1NCAL

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncaL01
3VWKB 1NGQH 2EYRB 3MRBA 5GS2D 1P7KB 2D2OA 5KVEH 4BJLA 1FZJB 5D7LB 3H3PL 2IWGA 4KZDH 3VG9C 4LLYA 1NPUA 1HINL 1QFHA 5FF6B 1T04A 1XCTA 4NQEB 5I8EA 1AGBB 1QLFA 5F1IA 2CK0L 1CD8A 3C8DA 1HILB 3WXVH 5TQ0L 4A2MA 5GQBA 1WBZB 4JZNB 2R2EB 4QCIA 5EOCH 1NCWL 3P4OB 4D94A 2NY6C 1OL0A 2DWDB 3QXUA 3U2SB 4Z7VE 4MCYA 3JXAA 3ZKMD 1IRAY 3I50L 4LF3A 1JF6A 4Z8FH 5EORL 1KBGL 5E9DB 5HDQH 1AC6A 4R8WH 1F4WL 3QH3B 1FFNA 1WAAA 4OCNC 3Q0HA 4DVBB 2VWEE 1EH9A 3HI1A 3ARDB 3SGEH 4G80A 1FPTL 3WXWL 3U79A 5T5FH 2HFFB 1EEZA 4DGIH 3G6DL 2YUWA 2CXKA 4IM8A 4FQHB 5DMGD 1I85C 1TLKA 1HI6A 43C9A 3ULVD 1I3VA 3IU3A 4BQCA 3I6KB 1NLBL 1P4IL 2CKBA 2CKBL 3SDCA 2MHAA 4OT1H 2A6KB 4FFWC 5EZIL 4UQ2B 1T0NB 4J1UB 3V4UL 5KZCB 5DF0A 2P7TA 1Z0NA 2IPTL 3DARA 4Y16A 1ZEAL 3QFJE 4LCIL 2Z31A 3ETBF 5H94A 3WN5C 4K2UH 1FDLH 1MOEA 3EW3B 1CDBA 2J8HA 1NMCC 5T1LB 2IAND 1UH3A 4CMHB 5HJ3B 4DKEL 4OFKA 4XMKL 1DUZB 1XIWC 4IRSD 3MNWA 1FBIH 2FEEL 1NDMB 3MLTA 4ZPVA 1DVFD 3FFDB 5E8NA 5KSBE 1YNLL 5JHDE 2XWTA 2FBJL 4OBRA 1TCRA 5ANMB 3BP4B 2XN9D 1FCGA 5E6YA 5D7IB 4FFVD 4WW1A 3KS0J 1JWMB 3LQMA 3ARPA 5E4IA 4OV5A 5ADOL 2R8SH 2HH0H 1MI5A 4E41D 3UYOD 5AWNH 2EE3A 2GUOA 5DHVA 3R8BB 3SOBL 3ARGA 3MNZB 4U1MB 3QCTH 3QEQB 1FL6B 3GMMB 1YJDL 2APVA 3BGAA 3PGCB 3ROOB 1KT2B 3RWGA 1U8LB 4U1JA 1MCKA 3FB6A 4WW2F 4N8PA 5GGVL 1K6QH 3QA3B 1GZPB 1SYVB 1ZV5A 3DETD 1PBYA 4OFYA 4IRJD 3U46B 1F3JB 1H3PH 3PXJA 1AQKH 3MYZA 1XF4A 3RL2A 3U9UA 1UZ6E 1WTGT 4IJ3B 3FHQA 3L1OL 3BX7C 3GSUB 3L3GA 3HC0B 1ACYH 2CO6B 1ZLSH 1I1AB 1P1ZA 3LY6A 3ZSTA 3UEZA 4BFIB 3WSQL 1XR9B 2J5LC 1C7SA 4QF1A 1CBVH 3EJYD 5IFAH 4OZGB 1CR9L 3I3EA 1X4XA 5FO7B 1IFHH 2VAAB 3QUZB 3OGCA 3RNKA 4U6XA 3C09B 4W70A 4O9HL 5KN5A 2C3VA 3OQ3B 5J6GA 4MD0A 3L3IA 4OF5A 3UZEA 5FECB 3D39A 2HKFL 2IQAB 2PUQT 5IVZA 4KUZL 1G9NL 3ZDYE 4KKNA 3BOVA 1T22B 1OTSD 4JO4L 4OAWA 5EU7E 2CD0A 3QZWG 2DI9A 1AR1D 4ZSOE 4HDIB 2LFGA 3KS0H 2NW3A 2HRLA 4XB7A 2VLJA 4M6MH 4FXKA 4MA3B 1Y6KR 4P99A 5I1LA 5CIPB 3QRGL 4OZIA 1E0OB 1S7SB 4NKMA 5GS3A 5IIEA 2BNQB 1JV5A 4JFHE 2DQTH 3GHBL 3BE1H 1RZJH 1YY9C 5T1KB 3UO1L 5FDWA 2ARWA 4G6AD 1DQML 4TPRL 1RZKL 1YECL 2EKSB 5DSCB 4Y4KB 1GGCL 4XBPA 4XTRC 5I75C 1XF3B 1P53A 4EDXA 1LVEA 3WFZA 5HGDA 1MSPA 2VH5H 4HZAA 5F7DA 1NCBH 4R97B 3X11B 2FJFB 3I85A 5E2VH 3KYAA 5JA9A 4GQPH 4NP4L 4LQFH 3GEWB 3C6LD 2VZSA 3GSXA 1SEBB 3QEGL 4M5YL 4N0YH 3LRSA 5FYKD 5F9JB 1IAKA 5I1HH 4GLRI 5F21B 4BYHA 5E1HB 2NLJB 4TVPH 4GKSB 4HWBL 1U95A 4WIQA 1QRNE 4FQPA 3MGOB 4PRNB 5TQ2H 5AYUH 1RUPL 2EECA 5EUOB 1UJ3A 5ESVA 4X5XA 2XFXA 3HPLB 1NSNH 3CNKA 4RWYH 1Q1JL 3EYUH 5B3JE 5BRZE 4UT9L 1Z5LB 1MHCA 3LV3A 4DFIA 2IFFL 3CC5B 2IQ9L 4FZ8H 2VDML 4I48A 5D2LB 4UUJA 4F33A 3FRPG 4PJ5A 5D7JA 2NY7H 4EBQH 2AEQH 3RVTC 1HYRC 3AS1A 15C8H 1KLFA 5H2BA 5F96H 1MJJA 4NFCA 5J0BA 5J3HC 3SCMD 5F1NA 3CDGB 1BFVH 3EJZC 4JDTH 4NNYB 5CZKA 1DLFL 4Z7WE 5J1AA 2R4RL 1MFBL 5CBAA 2PYEB 3CFBA 4M8VA 4KGLA 3FQRB 4RGOL 3FO9A 3FN0H 3KPNB 5IMKA 3RGVC 2AGJH 3L9RA 4LLMB 4TOYL 3TV3L 2LV4A 5HTSA 4PJEB 4EI5A 4JRXA 3WFHB 2QQNH 3MFFA 2LAGB 4YDLB 3STLB 5ISZB 1KCRH 1UKTA 2ADGA 2WP3T 4OUUB 3K4ZA 4KPHH 4R4BA 4HX1A 1ZGLP 1XH3A 2EIEA 4V2BA 2YK1H 5EU5B 3W0WB 4QKXB 1JK8B 1MIEL 2ERJB 3QXTA 4RGNC 1S7VA 4OM1H 3QNXB 2FATH 1UACL 1ZT7B 4WEMB 1WIUA 2EDHA 2OJEB 3U30C 5HVHB 1NGZA 2JJUA 3MLPA 3WFEH 2B1HL 2FJGA 5C0GB 1BBJB 1V7NH 3LQAL 4GSDL 1GOHA 2FECI 3BXNA 4I3SL 2W65A 1IQWL 3P4MB 1ZA6B 4LEOA 4OZFH 3KJ6H 5ICYB 4NNPL 3MV9B 4OZ4A 2BVTA 2ICWJ 1IKFL 3D2UB 4YK4B 2HJFA 4PJBA 5CP7B 4YHIB 3WIIL 4EDWH 2BSTB 1M1SA 4L29B 1C5BL 4APQA 4D9RD 2GQHA 5E2WL 1IBGL 1I8MB 1JGEA 4K7PL 2BC4A 2OTUA 1OPGL 5DS8A 5KSAA 2LVEA 3ROLB 5E94B 3NTCH 1IEAA 1A6VL 2BY3A 3OKLA 2GIYA 3H9SD 1A7OL 4OUOA 4J3VA 1KV3A 3KXFA 4LL9A 4P3CL 1OGTA 4NIKB 4ODWB 4G8GE 3O2DH 2KH2B 3VD4A 2DQCL 4WDIB 4XCFL 4NQUA 5HDBE 1A2YB 4NQDB 1LE9A 5BV7H 2HT2C 3BPCA 3IVKA 4TSBH 2YUVA 3IYLW 4DTGH 1F13A 3IDNA 4AIZA 1KPRB 1FIGL 2MKWA 4X5WB 3GUTA 2FX7H 2R9HD 4JZOB 3IXAB 5DK0B 4GUPA 4XXCC 2BHZA 2FGWH 2J6EH 4V1DB 1X5FA 3VGFA 2A9NH 4EN3B 4NRYB 4WHYG 3TN0C 4F7EB 3O8XC 3VXOA 3FTGA 3SE4A 2QHRL 5FV1L 3QO1A 2VB5A 2JB6B 4LHQB 4HIHA 5EU6E 4JFZH 2BCKA 2VXSL 4TUJB 2X1PA 1KB5B 1UWGL 4AY0A 4D2NA 1H3TA 5I1JL 5CBEB 1FZKB 1E4KA 3OKYA 3C5JA 3E6FB 1K85A 3EO0A 4N0FA 1BOGB 2Z8SA 1HIML 4TSAL 2IFGA 3U1SL 1CG9A 2QV2A 3NCYP 1QFPA 3TVMA 4DQOH 5FYLH 1H3XA 1XF2B 2YMXH 3AY4C 3DVIA 3LKRB 5DVKA 3B83A 1QKZL 5ETUB 3UBXA 2HP4A 3DSFL 4XH2B 4YIQB 4Y5XB 3K3QA 1W0VB 4LVNC 1KENL 5CLTA 2DKUA 5EOTA 4IS6B 1JFQL 2QL1A 2GAZA 4G9DA 5C09B 1WFOA 2BVQA 4PREA 4HD9A 1XGUB 1EK3A 1Z6JT 2OMBA 2E27H 3L3HB 5DD5L 4Y2OA 3VWKC 2QHLA 3D6GA 4LDEB 5I19L 5K9QI 4GG6E 3WMSA 4AMKL 4NO5B 5KW9L 3SDCD 4YBHA 2EIZA 3VXPA 4RAVA 4LIQE 4Z18A 5EC1A 1MFCH 1S9KC 1OGAE 5KANG 1MLCA 5HI3D 5JIKA 2Z31D 1A7RH 1ZHKB 1JZ3A 4JRYB 3N1PC 4HW6A 2OJZL 3TJHD 4WHDA 2D03L 3BVNB 1WC7B 1E27A 4PS4H 2FJHA 1OB1A 3ZE2F 1BAFL 5FEBA 1AGFB 1NMBL 3SDXA 3T4YB 4DCQA 5SWZE 5FYJU 1NC2B 4LCWA 5D1XA 1MELA 3GM8A 1II4E 4J3OC 1JYWA 5I1GL 4L3CA 1EUTA 