1NCDL

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL01
2QSVA 3BPNC 3GHBL 3HI6H 4OCXL 1E4KA 3VRLE 3WE6A 4DKEL 4X5WB 1BZ7A 5I8KL 2ATPB 2R0LH 3IKKA 1HYSD 4UU9B 2HG5A 3HE7D 4JJHA 4W4NA 3RGVA 1J1XH 2JELL 3GSUB 2IPKA 3HA0A 1JK8A 3P0YH 5KW9L 4YHLH 1CDGA 5F3BA 5EG6C 3DVNB 1PSKH 4H1LA 3CMOL 4WU5B 4WI5A 1NBQA 2APXA 2HTLC 4M7JH 2J12B 3EYSH 4XWGH 5IB3B 3KWWA 3EYFA 1X6NA 3CFDB 5CP3A 1U8NB 1Y0LB 1M6OA 3BPCA 4UBDC 3EIFA 1KTDA 2WWMD 1W72L 3GMOB 3WFHA 4PLNC 1JUFA 3HAEG 4JY4A 2PYFB 3VGGA 2DL9A 5DQJA 4RQQA 3PIQA 3B9AA 4F57L 4LP4A 4X98A 4ZUWB 3GI8H 3IU3B 1U8KA 5HVWA 2QHRL 1R5IA 1YY8B 2AGJH 4NN7C 3RJQB 4P2OB 15C8H 4WVRA 4KMTH 4A2MA 4ZTOL 3QJFB 2BHUA 1YNLL 1NBYA 1YEHL 4PP2A 5DJ0A 3MCKB 3UBXI 1MHPH 1NFDB 1XZ0A 2Y9RT 3S97C 3W2DL 1BGXH 5E7BA 4RX4D 1S7QB 5I1KL 1FGNH 4PBXA 3GKWH 3WYRA 4P46D 2FZ3B 4XXDB 1ZSDB 4IRSA 3ARBC 1IM9A 3D25B 3EDKA 4QWWC 4YUEH 4QOKD 4NM8L 3BISA 4TUJA 2ILLA 3QIUA 4Q74A 2GEEA 3FO2B 4LHUG 1OAUL 3CFJB 1NCNA 2I25N 2IH1A 1RZFH 4MA7H 3SGEH 3L3OB 1RHHB 4E42B 3VMOA 4RGOL 1FLRH 2Z91A 3QQ9D 5IJKA 4JFEB 3TJHD 5IHUL 5B39G 3HCVA 3P11L 5FYJU 2IBGA 2ITCB 3ZKXC 5JXED 2FECL 3OWEA 3S36L 2XZQH 5EU3B 4YBHA 4HH9B 4DZ8B 5GGVY 3O8XD 3ZDYE 3JWDC 4JREC 4M8VA 4GXVH 3MRKB 5JPNB 2A2QT 2KPNA 1FGVH 3QEGH 3P9MB 5MEND 3D48R 3H2WA 3N1PC 3QUZC 4LCYB 1OTTD 4XBPB 4NCC1 1T0MB 3HZKB 4NHUA 5HYEA 2UVFA 3T77A 3MA7B 4M03A 4XC3L 3WIHH 1RY7B 5DLMH 4JVPA 1GYAA 5I18H 3BZEA 1UXWB 1EA9C 3TCLA 1S7SB 1IVLA 3O6MH 1K8DB 5D71H 3I50L 43CAA 4EIZC 3WO4C 2JTDA 2Y1VA 1X5XA 1H3VA 3O2VH 1KB5B 4I8DA 5FGCE 2EDEA 3X11A 4ONHA 4ZMAT 5E2TH 4WHYG 4KQ3L 3RZCB 4Z95H 2BVPB 3L5JA 4OSUH 4KV5F 4XVSL 2W92A 3L5XH 3QO0B 4DAGH 1U3YA 5J13B 3O9WB 4XPTL 2F53A 3WFDL 4LPUA 4CVXB 3S96A 3WUWA 4ACPA 4NRXB 4WWKB 2IQ9L 4WW2F 3MREA 5HYSG 5CEZL 1AC6A 4U05A 4IDJL 4MWFA 4QY8B 4NO0B 4FFYH 4Y19A 4KJWD 5EUOE 4OJFH 5DK0A 5CP7B 1J8HB 3N85L 5FM5O 3V4PH 4OF7A 4ELMF 1I85C 3MOQA 3HLAA 1XIWB 3HS0A 1BFOB 1EK3A 3BKJL 4NQEA 4OFPA 1D9KD 3JTTB 2H9GB 3BUYA 1QBBA 5D1ZC 1CDCA 4M6ML 5JW4M 1TJIH 1A6VH 1HCVA 3DXAE 1A6TA 3STBA 4LAQL 1WBZA 2HTLD 1BOGA 1PZ5A 5D7LB 3IJHB 1E6JL 1OD9A 3SQOH 3ILPA 4UBDD 5IB5B 4WTWA 3GSVB 2ZKHL 4OV5B 3MCLH 1AQDA 2R1WB 2NY3B 5D7JA 4YHNA 5JUEH 3K4AA 2ZWLT 3THMH 1YEEH 1QP1A 4K3GA 4O51B 1WICA 2P8LA 3MV7E 3QT2A 1QBAA 1AGBA 4UDTB 2X4RA 3L5HA 1NCDL 4XNZC 3HZVB 1UKTA 2JB5L 4IJ3C 1ROWA 1T4KA 5FO8A 1INQA 4K23H 2Q6WA 3GSRA 4YNYB 5C9KA 5I76A 1FJ1B 4PGDA 4LSRH 1SJHA 4HEPG 4HLZH 4YHML 3P30H 3LEYH 5FCSH 2PW1A 4LLDA 4XCNB 1RVFH 2NLJB 3JVGC 3PHOA 5DEFB 3EFDH 3MTRA 2P5EA 1XR8B 1GIGL 1X6LA 3FOLA 4WENB 5EU5B 5IV2A 1J5OL 3ARBD 2VIRA 4MB4A 2RGSA 1JV5B 2N7BA 3SCMA 3ARWA 2Y4SA 3D87B 4MA8H 2EZ0C 5GIRB 4ODXB 3TO2B 1D5BA 4LCWA 1CWVA 1HXMB 5EULV 1WFNA 4EEEA 2OJZH 1QR4A 4HPOH 4J8RB 1G9NL 3GM8A 3W81A 4RRPG 5J1AA 2IH3A 3PWPB 4WI2A 3GBLA 3VXUE 5H37H 5GHWL 1X4XA 3V5DB 2RCSH 3Q48A 2GSGB 3WNLA 4ZFFB 3VFMA 1WBXB 3QULB 5HVHC 5GGTA 1GH7A 4UOW1 5KS9E 4LLQA 4WFHD 1T1YB 1UM6H 4KHTL 1YUHB 4URTB 1TCRA 3K2MC 1UQSA 5TE4L 5HYIA 3TO4B 1RAMA 1K3ZA 3QRGL 4X6CA 5IB1A 1J1PH 5CIPB 4LSDA 3NFNB 5ERWB 3LQZA 3TZVB 2FWOA 2VL4A 1JZ8A 2AAVA 3FO0H 1B6UA 4QGYA 4C83B 3IXTB 2H45A 2Z31C 2YD3A 4BQBA 4MDJA 5KVGH 4LPYA 2HFEB 1ZGLP 4GG6B 1MCLA 2I5YH 5EU6B 4HKBA 3DECA 2PR4H 1K2DB 4OUOA 2PO6C 2WP3O 3RPIB 4XCEB 1ONQA 3BSZL 4WTZA 5DF0A 1NDMA 4MJ5B 4U6XB 1PKQB 3PP3H 1DDHA 4R4NC 4OLEA 5I66A 5HHNB 1JRHH 3GJEB 4FABH 4S11A 4PJXA 4QRRA 4Y4HB 5JPMA 2EC8A 3TT3L 4KKCC 1UA6L 1IBGH 4FP8L 2FJGB 5I17B 4QHLA 4D0BA 3DHJA 1OSPH 1QSFA 2VDMH 1MNUL 3VFNA 3DYOA 3MLVH 5A2LH 4XH2A 5HDQH 4DW2H 5E1AA 4Y1AB 1VERA 2G60L 4G8EB 