCBB 2IAND 5KSUB 1KXQE 4Q9CA 2V2TA 3I3BA 4Y5VA 4XNUL 2OSLA 1MEXL 1KB9J 5F72S 4KZDH 3ZO0A 4DUVA 3IS0X 2DIAA 4MX7A 2X4NB 3RTQB 3SJVD 3QWRA 1H15A 3GSNH 5TGBA 4W6WB 2OMNA 1MHHA 4ZSOE 5DVKA 1S9YA 2KL6A 1Q9WB 5D2NE 2APXA 1PEWA 1D9KA 1VACB 3V4UH 3OAYK 4KUCF 3BI9X 5KANG 4G8EA 4KPHL 5IWLC 4PP1D 4E5XA 1YEFL 5B8CA 3BPLB 3M17B 4WV1B 3ARFA 5FGBC 4JFDB 4CVUA 1S9VA 4M93C 3VXRE 2ATPB 3SO3B 4R7NA 1ADQA 2NXZD 2XN9D 3MLRH 2PO6D 4KU1A 4FQ2H 4NKIH 3CNKA 1C12A 2LVCA 5TPWH 4RMQA 3L5HA 4POYA 5TE7H 1MHHB 4XP6L 2MHAA 4X6DA 3TWCH 1FCGA 4Q0XL 4U1HA 5BW7C 1AC0A 3VFUB 2QQNL 3P9MB 2F53B 4ZOAA 3H0TB 4GW4A 2I27N 4JFPA 4P5KA 4Z78B 4ODWA 3CSYB 1QSFA 5DJ0A 3VH8B 5KVMC 4OLXL 2RFXB 4Z7WF 3E6HA 3C5SB 4HCRL 4L4VB 3WJLC 2COQA 3CH1A 1QLRB 4JM2B 1DSFL 4JLRA 3MMEA 1XF3B 3WYRA 5EOTB 1WC7A 3S4SG 3P3YA 3U7AA 3ILPA 3GGWA 4APQC 3ESVF 1E4XH 5CEXA 4GW5B 1P84J 4DZ8B 4F9LA 1ZLUK 3ZDZF 3V6ZB 1MJUH 3K80A 3ARFD 4WFFE 3JUYA 3NOIA 5IJKC 4EN3A 4RAVB 4NIKB 4JZNB 3KLDA 3S4SA 1KN4L 1CFQB 1IFHH 2PXYB 3P9WB 3DVIA 2EKSA 3RKPA 2GQHA 4QTIH 3OKKA 5EO9B 1A6PA 3QWOB 5DK2B 4PJ8D 3QI9C 3V6OE 3VG0L 1ES0A 3ILQC 5C07D 1XF5B 1LEIB 2FX7H 3WUWG 3FKUS 3IDJA 1I9IH 2AK1L 1I7UB 5IB1A 4TVSa 1N5YL 5F7DA 2F9BT 1OSZA 2X4OA 2Q87A 3QXWA 4GKOA 3SGJC 3I6GA 2ZSVA 2VQ1A 1DEDA 4O51A 2B2XH 4RGOL 2EO1A 1OAUH 1QLFB 1W2KT 2NY4B 4I0PB 1MQ8A 4IS6A 3LD8B 5FDYA 5DEGA 5D9SB 3T3MF 1SYVB 4Z95H 1D3CA 2Z92A 4U49A 32C2B 4KFZC 3RWGB 3NIFF 3NMEA 3WN5C 5IVXB 1U8NB 4G7YH 4XVUC 3RVUD 1T21A 1MJJB 4DCQB 5J1TC 1QFUH 4PJ9A 3CAFA 5F1OB 2V5RA 3SGKC 1VHPA 5TDPA 4L8DA 5BV7B 2VDLH 5DD0H 5HGBA 4OQTH 5JO5B 3EZ8A 4TUKL 1U2CA 1QLEH 4MNQD 2V5SA 4V1DA 2X4QA 1IC7L 3JVGC 3JWDL 4NOFA 1OAYL 3KAAA 1CT8A 1O7VA 1QFUL 2VB5A 3P4LA 1NAKL 4JB9L 2I24N 3HNTL 4WRLA 4DUXA 4DKFL 1ONQB 4NJ9H 4JQIH 3D18B 3MRHB 3HI1B 5K9QG 3BZ4B 4ZSOB 4C55A 1AQKH 4C4KO 3EYFA 3IKKA 1UKSA 1JI2A 3EYUL 