4ZPTB 3IFOB 4ZNEA 1NFDA 3X12B 5CP3A 3RKDC 2JIXA 3FMGH 5DHYB 1HDMA 1CF8L 4WEBL 3IDGB 3BZFA 3W9EB 4DN3H 2C3HA 1WGOA 4JPKL 1WVZA 1ZA3B 3ARDC 4FZEL 2R1YB 2AJUL 1MI5D 2APFA 4HXAH 1N5YH 4XMLH 3HZMB 1J1OH 4MAYB 1PFCA 1AXIB 1R5IA 3RAJH 1RIHH 2C1OB 3B5GA 4YHML 1G9ML 4MQ7A 3GMOB 5L7XH 3QUMB 25C8H 4LKCA 3MRLB 2CUMA 1T80A 4KTDH 3MREB 5MERB 2UWEE 1LEGA 5D7KD 1CFVL 1TQBB 1J05A 1I7UA 4OFYD 1UT9A 4M9PA 2CK2A 1ETZA 4HGWA 5EPMA 2DQFB 4Z0BH 1N64L 1T66D 3WUWA 5C0BA 5JOEA 3QB7C 4UOW0 4HIEA 1RZ8A 4KMQA 2Q7NA 3FN9A 4GFTB 3INUH 1NGWA 3V0WH 2J88H 1V5JA 4LK4A 1YEJL 4CMHC 1RK0A 2FL5A 4KVNL 4KI1A 1Y6NR 5DRXB 3C2AL 4NUGL 3KDMB 1VA9A 3TO2A 3ZKXB 4MSWB 4X5LA 2XTJE 3FQXA 2ZUUA 4KRNA 5GSVB 1DFBL 2CR6A 1CDUA 4UTAH 2OMNA 3D39D 1CLCA 3IU4L 3MA7B 3KPSA 5FGCB 1SBSL 1IL1B 4L9DA 2E6JA 3VI4E 3FO1B 1MAML 4G8EA 1CFSA 1VADB 5MENA 1DQQA 2H26B 4HUUB 2ITDA 4I9WE 2VLJD 2XRAH 4XP9L 2VUOA 1Q9KA 5GGVY 2ZG3A 1HOCA 2ICCA 4EEEA 3S34H 2WBJA 1EBAA 3CVHA 1YDPA 2ADJB 2DQIH 1RJZB 2G60H 3CVHL 3F7YA 3G5VB 4RNRB 1T1ZB 4IJ3C 3C8KA 1WT5A 5DRWA 1B0RB 3QHFL 4F7PB 4XCNB 3A6BL 1QFUL 5FYJD 4M1CC 3U0PA 5ICXB 1I1AC 4R7DB 3VDCA 2VDPH 2EXYC 3KPOB 4XC3L 2BERA 3CCHB 3SDDB 2Y6SD 4RQQB 3WDJA 2Y06L 4JN2B 4WW2B 3VXMB 3QUZC 4LLDA 3S97C 3MCKB 2DLHA 4P2RB 3RX5A 5C0RH 2ARJB 4GAYB 1CGYA 2EE6A 3DVFA 4TYUA 3V52L 1ND0B 2X4SA 1YC7A 1XGYL 1FP5A 4UINH 4PRAB 2GTZB 4M6AA 1I3GL 2GCYB 3FB7A 4R96A 4L4VA 3ILQC 2P48B 3O2WL 3QBTB 4CMMA 3PABA 5JO5B 4OLYL 2GK0B 4Q9CA 1U2HA 3T0XA 5DZOA 2BOBA 2XIDA 4PJXA 5EA0L 2WBWB 1KLUB 4H1LG 5DVLA 5A16A 1RQ5A 5HHNB 5DDHB 4LASL 5K9QG 1S7WA 1RJLA 1EVTC 5DRZA 2JLLA 4PJ5D 2D7MA 5D7JD 5FOBA 5DR5H 5C9JB 4K07A 3BWAB 5HYJE 2P8MA 1IGYB 4LEXH 5DJ2A 3FL7A 4RA3A 1U58A 4R97C 4CUCA 4AL8L 1QFWL 3QULB 5TF0A 1JZ4A 3SDAB 1Z2KA 2FSEB 1ZLWH 4LSTH 5JXAL 3WDIA 1QQDB 1K5NB 1J0ZA 1X4ZA 4WFGE 4PIRF 1F90H 5IBLD 1NAKL 1F5WA 3P4NB 1CS6A 4JRXD 1WWBX 1UEMA 2P47B 4FTVB 1XF5B 3MLYL 2V2WA 5GS0D 3G04A 2HLFD 2H8PB 2R1XB 4CADB 3E8UH 2X1XR 4L8BB 4ZDHB 1VGEL 1KJ2A 2ED9A 2AJXL 4HULB 4OLWL 1Z9LA 1KJ2L 4WI7A 2D3VA 2V2XA 4S1DD 1M7XA 3BUTA 3T0EC 2UY6A 4HC1A 4LRIC 3JVGA 2QQLL 5DO2D 5GHWL 1YYML 4HC1L 2X4RB 3MYJB 1T20B 3DUHA 2UZIH 2VNCA 4EKXA 1X6LA 3TF7C 1GCFA 3MLRH 3N9GH 4PJCE 3V4PL 1EUUA 4HUKB 3ES6A 4Z7UB 5F71A 1HHKA 5FB8A 4IOFC 1GGIL 1MJ7L 2HVKB 3NIGF 1JPST 1J88A 4NWTL 2CLRB 2Z0BA 4EJ1C 4OCXL 5FKAA 3CAFA 5LXGH 3B2UD 2YD4A 2EEDA 2AK4A 1VFUA 4LFHD 4U6HA 1RMFH 2IANB 4QRRA 4XP6L 4NQCE 4APQD 2Q7YB 3MJ8A 4IRSB 4Z7QE 3I6LE 4OZIF 5JXEC 1BLNA 4Z78A 1DVFB 3BEVA 1MHEA 5JQHC 2WBKA 5F9DC 3MRFB 3KGRA 1HK6A 2G75B 2A6IA 2F53B 2HFGL 3WS3B 2Q8AL 2CRZA 3HC4L 4TRPH 3GK8L 4JLRA 1UA6L 2F5AL 4YDLC 3VH8A 4Y5VA 3KXFD 2AJZA 3UJJH 4E41B 5D1ZC 2BP3A 2JTDA 4QT5B 2B20A 2ERJC 5CILL 4RMWA 4ZYKB 3GSNH 1XGQA 3WEXA 1MVUB 4KJWC 1A3LH 3TWCL 4RGNE 4ZFZB 1G6RB 1BD2D 4R0LA 5I8KL 1VACA 1DSFH 4IRJB 2B2XH 1BZ7B 3BH9B 2WV3A 4OB5H 4QHUA 4YR6B 2X4QA 1EIBA 3DTXB 1N7MH 2NZ9C 3MXVL 2QQKL 4YDIH 4FQXD 5I2IA 3IFPB 3LIZH 3JUYA 4YK4C 2YD9A 3UROR 1JNNH 4ALAL 5DMYA 3QDGA 3BSZL 2J3SA 1A1NB 5JDSB 4YUEH 4BH8A 4K7PY 5SWSA 4PLNC 3BP7B 5C0CE 4TSCL 4HKBA 5JR1L 5FA3B 4TUKH 2RFXB 2WZPD 2NTFA 3BGMB 1E6OL 3IJHB 1CFQB 3D48R 4KQ4L 1A1MB 2DLEA 1T89C 3RA7L 1I8KB 2I9LA 3TVMD 1KJVB 1NFIA 4PYGA 2XWJA 2V5MA 3NCJL 2O5XL 4PRIE 4XRCA 4N90D 1OTUD 1I4FA 4GXUM 2Z92B 1N5AB 5H35A 4JFFD 2CLZB 4CN4A 1IE5A 4JFYB 3NABL 1UWEH 1FVCA 3MC0A 2NYYD 2ADFL 3VFOA 4KJQD 1XGRA 3T3PE 4HLZG 3HI6L 4PJ9A 1UKQA 2VMFA 4ZD3H 5C0FA 4K23H 4ZO8A 4XXDA 5HVFB 2GI7A 2YPLA 3LN4B 1SY6H 1DN0A 4M7KL 1ZWIA 4JPVL 1FGVL 3M1BA 3UYRL 3C5ZA 5DI8A 4P9HC 3UTTD 3O6ML 4XPFH 4S1SL 1UH4A 1S9XA 1EEUA 3JV6B 3DX9B 3C6LB 4HAFA 1LO4L 1PQZB 1QSVA 2I07B 2Q20A 4LSSL 4NKDA 4OLUL 5T5NF 3TH3T 5J4MA 4LRNL 5GGUB 3WKNA 1LNUA 2M26A 1ZTXL 4Y5YB 5D1XD 4G8FB 5JLZA 1LO0H 4PRDA 3QIUA 1J86A 4EIGB 4R26L 3B9DA 4JVWA 1IAOA 1A6WH 5IG7A 1AHWA 5FK9B 4J3WA 2JIXD 4QY8A 4PJBF 3S35X 1KXVC 2P8PA 4Y5XC 2R0LH 3WO4B 3PWJB 2PYFB 1CD0A 5GJSL 5IW1A 2VITA 1TNNA 2OR9H 3BN9D 4HKJA 3EOTL 4RSVA 3OMZA 3ULUC 1RK1B 1PGRB 2VIRA 4A6YB 3PP3K 3L5XH 1AJ7L 2R0KH 3WNNA 1AFVL 1DBJL 2Z8RA 4LLVA 2VABB 3SKOA 3SCMB 4KKAC 1HYSC 5D7LE 2OTWB 1H0DA 2V17L 1MCOL 3R4DA 5DK3A 3WE6A 3BPNB 3V5HB 2IBZX 5C0BD 4LHUG 3BZEA 1FHGA 3MJGX 4K3EL 1H5BA 5IHBA 5IGXL 4C59B 1TZHB 2NY1D 5EUKB 4NKIH 5HHVH 3HAEH 4LHUA 1CDYA 1MEXH 4RFOL 4MHHG 5IBTH 1PG7L 1NCDL 4NC0B 2FDBP 4MNQE 5DQ9A 4FNLL 1CFTB 5CUSH 1KULA 1JPFB 3MV8D 1AQDB 1K4CA 1R5WB 4M8QA 5E9DE 1ITCA 4OCSL 3ME0A 4Q2ZA 3RDTD 5E2UL 5D96B 2VXQH 2VDRH 3FOLA 3CZJA 4LAQL 3QUYC 2C1PB 5BMFL 4HUXB 4HF5L 2GW5A 4XT1C 3MX0A 2VZTA 3KAAA 5MEND 3N85L 4JCLA 3VXQB 1D5IL 3KLHC 4XPHH 2GYSA 1U9KA 4WHTB 2KQNA 3GMRB 1HEZB 1ZLUK 3S88L 3RPIA 3RVVC 5T3XH 4XNMB 5HI4D 4D9LL 5DHXB 3OHXB 2JJSA 3T2NH 2C5DC 1S9WB 1DEEB 2CKNA 1WWCA 3HR5B 1P4BH 2VXTL 4U6TA 3K1DA 4WI6A 2WBJD 3FO2B 4WY7L 1TQBC 1I1FA 2Y36H 3L3JA 1HHIB 4B53A 1AH1A 1Q94A 4RWHA 1G7HA 4F7CB 5B38B 2DWEA 4GRLD 1EVUA 4DOHB 5ICZA 4Z7NE 3LOWA 1BECA 1KTDB 2AEPL 3VXSD 4ZUWB 1S3KH 2EDFA 2EDEA 2PTUA 2IAMA 1U3HA 