2G5RA 2HN7A 3SDDB 3UTSA 1XCTB 3PG2A 2JCCA 2VXVH 3K7UA 4YHOH 5D1ZD 4PRPE 4IRJB 1N4XH 2IADB 5KVEH 2YD5A 4TULH 4XBEL 1PD6A 2WQ8A 3FN3A 4ODVH 1MREH 4OZIE 2GUOA 4N8VA 4FS0A 4JLRB 5C0EB 4HWZA 3LS5L 1UVQA 1LE5A 1NEZB 5DEZA 2DI9A 4NQXB 1UACH 2QV2A 5CEYA 3KPPB 3TN0A 4HUUB 4V2BA 4NHCL 1BVKB 3MV8B 4HFUH 2AQ2A 4QHUB 4JFPA 5KSAB 2VZUA 4N9GA 2P24A 4LSPL 5JHLH 2VQUA 3X13B 2QL1A 1KPUA 4JB9H 4KJYA 3S35L 4NQCE 2AJSH 2BMKA 4DVBA 1E27B 4M1DH 3MV7D 3MACH 2I9LB 4MMXC 4PJCB 5KG9A 5D70H 4WNQB 3ALPA 4APQA 5F6IC 3MSPA 2E5EA 3D1MC 5BQ7B 1JPTL 2WV3A 3A6BH 4IOFC 4L4JA 4LSUH 1ZOXA 5CJOL 4DN3H 3TT1L 1K6QH 5FM5M 5FUOH 1KIRB 3QDAA 2WBJB 5CFHA 5FGRA 2Z0BA 3PJSA 2EZ0D 4NKMB 2PTVA 5DMJB 1S9KC 4G6FB 3BD4A 3ULSA 5JQ6L 4HXAL 2B2XL 4Q2ZB 4HX1A 1NFDF 3FZUD 3SKNB 3MRFA 4OCLC 3VXTB 3U9PL 5BS0B 1GGUA 4PJBE 4PRBB 1CGYA 1VFAB 1MHEA 4QTHB 3MLUL 3T0EA 1M71B 5C0NC 2X4NA 2W38A 4LLVA 3IDJA 4J6RL 4JRWA 3B83A 4KWUA 3I3DA 1CGXA 3LPGA 1KFAL 3NPSB 3S5LA 4HPYL 1JPFB 1NBZB 2XG5A 3VXUD 3C09C 5FOJA 1BLNA 4JKKA 1NCCL 3JV6B 3OKYA 4ODHH 1WAAF 5CGMA 4RGNB 4KQ4L 4NO5B 3ZMRA 3HMXH 1RZ8B 2BK8A 5B8CB 4POUB 1FFPA 4FTVA 1FO0A 5IHBA 3WLBB 5KTEH 2NXZB 4JHWL 3NA9L 4NYLA 4YIQB 4PIRF 4QT5B 5BOZG 3HC3L 1ZANH 2GITB 4I3SH 4PR5B 1DEEA 4XX1E 2QQNL 1KJMA 1FL3A 1ERNA 1FV1A 5DFVD 3CUPB 5EUKA 1BFVL 5T5FH 1YN7A 5HDBE 3C8DA 2PO6D 1RUQL 1F4WH 3MRCA 4P3WA 5GGSB 5BV7B 3HRZB 3RWJB 5CBAA 4PJGE 1RJLB 3GRWH 5FK9B 3ZE0E 4JGJA 3RBGA 1YEGH 1QRNA 2YN5A 4FQLH 3PDDA 1P4IL 4R4ND 5C0IB 5HXMA 2Z35B 5T3ZH 3DRQA 4L4TE 1CD1A 3A0OA 3Q2CA 3UTTE 4KKCD 2JLLA 1CFNB 4MYWB 4NQUA 4PLJD 3MC0A 5C0JA 5EC1B 3Q6FB 3DMMD 3TPUB 1ULVA 2EDQA 1JGLH 2VWEE 1OAYL 2F58H 3KYNA 3O2WH 1SY6A 4AK1A 3O6FA 1MCCA 3JZ7A 3NTCH 5LGKA 4BELD 3GEWB 3MLSL 4Y4KA 4JAMB 4XVUD 1HQ4B 4X83A 2VWEC 3WNPA 4D9RE 2VDQL 2FBJL 1YPZA 2QHLA 2ICWJ 2DQDL 1LO4H 2OSLB 4P5MA 3UJJL 1YMHA 3NIFF 1KLUA 2C3XA 4ONGH 1CQYA 4FMKA 5IWLC 4J23A 4I2XB 4DEPC 3HE7A 5D7IE 4HW6A 2FSEA 5D1XC 3BEVB 4OGAC 1HN1A 4YR6B 5HHXL 4HT1H 4FXLA 2EH7H 3GHEH 5E08H 5DZLA 2ZNWA 3P9LA 1U8PA 3L9RA 2F5AH 2CLRA 2XZCH 4LKCB 35C8H 3BJLA 5FDWB 5ISZE 4PREB 4NNXA 3WIIH 1HILA 3P0VL 5IMOB 1X5JA 5CAYB 4NN5B 5C08B 4XX1G 3U79A 5HD8C 3QWOA 2HKFL 4NQCD 3RTQD 4X4XB 1AHWC 2BRRL 4U1JA 1NMBH 4ZFOL 3C5ZC 5I1EH 5HPMA 1IGJA 2Q7NA 4UTBL 1JGUL 2VDLL 4PGEB 1DVFC 2EEDA 1RIUL 4HJJL 4HQQL 2XA8H 1CBVL 4JFQB 1I9RL 5EOCL 1MVUB 3T4YA 4RX4A 4WHYH 4YAQB 1QNZL 2LFGA 1J0IA 5T5NG 3NBNA 3JV0A 1XGPB 3CC5A 1N2RB 4PP1C 3DBXA 4MNHB 4QOKA 3CX2A 5A1AA 2Q20A 2NTFA 2OMNA 1SJVA 2Z4QB 3VFVB 2D31B 2ESVB 5C0ND 4L3CB 4J3VA 1U3ZA 2VO5A 2EEAA 4UT6H 3V6OA 2DTSA 4KUZL 4HLJA 2VN4A 5IM7B 4CJ1A 1D5MB 2ZSWB 2J6EH 4R97B 4OKVB 1XGYL 1IC5L 4MA1B 5F96L 1I3UA 1BJ8A 3C9NA 1S8DA 2VDPH 2C1OA 3HNTH 5TJWK 1JYVA 4YGVB 3VG9B 1SVCP 4H0IA 4Y2DB 3RVXD 4L8SA 1ZS8B 4Y5XA 1LNUB 1B0GB 1KN2H 4MHHG 4JDTH 5JXEA 3E8UH 1CFVH 4HIEA 4NQDD 4U31A 1CTNA 5E94B 5I19L 5ADOH 4K7FB 2X1PA 3QFJE 5GSRA 4OCMC 3HMXA 3O8XA 1KYOJ 2HAZA 3OF6D 3PQYB 4OLXL 5D6DC 5B22A 5EO1B 5IHZA 1X7QA 1FNFA 3B6SA 5D2NA 3MRIB 4CADA 3SE4A 3D9AH 5MENA 5J11C 4MQ7B 2GAZA 4MNGA 1CCZA 4KI5F 4YLQT 3HAEA 1MJ8H 4OCSH 4P5TC 2H2PC 3V4UL 4Q9QL 4UI2A 3CSPA 1GPOL 2B4CL 1YN6A 1AE6H 3WJLA 1CQKA 5JW4N 4HKXB 4H26B 4TRPH 3C08L 4E9LA 1IGML 3QPQC 4MQTB 2A6DA 2RIKA 3FTGB 4WW1B 1C5BH 4OLYL 4NRYA 3UPRA 1E0OB 2YBRB 2YSSB 4L4TD 5DHVA 2WIMA 4GG6F 4N0FA 5BXFB 3UTTD 5CEXA 4P9HH 3WE6B 3AGVA 1S7TB 4U1GC 1BZ7B 4D3CH 1ZGLA 4MVBC 3SDXB 1D5XA 3MLRH 2HG5B 4QRPB 5LGJB 1CG9A 2IPKB 1JK8B 2ORBL 5F3BB 1VA9A 5DD5L 3JWOH 3U83A 4BSWB 1RZGA 4HGMA 4ZOAA 2VDOL 3A67H 3EYFB 4WUKH 3RKDC 4DJMA 2EE2A 1Q0YL 