1VEPA 2XA8H 3OB0H 5E95B 2Q3AA 2EE9A 5IFHL 3L3JA 2FGZA 2CQVA 4D0BA 4PRPA 5DRZB 4ODXA 1CGSL 2XKNA 3MNVA 4C56A 3DPBA 5IBTH 3U0TA 3ULUF 1NBZB 5IROC 5H8DA 2D7MA 3C9NB 1MCLA 3CDGB 3OQ3B 4MD0A 1D5MB 1C5DB 1Y18A 4OAWB 3R06A 1V3KA 5KVEH 3QQ4A 5T3ZH 2NY4C 1CR9H 2QQKH 1U3HC 3CK0H 4MLIA 5AYUL 5GS1A 2IJ0C 4CMHB 3LIZH 5DDHA 1CL7L 1YEEH 3GSXB 5GRXG 2W91A 5CJOH 3H9HB 5HYEA 1GGBH 3NFSL 4TSAL 1JP5A 3IDMA 4UMGA 2OZ4A 3MOAL 3DXAD 1OARL 2IPKB 5C70A 5D2LB 4J3VA 3VA6A 5CEZE 3OKLA 3UYOD 5KAQG 3BH8A 1EEZB 4L3AA 3Q6FB 3LS4H 4EDXB 1JRHH 3OZ9L 3T0EE 1Z9LA 4DZBA 5D96B 1IAIL 1MIEH 1MRFL 4M3KB 4FXGA 4JDZA 3BAEL 4RMVA 2VDOL 1JNNH 2F19L 2GK2A 1P5UA 1QYGL 4MS8C 3MPCA 2IF7A 3CCHA 5I19L 2OS7A 3K2MC 4Y2DB 3MX0A 5ABDE 1UJ3C 1GRWA 3LAFA 2HJLA 5E2VH 3GSVB 1WEJH 2HG5A 3NPZB 2BRRL 2VJXA 4TSCL 3KR3L 4OGAC 1HKLH 5F70A 4HGWB 3QZWA 2I9LB 2DMBA 1UH4A 4PB0L 4WY7L 4LLVA 1IQDB 4YHPA 5IMKA 3SGDH 3BD5A 3LN5A 1E4KA 3OGCB 1Z3GL 1G7JA 4FQXC 3QUMA 3E8UL 2VMFA 4GRLC 1FGVH 1MAMH 2P8PB 3IU3B 3MRKA 2KQMA 2YD7A 5JHLL 1CGTA 1B0GA 3U9UA 3T2NH 3QIBA 4HFUH 4I0KA 1D5MA 4QHNB 4ODUA 3BKCH 3TBYB 5CGTA 4M6OH 4BFIB 3ZKND 2IGFH 2WQ8A 1WIOA 2ITCB 3OHXA 2QADC 4UT6H 1BD2B 5EU5A 2EH7H 5TE4L 3RY4A 1B2WH 1C5BL 3N9GH 5IFJA 5IB2B 2XPGA 4OI9A 4ZUTB 2VXTH 5EU4A 4XC1L 4EVNB 3HTLX 4RWYL 1T7ZA 3H7BB 3MROB 1FC1A 1W72A 2VLJA 1KLFA 4NZTL 4P23C 1CZ8H 3LQAC 2ZCKH 4HBCL 4MA3A 2ZUQC 5JOEA 3AS3A 4KKBC 1NAKH 4JB9H 4H0IA 3OL2A 4I77H 3SKNB 3MRQB 4Y5VC 4ONHB 3NCYP 4ESKA 1N8ZB 2NY0C 2JB6A 1OTSC 1ORQA 3PHQA 4Q9RH 3FN3A 5DUPL 5C6TH 3N1GC 5GZND 5DC9B 1OP5K 4NBZB 3CDGA 1B6DA 5IVOA 1IARB 3GJEA 4N8CH 4XAWL 1VFBB 2DLFH 1I4FB 5SWQA 4LPTA 4HG4K 1D5XA 4NZUH 2DQHH 1PYWB 4PJXB 5T1KD 3EYOA 1PY4A 4QRPD 3GO1H 4JPIB 5IBLC 5CHNA 2WV3A 4P4RA 3QEHB 5D9SA 3H9YA 1XCQB 2DDQL 3O11B 1K2DA 1HDMA 4W4OA 4IJ3C 3SPVB 3RGHA 2NY3B 4W81A 3RTQC 4L9DA 3RWDB 1G7QB 1TQBB 1DUZA 