4XCCH 2FHBA 3QXWA 3H9SB 3CXDH 4P9HH 1T5XA 4GW1A 1KOAA 5IJKC 1FO0L 3HPJA 3ZKXC 1BQHG 4YPJA 3QEHA 3VXRA 3MJ7A 5H37G 4YPGA 2QADD 2XKNA 3GI8L 4LMQE 3ZSSA 3STZA 1B0GB 3RFZC 2ZJSH 3KLAA 3VFPA 1U8JA 4KZDL 5FCUH 4JFDB 2I60H 4TNWK 4RCAA 5LQBH 4XNQA 3D9AH 1MWAH 4R2GC 1I1YA 1DTUA 1QBMH 3NIFE 4O2EA 3SDXF 3IDXL 3MV01 3S3SA 3MRBB 3WXVL 1QSFD 4O2FA 5MHSD 3QEQE 1OQOA 1JWSA 1PZUB 1QD0A 1SJHA 5DD1L 5EOCL 5HHOD 2BRQA 1GPOH 1DBML 4HKXA 3ZHLA 3ALWA 1NFDF 3GBNH 4KJPC 3KYKH 1T04B 1XCTB 5I8EB 4S1RH 3ULUH 1YN6A 1QLFB 5F1IB 2XQBH 4Z8FL 2EDOA 3CLEH 1JI1A 5HDQL 1JPGA 4QCIB 1ZT1A 4R8WL 3FB8A 3LCYA 2DL2A 3LB6C 4MCYB 4L8SA 1OM3L 1BF2A 4XP5H 3MRNA 1QBBA 3SDDC 5T5FL 3EO1A 4LF3B 1J0KA 4DGIL 4YHZH 5J1TC 4OZGE 4PRHD 3U0TA 4PG2A 1CI5A 3LDBB 1N6VA 1C1EH 1FFNB 1ACZA 4IMKC 5C2UB 4HWEH 3HI1B 4R7NA 3KPPA 4G80B 1A4JA 2BY0A 1EEZB 4HWUA 4I0KA 2A74A 1DL7H 1T5WA 1AD0A 2IBGA 1G9EA 1HI6B 43C9B 3IU3B 5C7XL 2UZXB 2CKBB 1OWRM 3P40A 4LLQA 5T1DH 1FDLL 4NBZB 4NGHH 3SDCB 4XC1L 2MHAB 3RIFF 5D1QA 2W07A 2BNQE 3MJ6A 2P7TB 3HFML 4Y16B 3IKKA 1KTKE 4F80A 2Z31B 4UZGA 3MACH 2CSPA 2BJMH 3QISA 1NCAH 5H94B 1FBIL 4X9GA 2Y72A 1ZVSA 4GT7A 2VLKA 4AH2A 4HQQL 4X98A 3RIAK 5EIVA 4N8VA 4LGSB 4QWWC 4UT7H 2AK4D 2FX9L 5EB9A 4QRRD 1S78D 3SDAC 3UPCA 4PTTA 1CK0H 2NY2B 3MNWB 1L6ZA 4WFHE 5HHPA 3MLTB 4ZPVB 3LH2H 5E8NB 4UILH 2XWTB 2ESVE 3MLWL 3QCTL 2IJ0C 1TCRB 5T33H 4KHTH 3QHTC 5I71B 4WW1B 5ALBH 1EO5A 4OV5B 1MI5B 3KWWA 4LPUA 5K33A 4M9OA 3WV0A 5C0IA 3A0OA 3TA3D 2GUOB 5DHVB 4YHYB 1RU9L 4M4RA 5EULV 3QQ9D 5EUOE 4ZAKD 1KEMH 1NL0H 3RWGB 2CLVA 4U1JB 3LS5H 1WZ1H 4WFEE 3FB6B 1I1CA 1U8HA 2NMSA 3VFWA 1QP1A 5JQ6L 1ZMYA 2JJWA 3RL2B 1XF4B 3FFCA 5D2LE 1W0YT 3U9UB 2YWZA 3CX5J 1JTPA 3CDCA 4EUPG 4Q74A 3L3GB 4D8PA 1P1ZB 4WI9A 1NBZA 1JHKH 5JMOC 2BNRA 4XPAH 3GBMH 4QF1B 4PRPE 4B50A 3QDGD 4PJXF 5BW7A 3LQZA 5SWSD 4IRSC 2P5ED 4MDIA 1EJOL 2QKIA 3OGCB 3RNKB 1C5CH 1CXHA 4U6XB 4NO3A 5IHZA 2QQQA 5J6GB 2C3VB 5KN5B 4MD0B 3L3IB 3GJFH 3D39B 4Z7OF 5IVZB 4U0QB 5KVGL 4PGJA 4OZHA 4FFVC 1RJYA 4Y1AE 2NX5A 4OAWB 5ISZE 1WIOA 2OM5A 3W2DH 3H9HA 1YZZA 1RZJL 2VDOL 2NW3B 4I13B 4PR5A 3RJDA 3W0WE 2VLJB 3CJJA 1R24A 4FXKB 4ENED 4OCLC 3VMPA 1MFDH 5I1LB 4OZIB 3VFGH 4F8QA 4NKMB 2VH5L 4OF8A 5IIEB 1F11A 1JV5B 4UQ3A 3GFUA 4IRJC 3DO3A 2DBLH 3QWQB 4BH7B 4B0MM 3GSVA 3BDYH 3OKDA 4JG0H 4N8CH 4PJ9D 5FDWB 3WN5A 4J3UA 4M48L 4WRLA 4LQFL 4XBPB 3U36A 3CFKA 1WFUA 4R3SA 4EDXB 2YPLD 2EDJA 5HGDB 1EZVX 3VWJC 5F7DB 1KB9J 3MV9E 5CEZH 3CMOH 1MCLA 2HG5A 3VFRA 3H42L 5CJ5A 2KZWA 3DGCR 3EJYC 4YDVA 4WEUD 1T21A 1MJ8L 5AYUL 4JM2A 5FM5O 3GSXB 3DYPA 3LRSB 1IAKB 3J8F7 1NSNL 1PSKH 3DO7A 3EYUL 4X7FC 3CGTA 2AXGA 5A1AA 3UBXI 3IAPA 3UTPE 3QIUD 2N1KA 3WJLA 2N4IA 3OAYK 1U95B 2NY5L 3D87B 4NC2B 3DECA 1K9TA 3FHAA 4FZ8L 2H3NA 1AR1C 4M7LH 4W68A 4KRPD 3MUY1 1UJ3B 2ZUTA 2AEQL 5ESVB 5ID1A 4OQ1A 4TNVK 4X5XB 2XFXB 15C8L 1T3FA 4MJIE 4LPYA 5BO1L 2BVYA 4NQDE 2EYTA 2E3VA 5DVNA 1MHCB 3LV3B 5B39A 2W9LA 2XZCH 4JDTL 4L9LA 3BP5A 4MS8D 5DUPH 4LSVL 4I48B 4UUJB 4NOFA 4F33B 4PJ5B 3MTRA 5D7JB 2XACC 2V2TA 1QBLL 5H2BB 1ZANH 1MJJB 2ID5A 3SE8L 2AGJL 2EC9T 5F1NB 4HH9A 4V1DE 3HNSH 2HMID 1KCSL 5EG6C 2QQNL 4OD3L 5E4EC 2PW2A 5J1AB 1TCMA 5TH2A 1GXEA 1KCRL 1SVZA 5CBAB 1MFEL 4CJ0A 3CFBB 2FEDC 1RZFH 3R8QA 4H88H 5B8CA 2F58L 3FO9B 1JGLL 5IMKB 1UG9A 4QXGH 3L9RB 1REIA 4K9EC 2FHCA 35C8L 1PKQE 4HK0A 4EI5B 4OM1L 4JRXB 4Y5YC 5GPRA 3MFFB 3T3MF 2B8OT 2ADGB 4R4BB 4POUB 4X7TA 4HX1B 3CSYA 5D2NA 1YC8A 4CVXA 1XH3B 4G9FA 1V7NL 1GL4B 5IESH 1VPOH 1IGCH 2JKXA 5EBGA 5IVXA 5F6IB 4PJAA 4OZFA 2H2PC 3SE9L 3WO4C 4YNYA 1CXKA 3IF1A 3S4SA 3MCG1 1NGZB 4ZTOL 4U7SA 4AG4L 4YXKL 5BJTA 5E08H 2FJGB 4POZD 4QHLA 5C09E 1MCCA 3BXNB 2W65B 1IM3A 4LEOB 3CSPA 5SX5K 1KF9B 4L4TA 4OZ4B 4HJGA 3SCMC 4X4XA 3WFBH 4LFHG 1KYOJ 1MRFL 4NBYB 2VN7A 5GZNC 4JO2H 4PJBB 3GNML 1EHNA 2BMKA 3V6OE 3MFGB 3TCLA 1FNGA 4LHJB 1HXYA 1R6VA 3F62A 5D70L 4APQB 1DBBH 4MXQC 4JRYE 4QGYA 3O2DA 5TFSH 4X7CC 1JGEB 2E6PA 2BC4B 3LS4H 2OTUB 5DS8B 5KSAB 1IGMH 4DK3A 3BQUA 1IEAB 4WVRA 1U3HD 5BV7L 3OKLB 3BPOB 4IMLA 2DKSA 4UTBL 1E4XL 5ERWA 4YX2H 4D3CH 2LABA 3KXFB 5A2FA 2ENYA 1OGTB 5MP6H 3SQBA 3T1FA 5FDYA 1I7RA 1N3NA 2W9EH 3RHWF 4JAMA 2DQJH 5D96C 1LE9B 2J6EA 4JB9H 3IVKB 3BPCB 2PKDA 2J6EL 2X1QA 1QACA 1DQLH 2A9NL 3IDNB 5HYIA 1O7VA 4JY6A 4AIZB 3PHOA 4YFLF 4MGXA 2MSPA 5ESAA 2ICWA 3GUTB 2J7LA 4UNUA 2UZYB 3EKCA 2W38A 4JFZL 3LKOA 1KFAH 4GUPB 4CBPA 5EC2A 3G6JF 3ZE0E 4GRWH 5D6CB 4FA8A 3DMMA 3VD5A 3VXOB 3FTGB 2J8OA 3WHXA 1W72H 2DIJA 3QO1B 4WHCA 2FIRT 3BRDA 2Q87A 4JQVC 5FYLL 3RGVA 4HIHB 2BCKB 2YMXL 12E8L 1GIGH 1JGUL 3CVIL 3O9WD 5CGMA 2XTLA 2BDNH 4ODVH 4CN6A 1JNLH 2I27N 5E03A 3C5JB 1TPXB 1EHXA 3EO0B 4N0FB 3KNBA 5ESQA 1NDGA 2X70A 5DQJA 1CG9B 3RTQA 2D7NA 3TVMB 4K94C 3BD4A 4Z0XA 1HHHA 3X14A 3KHOA 4LQ1A 4K9EH 3UBXB 1EFXA 5FGCE 4PUBH 5EOTB 3OKOA 4DW2H 4G9DB 1MFCL 2GAZB 1URLA 4P2CG 1TETL 3WS6C 4OI9A 2BVEA 2BVQB 4PREB 1CGTA 3A67H 1BGXH 1A7RL 4KV5E 1OT2A 3HI5H 5JW5A 4NC1C 4NZRH 5JPNA 4QXUH 5E7FA 3AXLA 4JO3L 4KTEH 4JDVA 4PS4L 2ZZUT 2E8YA 2EIZB 4L3EA 3VXPB 4RAVB 5D1QD 3CSGA 4QRUA 5EC1B 