4FQQA 2AJ3B 2XXCB 2BX5A 5JW4R 4FFZL 1M6OB 3BPCB 25C8L 3BZ4A 3G6AB 3V79C 5B39A 5CZVH 2ED8A 1KTDB 3FMGH 2X44D 3WFHB 4D9RD 1JUFB 2AV7A 2IALA 1D9KA 4AT6A 2DIAA 3IYLW 5DQJB 5E4IA 5FYKL 1FH5L 3PIQB 4OGAD 3FN9A 3MR9A 4X98B 4YWGH 4NGHH 4PRNA 5FXCH 5L6YH 1ZXQA 3O6KL 5FEBA 5D93C 3B9KB 1Z9OA 4KZDH 1A9EA 1JGVH 2BVQA 2DQCH 4I77L 1NBYB 1S7VA 1OAKL 1KG0A 2X1QA 2R4SH 1NGPH 3RWDB 3QCVL 2AK4D 2VISA 2XZAH 1BWWA 1YDPA 4N90D 5ISZD 5T1DL 1ZAGA 4LLUA 5GS2H 1WFUA 4IRSB 3C5ZD 3MOAL 3CVHH 5B3JF 1P53A 1IM9B 4EI6A 3KXFE 4ZUTB 3PP3K 1A7RL 3W11C 4JHZA 1II4E 4YHYC 1EO8L 3CSBA 5C0AE 3NMEA 4HIXH 5EU7E 4ALAL 1RK1A 4UB0H 2VKWA 4B41A 2IH1B 3F62A 1P4BL 3MRBB 3T65B 3VI4F 5GS0H 5FA4A 5J9PA 2A6IA 5CCKL 3TIDB 5EU7C 3ARBA 4P9ML 3S4SG 3KAAA 2HYMA 4GRMA 4HCRH 3P9WB 1S3KL 3SKJH 5IFJB 5D5ME 1WT5C 3HCVB 3QUMA 5M7QA 5GGQL 2GW5A 3BP5B 1ZLUH 3B9DA 5ACZA 4HZAA 2FL5A 2VZOA 4PRDB 4XMKL 5HYSA 3CH8A 2UZIL 3H3PL 1EH9A 2V7NA 4XB8A 4ZO6A 5IK3A 2UY6A 3T3PF 4OKDA 2JJSC 4FQJH 3GZKA 3UTQB 5GISL 4AIZA 5DMIL 1CGWA 2B7DT 3MUY1 4RAVA 2V2TA 2ITDA 1EHLH 4OZGB 1BVLB 3O81A 4YDJB 4NHUB 3QEQE 1MCOH 2ZP0T 3BO8B 1KNOA 1X5AA 1H9VA 4P2QE 1MCRA 2RHEA 1BD2E 4M4RA 1AFVL 3S36X 3BZEB 1NCWL 1Y6KR 2Q8BL 3QFJD 3TCLB 5IMLB 1I1FA 3KPSB 2E9IA 2HMID 5B3NA 2AEQL 12E8H 1DSFH 2H2PD 4UINL 3X11B 3VJ6A 3NGBC 5HHPA 4ONHB 3F5WA 5D7KE 3SGDH 1J9CT 1IEAB 3OV6A 5C0DA 1KC5L 1RUPH 3LKSA 5C0RH 4P4RA 4GQPH 4WGVB 4L1HA 3QPQD 3OB0K 3GSQA 3DUUB 3WHXA 1VCAA 2KBGA 1AJ7H 4XCFH 1BEYL 2O5YH 3WUWB 1PW3A 3ZDXE 3GSWB 1X5FA 1RZJC 4GSDL 3MJ8B 4JFZH 4KKAC 4ZS6D 5E2UH 5GXBB 2D7OA 4K3HA 3GMLB 4Y19B 5DK0B 5T1MA 1A1OA 2HJKA 5DJ6A 5TH2B 4WJ5A 3I3EA 1ZHBB 3BP7A 4MVBD 4O02H 1L0XA 2M1KA 5IQ9A 5F7HA 3HS0B 5C2BH 1BBDH 4YPJA 5B21A 4GW4A 2I60L 3WDJA 1FC1A 1VB9A 2V17L 3BGMA 4OQ1A 1AGCB 2XRAL 3D0LA 4HGKC 3RL1A 1A6TB 3BT2L 3GUTA 3CFCH 5E8OB 3QIWC 1PZ5B 3MRGA 3MRPA 3FRPG 1JCKA 4B0MM 4CN1A 3KLAB 3IAGC 5F7KC 4C4KO 1K5NB 4LPTA 1AQDB 1P2CB 1NGXA 3OKNA 5EUOA 3D5OF 5EZIH 5D1ZA 1KYOK 4YHNB 3UP1A 4L29A 5BW7C 5C0BB 1WITA 2P8LB 1AGBB 2JF1A 1DQTA 3GSXB 2VB5A 2PYEE 1WK0A 3ZKSD 4DGIH 3OR7A 5F97E 5CUSH 5FO8B 4KK8C 1YEKH 2Q6WB 2MTPA 3GSRB 1NANH 2FIKA 4PGDB 3RVUC 1T6WA 1TIUA 4ODUB 4R8WL 2DN7A 4N8CL 1DUYB 4OCNC 1CE1L 2ZZUT 3WKMH 4XB7A 4YO0A 3E6HA 4D2NA 4HBCL 2P5EB 1SEBA 3FOLB 4XZUA 5IV2B 1FLTX 3V5HA 3X3FL 1OQOA 1EERB 2FH8A 2XY2A 5JW4Q 3S37X 5K33A 3MV7A 5FV2A 1YEIL 2PKDA 3MLZL 3MYJA 1FVDB 2GJ6D 3KXFD 3HI5L 2YHGA 2K7PA 3JVGA 3ULUH 1D5BB 2E3VA 4G6KH 4LCWB 4G42A 4LEXL 4M48L 1JZ7A 3F6LA 4TNVF 5C0AD 1W0VB 3VXRE 3IF1B 1FRGL 4O58H 4RISH 2ZCHL 4G8IA 2H1PH 4L9LA 2X4TB 2FX9H 3UPAA 1OVZA 4G6JL 1R5VB 4HS6A 1AP2A 4NM4H 3VFMB 3TYFB 3BD5A 1KJ3L 4LLQB 4R90H 5DGRA 4HEME 5IW3A 4G7VL 4WTXA 1HQRB 1CDUA 2LU7A 3NVQA 2NX5B 4X6CB 1OW0C 5IB1B 2ADIB 2ZCKH 5A43C 4D0DA 4G8GE 2F74B 1IQWH 3GFUA 3K8MA 3TGXA 5I1IH 3RY6C 4JGUA 3PWUA 2HH0H 5TF1H 4RGMC 3VXUA 2RB8A 4POYA 3QEQD 4UT7H 2ZUYA 1HEZA 1WVZA 4LOUC 5KS9A 3UZVB 3I84A 1BD2D 3GJFK 3MBXL 4JM2C 4AG4L 2ZNXA 1NUFA 3HI1A 4MXVE 4LSVL 4YGAB 4FQ1H 5F1NB 1NDMB 3EUUA 4PJEB 3MRLA 2KKQA 4N0YL 5I66B 1DE4B 1ZLVK 4LASL 1C5DA 1CGSL 2DQUH 2Z31A 1OGTA 4BSVA 3NPZB 3BJ91 1T03L 4PJXB 4YFDB 5CD3B 1CT8A 5D7KD 3GM0A 4XVJH 3GMNB 2PO6A 5I2IB 2IPTH 4QHLB 4PY8J 4D0BB 1QSFB 2X70A 4U1NA 3VFNB 4HG4K 5FFLA 5AD0B 1JGDA 2WLZA 2C3VB 1OWRM 5J6HA 1A14H 1H5BB 3NH7L 4Q58C 1MI5B 4XH2B 4EI5C 5DWUL 3HB3D 5E1AB 3DRTA 4UIKL 3GHBH 4OCXH 4DKEH 3EYQC 4WY7L 5I8KH 4WCYL 2HN7B 3U48A 2WUBL 2JCCB 4UUJA 4J1UB 3DO3A 4ZTPL 4D8PB 1MCDA 2AW2A 2JELH 1QLFB 1MRDH 1GOGA 4KFZC 5KW9H 4HDIA 1V05A 3AXLA 3UYRH 3QIWD 3CMOH 3DMMA 3QAZB 4W6YB 1P9MA 