3E3QC 3BH9B 3O0RH 5FGCB 5HYJE 5FK9A 2NXYB 3OR6A 4R96B 3GSWA 4U4BA 3JV6A 5D6CA 5GHWH 3NFNB 3S35H 3UBXI 3P40A 3DJ9A 2IGFL 3VXQB 1C1EH 2PYFB 3VGDA 2N7BA 1FVDB 2AJ3A 4QCIB 3DSNA 1QACA 2MPAH 1ZLWK 1FNHA 3D39B 4WO4C 5EPMA 5I0DA 3TVMB 2OCFD 4R26L 2AJSL 3OKOB 3MLYL 3WIHL 2EYSA 3WXWH 3BP4A 1IQWH 3UJIL 5LAXB 4ETQB 2QEJA 3QHZH 1HHGB 3UTTD 2NZ9D 4IS6B 2ADGA 4YHOL 2IPTL 1UM5L 2VQ1B 1JGDA 3VE0B 3DSFH 4PGCA 1ZWIB 4XXDA 1FG9C 1XGYH 4RBPH 1I7UA 5IB1B 4PRHE 1DCLA 4OCSL 1EMTL 1IEHA 1DFBL 1N6QH 5CKGA 1KIPB 4ZD3L 4KQ4L 2YEZA 2P24B 3BUYB 4D8PA 4GSDH 4UT7L 3LV3B 1S3KL 3B9AA 3WNPA 3IDIA 2PXYA 3O8XB 4X99A 5HHVL 1SJHB 2Q7NA 3EJZD 4OZHF 5DJ6B 4DGIL 3K74B 3V6OA 3P30L 3RA7L 1WFNA 1KJ3H 2BNRD 4AIZA 2B4CL 1PD6A 3P4OA 4U1LA 1A6TB 4GRLA 1RJYB 4Y5XA 4EN3B 3T0BA 4NKOA 3NH7H 2ATKA 1YEEL 4QRTA 4MQ7B 4WUUD 5CCKL 5TFSH 3MV8D 4N5EC 2BY3A 2X4SA 1P7QA 2VSCA 4JE4B 4P23D 4GBXB 2Z0BA 3LEVH 1ZMYA 4XH2A 3BZDA 5MEQB 4OZIF 2WIMA 1VACA 3SDYH 2PYEE 5HHXL 1JWSA 4Z7QE 1J1XH 4ELKA 4KTEL 2YKLL 2OXGA 3HG1D 5DI8A 5EUKB 3QQNA 2K9UA 1FL6B 4K9EH 1SMAA 4UV4L 3T3PF 3Q6GH 3KPNA 1R3IH 3A6CL 1WCBA 5KSUA 1NKOA 2WLYA 4OCXH 4RQQA 1HHHB 1QFWI 5DEZA 4XVSH 5FO9A 4Z7UF 4OB5H 2MSPA 5DI8B 5EUKA 5GGRB 4CMMA 4FXKA 5HDBF 2UWEB 1U8HA 1P4IH 1IBGH 1YYLH 1M05B 4FTVD 4L4TD 1XAUA 4YWGL 2Z91B 4E0RB 4X6CF 1MNUL 4MNHB 5JW3H 4OF6A 3HZMB 2FBOJ 4M7LL 1IZJA 2WP3T 3ZDXE 3IJYA 2A2QT 2W0PA 2R56L 3BDXA 1UWXK 3D85D 3ZE0F 2IH3A 1RZGA 2E7HA 1A4KA 5EDXA 2GFBA 3F5WA 4LHUG 4KH2A 4XMKH 4AIZB 4OLWH 1AGEB 2GK0A 2DBLH 1KCSL 1ZHKB 4AZ8A 2D4DA 3LMJH 4PJIF 5A16B 3VFVA 1KJMA 3I02A 4IRSA 3TVMC 4S10A 4ZFZB 1MFCH 4D8PB 3KJ4B 4DEPC 3SE3A 2WMPA 3HA0A 3VFPA 2E5EA 4JFEB 5GS0C 1N7MH 2DYPD 4WI8A 1DE4B 3KHOA 4JY5H 5EBGA 4JGJA 3WFBL 1ETZA 3ZLQC 3C8DA 2YSSA 5D1XA 3RBSA 1I3GH 5LKNA 3VD5A 1BMGA 1L6XA 5HJ3A 3S35L 4IOIA 3G5XA 2HAZA 2W0FA 2D03H 5DC4B 1JNJA 1XGTA 