4F58L 1L7TL 1MLCB 4YZFF 2E5EA 1PZ5A 2VR5A 5KS9A 2DJ4A 4PD4J 4O51A 5IBUG 5DD3H 2VLKD 2FJHB 1OB1B 2A73A 4WUKL 1PJ9A 3SDXB 4DCQB 5DA0B 4LCWB 5D1XB 3NACL 4WTZG 4K3JH 4HXAL 5F6HJ 4ODTL 3RVUD 4XMLL 1N5YL 2ATPA 1OAUH 1XMWA 4L3CB 5CINH 5DEFA 1NFDB 3LDBC 1G84A 5LGJA 1KJMA 4QOKA 2JIXB 5B4MD 3RAJL 4JY5H 3O3UN 1HDMB 1RIHL 2HTKC 3GKWH 1FNEA 1PLGL 2KPNA 3BZFB 3VI3F 5E6IA 1T1WA 2UUDK 3MRPA 4KTDL 1KLGA 3FAWA 2WQRA 4MQXC 3RU8H 4E5XA 4JO1H 4OF6A 4JFXA 3OR7A 1R5IB 2DLGA 5CHNA 4MQ7B 3K4DA 4LKCB 1PDKA 4H5SA 1RUAH 2EDBA 3INUL 3TN0A 4DN4H 1LEGB 2ZNXA 2J88L 3C08H 4B5EA 1J05B 1I7UB 3GSOA 1MCQA 3LEYL 4QRTA 4Y16C 1P7HL 3VFVA 1ETZB 3HB3C 2Z31C 4HGWB 3FFCD 5EPMB 5DFVD 3WUWB 5C0BB 1I3UA 2CIKA 4OLVL 1OP3H 4HIEB 4XP1L 1RZ8B 2NY6D 4M7ZB 4UTAL 2NY1B 2CQVA 2APBA 1N6QH 1NGWB 1FFRA 2CDGA 3N50A 3MRDA 2BNRD 1F42A 1RK0B 2FL5B 1JGVH 3P9LA 2NY2C 2CRIA 3TO2B 3AY4A 3FQXB 1A21A 4ZOCA 3S36X 1QPXA 4E42A 5MEOA 4KK9D 3KPSB 1OD7A 5I71C 2F5BL 4KK8C 3QI9A 2NX5D 3ZMRA 4G8EB 1CFSB 5L6YL 3GI9H 5BS0E 2CIIA 1NKRA 2EZ0D 5MENB 1DQQB 5FUZH 2BHYA 2DQIL 4YHYC 3ARGC 4QO1A 2ITDB 1YJDC 2G60L 3QJHA 1U8PA 3AAZA 3OAUL 3ULVE 1Q9KB 3AMKA 1HOCB 4FFWD 2JCCE 1V3MA 4GJTB 4H0IA 3LN9A 1BM3H 2WBJB 2VDPL 1MREH 3CVHB 1YDPB 3FT4A 5D7SL 4RMRA 4W6XB 2X44D 3K2UH 4LLAA 4Z7UE 3C8KB 5DRWB 5EU3A 3TZVC 1S7QA 3H3PH 3CDYA 4PJIE 5C0RL 2BXZA 4O2CA 4HXBH 3X3FL 2EEBA 3U0PB 5HYSA 4UINL 1MCWW 3QQ3A 4TVPD 1Q9WB 1XIWD 2CK0H 4XX1G 2IANE 5TQ0H 3QDMA 4LLDB 1WCBA 4XGZA 1RHHA 5SV3A 2GFBB 2AXFB 1G9NC 2BZDA 3V0VA 3WJJA 1V8HA 1QHPA 2X4SB 4DUXA 3MXWL 2DLTA 4KQ3L 1R3JA 3FB7B 4R96B 4L4VB 3ISWA 2XN9E 2XPGA 1VENA 2FLRT 5GGRA 4CMMB 1KBGH 3PABB 1GGTA 3Q6FA 1KUMA 2WSKA 4UU9A 2OBGA 2BOBB 3G5ZA 1J0IA 1CQYA 5DR5L 2JJVA 4PJXB 3WO3B 3CFDA 1VERA 1FPTH 5IOPA 5A16B 2CDFA 4LEXL 3G6DH 3W39A 1S7WB 2K7QA 1RJLB 2R1WA 5D5MA 5DRZB 4GOSA 5FOBB 5EOQL 2P8MB 4AJ0A 1F90L 5E00A 5DJ2B 1A7NL 1D5XA 2IPTH 1JIBA 1ZEAH 4LCIH 4Y8AA 1HCFX 1WISA 4JVPA 3B9AA 3SPVA 5KVDL 3ARTA 2FIKA 4PP1C 5JPMA 3EIFA 1RUKL 1YEIL 3UTOA 1F4AA 1INQA 3NGBB 2V2WB 4XMKH 3G04B 4LBEA 4PJ7A 1NUNB 3ZO0A 4HUNB 2FBJH 1KJ2B 4XNUH 4X83A 2V2XB 4CW1A 1QBAA 5CD3A 5ADOH 5GS1A 4M1DH 4I8DA 5GJTL 5HGAA 4NNXA 2C4FT 3QWRA 3SOBH 3U83A 5J12B 4MDJA 3ES6B 1F3DJ 3HE6A 1HHKB 2Y07L 1U8MA 4OZHF 1D7FA 4JPIA 5FB8B 3DRTA 5BZDA 4L4TD 2P42B 1CL7H 2VDLL 4NPYA 5FKAB 1KEGL 4X0KA 4TRPL 2AK4B 4U6HB 1BJ8A 5C0NC 4QRRB 3MRRA 5GRUL 5GGTL 3T0BA 5GGSA 1BLNB 4Z78B 3MRMA 4WV1A 3BEVB 1MHEB 3AROA 5GRYA 2A6IB 3GSNA 2AQ3A 3T0DA 5IFHH 4EI5C 3GSNL 1A3LL 1ERNA 3PWPA 4JLRB 1JZ2A 5FYKE 1CR9H 1DBKH 3VH8B 5I1IH 4Y5VB 2HLFC 2AJZB 4X4ME 4FQ1H 1V3JA 3BEWA 4WGWB 2B2XL 4ODBD 4KUZH 3RP1A 5F6IC 1ZK9A 1N7ML 1XGQB 3WEXB 2XXCB 4JO4H 3ELAT 4YDIL 4QXTA 2IADA 3QNZA 5CGTA 3LIZL 2HJKA 4R0LB 4JM2F 3RVTD 1JNNL 1MQ8A 4QHUB 5ABDE 2EXWC 2X4QB 4U6VH 3MZGB 3QRGH 3TP4A 5E6ZA 4TUKL 3EJZD 2OL3L 1F3DH 4UT6H 2Z8VC 3DMMD 5C2BH 3B2UC 4XWGH 2X89A 3TO4A 2PXYA 1NJ9A 5FYLD 3QDGB 1DQMH 3OXSA 1KJ3H 4APQC 1RZKH 1YECH 2W92A 4KI5C 4BH8B 5SWSB 1GGCH 3RGVD 1TJGL 3IDYB 4HKBB 5KSAC 2EYSA 1V3KA 5FCSH 2NTFB 2B5IC 3S96A 3EYQC 3RTQD 2I9LB 1FLRL 1NFIB 2FGZA 1I75A 4JHAL 1CXFA 5HY9A 4D9QD 4XRCB 4M5YH 4CJ1A 3CH1A 4X99A 1I4FB 3I84A 3T0EA 1ZHNA 3DX8A 1CE1L 4U3HA 3MRCA 4FQQA 3AB0B 1SY6A 3OSKA 4K23L 4HWBH 5I9QB 4P4RA 4KHXL 1FVCB 4XCEA 4Q58C 3VFOB 3THMH 1GZQB 1XGRB 1Q1JH 4XPFL 4UT9H 4R6UA 3EDKA 4PJ9B 1S7TA 4ZS6C 5HDOA 3AMLA 4JFED 4L3ED 4ODSL 3VCLA 5C0FB 1MPAL 2OI9C 4XXDB 2YPLB 1MJUL 4IHOA 1DN0B 2IQ9H 2VDMH 1ZWIB 4BK5A 4XNXH 2VO5A 3M1BB 3SE4C 5CAYB 3C5ZB 5IVXF 4PJAF 5DI8B 4AIXA 3GIVA 4YEFA 3IJYA 4HUVA 3NAAL 3SGEI 4RRPG 3MLXH 2XXMB 1S9XB 3NCBB 4RMUA 4X6FA 3ARFC 1M7IA 4D9RE 5J9PA 4NKDB 1U8NA 1G1YA 1DLFH 3QSKB 3EZJB 5TE7H 1LNUB 5E8DL 1CLZH 2R4RH 1MFBH 3O3EA 5JLZB 4PRDB 3QIUB 2O26U 2BHUA 5D1ZA 4RGOH 3H9SE 4LNRA 3I2CH 4AQ1B 1IAOB 4ZSOA 1AHWB 3TV3H 2R4SH 4QOKD 4TOYH 4QY8B 1OTUC 2ZUSA 3L5XL 4KRPB 2P8PB 4Y4FC 5E6ID 3CSBA 3BPLB 2VDNH 5F7EH 5IW1B 2FNBA 2VITB 3FAXA 5CLWA 5LKNA 3IDJA 3EYFA 2ZOLA 2NYYC 1MIEH 5F88A 5A3IC 5SX4I 2VIRB 5DZNA 5IB4A 4NC1E 3QDJE 4FG6C 3HAEA 1G7JA 3TN0D 4HT1L 4LLVB 5HHVL 3SKOB 3NIDF 2B1HH 1BVKA 2W0FA 2AJVH 2YA0A 1H0DB 2VLRD 3RPKA 3LQAH 1FJ1A 1OLZA 1MEXL 3WE6B 3DSNA 3VMNA 5IBTL 3HZYA 3BZEB 1H5BB 4C57C 5HSFA 4NNPH 1JRHI 3WNPA 1IKFH 4PV9A 3Q5OA 3WIIH 1OTTC 2VXQL 5IT2L 2VDRL 4LHUB 3U4AA 4ETYA 5D1XC 2MOVA 2MNUA 2EH7H 1A47A 1IBGH 4K7PH 5DQ9B 2E6QA 1OPGH 1K4CB 2R56H 4M8QB 3QIBC 3IS1X 5DUML 3I3BA 1A6VH 2WWKO 2FH6A 4Q2ZB 4RGMB 1WAAE 3QI9D 3T2NL 4F15B 3FOLB 3O0RH 2DTMH 1P4BL 4M6NL 5KAQF 3WBDA 2PW1A 1PD6A 2YD2A 5C6TL 2Y36L 1AO7A 2DQCH 4XCFH 2H9GA 3RWIA 1NUDA 4OTXH 3RPIB 1G9MC 4U1NA 2WUBL 3P0VL 3K2MC 1FE8L 4PLJC 1DCLA 4AM0A 2DI8A 2YS4A 1WK0A 4NQED 3AUVA 1I1FB 3L3JB 5DMKA 2J8UA 1S3KL 3B9VA 1IGFH 5DJAA 3U7AA 4XCCL 1Q94B 2DQEL 3CXDL 1G7HB 1N2RA 3WIFA 2DWEB 5ICZB 1M6OB 2EIBA 3VDAA 3NPZB 1BZQK 1DANU 2IAMB 1U3HB 1ONQA 4B7IA 5DA4A 1KELH 3HPJB 2I60L 1MWAA 3QEHB 1UWGH 1A1OA 5C08A 2OYPA 3FQNA 2FO4A 2WUCH 3VXRB 3MJ7B 5I1JH 3D9AL 1MWAL 5JTWA 1FFPA 4W6YB 