1UXSA 3CGTA 2GUOB 4N8VB 4ZOCA 4NQVB 1UVQB 1T1ZB 1FZKA 5IFAH 4R2GD 4ZQKA 5GZOC 2EDBA 5EO0A 1H0DA 3LQMA 4PJIB 4ZD3L 3TN0B 3AS1A 1GZQB 1W72H 2OTUA 5CHNA 3NCCB 2C7UB 4JFPB 1X4ZA 4YPGB 2HTKD 4ZSOE 2XN9B 1WEJH 3BQUD 3OXSA 3QQ4A 4HJ0C 2P24B 4N9GB 3SDXF 4F57H 2BVYA 3ZYZA 2MPAH 4S1DC 2R2BB 1KPUB 3V5KA 1FYHB 1TZHA 4KK8D 2YN3A 2P5WE 4Z76A 2BMKB 5EIIA 1WJ3A 1W0WA 3RVUD 1S5HB 1N8ZB 1YNLH 4GQ9H 1N59A 1YEHH 5KG9B 4OZIA 1Q9KA 5MEQA 3MRNA 4R0LC 4DKAA 2HLAA 3W2DH 4APQB 4LQ1A 4XRCA 2PYED 1R3JB 1SYSA 5I1KH 4CW1A 2HRLA 3CU7A 3PWLA 4G3YL 4KXZH 4YFEA 4IOIB 3VRIA 3R1GL 3ULVC 1P6AB 4GRLD 4I9WE 4QRTA 3E2HB 3RNQA 5KVDL 3WJJA 2IFFH 5DUPL 3IJYB 4I4WA 2UY7A 2VXTH 3BH8A 5JOFA 3JWNC 3R0NA 5EZOL 4PRHE 3QNYB 1C7SA 1OAUH 3ULSB 3S35X 4NQCA 3RTQA 4JY6B 1D5ZB 3UBXG 4HX1B 3K4ZA 1FVCB 3BKYL 1U92A 4OD3L 3F7YA 4RGOH 5FF6A 5FCUL 5I30L 1JNNL 4E5XA 5TDPB 2FX7L 5F8RC 1ETZB 4NZTL 5IHUH 5E8NA 3P11H 4LLVB 4I18C 4OFDA 4N0UE 3TJEL 3IDJB 1CF8L 3VXRD 2Z93A 3S36H 3S5LB 5TQ2L 3SKUD 4XP1L 4K94L 3MODL 2RBLA 1BLNB 4LBEA 4UNVA 4YJZL 5GRJL 2G75A 1U8QA 1LEGB 3RU8L 1F2QA 5LG1A 1FFPB 1MCNA 1FO0B 1EFXD 3U7WL 5I8OL 2FX8L 4PJBA 3UMTA 3PGDA 1KJ2L 2VNCA 1GGYA 4XC3H 5BVPL 3KPLA 1DEEB 2DM7A 4EXKA 1KJMB 3Q5OA 1B0RB 1FV1B 4G8GD 1S7RA 1YQ2A 2P49B 1CFTA 1LDSA 5EUKB 2VR9A 2B4CC 4K8RC 4LOUD 1AGEB 1YN7B 4U1HA 5EZJB 3QXAA 4JM2D 4NQDA 3I50H 1HNFA 2DLIA 3WNKA 2H3NB 3ROLA 5L2KE 5CBAB 3AMLA 1PG7L 2CRIA 3QCUL 3QXUA 5CLWA 4ISVB 2H6PB 3OF6A 1QRNB 4XPAL 2C1PA 3CSYB 4OZGF 2BY1A 4NSKB 4KQ3H 3F12A 2GJJA 5HYJB 2IGFL 3RVWC 1IT9H 4F7MB 4PV9A 4XVSH 2EDTA 5KZCD 1MIEL 4NUGL 2CLVA 4X9IA 2UWEB 2AV1A 3REVA 2V5RA 5M95B 5E2VL 1I3GL 5DS8A 4U6YB 5L9DL 3Q6GH 3OKEB 4AH2A 5C0JB 2P44B 2BOCA 2IQ9H 3O2DA 5CEZH 2HP4A 4HKZA 5H2BA 3VFUA 5J1SC 4EI5D 1FZMB 5C6PB 4HFWA 3C6SA 2VZVA 4PJGA 3EYQD 4DOHE 4F8TA 2YA1A 3KYNB 4I3GA 1JPGB 2IMNA 1BOYA 3O6FB 2X4SA 3IDXL 3BKJH 4P49A 2DWDB 4L4TA 4WEMB 5AAWA 4QRQA 3UTTA 5SWSB 3ARGC 4P5MB 3BIKA 1YMHB 1NMCC 1E6JH 3P4OA 1CL7I 3VGFA 3T0XA 2XY1A 5DXWA 2ZKHH 5SX5K 1JHKH 1BM3L 4Z7WB 1M7DB 4M93C 2DQGL 4X7SL 5IHLB 1I7ZA 4YDLC 3P9LB 3BKCL 1U8PB 1SYVA 2ZUWA 4NN6C 4BZ2H 1NCDH 5IWLA 1JYXA 2JB5H 2F19L 4NNXB 1HILB 3RI5K 4F7PB 2DLTA 1VADB 1NQBA 4MLIA 5IG7B 4YHMH 3QWOB 3IDYB 2AJXL 3ZYIA 5D7IA 5DK2B 4U1JB 1GIGH 5HPMB 3ULVD 1IGJB 1J5OH 4Z0XB 2C9AA 3FO1A 2XNAA 3VFGL 4RSVA 1S9XA 5IW6B 3T4YB 5MEPB 1VEPA 3PHSA 2AK4A 3DETC 4FZEH 1HYRC 5ISZA 4PJDB 5FYJL 4P46B 1KCKA 3B3IB 3C5ZA 4PRHD 4QOKB 5F89A 4KPHL 5J06A 1H8SA 1G9NH 1U58A 5D2LE 2PTUA 3EOYG 4LMQE 5GHWH 2YWZA 3L3IA 2V5YA 4FNLL 5IJVA 5EORL 4MAUL 1S8DB 1JF1A 3TH2T 1X5YA 4D0CA 1ED3B 4KHTH 1QR1B 1P4LB 3AREC 1AXIB 1A21A 5TE4H 4MCZB 3SO5A 1OAQL 1XGTA 3REWA 3QRGH 1FNLA 3UX9B 3MJ9A 4CL7A 3CX5J 1A7PL 1LDPL 3B6SB 5D6CA 2P46B 3UJTL 3L3JA 1R24A 4MNGB 2ARJA 5DHXB 5DUBB 3HAEB 5E00A 2H32H 3MRRB 3FQNA 2QKIA 1JNJA 5CWSA 5F8QC 4KGJA 4NQTA 3C60B 4WRLA 5BRZA 1NCAH 3NAAL 1YN6B 4X6CF 1KTKE 1TVHB 5D6DA 1MAML 3DX9A 4P23C 5ICYB 4Z77A 3QFJA 4X9GA 5L2KD 3RVWD 4WHCA 4J3OC 2A6DB 4J2XA 1QVOB 5C0GA 3T2NH 4RFEA 5CINL 3TT3H 1UA6H 3LRGA 4NRYB 5ACMA 5FHBL 3UPRB 4FP8H 2X9XA 1F45A 1U2HA 3WFEL 3OKLA 4YHZL 2WQRA 5CEXB 2EIDA 4CAGA 5INDA 4YBQC 1ZGLB 2XQBL 5JA8B 2A77L 3DV6A 1JN6B 1RZIA 5A2JH 1EIBA 2G60H 4LHUB 1CG9B 1T04B 2EYRB 4CNIA 2VL5A 4PJXF 2H26B 2EE9A 3FQWA 3TA3C 1RZGB 3FQTA 1OD7A 4OZFA 4YXHL 1HCFX 3LN9A 2Q7YB 4XBEH 1IC7L 2DBLL 4FQQB 1IM3B 3K2UL 5HI5C 4Y8AA 5B39B 3LS5H 1OT2A 1G84A 4PJFE 4OIIL 2OR8A 3KPTA 2AV7B 2IALB 1D9KB 4AT6B 4HHAB 2PETA 3TNNA 2GTWB 4NHCH 4HC1A 2AVGA 1EO7A 2JCCF 4LSPH 2Y72A 5JMOC 1A9EB 3GMRB 2WUCL 5E9DE 2BVQB 4NKIH 1S7VB 