4L8SC 4QHUB 2QSQA 3WV0A 1IGFH 3OJDA 3CU1A 2AGJH 3CVIH 3GZKA 15C8L 3GSQB 3BXNB 1YY9D 2H32A 2ORBH 4HV8A 1KXVC 1IMHC 1JUFA 1I1FA 4NJAH 1S8DB 2OZ4L 5E8EA 3ARED 1UQSB 4J3SA 3QDMD 3D39A 1ZTXH 5DUML 3VXNA 4X9BA 4ZAKA 3RUGF 4OT1L 2FX7L 3DUUB 1YECL 1OTUC 4OKDA 3VCLB 2JJSA 2V5TA 3ZDYE 5DD1H 1UVQA 4LU5L 1NGXB 5DMKA 1RUPH 2MQ0A 5MEND 1KJVA 1A7PL 2Z35A 2Z31B 3EYVA 1FN4A 4O02H 3BW9B 5I17B 3TBWB 4PJEB 3LEVL 2GIYA 2GJZB 3VXME 1J12A 4P57B 4ZD3H 1MCCA 2CXGA 2Y1VA 3QEHA 1HSBA 3U7YH 1GC1L 1WCQA 1MFNA 2BSTA 4FTVE 5IBLD 4UBDC 4L29B 4HAGA 4FP8H 4TPRH 1Z5LB 2IWGA 1P4LA 5GGRY 3KYKH 5AEAA 4E41A 3RA7H 4JKPH 3CX5J 4L8CB 1X5AA 3RVWD 4NN5C 1YYML 4U05A 2ZCLL 4XP4L 3H3KA 3SHSA 1R3JA 2O61B 4F7PA 4DW2H 4HS3B 1N6UA 4KI5C 2WSKA 5EO0B 1KB5H 4N1EA 5CZVH 2QADB 1RU9H 3P9LA 3GHBH 1F4XL 4V2BA 3BIAX 1DL7H 1GOGA 2FEEI 3P73B 1LE9A 5KSAC 4Z0XB 4Z7VE 3OAYH 4LSPL 4JDVB 5LGHL 2HFGL 1J1OL 4NQXA 1I9EA 4RZCA 4HLZH 5DD3H 3PXJA 1WT5A 2EECA 1MLCA 1K3IA 1T2QL 3WEXA 4DVRH 1YPZE 3D87B 1NBYB 3HG1A 3WL9B 4M62H 3L7EA 2JJVA 4JHBA 4LDEB 3TNNB 1H5BC 4LVOB 2GY7B 2IALB 4KK5D 1RY7B 1I7TA 3WIIH 2OR9L 4XVJH 5EU5B 5C3TA 4OF5A 3HE7C 5J12C 3TT3L 4YUEL 4FZEH 3O41B 4FS0A 4P46C 3UTSE 1A22B 1UM4H 4ODVH 3MRKB 3WIFB 3VI3E 5CJQH 2EDEA 3KPSE 4WW1B 4Z7WB 3U9UB 2RQ8A 3I50L 3H7LA 4OZIB 1UYWH 4Y2DC 3S97C 4OLUH 4K94C 3VFWA 1CGXA 1UCBH 2FX9L 4L8SA 3C2AL 1MCOH 1SVCP 2R0ZH 1ZV5A 2ESVE 1GZQA 3B8YA 3MRLB 1E6JL 4HWBA 1EAPB 3O2WH 4J7RA 1YJDH 2VUOA 4XWOC 2MCPH 5C0DA 1JFQH 3KJ4C 4OFYD 4WFED 2VTFA 3TLRA 5JPNB 5BZWA 2UV3A 2V7HA 4OD3H 3FZUD 6FABH 3LN4B 2KZWA 1A6VH 1EAPA 3FT4A 3DHJA 3O4LB 3HAEG 4OD2B 5B4MC 4V1DE 2C4FU 4M03A 3VD4A 1MELA 3L5JA 2A1WH 3EJYD 4HCRH 5I74C 4HBCH 4OFVA 4M5YH 1ORSB 5IB5A 4NN6B 1CFNA 1KPUA 1QP1A 3TYFA 1KIQA 4I3GA 4HKJA 3LY6A 1TTFA 3Q6GL 3RX8A 3H42H 3S98A 1X5HA 1BFSA 4Z7VF 3QH3A 2H32H 3C2SA 4ZOBA 3G6JB 3ARBA 2QKIB