4YPGB 2XKNB 4LLWA 3ZHKA 4WO4A 3STZB 3FN3A 5KS9F 4YGVA 5B22A 4FN0A 3KLAB 3VFPB 1U8JB 4JKKA 1QUNA 4WFFD 1MI5E 4XNQB 2D9QB 1QKZH 1I1YB 4RBPH 4O2EB 2Q3AA 3ABZA 2XQBL 1ZS8A 3RWCA 3VE0A 3CLEL 4KUCD 4O2FB 5MEQA 4GLRH 1TTUA 2IG2H 1JWSB 2EC8A 1W0WA 1SJHB 2YD7A 3O3DA 1JFQH 4EVNA 1K8IA 4I18C 4HKXB 1LGVA 5D7KE 5DD5H 1YN6B 2X41A 5IJVA 4QLRA 1WT5C 1JPGB 5AAWA 1QSEA 2BFVL 2C4XA 3L5IA 1ZT1B 5GIRA 1FSKB 3S3PA 3FB8B 1R3IH 4HWEL 4L8SB 1Q38A 3AS2A 3MRNB 3BYTA 2D03H 4G6KH 1AIFA 3EO1B 4MA7H 4L8CA 5MI0C 1TVHA 3GZKA 4J3SA 2Q6WA 3U0TB 4QHMA 4CDGC 1BAFH 4G8GA 3T4AA 1NMBH 2MCPL 1KCVL 3QDAA 4UDTA 1ZHLA 3JSSA 5T1DL 3D39E 3QUYA 2BVOA 3NFNA 4R7NB 3KPPB 1A4JB 2EDQA 4I3RH 4MNGA 1WTLA 4DZ8A 5I1GH 1BREA 4ZODA 2YD1A 4LCUA 1YNTA 2A74B 1T5WB 1XGPA 1AD0B 1NCAL 1CF8H 2NXZB 1JPSL 2VR4A 4JPKH 4LLQB 4LVOB 2VLJE 5DEGA 3R1GL 4Y2DA 2HTLC 4H0GA 5T1MA 3QWRD 5D1QB 4UT7L 1AGCA 2KZ1B 3B6SB 3RY6A 3O4OB 3CLFL 2OLDA 2VDKL 4ELMA 4IRZL 1CK0L 4LDLB 5HPMA 3PGFL 3LH2L 1FC2D 4UILL 4M1CD 5EU6A 3ZZ1A 1ZVSB 1I1AD 2VLKB 4ZFOA 1CFVH 5F1SA 1Y0LA 2EXYD 4KHTL 4AH2B 1B4JL 4X98B 4ZFOL 4GW5A 4R4ND 4N8VB 1N6UA 5FYJE 5MEPA 1U92A 5AG8A 2GJZA 3ZDZF 5IMLA 2D0HA 2V5RA 1N64H 4PTTB 5HHPB 3MJ9H 4FQ2H 5D93B 3TCXA 3LMJL 3MLUH 1B6DA 1YMMA 1A7QL 1MH5A 1YEJH 5L0QB 4JQIH 3FRUA 1KEML 3E3QE 1NL0L 3SKJL 3PWPD 4RAHA 3LS5L 1WZ1L 3ILQD 3NGBC 5HI5C 1N0XH 3C2AH 4NUGH 5DJXA 5EWIH 4OGYH 5LAXB 2XI9A 2N7AA 4H20L 4JFPA 3KWWB 4OCWL 4MLSA 5C0IB 3IU4H 3SE3C 1EAPA 1XR8A 1AP2A 5J6HA 1EXUA 1UYWH 4G8IA 5JDJA 4GG6A 2CLVB 1IZKA 4U1KA 3JVGC 3PGDA 1F4HA 1U8HB 4PJGA 5JORA 3VFWB 2ICES 1U0QA 2WIIA 1JHKL 4XPAL 5J12C 1L0QA 3CH8A 3CU7A 3GBML 3FFCB 2QSCH 3VGGA 4PJ5E 4PGCA 4ELKA 4GAJH 1C5CL 3GJFA 4K3HA 2NY6B 4PLKD 2SEBA 4PJDF 4D8PB 3FOMA 2X89D 2YHGA 1NBZB 4GMTL 5JA8B 1VFMA 2BNRB 1S78C 5SWZA 1TITA 2BY1A 5EO1A 3LQZB 3QXDA 2QKIB 5GGSY 5KTEH 3A6BH 1MVFA 1QFUH 3W2DL 4NO3B 5IHZB 1X5JA 4IMKA 5D5MF 5IQ7H 5EO0A 4CVZA 3QIWA 4MQSB 5HGBA 1G1CA 4U6YA 1GYAA 4OZHB 1RJYB 2Y06H 4JRXE 3VFGL 3EJJX 4Y5VC 2NX5B 3M17A 4JQXC 1JVKA 1ZLVH 3H9HB 3GMLA 3V52H 3KYOA 4MWFA 2DBLL 2DMCA 2G5BA 5KJRL 2E7LA 4PR5B 3SJVA 3T0ED 5BQ7A 1I3GH 1R24B 2ICWI 5TDPA 4HS6A 3O2WH 4OFVA 3IS0X 4I0PA 1WFNA 1F11B 4UQ3B 1FL3A 1FYTA 4R0LC 1OAKH 4NO2A 4P2QA 4M5ZH 3GSVB 5EA0H 3OKDB 1AKJD 3WN5B 4ZNCD 1RV6X 2AJYH 3AM8A 5AZ2H 3CFEA 4LASH 3CFKB 3U36B 4R3SB 2F8XC 4PJ7F 1PSKL 5LVEA 4P5TA 2HG5B 4ONGH 4MXWH 3VFRB 2PYED 1N59A 4H1LH 4N5EC 4PJBE 3U6RA 4RX4A 5JXED 1MCBA 1W8NA 1PG7W 4YDVB 5DJ6A 4P2OC 5FUCC 1T21B 1OP5K 4M7LL 2P8LB 1Q72H 1X9QA 1NBQA 1I7ZA 4JM2B 3W82A 4AL8H 3IGAA 4LSUL 3DO7B 2GEEA 6CGTA 1O5DT 2AXGB 4JKWA 2R2BA 3F12A 5AEAA 5D1ZD 3OB0H 2XZCL 3V6ZA 5DUPL 3KXFE 1NAKH 2H3NB 1CFNA 4IEFB 5ID1B 2R15A 4KJWD 3WFDL 4Z7VF 1T3FB 1ZANL 3MLYH 4RZCA 3P9MA 2EYTB 1RURH 3DV6A 1ZT4A 5B39B 3D69A 5I9QC 1C16A 1LHZA 3M07A 3HNSL 1B0WA 1VGEH 3BP5B 4L9LB 5A43C 3BHBA 4PBXA 1S8DA 4X4ZA 1BD2E 3BT2L 2NZ9D 2V2TB 1SMAA 2KBGA 1RZFL 3EOYG 2X4PA 4H88L 5KG9B 3ARYA 5F8QC 2QQLH 3LEVH 1YYMH 4QXGL 1IM9A 1CTNA 3ULVH 4HH9B 1HWHB 2X10A 2PW2B 2LU3A 3C5ZC 5TH2B 1Q0XL 4KWUA 4X6CE 2NW2A 4NWUL 5I1DA 3MOAH 5IK3A 4JN1L 1MJ7H 1RUQL 5B8CB 3GMQA 1QA9A 3IKCA 4X8JA 3P30H 4U1SA 1IGCL 3JWNC 5JW3L 4HK0B 5IKCA 3WD5L 2JELL 3MO1A 4X7TB 4YQXH 3CSYB 4FFZL 2E8ZA 5D2NB 1A02N 4CVXB 5T3XD 4EZMA 2HFGH 1AHWC 1T4KA 3WIHH 3HC4H 4XVTH 5IVXB 4PJAB 3GK8H 4N90E 3D0VA 4OZFB 2F5AH 5E5RB 4ZMAT 4YNYB 3GDBA 3IF1B 2EDTA 4HJJH 2CRYA 3S4SB 5IB2A 4JFFE 1DDHA 2X1WL 1H3UA 3WFBL 4WGVB 1AO7D 4YGAB 3Q6GL 5FOJA 3CU1A 5BJTB 4QHLB 1A3QA 3X3GL 3ZL4L 1J9CT 5TFSL 2DJUA 1IM3B 4KY1L 3LKNA 4MB5A 3LS4L 5FM4A 3TWCH 4DKDC 3SGDH 4PY8I 4L4TB 3VWJA 1X5HA 2EDWA 3SGKA 3QNYA 4HJGB 4DKAA 4X4XB 1IGML 2ATKA 5I8KH 4BM7A 1UEYA 1KIUA 2BMKB 3TCLB 1FNGB 4YX2L 1HXYB 2R0ZH 1D6EA 1LP9A 1H5BC 3MXVH 3UTTE 5MP6L 4XPTL 2NXYD 5C0JA 3S5LA 4ONFL 2FHFA 3MV7A 5BV7B 1INEH 2W9EL 4J8RA 4XPBL 3BQUB 5BXFA 2RQ8A 4G43A 5ENWA 3GKZA 2MCG1 4IMLB 3BSZH 1HXMA 1DQLL 5ERWB 2EE2A 5J7CC 5DJZA 5CFHA 5C08D 5JR1H 3KPRD 2YRPA 4P4KA 4XAWH 3T1FB 1E6OH 3ARQA 3EAKA 3VD9A 3FZUC 1I7RB 1N3NB 5EZJA 4WO4D 4PB9H 4JAMB 4F15C 3RA7H 1KPVA 1KFAL 5CGYC 3V5KA 4Y89A 3NCJH 4JY6B 1W72A 3ULUD 3PHOB 1NGYA 3JTTA 1RZGA 5ESAB 4POZC 2ICWB 2VSCA 3N1QC 3ZDYF 1DQJA 3OG4B 2JJSC 3L95A 1GIGL 3LKOB 1XGTA 4KKAD 1HYSD 5EC2B 3NABH 2BDNL 1OAYH 3PL6C 1JNLL 2ADFH 3HMXH 4WI8A 3DMMB 3WHXB 1YEKH 2NTSP 1CVRA 1TTFA 1DR9A 4FQCH 4NQCA 1CIUA 1T2JA 1OSZA 4P46C 4DKFH 3DVGA 1BWWA 1RULL 1UH2A 5INCA 3RGVB 1A6TA 1QSED 5C0BE 1FFOA 1CQKA 3IRZA 4NYLA 2BSRA 4M7KH 4PJFA 1HWGB 4JPVH 1NC2D 1FGVH 4XI5C 1ORQA 2APWA 1U3HC 2IAMC 5EN2A 4PUBL 2FB4H 3KNBB 5ESQB 4RIRA 1NDGB 2H2SC 2X70B 1RVFL 1KCLA 4O58H 5CMAA 5DQJB 5F7FA 3RTQB 1BBDH 4KROB 4Z0XB 4RMVA 1LO4H 4OLUH 1HHHB 1MF2L 3X14B 3HI5L 3ZT7A 4LRNH 3MV8E 5E8OA 4MJ6A 2BOCA 2D7OA 4WNQA 3QUYD 1EFXB 3H7LA 3AGVA 2ZUQB 3OKOB 5FYKH 5F89A 4LDOB 4JFOA 1HCVA 3RVVD 3UCRA 3HZKA 5MENE 2I9TA 1B88A 1T2QL 2ITCA 4NCDA 2FD6L 5JW5B 1MUJA 3RWJA 4N1HB 3AXLB 1MCDA 3BKYH 1WF5A 3BP6A 3A6CH 4K7PX 2P49B 1FN4A 1BFOA 1OOAA 4L3EB 