1EFQA 4R26L 4RMRA 3VXQB 1KG0B 4G9FB 1BAFL 4QF1B 2C5DC 1KCLA 2GSIA 2P8PA 1RUAL 1R5WA 4PJIF 3EJYD 2C26A 4LLUB 5HVFB 3D6GA 3HR5A 2OQJA 1JPTH 4HV8A 5CJOH 1NH6A 4LL9A 1T2JA 2ZCLL 3CVIL 1RK1B 4G9DA 2A0LD 4U1SB 4ZXBD 5TDOA 2Y5TB 1V3KA 2AP2A 3WS3A 5JQ6H 5FA4B 3IFNH 2B2XH 5J9PB 4RIRA 4PG9A 4GRMB 3L3GA 3QUMB 4KRPC 3U9PH 2YPLE 1UWGL 3MLUH 4L3EE 2EC9U 2FL5B 5T1LD 1RK0B 4Y16C 4J6RH 2GJ6A 3KXFA 2YPKA 2YRZA 5HYSB 2X7LA 2OZ4H 4IIQC 4ZUSA 1VACA 3X3GL 4O9HL 2V7NB 4G80A 5C0AA 4HPYH 3MUGA 2QSCL 5A3IC 3MLTA 4QO1A 4P59L 3VXPA 5F3HA 1N7ML 4AIZB 3IDMA 5FO7A 1NCCH 4MD5A 1OP5K 3H3BC 1EBPA 2KH2B 4KQ4H 5ECJE 5C7XL 3MXVH 3QNXA 4ZFZA 5JDSA 3UC0L 1MAKA 5HI3D 1KCRL 1LK3L 4DUWA 5D5MA 3AC0A 4FQCL 1XF2A 4JHWH 2NY5L 3NA9H 7FABL 5D4QA 1BREA 3HC3H 2QQNH 1BQHA 3M8OL 1I1FB 1B2WH 1T7YA 4OF6A 5I9QC 1IEBB 3K1DA 4JO2L 1L6ZA 4ZAKB 2NR6D 2AKRA 1MFCH 5CJBA 1INDH 4X4ZA 1CLYL 1RUQH 1J1OL 4RAHA 3VJ6B 2CKBA 5HHPB 4HZLA 3V0WL 3OQ3B 3RL2B 1CD9B 2DM3A 3W39B 2I07A 3M1BA 1X5HA 1P4IH 3CDCA 3QEQA 5C0DB 3LKSB 3I75A 4P4RB 5LVEA 1AXTL 1T1WA 4KROB 4Z5RA 3WHXB 1BD2A 1FG2A 4HIJA 3PL6C 2WZPD 3MJ6A 4X99B 2F8VA 1QSEE 1JPST 5GS3A 1C1EL 1A1OB 2HJKB 5A40E 1IAOA 5GGTL 3B2VL 1PEZA 4TQEL 4HUKB 3BWAA 2Z8WC 4MXWL 5FGCB 3IFPB 3RWEA 4TSCL 2P7TA 5I74B 2NW3A 3QQ3B 1OAYH 2ICES 3BGMB 2ED7A 2CRMA 1AKJB 2F5BH 5C0CB 3D0LB 3RL1B 3GUTB 5I75C 1RFDH 4GAGL 2VDQH 2FBJH 3MRGB 2AEIT 2GFBB 2DQDH 3MJGX 3UJJH 5DYOA 1IILE 2A1WL 2XKNA 1NGXB 3P4LA 3SY0A 4JQVA 2EIEA 1CN4A 3U0TA 4BQ9A 2D0GA 4JQXC 3QIWA 2Y25A 1EVTC 1BP3B 5HGDA 2OBGA 3DI3B 3PV7A 3MNWA 1HE7A 4Y4FC 2BJML 5KVMC 1C08B 3OR7B 3DXAB 5EPMB 2RQ8A 5FV1L 3U9UA 3LKNA 4OBSA 4F37K 3QUYC 1YPZF 1QBLL 4X6FB 4MDIA 2FIKB 2XV6B 1NLDL 2NY4C 4LGRB 3P0VH 5LBSL 4KDTC 2VLRB 5BW7A 2ERJC 4LLAA 3BQUA 5E9DD 4EKXA 1SEBB 1SBSL 2HKFH 4XZUB 4U3CA 3EDJA 5B38A 5K59F 1A6AA 3V5HB 2BRRH 4Z7WF 3RHWF 2BSSA 4D94A 1OF2A 4X6DE 4UTBH 1JGUH 2VDLH 2DAVA 2IFGA 3V8OA 4HQQH 1RIUH 2NTSP 1I9RH 3BYTA 4YHIA 4LCCB 4H88L 1FQ9C 1QNZH 3N0PB 1U8OA 3LSOA 4G8FB 4G8IB 4BQ6A 1QG3A 4GRLA 4L9LB 1Z3GL 4KRPD 2VUOA 4PGBA 4WO4B 2ZPKL 4K94C 1CIDA 4Z7QE 4HS6B 1AP2B 2GQHA 3SDCC 4KGLA 4EN3D 4Y16D 3E1F1 3HG1E 5GS1C 4KUZH 5EA0L 4LVOC 3CFEA 3G5ZB 4LPWA 3CDGB 2Y36L 5IQ7H 2YPLD 1XGYH 1IC5H 3H42L 5DRNB 4EQ3A 4QXGL 3FB5A 4L3ED 4U1IA 3DVGB 3E6FA 2E7LA 1MELA 2YEZA 3HE6C 3KGRA 4PJDF 5FIEA 5I6XB 4KK9D 1JI2A 4OD2A 3SJVE 3VXRA 4N8PA 5FKAB 1CDJA 5I19H 3PWUB 4HMDA 2DQTL 1GC1C 3VXUB 3KPRD 3KPQA 5C3LD 2BVEA 4S10A 1EEUA 4DVRH 2NY6C 1G9MC 3B5GA 1MLCB 1F4XH 1EAJA 4UILL 5ITBL 2HJLA 3WN5C 3FQUA 3KYKL 3TBTB 3U46A 1OW0A 4LCUB 5JIKA 1A2YA 1UM4L 2XTJE 3HI1B 5ID0A 1EFXA 2JIXD 3HFMH 3RY6A 3V4UH 4BK4A 3JV4A 3MRLB 1LO5A 3KG5A 1GPOH 2W9EL 4KUCD 1C5DB 2XTJC 4G8GA 3TIEA 3D2UD 3PWNB 1CL7L 5EBLB 4FFWD 3C08H 1IGMH 3D39E 4JM2A 1DQMH 2PO6B 3PL6D 2HT3C 5DR5L 5JA9A 2DD8L 3VCLA 4PD4J 1PDKA 4OLYH 4PTTA 1TENA 3KPMA 2X70B 4U1NB 1KJVB 4UIMA 2HT4D 5J6HB 4RBPH 3GJFA 1UH2A 1KT2B 3RRQA 4PJ9C 3DRTB 1A22B 5EBMA 1I1YA 2C3HA 3Q3GA 1QSED 2LE9A 2QSTA 4UQ2A 4LGPB 4TVSa 2R1XA 4QKXB 1T2QL 4ZPTB 3FCTB 4F15C 2X41A 2ORBH 5B4MC 4HDIB 3AXLB 3DMMB 5DD5H 4EI5A 1UXSB 2BVOA 1X44A 5DRXB 3AFLA 3GI9L 4PTUB 1BBJA 1Q0YH 3O3EB 1FZKB 3ISWA 4O5LL 4PBWD 4FFZH 4ZQKB 4YDVA 4M7LL 25C8H 1JP5A 1H0DB 2K7QA 3O41A 4KKLC 4TVPH 5IT2L 5MP6L 4QRUB 1IC4L 1K8IA 1T2XA 2GJZB 2OTUB 5CHNB 2ZG3A 1I1AB 4EDXB 3HZMA 5FYKH 1FH5H 2DOCA 3OXSB 5EBWA 1XGUA 3QQ4B 5C6WH 3VWJD 5L2JA 1RJZA 4JG1H 1ZT7B 1DTUA 2APBA 4Y4FD 1S7WA 5IEKB 3WIFA 4JVWA 4PRPB 1TVBA 5EU4A 1TZHB 4Z76B 3IDGA 1K85A 1W0WB 2DQFA 2NY4D 4I77H 2XKSA 1LQSR 2FJFA 1HHJA 1Q9KB 1OAKH 4NWTL 2Q1EA 