2AV7A 3LPFA 4QRUB 1YEFL 3EOTH 3KYNA 5L8KB 2F74A 4NZTL 3D85A 3BKJL 3HUJB 4PGEB 1AJ7H 1PZ5B 1NEZA 4K3JL 1AFVH 5KS9B 4WENB 4GBXA 1DBJH 4HMDA 2DMBA 4M03A 4O51B 3VGHA 5CINL 3TBVA 3RVWC 1FSKC 2A73B 1NH6A 4JY5L 3CIQA 3MRKB 5DYOA 3UZVB 1MCOH 1QO3A 3VXSE 4L8SC 3CXHJ 4ZFGH 2V5TA 4K3EH 5IGXH 2ATPB 5DEFB 3RU8L 4U2ZA 3TYGL 4AENA 5FA4A 4S11A 1BIIA 1YMMD 5LGJB 1KJMB 2J8UF 3FB5A 4QOKB 4EI6A 3RI5F 4Z7WF 3ZYOA 1FNEB 1UWXH 4NJ9H 5E6IB 4G6JL 4KDTA 1PG7H 5LQBL 3MRPB 1RUAL 1I8LC 1OHQA 3ZTNH 1KLGB 4DN4L 4FNLH 4R2GD 3DVNA 3S98A 5CEXB 4JFXB 5E2UH 2NXZC 3OR7B 5CHNB 5T3ZH 4M61A 2V5SA 4LAQH 4LVOC 5BMFH 4H5SB 2PCPA 4PLOB 1QSFE 1GC1L 5MHSE 4KJPD 3TN0B 1D5IH 5EU4A 3ULSA 5D1QC 5HHOE 4FMFA 1HHJA 2IBBA 3O4OC 3BFOA 3GSOB 2ZKHH 4QRTB 1CLYL 4KVCL 3VFVB 4M43L 4H26A 4Z7OE 4D9LH 4JQVA 1QOKA 2CIKB 4U4BA 4AQOA 4WY7H 4ZXBA 3LB6D 2CDGB 2JJTA 3MRDB 4RDQF 3SDDD 2EDKA 3P9LB 3VXMD 1OWWA 1IARB 2FZ3A 3L3DA 2X9XA 4P2RD 5A2LH 1MIML 3G08A 3MCLL 2MQ0A 4KXZH 3B5HA 5FUZL 5D93C 4JRWA 2AEPH 4GO6B 4PRHE 3DPBA 4E42B 5MEOB 5L0QC 1JHLH 3V7AE 3QI9B 5CWSA 2LU7A 1FO0H 2CIIB 4X80L 2VE6A 2XZZA 1MREL 2E9WA 2GSGA 5IV2A 2DYPA 3SJVD 1YNKH 1CDGA 3B5TA 4QNPE 3GI8H 3QJHB 5D72L 3K2UL 1C8PA 1U8PB 3AAZB 2L7UA 4FABH 2ICEA 5DFTA 1P7KA 5CEZD 3CDFA 3MRJB 4HXBL 5CJOH 3WLWC 4N0CD 5H37H 3ECBA 5TPWL 5F97E 1FYTD 3PWUA 5CKGA 4P2QD 1L9NA 4NQVA 3FT4B 3IDXH 3MRIA 3U48A 3BKCH 5HDBF 5DFVC 2YD5A 1KCKA 5F7HA 2W0KA 1QFWM 5DD1H 5EU3B 4JJ5A 1S7QB 5J57B 4O2CB 1DBMH 2Q3ZA 4QWWD 2XQYG 4P5TD 5BVPH 1A9EB 5HYSB 3LEXA 3SDAD 3BN3B 3QQ3B 1NCUA 1WCQA 1NCCL 5BW7C 4RX4D 2AK4E 3F65A 3OAZH 4QRRE 3QDMB 3TGXA 3GSRA 4MNQA 1J0YA 1WCBB 4C4KO 4XGZB 4HGMA 3V0VB 4UAOB 4FTVD 3RX8A 4ELMF 5IWLA 4KK9C 1OM3H 4OCYH 1D5ZA 2HVJA 1GVIA 1R3JB 2O61A 2XPGB 5TDOB 5GGRB 5JZ7D 1MCJA 1D5BA 1RZJC 2EZ0C 3Q6FB 3QDHA 4UU9B 4OJFL 1GOGA 1R5VA 3G5ZB 3S37H 3CFDB 5IOPB 2CDFB 5J11B 3W39B 4N0RA 1N26A 3U7WL 3R0MA 5ITBH 2CPCA 2R1WB 4RFEA 5D5MB 3L5WA 1YEHH 1ADQH 5C7XH 2I26N 1MHHA 2DMKA 5KVMC 3REWA 1XZ0A 4YH6A 3VRIA 4XC1H 1IM9D 5E00B 1EGJL 4F37F 3ZKNC 1D5XB 1KC5H 1RZIA 3HFMH 1U36A 3RUGA 2AEWA 4J4PA 2X4TA 4NCC1 5FM8A 4G7VL 4GG6F 2YRLA 3SPVB 3RL1A 3QDGE 1FGNH 3W5MA 2KKQA 2E9BA 4PJGF 2D4DA 2F53D 5SWSE 2FIKB 2P5EE 4HQQH 4JM2C 1MAJA 4XNUL 5JPMB 2B4CH 1SEQH 2FX9H 4FP8L 1HH9A 2M2DA 4Q9QH 1INQB 3KJ4B 3BP4A 4DVRL 4M1DL 2NY5C 3WJLC 4LBEB 2HT4C 4PJ7B 2K7PA 4JM4H 5EBMA 3MLWH 4KAQL 4XAKD 1L7IL 5CD3B 4UBDC 3KR3H 1YYLH 2X09A 5HDLA 5GS1B 1BVZA 2J4WH 5EZOH 1F3RB 1GAFH 3QPQC 3VFSA 3ARWA 4MZ2A 1CL7L 2IGFL 5HGAB 1S5IH 4NNXB 4L9LC 1FZMA 4LSPL 4YFEA 2BXYA 3FQTA 1RU9H 1LWRA 4MDJB 2ZP0T 3HE6B 3CPLA 4Y7MA 1U8MB 2XZQL 2AK1H 4JPIB 3TZVA 5E1AA 4B41A 3DRTB 5BZDB 3VWJD 2KDGA 4YWGH 4JG1H 5JQ6H 2RCSL 4NPYB 5IFHL 5EBWA 3PE9A 4X0KB 2YPLE 5E24E 1IGTA 1Y18B 3BISA 4S0SD 3MRRB 1DBKL 5I1IL 5JIPA 4FQ1L 4U31A 3HA0A 5GGSB 5B8CC 1QTYT 3MRMB 4WV1B 1DP0A 3MV7D 5L2KA 4W4NA 3GSNB 5D8JL 3OJ2C 4HWNA 1I9RL 3PWPB 5C6PB 2XG5A 1EJOH 1X5IA 4EUPH 5D2NC 4MJ4A 3BEWB 4GKZA 3TBYA 2VRAA 2VQ1A 5AAMA 5KVGH 4CU7A 5JW4Q 4U6VL 3QZWA 4JR9L 3B2VH 1KACB 1CWVA 4QXTB 2IADB 4UT6L 3QNZB 2HJKB 5C2BL 3GSQA 2VDOH 4XWGL 3N1MC 4IOSD 2L0DA 1KJ3L 5DVOA 1J7VR 1F8TL 3V6FA 4XB8A 4MX7A 5JHLL 2IF7A 1MCHA 5T1KA 2X2YA 2XKSA 4POYA 1X5GA 3MLVL 4WI2A 4F9PA 1NGXA 3TO4B 2PXYB 1D9KA 1NJ9B 2FEDD 4ZUTA 3OXSB 4M48H 5CJQL 2EYSB 1MY7A 1WBYA 2ESVA 4ZS7H 5HVWA 5BV7C 4M3KB 2LQRA 3BQUC 3H42H 5IEKA 4HWBA 3RIFK 1AGDA 3E6HA 1MJ8H 5HY9B 3D3VA 2AV1A 3THML 2A1WL 2H2PD 3CH1B 4X99B 3QHZH 4J2XA 3T0EB 4BUGA 1ZHNB 3DX8B 4YZFE 3MRCB 4FQQB 2NY5H 4P4RB 1T0MA 5I1CH 5E99L 4XNXL 4XCEB 5DQDL 4H8WL 4MNHA 1SQ2N 5KSUA 3T0VA 5INDA 1WBXA 5BO1H 3MLXL 1E28A 4U1IA 4I77H 1AKJB 1S7TB 2OCFD 3DNKA 5JMRA 4DUWA 3VCLB 3FRPA 5GZND 3ZYIA 2VOTA 5TE7L 4IHOB 3K0WA 4LSVH 3DMMC 1T7XA 3WNMA 1CLZL 5D4QA 5AUMB 4GXVH 4HFUL 4MXQD 1QBLH 4PRPA 3GIVB 2YR3A 4HUVB 1TVDA 1I7TA 4NN6B 4QYOA 4EQ2A 1NC4A 3I2CL 4X6FB 2ZUWA 1MRCH 3SE8H 5J9PB 1D3CA 1M7IB 1PW3A 1AGEA 2R4SL 1U8NB 1KCSH 4OD3H 3VGDA 4NUJA 3HE7A 5JUEL 2VDNL 4YC2C 5F7EL 3O3EB 1B6UA 1MFEH 3U4EB 4Y1AA 4BQ8A 4HCRH 3RTQC 5CD5C 5D1ZB 3EYOA 2F58H 2YN5A 4LNRB 4KROC 1JGLH 5DURD 2R39A 3B9KC 4ZSOB 1MRDL 35C8H 4UV4H 1EFQA 2BSED 4F7MA 1B2WH 2A0LC 5DLML 1A6UL 1JK8A 4YXLH 1YEGL 1LP9F 2ZUQC 4AEEA 4OIIL 3IDJB 3EYFB 2AJVL 2ZOLB 4NQSB 5F88B 5GS0H 3SE9H 1IC5L 5IB4B 2A83A 4YXHL 1ORSA 3O3AA 3HAEB 4ZTOH 1G7JB 3DV4A 5C70A 4AG4H 4YXKH 1BVKB 2W0FB 2EEAA 1WLHA 1FJ1B 3EYSL 3O6FA 2DS4A 2EH7L 3I02A 3HZYB 1T1XA 2CUHA 1RD6A 2O5ZH 1C5DA 1FNLA 2IH3A 4GRWF 5FGSA 2R56L 4KK5D 1MRFH 4PV9B 3GNMH 4M7JL 3NVQA 3O0RL 1QLEH 2DTML 3AU1A 3BJ91 5D70H 1MFAH 4Z77A 1XFPA 5F7UA 4MMXC 4ODUA 3DUSA 5SWQA 1A8JH 3VDBA 3IDIA 2DIAA 4OTXL 1EEYA 3EDFA 5I0ZA 4UTBH 1E4XH 4MJIA 5E6IC 3O41A 5F7NC 5GRJH 4JFDD 3OXRA 4Z7QF 3D5OF 2PW1B 3WHE0 3PF2A 4DJMA 1P9MA 1AO7B 1EJ6A 1IGFL 4PJFF 2H9GB 3QJFA 3RWIB 1OLLA 1H8OA 4HG4K 2ZCLH 4GMSH 4NJAL 1KPRA 4U1NB 1EA9C 3I3DA 4AM0B 4X9BA 5DK0A 4BKLA 1YPZA 4MJ5A 5DMKB 2J8UB 1J1XL 4XZUA 1KELL 1EPFA 1K8DA 1N2RB 5HD8C 3WIFB 3ARFA 2WUCL 2QSQA 2V7HA 