4D9QE 5MEQB 2BFVH 4XRCB 5CGYC 3RVTD 5FYJE 1FFNA 3U2SA 1JPSL 1SYSB 4HK3J 3QCVH 4JR9L 5DJDB 3NN8A 5T1DH 4MSWB 3VRIB 3VRLF 2ATKA 3H3KA 4HF5L 4CVWA 3MOAH 4ZSOA 3RNQB 3UXFA 3VD3A 4R3SA 1VFUA 1EO8H 5JOFB 1ZA3B 2PXYD 1R3LB 3F6IA 3EJJX 5F6IB 1F90L 4BFIA 5DRZA 4NQCB 4LVEA 1SY6L 3RTQB 1KPRA 5AAMA 1U92B 1P4BH 2FEEL 3F7YB 5ABDE 3KJ6L 4JRXE 5E6ZA 5CCKH 3QBTB 3QDGE 2L7UA 4E5XB 2W60A 4P9MH 2ZUQB 5I1LA 1XH3A 3KHQA 1S3KH 4L9DA 2VQ1A 2OTPA 5GGQH 3SDCD 3VXSD 2VMFA 4U4BA 5F9OL 2BSRB 3K8LA 4XMKH 5IVNA 2UZIH 3H3PH 4H8WL 4ZNEA 5IF0A 1K4DB 5F7YC 4PRHA 5L8KB 1KELL 4PJ7E 2MJWA 2G75B 2AXHA 3HG1D 3MRDA 3MV11 3MOBL 5DMIH 1LHZA 1UG9A 3W9DB 1YMMB 4PJBB 3PP4L 1MPAL 1BECA 3PGDB 2EXYD 4N0UA 2NXYD 2NY6D 2VLKE 3C5JA 1AFVH 1NCWH 9CGTA 1CFTB 2Q8BH 1QEWB 5FGBC 2X10A 1O5DT 5FYLL 4AEEA 5IR1A 4U1HB 4WW2C 3MLWL 1W0YT 3SDAC 2AEQH 4UINH 2ZUSA 1M05A 2D0FA 3F12B 2XTJD 5TFSL 1PLGH 1CU4L 5JXAL 2Z8VC 4MA3A 4PV9B 1KC5H 5IB2B 2CLVB 3BZFA 4H1LG 3WD5L 2JB6B 3REVB 4OCWH 5C9JB 5DS8B 5DTFA 1BEYH 2GHWB 4AH2B 2DKMA 3ZDYF 4NWUL 4HKZB 5H2BB 3VFUB 3D39D 5SWZE 4KTEH 3C6LD 4NO2A 3C6SB 4PJ9D 1PG7X 4PJGB 2R69L 1QYGL 3KHOA 4L8CA 1PKOA 1TJHL 4UNTA 1HDMA 1MH5B 1BMGA 4PBVC 4MZ3A 4JFYA 4JZJB 4FFVC 1X5KA 2I60H 4L4TB 2EYTA 2V17H 3CJJA 5JW5A 4Z7VE 4YH6A 5B4MD 3ZKMC 2XRAH 4DCQB 4QRQB 4GRWE 3WS6A 3BT2H 1QUNA 5CIPH 4XGZA 1P7HL 5F7WC 1Z0NA 3BIKB 3P4OB 4I0CC 4KKLD 4XNMB 5T1KD 3UDWC 3QB7C 3T8XB 1KTLB 2M2DA 5I8EA 2F53E 2CQVA 5HBBA 5BZDA 4PRIE 3TWCH 4JG0L 3OKMB 4RMVA 1W72B 3U1SL 1F2XK 5KJRL 1I7ZB 4W70A 5ICZB 3D85B 2VDKL 1JYWA 5HJ3B 4ORGA 3OL2A 5GGVL 5E8DL 1TQBC 3QISA 1OY3B 1T80A 5IEHA 3STLA 1JNHA 3IS1X 1A0QL 3MBEB 3FQRB 3OX8B 4R8WH 5CGYD 4DN4L 4WHDA 5EUOF 5D7IB 4JZOA 4HBCH 3SO3C 3R4DA 1U36A 1NC2D 4E41E 4D9QD 4LLWA 3FO1B 1A3RH 3X3FH 4HWBA 2DLHA 1U93B 2DF3A 1S9XB 4PD4K 1LP9B 5L0QC 1M7XA 3L7FB 3ZSTA 3GIVA 4B7IA 1CGVA 1YEIH 3P77B 3MLZH 4JDZA 4AEHL 4XNQB 3HI5H 5H35A 5T3XE 3QIBC 1OP3K 1I8KA 4M48H 5DJ2A 3I3BA 2YKLL 5F89B 1U3HC 1FRGH 4GXUM 2ZCHH 4Y5YC 1XGQA 3QHFH 3RIAF 2AXFB 1WBYA 2CMRL 4G6JH 4ZXBA 4JRXD 2W9LA 2BERA 5E8PA 3L3IB 3QDGD 5IJVB 1BJMA 1JGEB 1JF1B 3TEUA 4XAKE 4K2UL 4D0CB 4ODWB 3AS2A 3D18A 1NGWA 4G7VH 5F21B 4X5XA 3BDXA 2MHAB 4PFEA 3PUCA 5EOQL 2V2XA 3D0VA 1XGTB 3LRSA 3REWB 5T1LA 4JO1L 3W0WE 5BZWB 3WXVL 1IGCL 1EEZA 2JK5A 5LJYH 3G04B 2G5BA 3F7PC 1IGYB 4MNQB 3VG0L 2A6JB 4O2EA 1OWWA 1MCWM 3DIFA 4OF8A 2BSTA 3VFSB 3QIUD 5DFWH 3T08A 5D2LA 5D6CB 1DBKL 2LU4A 3ARQA 3QDJE 1NDGB 3O45A 3WUWG 2FO1A 2VLLB 4LARL 3L3JB 1R24B 1CLOL 4KY1L 5E00B 4QEGA 3O4LE 1T7VA 2QKIB 1NJ9B 3MBXH 4L4VE 3SDAD 2VLKD 5CWSB 3FN0L 4D9LH 1P69B 4AG4H 3BPOB 2FEDD 1RIHH 3DX9B 3PDOA 1JMXA 4N0YH 1S5IH 3QFJB 3VXME 4LASH 3MLYH 1CGSH 2QADD 3MRMA 3WSQH 1J87A 1RURL 1T03H 1OL0A 1Q9LA 4NFCA 4RFEB 4WHTA 2VZSA 1WFOA 3DV4A 3QUXD 5K9JL 4JDVA 3RDTD 1KXTB 4XHQA 2CKNA 2A73B 3OKLB 1P7QB 3FFDA 2VERN 3NH7H 1P7KA 5DWUH 3NCMA 4B7LA 2RFXA 3DV6B 2IANB 4UIKH 4DKDC 4FQXB 1G6RL 2O61A 4AY0A 1I8MA 5ESVA 4WCYH 1J86A 4LF3B 5SWZD 5DI8B 2ZSVA 3DNKA 4CNIB 3CIQA 2VL5B 4ZTPH 1ZK9A 5ICXA 2EXWD 3H9HA 2NY7L 3UPCA 2O5ZL 2VUYA 4NDMA 3LZFL 3ABZA 4RMSA 4WWID 1RSFA 3JWDL 5DJXA 2P1YA 2E7MA 3MNVB 2V5TA 2BZDA 5E7FA 3HMWL 1CLZL 1C12A 5F9DC 3U7AA 4QYOA 1EJOL 2AEPL 5E4EB 1U95A 3QEUB 3TNNB 1C5CL 4Z7UE 5LAXA 4U6HA 4N5EC 2J1KA 3KPOA 4JFDB 5BV7H 2ZOKA 4PRID 2VLJE 1LILA 1KGCE 2FECI 4P2OC 2CDEA 4QCIA 1CFSB 4GKSA 1DBAH 5JHDB 1LE9B 1OOAA 3UTSE 4ETYA 3VI3F 5FOBB 3WL9B 2JJVA 2GSIB 4NKDA 4OT1L 1WWWX 1HHKA 4PJFA 2MWCA 5D93B 3HR5B 1Q0XL 1ZT4A 2OQJB 4G3YH 4I0PD 4HV8B 5IIEB 2P43B 2DWEA 5DC9B 5I8CB 3ES6A 4NRZA 4MB3A 2IG2L 2K1MA 3L3DA 1YECL 5KVDH 4N1HB 1ADQL 5DUPH 5TDOB 2MCG1 3BESR 2FCBA 5EZOH 4E41D 4JFXA 5E9DA 4HUXA 3FHAA 3QIBD 4RIRB 4OZIF 4J3UA 3VU2A 1FC2D 3BKYH 5HGAA 3TC9A 4OD3H 3L3GB 3CK0H 3MRJA 5I30H 1IZJA 1PGRB 3UJIL 1JNNH 4Z78A 2Q86B 3HTLX 1KACB 2FX7H 1AD0A 5T3XD 3KYMA 3IXAB 1IKNC 4POZD 4NZTH 3SKMA 4XI5C 1JHLH 1JWUB 3KXFB 1CF8H 1YJDC 3OPZL 1OM3L 5KSVB 5I73B 1FL6B 2GIYA 4G80B 3LV3A 2R23A 2CK2A 5TQ2H 5FKPA 3MLTB 4XP1H 1V7MH 3MODH 4F3FA 2FDBP 1XEDA 2XWJA 5F3HB 3STZA 3LB6C 4YQXL 3IDMB 5FO7B 4MD5B 1G7IB 5L7XL 3B9VA 5TPWL 5JMRA 4WTZG 3QNXB 4Y16A 4XAKD 3RU8H 1D6VL 1KENL 3EFFA 5T33L 5D5MB 4IIQA 4HGWB 1A1NB 3U7WH 4HBQA 1XF2B 5I8OH 2YPLA 2FX8H 5AZEL 4L3EA 2UYLA 3QCTL 3W0WD 4JHAL 5BVPH 1KN4L 3BGFC 2IWGA 2QEJA 5K9QI 1QZ1A 1WWCA 5CSBA 5CD5C 3UYPA 4OFVA 4JPWL 1DLHA 1Q38A 4BZYA 2CDFB 5C1MB 3QDJD 4X7TA 4HZLB 1T66C 1PG7H 3QCUH 3KPRA 4Z6AT 1AH1A 2I07B 3BDBA 4CU8A 3G5VA 3O4LD 3ZO0A 3LD8B 3QEQB 4L4VD 3RZCC 2ARWA 3I75B 4PJBF 1T89C 4P2QB 2IGFH 4XPGL 4KTDL 4JPIA 4OF0A 1IL1A 1BD2B 1UB5A 3NIFE 1MIEH 4NUGH 5DFTA 3RWFA 1HH9A 2EDDA 4IMKC 5DMGC 5J13C 2JIXA 3O9WC 4MD4A 4PRAB 4JPVL 3VXMD 1X5GA 4N8VG 5EN2A 1PZUB 1I3GH 5L9DH 1J11A 3SHSA 3QQNA 4WWKC 1EAPA 1F6FB 3GBNH 1DANT 3H7BA 5DMKB 3D2UA 3ESUF 2OK0L 1MFDL 2VAJA 4NC1E 5ETUA 4AEIH 3BXNA 3IFLL 3PL6A 3LOWA 3OAUL 4RWYL 1SVZA 3IDXH 1S9WB 2YD6A 1JMZA 2HA1A 3SQBA 4QHKI 5HI4C 4S2SA 4KRLB 1JZ5A 4TUKL 3VFRA 5DYOB 1Q1JL 3IJSA 1QSEA 4V1DE 1E4WL 3SY0B 5JW3H 3BP4A 4BQ8A 3U0TB 4MQSB 4PJGF 2NY3C 2CUHA 3ZE0F 1BM3H 4ESKA 2XTLA 1I8IA 2DQGH 4X7SH 3FB8A 3BEWA 3C5SB 4R7DB 2I24N 1F6LL 2WK2A 1G1YA 2CXKA 1KEMH 3BVNA 1KXQE 4R2GB 3VGBA 4FQHA 3LIZH 4JKPL 1I4FA 4BM7A 2WIIB 3CLEL 4W6WB 2N7AA 2I9TA 3BQUB 4JQXA 3VWJA 1L0QA 2VLJD 3EO1A 1KGCD 1QPPA 5IB4B 1A6AB 4Y4FA 4DFHA 2PN5A 2V5MA 3T0VA 1FZOA 2R1YA 4W4OC 2OR9L 3OG4B 3NACH 2BSSB 4JFFB 1OF2B 1PEWA 4M43L 1H3XA 1OGAE 3S5LG 6CGTA 4S1QL 1A7NL 4ZO8A 3VFGH 4KDTA 4FG6C 4NOBA 1HKLL 2PYEB 4YHIB 4NBYB 1SJEB 3OKOB 1U8OB 2R29H 4HKJA 5E6IC 2DMCA 5DSCB 3LSOB 3IDUA 3QJHA 3QXTA 5FYJH 3VA6A 2D0HA 3IDIA 4H1LH 4GRLB 3AUVA 4HIIB 2IPUK 1YC7A 4KJPD 1MSPA 1ZVSA 1T20A 4JFED 5D7IF 1E28A 4H8WC 4YC2B 3SKOA 2PXYA 3L5WA 1UZ6E 3PWJA 4CVUA 3N06B 2CIIA 3VFWA 4DK3A 1S9VA 4HUMB 4X6DA 3DI2B 4AM0A 3KPNA 5EORH 4MAUH 4Y88A 4AENA 4BFGA 4KI5C 3LB6D 5DHYB 1YA5A 5FYLE 1DCLA 4UV7L 3CFBA 4OD2B 5J12B 3SDCA 3VXRB 3VXSA 3TO4C 1OAQH 1FIEA 4C58B 1H15A 2RJMA 4YEFA 3ZT7A 3JBG7 2OJEA 32C2A 3KPQB 3TZVC 4XHJC 1RI8A 4GG6E 1A7PH 3HG1A 3BRDA 3GMPA 3FQUB 3U46B 1IFHH 1KJ2A 1KBGH 1TCMA 1UFUA 5F9JA 2VSCA 2JJTC 2R15A 1F4HA 2BNUB 5CD5D 1PKQE 5K9OA 2GCYB 1FAIL 3H9SB 3DUHA 4R9HA 4Y7MA 1LO5B 4IEFB 3NAAH 3QH3B 1WC7B 4XAWL 4ZO9A 4NZRL 1MAMH 4G8GB 3TIEB 4QHMB 4DZBB 4S1SH 3QXVA 1TETL 4GG8A 4K9EC 3WN5A 4U6TA 2IAMD 4OZ4A 4JM2B 1EMTL 3AY4C 3T2QA 5DMGD 4YZFE 4Y4HC 2HVKA 5CINH 4PTTB 1T7WA 2F8XC 4OIBA 3KPMB 2J7LA 1I8LA 4QXUL 4UIMB 4WWKD 3WFEH 4O2CA 4GOSA 4HAFA 3WMSA 4YHZH 4UOW0 3PHQB 5EBMB 1YEFL 5KZCB 1HHGA 2EH8L 3O0RH 1I1YB 1WSST 2VC2L 2X2YA 3VFPA 2XQBH 2A77H 5MENE 1QACA 3WUZA 3KLHC 1G9EA 4N68A 2GT9A 4X4YB 3SDDC 5I15L 5ELIA 5LCVL 3UBXB 1FIGH 3UZQA 1UWXK 3D39A 4H5SA 3R06B 2BVOB 4JQIL 5E6YA 4EI5B 5F88B 3C6LA 5HI4D 1T83C 2EC9T 3F7VA 1IC7H 4PJ9A 5F1OB 2DBLH 2IQAA 3DUSA 1EXUA 4CN4A 1KXVC 1V3MA 3CFIC 3TV3L 3O41B 1CDIA 3CH1A 1GGCH 4EXPX 1MRCL 4BKLA 2OXGA 1DBML 4YHLL 1DQJB 1J0YA 1PSKL 3I02A 3P73A 5L2JB 3ARYA 1TLKA 4V1DD 5DJAB 4XWGL 5KSAC 1FDLH 1S7WB 1T0NA 3WIFB 2BVTA 1GGBL 4GRWH 3BUTA 3C8HA 5ESAB 5EU4B 1TVBB 3VXNA 1QOKA 1TMCB 4PJCE 4AMKL 2YD7A 2WUCH 1ZHLB 5T1KA 3RP1A 1HHJB 4R26H 3SDYL 4M5ZL 4HSQA 3UTZA 1FP5A 1VFBA 1FFNB 