3BUYA 3NZ8A 2NXYB 3UMTA 1ROWA 2E9JA 2EE9A 4NN5C 2VLKE 2OQJA 4N1CA 1PKQA 1KB5L 3MZTA 1ONQB 1LMKA 4Q0XH 2AJ3B 2Y7QB 12E8H 1MWAB 4PP2A 5HHMD 1A1OB 1JGUH 3CVIH 3FQNB 2FO4B 5C08B 3KPRB 5E95B 1WIPA 1CVSC 2DAVA 1FFPB 2HTKD 5DJYA 4Y4FA 4LLWB 3TT1H 5I8OL 1GRWA 4ZTPH 4WO4B 2IG2L 3QI9C 5ETUA 4YGVB 3C5SA 1AI1H 1SJEA 4MQXD 4X6EA 3I6GA 2COQA 4ZO6A 4BSVA 2MQ3A 1WUNT 3VFTA 1ZS8B 1F58L 3RWCB 3VE0B 5MEQB 5J1SC 5DVMA 8FABA 1W0WB 3O3DB 3MRGA 4EVNB 1K8IB 1TETH 1R3IL 4WWKC 5ACMA 4Y16D 5EIIA 3HB3D 1MY5A 2FBOJ 1PG7X 4G6KL 3V6OA 4MA7L 1P7QA 4JO3H 3FFCE 5IJVB 3BZDA 4JRYA 2BSSA 1QSEB 5GIRB 1HNGA 2A38A 4F58H 1FC1A 1L7TH 1X5LA 2XICA 2NY2D 4G3YL 1I9JH 4RAUA 2BNRE 4I3RL 1AIFB 4L8CB 1TVHB 3C2SA 3DBXA 2Q6WB 4I0CC 4QHMB 3QIBA 4PGZA 4WUKH 4XHQA 1Z9MA 4XVJL 3T4AB 5FHAH 3WJJC 4UAOC 4KK8D 4UDTB 1ZHLB 1I1RA 4FHBD 3QUYB 3NACH 4OI8A 2BVOB 3NFNB 3LPWA 3BIAX 4I4WA 5EIQA 1VHPA 3HN3A 4MNGB 4HS3A 4FXGA 4ODTH 3DHJA 4OZHE 4DZ8B 4LCUB 1YNTB 3P4LA 3ARGD 1P84K 2NX5E 2ZWLT 1XGPB 5JW4R 3GGWA 3C60C 2VXUL 3MR9A 3DI3B 4N9GA 1PLGH 4TULL 5DEGB 1Z3GH 4Y2DB 1BPVA 4C55A 5J11C 1IT9L 5F9WB 5T1MB 1TXKA 4JVUA 2GKIA 1AGCB 3QUML 2F19H 3H9YA 4ELMB 4FQLL 4P23A 3KVQA 5K59E 4GKOA 2OTPA 3MJ9A 3LKSA 5HPMB 4Q7DA 3TM6A 3TZVD 2FECL 2OZ4H 3MJ9L 4DGVL 2XZAL 1U8KA 4FQ2L 1KG0A 5EU6B 4ZFOB 3MLUL 3RHWK 1Y0LB 3LEYH 4GW5B 4QTIL 4JQIL 3RZCC 3NA4A 5MEPB 1EBPA 5TJWK 4MD5A 2GJZB 1N0XL 5IMLB 4C56A 3MBXL 1X5AA 5EWIL 1WWAX 4OGYL 4OLVH 1JNJA 4H25A 4TVPE 4UDUB 4XP1H 2QTEA 5BZWA 4ZO9A 1I9EA 5L2KD 2EDYA 1YMMB 2Q86A 4Z5RA 4UNVA 4JCMA 1MH5B 5F9OL 2WINA 3FRUB 2R29H 4AEIL 1UYWL 3EGSA 3QG6A 3KJ4C 5FO8A 5L2JA 2EDDA 5DJXB 3VFUA 2CUIA 2A6DA 4S1QH 4D0BA 4TUOB 3IT8D 4JFPB 4R2GB 4MA1C 2VXVH 1EAPB 4HV8B 5J6HB 1AP2B 2QSCL 1EXUB 1YUHA 2F5BH 3ESUF 3LSOA 4GAJL 4N9OB 4G8IB 1J12A 4GG6B 4U1KB 5GS1C 5L6YH 4I18A 3PGDB 4PJGB 5JORB 4D0CA 1CZ8L 2WIIB 4OLZL 3HE6C 3OAUH 2YOCA 5IB5A 4PGCB 4ELKB 5KTEL 4RNRA 1CU4H 1KIPA 3GJFB 4Z76A 3U0WH 2IPKA 5IQ7L 2SEBB 2DD8L 1B0RA 1OW0C 3FOMB 4R4NC 5C86A 3QUXA 5D7SH 1UCTA 5EO1B 1V05A 3QXDB 4NRZA 3FT2A 4NZUH 2IH1A 3AS3A 3P3YA 3OJDA 4WV1C 4PP1D 1UWXK 4OGXL 3X3FH 1I8IA 3ARZA 3IJSA 3M45A 4JKMA 5EO0B 4CVZB 3QIWB 5HGBB 4U6YB 1IAII 3M17B 1ZVYA 3D3VD 4ORGA 1OAKL 4HIJA 4Z7NF 3GMLB 43CAB 4M5ZL 4MWFB 2G5BB 3FJTA 3SJVB 3RUGF 3MXWH 5BQ7B 4KQ3H 2AJYL 1FNHA 1ULVA 5TDPB 4PJAE 5AZ2L 4BSJA 4HS6B 4L4JA 3EBAA 4I0PB 2FO1A 1RI8A 1FL3B 1FYTB 3OKMA 1ITBB 4NO0A 4H1LA 4W6WB 4NO2B 4ONGL 4MXWL 4P2QB 3QCVH 3DYOA 3HMWL 5HHQA 1L6XA 3JTSA 3GRWL 1MAKA 3TNNA 2W59A 3K4AA 1Q72L 3CFEB 1G7QA 4K8RH 3K80A 4PLKC 1EV2E 4L4TE 5C0ND 4P5TB 5GISH 3TO4C 2PXYC 4LKXA 5K9JL 2DJSA 3IXTA 2EH8L 4PRPD 1N59B 3R06A 3U6RB 1C7TA 5EOQH 4BFEA 1NC4D 3RVXD 5DJ6B 4N0UA 1A9BA 5E0QA 5TE4L 2XTJB 5DD0L 3BMWA 1MQKH 4JFQA 1I7ZB 1A7NH 3MRQA 4EI5D 3IGAB 3AVEA 2I5YL 3BMVA 1QNZL 3HE7D 5E8EA 2Z91A 1W2KT 2R2BB 3F12B 1RURL 3RKPA 1ZOXA 5KVDH 3MGAA 2VLLA 5IB3A 4HLJA 5BS0A 1X44A 2DB8A 3V6ZB 3SE3A 3CFIC 1PEZA 1CFNB 1SYSA 1RUKH 1YEIH 1JPTH 1AC0A 1GJIA 3LEVL 3FO0H 3P9MB 1R3KB 4RZCB 4LLUA 4UIKL 3LAFA 3ULVL 3DV6B 1ZT4B 2JCCA 3D69B 1C16B 3G6AA 1FH5L 4LPTA 4LPVA 1X5ZA 3BHBB 2EXWD 1S8DB 1BQUA 3MLZL 2VZVA 3MOAL 3UZQA 1MCSA 2X4PB 3NMEA 1IM9B 4PJIA 3PWVA 5GJTH 3P30L 3OAZK 1GHFH 4URTB 1MCPL 5I6XC 5C92A 3O6FD 4KI5D 3N1GC 2AQ1A 2Y07H 3Q1SL 1QR4A 2NW2B 2OP4L 5I1DB 4NN6C 3P77A 5IK3B 3TEUA 5KSAD 4YQXL 3VXTA 3GMQB 1QA9B 3IKCB 2GY7B 4X8JB 3WIHA 1A4KA 2VDLH 2HLAA 4U1SB 3WIHL 1KEGH 1DVFA 1WWWX 4XVTL 3UAJC 5IKCB 3NFPA 3EYQD 5BCAA 4HJJL 5IMMA 1SMOA 5GGTH 3MO1B 3P11H 2XN9A 2ZCKH 4HEPG 1LEKA 2PTVA 1U2CA 4JQXA 4YBQC 5EU7C 1L4IA 1GH7A 1LO5A 3ALXA 4QRSA 1T4KB 4D9QE 3NN8A 3V5DA 3PV7A 3D0VB 2VZ3A 4ZYKA 5IB2B 1DDHB 5L8JB 1CTOA 4XBEH 3EOBA 4PFEA 1T1YA 5ID0A 2R0ZL 1G6RL 4WUUA 2Z8WC 4ZS6D 3TIDA 3VRJA 3IFLH 4NDMA 1UCBH 3LKNB 3VWJB 3QNYB 1INEL 2ATKB 4JFEE 2Z4QA 4L3EE 1DBAL 2ZOKA 4EIZC 1RUMH 1RIVH 1T0PB 4Q9RL 5HGGS 1QEWA 5EUOF 1D6EB 4P2OA 3ARFD 4U1LA 3HUJE 1LP9B 3BIKA 2V9RA 3DIFA 3DXAA 4MVBC 5KS9E 1NANI 2Z35A 4XAWL 2OL3H 3OZ9L 5C0JB 3K46A 3S5LB 3FCTA 3MV7B 1CYGA 1I9IH 4J8RB 4PB9L 5C1MB 5BXFB 4G43B 5ENWB 3W11C 3TBWA 3Q2CA 1HXMB 5ADPH 5DJZB 1TJGH 3KPQA 1JHTA 4KH2A 1VSCA 4LCYA 4P4KB 2NY4B 1TQCB 2HT3C 1IC7L 4Y4FD 5EZJB 4QOKE 1KPVB 1Q0YL 2UYLA 2AABH 1FLRH 3HMXA 4GRWB 1OAYL 3V5KB 4ODHH 4JHAH 2Q8BL 3HMXL 4LNVA 2GTWA 1W72B 5A3ID 4MXVF 1NGYB 4OFIA 3JTTB 5C07A 1RZGB 3D18A 1YEKL 3OJMB 4FQCL 4DKFL 4HH8A 1CE1H 1EMTL 3T2PA 4FG6D 1DQJB 5TGBA 3L95B 1J8HA 1XGTB 4R9HA 4KHXH 4NHUA 5E4EB 3ARBC 2FB4L 2QSTA 2VLRE 4O58L 2DDQH 4NQCB 1OSZB 3DVGB 1BBDL 5INCB 2ZNWA 1A6TB 4ODSH 3TPUA 1MPAH 1FFOB 2NXYC 1MJUH 4RMTA 1OTTD 4NYLB 2BSRB 4PJFB 4LCWD 4WCYL 1ORQB 4MCZA 4PGBA 5EN2B 4M62L 1K2DA 3NAAH 4MAUL 4RIRB 1LQSR 5HGHA 5CMAB 1OY3B 3B3IA 3EDJA 5I76A 5FYKL 4X7EC 3G6JA 5AD0A 3QIBD 3OJVC 5I8CA 2AP2A 1CGVA 1WICA 5E8OB 4MJ6B 3V4VH 4WNQB 5E8DH 3BKYL 4RMSA 3A6CL 4WO4C 4WU5A 4XCYA 4Y4HA 4KI5F 5LJYH 4JPWL 2R0WH 3ARVA 1OVZA 5F89B 3LVEA 4JFOB 2D0GA 5FAAA 1LEIA 4AZ8A 2VL4A 1BZ9A 3HZKB 2I9TB 2ITCB 1MUJB 1MCIA 3RWJB 4PLJD 3BP6B 1DEDA 5AG9A 3BZ4A 2DF3A 4EXPX 1FN4B 1BFOB 1H15A 3LZFL 3NH7H 2AV7B 4NKQB 3KYNB 2QEJA 1LO3L 3Q3GA 3ZE1E 2F74B 1BFTA 3D85B 4NQEE 4P23D 5I16A 1RPQA 4LSRH 4ZFGL 1NEZB 1WZLA 4G6MH 4G5ZL 4JHWH 4HHAA 2FEEI 4GBXB 3TBVB 4HT1H 5FGRA 4IIQA 3MOBH 3SBWC 2C26A 3LD8B 2ZG1A 1QO3B 4NJ9L 4J3TA 5FUOH 4C56D 2HKHL 3ZDXF 3ZTNL 2W1NA 2XG4A 1OAQL 2YPKA 1OCWL 5DURB 1RZ7L 4AENB 3NA9H 5FA4B 1YPZF 1BIIB 3KPSD 1CFTA 4JGJA 4WI4A 3FB5B 5IT2H 1BJMA 5T3ZL 2O5YL 3ZYJA 4EI6B 1M71A 3L3KA 3PWNA 1A7PH 1LDSA 4J6RL 2QLVB 1Y6MR 5JOPD 1PKOA 2ZKHL 1A6PA 3DVNB 5DUMH 2W9DH 4KRMB 4WFFE 3EHBC 5DRNA 2X9WA 1UQSA 4A2LA 4M61B 3O2VH 3MBEC 4M6NH 1IQDA 4Y2DC 2PCPB 1CT8A 3PL6A 4O02L 5F9WC 1SVCP 5JW4N 1G6VK 3MMEA 5C6TH 3NCYS 5EU4B 3ULSB 3RY6C 1HHJB 3O3BA 2FR4A 1XF1A 2WUBH 4P46A 5D5ME 4H26B 3P0VH 1FE8H 1TJHH 4WU7A 4HEME 4ZXBB 2DQHH 2JE8A 2YA1A 4FFYH 4I1NB 4XPGL 1JHLL 2NR6C 5M95B 3QUXD 2DQEH 1FO0A 5FV2A 1FL5A 2AVGA 3DX6A 3QXAA 4IDJL 1JUFA 2FZ3B 3L3DB 3F6LA 1KGCD 3G08B 2KL6A 1DLHA 1YNKL 4UOW1 1BQHA 5ANME 4L4VD 4PTUA 4XNZB 2MQCA 4FABL 2ZSWA 3IDUA 5D7IE 5CWSB 4KZEL 5CJOL 2VE6B 3U7YL 1QLRA 2GSGB 2YBRA 2DYPB 5IV2B 3BKCL 1KIQA 1F02I 1SM3H 3BAEL 3P73A 2LTQB 2HTLD 2ICEB 4BZ2H 3QDJA 1SJVA 1M4KA 4LLYB 3ECBB 5BVPL 3BYYA 4NO0D 3PWUB 1S9YA 4OF7A 3RQ3A 1J0HA 4NQVB 3MRIB 5F8RC 2F54A 1HKLH 4QGTA 2V9QA 4CAGA 4JJ5B 4NKOA 5ITFA 3BDBA 3HG1A 5E8PA 1BIHA 3BRGC 2R2HA 3RY5A 3LEXB 3PNWA 4OCYL 3HC3L 2BVUA 2PF6A 3GSRB 4MNQB 3BO8A 2YN3A 2BFVH 5HHMB 3V79C 3ZE0F 1TZIA 3ZYZA 3QIWC 4LU5L 5HI5D 2Y5EA 3S37L 3MOQA 3QFDA 1D5ZB 2HVJB 3ET9F 1I8LA 3V8CA 2O61B 2EKJA 1NFKA 4GRMA 3PWPE 5BS0D 3MGTA 5ITBL 1ADQA 1D5BB 1GGBH 1YEHL 2RGSA 1ADQL 2MCPH 1KCVH 1KTLA 4XHJC 1LE5A 1R5VB 2E7LC 3VFMA 4Y19A 1HQRA 5LCVL 4X6BA 4N0CC 4U1HA 4I0PC 3UTQA 1KC5L 5C0DA 4RFEB 3L5WB 4XNYL 4ETQA 1JN6A 1MHHB 1JPSH 4PGDA 5CJXA 4ODXA 3REWB 1XZ0B 1FGNL 2GJ6A 3AM8C 3R1GH 4I5BA 5FO9A 3VRIB 4WI3A 2CJUL 2B4CL 1SEQL 1AXTH 1RZIB 3CLFH 5HPOA 4P5TC 1BWMA 2VDKH 4IRZH 4Q9QL 2OR8A 4KV5F 3RUGB 4WWID 3WKML 2H32H 2X4TB 3PGFH 5SX4H 1EO8H 5EO9A 3RL1B 4JM4L 2XTJC 3G5YA 1JZ6A 5ECJE 1B4JH 1EERB 3PQYA 4JHBA 3OG6B 3DROA 1D6VH 3REVA 1HH9B 3KR3L 1YYLL 2G5RA 5EZOL 2J4WL 1GAFL 5JZ7C 1S5IL 1LK3H 1MHPH 5EBMB 1QPPA 3ARGB 3LMJH 4MB3A 5FYKU 3BJLA 1U93A 1JRHH 1A7QH 5L9DH 3PJSA 5GSRA 3SKJH 3T0AA 2AK1L 2P45B 1QYGL 3T0EE 4H20H 4OCWH 3VFSB 2RR3A 4JG1L 4YWGL 1N4XH 2X4NA 4KDVA 1QG3A 1FZMB 1VESA 2KUTA 2B7DT 3FQTB 3NCEB 4WUUD 3UTSA 2E7CA 3CPLB 3Q5TA 2VL5A 1JWUA 3TZVB 1JZ7A 5E1AB 3K8LA 1KN4H 3BGFB 4X7DC 4P5KA 4X6DA 3H9ZA 5EFIA 4GAFB 2G9HA 4KKCC 4LIQH 2R2CA 5EBWB 4Q6IA 3JZ7A 2RHEA 3F8UB 4N5ED 5IR1A 1DJSA 4HBCH 1IGTB 4EUPA 3IDMA 4P2OD 2PYEE 3DXAD 5DXWA 3WFCL 3VU2A 4Q6YA 2Y5TA 4NQXA 5L2KB 3VJ6A 4GMTH 1E6JL 4KU1A 3JWOL 4PJEE 1G7LA 3B2VL 4GG8A 2YXFA 5L88H 3O11A 5IB1A 2VLMD 1HZHL 4OFPA 4XP4L 1JF1A 3EDEA 4GKZB 3TBYB 1D5MA 2IALA 2YWYA 2VQ1B 1GGYA 3QZWB 1VKXA 1NGPH 3CMGA 4CGTA 2UVEA 2VSDA 4CNIA 2PO6A 3EYVA 1HSBA 1KXQE 4HPOH 3GSQB 5C07D 5KJRH 1R0AL 3TIEA 2AJSH 5C0AA 3V6FB 4MX7B 4L5FH 3BW9A 1J8HD 4BH7A 1CICC 3SGKC 4FXLA 4ZS7L 1P4LA 1FRGH 3C5ZD 3PP3H 5DJDA 1NGXB 1D9KB 1J18A 5FYJL 1M7DA 4ZUTB 4I2XA 2HA1A 3ULVF 4JE4B 2RIKA 4OSUL 2JCCF 1L9MA 1U8IA 1WBYB 2ESVB 3QHZL 2D7TL 1T83C 4OGAC 3OF6A 5IEKB 5I15L 3PP4H 4WJ5A 1AGDB 1OSPL 2WNGA 4Z7UF 3E6HB 5I1CL 4PJIF 3D3VB 2AV1B 4P4KC 3LHPL 2NY4C 1TQCC 4TTGA 4LSUH 5T3XE 4I77L 4Y4HD 4KRLB 2DICA 2H41A 4DAGH 4U3CA 2FCBA 2KQMA 1T0MB 1ES0A 4N5UA 1F00I 1AO7E 5D6DA 1S7RA 4MNHB 2ZUXA 4GXVL 3WFDH 1UZ8A 5KSUB 5IMOA 4HFWA 5INDB 1NAMH 1WBXB 1E28B 4U1IB 3LRGA 1MRCL 3SGJC 5I30L 2H1PH 4W81A 1ZGLA 5KANI 1ZLUH 4ZOBA 4KJYA 4E9LA 4ONHA 4EOWL 1JTOA 3BT2H 5FHBH 4DWHA 4HCRA 2J8UE 4PRPB 4HCRL 3V8OA 1I7TB 2HRPH 4QYOB 1NC4B 4JDZA 4BQ9A 3X17A 4UV4L 1AGEB 1K4DA 1B2WL 4LHUD 5TF1L 1J1PL 1JF5A 4NUJB 3HE7B 3HS0A 3V95A 2VERN 1G7IA 4YXLL 1Q0XH 3P2TA 4NWUH 3GHEL 2UVFA 1BMGA 4JN1H 1RUQH 4Y1AB 3EYOB 5IUSA 4QHKI 1OAZH 3FZUD 5A2IH 5C08E 5T3ZD 5GS0L 1OQXA 3KPRE 4F7MB 5JW3H 3WD5H 1S7VB 2O93L 3EFDL 1U41A 1X3DA 1P6FA 2JELH 5CGYD 3N0PB 5T5NG 1E4WH 2UV3A 3H0TA 1EHLH 4FFZH 3FONA 5IP4A 3FQWA 3OKNA 4JEGB 3MUJA 4CVWA 4ORZC 2Z93A 3D25A 3ULUE 5DC4B 2CR3A 2A83B 2O5ZL 2JK5A 4LARL 2A77L 1ZAGA 1ORSB 3O3AB 3PL6D 4NZJA 2DIBA 1ZLWK 1A14L 3DV4B 3P0YL 3Q6GH 2IMMA 2HJFB 1H8SA 2IPUK 1QLEL 4P46D 2VQTA 3K74B 1UC6A 3X3GH 3O6FB 4NM4L 3ZL4H 1MFAL 3I02B 3TH2T 1T1XB 3W81A 5GZOC 4KY1H 4GBXC 1C5DB 5F70A 2IH3B 3S35H 2B5IB 3TT3H 4NFBA 4H0HB 4XI5D 3VFNA 1QSEE 2IAMD 2P46B 4AEHL 3I75A 3LD8C 3OWEA 2H2SD 3NCFB 4KFZC 3AU1B 5GRJL 3VXRD 4Z77B 3DHMA 1DANT 4ODUB 5ALCL 4XPTH 3DUSB 4ONFH 4KMTL 4Y8DC 5SWQB 2P24A 4LVHC 3IDIB 2EICA 2YD3A 2ZCLL 4XPBH 1EEYB 4GMSL 5DJ8A 5A2KH 4MJIB 4KDTC 4HWZA 3O41B 3VG0L 3OXRB 5BOZG 2P5WA 3MQIA 4MNGE 5JOFA 3QJFB 3VD3A 3OGOE 1BD2A 4KKBC 5JNYA 1GC1C 4EQ3A 2OI9B 3QDJD 2Q1EA 1VGKA 4BKLB 1YPZB 4MJ5B 4OLXL 1IJ9A 3EDDA 1UXSA 4XZUB 3VW3H 4FQXA 4D0DA 2F54D 5D6CA 4ELME 4X6CA 4Q0XL 1K8DB 2WWKT 3RVWD 3ARFB 1HQ4A 1WFTA 2EO1A 2V7HB 3BUYB 3NZ8B 3HG1D 3SDYL 5CSBA 4ZXBC 4KK5C