1BAFH 2DTML 4R4BB 1IQDB 4IOSD 2HFFA 3NN8B 1I7UB 2ENYA 4MJIB 3O2DL 1SQ2N 4XP5L 4FXGB 4ZSOB 1MLBA 3JSSA 1VEOA 2CXGA 2B5IC 4MD0A 3OKKA 1CXKA 3CPLB 1MHPL 3CVIH 4FG6D 3O11B 1UKSA 2MQ3A 4RDQG 5DRZB 5ALBH 4CDGC 2WBJC 2P5WB 2J4WL 5GRVK 1H3UA 5E6ID 1U8LB 3RNKB 1OGAD 4AL8L 1NC2A 4XVTH 1N6QL 3VWKD 1QFPA 5EOTA 3TBSB 2VQ1B 1PQZB 1UYWL 1UWGH 1K3IA 1J05A 1EX0A 3KYOA 3X3GH 3LN5B 4JN1H 3NPSC 1FLRL 4O9HH 3LKQB 2X4UA 4PRHB 4KMQA 2QSCH 4PJ8B 5EZLA 3W5NA 4YK4B 2DI7A 1LO3L 3MGOA 1N7MH 4M61B 4JFOA 3KJ4B 4M6NL 4G6AC 4RGNC 3TO4D 4JRXA 5JR1L 1P84J 3QDGA 4BH7B 5F1IA 5DJ8B 1FL5A 3UC0H 4U1MB 5B8CC 1DLFL 4UT9L 5FYLD 1KCRH 3WHE1 4FQCH 4HAGA 4XHJD 1S78D 2NXZC 1A4JA 4WI9A 2NY5H 1T0PB 7FABH 1BPVA 5TDNA 1LEIB 4OTXH 4XPBL 4PLKD 3MA9L 3M8OH 2G9HA 5IR1B 5AYQA 1DBJH 1V7NL 2J3SA 4JO2H 3HC0A 4PJ7A 5C71A 4ODTL 4FOMA 4TNWF 5GRWA 5DD0L 5I1AA 1EVUA 1M05B 1J1OH 3EZJB 5F7NC 5BV7C 5C6TL 5DLML 3V0WH 2YMXL 3GMMA 5D5MF 1T5XA 4EUPG 5HY9A 3BZFB 4LP5A 4WW2A 2FIRT 3SDAA 2VLKA 3O2VL 4Y4HD 2AQ1A 4UQ3A 4L8DA 2R2HA 2BY3A 5DJYA 1HOCB 1ZT1A 2AXGA 5JIPA 4WFHE 4BUGA 4YXLL 4TUOA 4BH8A 5E95B 3X14B 5GGTH 5L2KB 1F3DH 4MXWH 3TNMA 3L5XL 4WI7A 1QBML 1HDMB 4TSCH 4TSAL 3FL7A 4JFYB 4F9LA 3HUJE 5J6GA 1XF1A 2WBKA 2EYTB 3QUXA 5D9SA 3P40A 3RDTA 3RWIA 1UJ3A 4OFYD 1MCBA 4HK0B 3DURA 1OT1A 2Y07L 4XGZB 4ZPVA 4GAGH 3MJ9L 3UCRA 5HYFA 1DQQA 5IBTL 1F3JA 3UAJD 2WWKT 4CMHB 2H2SC 3DYMA 5I8EB 5SWZA 5BZDB 3EAKA 4NKQB 3TBWA 3CCHA 5EBGA 5IESL 1U8HB 4DOHB 1MQKL 4M6OL 5FECA 2A6KA 4IHOA 1YC8A 5CJXA 5KSAD 5F72S 1WWBX 4Z7NE 4TNVK 4RFNB 1AQKL 3D69A 3SQOL 4Z7VA 5IEHB 2BJMH 3STLB 1JNHB 1BFSA 3ZDXF 2EIZB 2FR4A 1NLDH 4JO4H 2EO9A 5JUEL 3IETA 5LBSH 3MJ7A 4NN5C 3DROA 2YC1A 4JZOB 1OAZL 4MX7B 1BIHA 1SBSH 3ZTJG 4YBLB 3HHRB 4PRIA 4LLWB 3G6JE 1BFTA 1EEYA 5F7UA 2FB4H 4GAYA 4JDZB 3WV0A 1ZEAL 1RVFL 2BXZA 5H35B 1G7PA 4E0RA 4G6FD 1UCTA 2VAAA 1I8KB 1FZJA 2HT2C 4I0PA 1JZ4A 1XGQB 1EHXA 1Z3GH 4MA8L 2F8OA 1WBYB 3IDNA 2ZPKH 4O00A 4ZXBB 4IM8A 3F58L 2OXHA 5E8PB 4E41A 5IBLC 1HHHB 1OB1A 1L9MA 3U0WL 2P8MA 3LKOB 5CBEA 3EZ8A 4RMQA 3CXDL 4M7KL 3QIBA 5EA0H 4R97C 2BP3A 4HC1L 5ITFB 3ZLQC 3H42H 5HYQA 4OI7A 8FABA 4MA1C 5CJQL 4Y5YA 5D1QC 1VGEH 2XXMB 1FNAA 3EOBA 2FGWL 3S37L 4PY7A 5T1LB 4Y2DC 2DQHL 4XPFL 2WP3T 3MO1B 1QFWI 4JPKH 3TESA 2G5BB 3H8NA 5ID1A 1JHTA 4O2EB 4PJ5B 4M6AA 2DQTH 4I3RL 1NC4B 1UM6L 2W9DL 5ENWB 3FAXA 3O45B 5FA3A 4MJ4A 5AZ2L 4PGCA 2DM2A 5ITBH 3L3HA 3KYKH 3V8CA 3FONA 1P1ZA 1KB9K 1ZTXL 1MCEA 2HLFC 1FVEB 1UM4H 4PLOB 3DX8B 1OSZA 4QWWD 5F9WB 1XCQA 2A38A 2L0DA 3EYOB 3PDOB 1JWSA 2W59A 3T04D 4JANA 1EUTA 3W0WA 3VFTA 1KCSL 4HIHA 2W9EH 2WBWB 4F7TA 1CL7H 1VKXA 2CO7B 3QDJA 5I0ZA 3DV4B 3NABL 3V0VA 1B4RA 5DR5H 1WIOA 1I3VA 4HS3B 1CDYA 3O4LA 3FFDB 5F1KC 1FN4A 2FBOJ 2LU3A 4L4VA 4NFBA 1WCBA 1P7KB 4C55A 3VMNA 1JRHL 3FFCE 3SPVB 4DGVL 1E4KC 2O61B 1ACZA 4UOJA 1MCQA 43C9A 1WF5A 4FRWA 3VXMA 5ICXB 3H9HB 1F3DJ 1KIQA 1T2QH 5CILL 4JM2F 5C8JA 2VDRL 2YUZA 1FO0H 3QUZD 3T2OA 1N5AB 4M7ZC 3GI9H 3JTSA 4DW2L 2M26A 3OG6B 3OHXA 4O5LH 5H94A 5I1DA 5DZOA 4JEGB 4OAWB 4M7LH 2H2SD 5IT2H 2XICA 5IP4A 1U95B 4UU9A 1IC4H 4MXVF 2GKIA 2ZUVA 4U6HB 5FB8B 5KN5A 3KPOB 1D6EB 3DVNA 3CZFA 2CKBL 4WU5A 3ZDZE 5IB3A 3AU1A 3RUGB 5F7MC 3B9KC 1U8NA 3B5TA 4GKSB 4MAYB 4QCIB 1NFIA 1UACL 5JLZA 1FE8L 4XMPL 2PYFA 4NWTH 4NKDB 4TN9A 4F80A 1IMHC 3CAFA 2X9YA 4PJFB 1JPSH 4OZHB 2Y23A 2DI8A 4Z7OE 4JR9H 4BA8A 4XP4L 2CSPA 1ZT4B 1YY8A 2DWEB 4Z7UA 3MLPA 2AQ3A 2EDOA 4IRSC 1IGFL 3L3DB 3LQAH 3QJFA 4LMQI 3MCKA 1F6AB 1ZVYA 1NEUA 3OAYK 5E9DB 1L7TH 3ECBA 4HUXB 5CZXC 2VLJA 1Q9WA 1RZJL 1K4CA 1S7QA 1NL0L 1SY6H 1EJ6A 4JN2B 1EEQA 5HGAB 2HT2D 3KJ6H 3MRJB 1E4XI 2FZ3A 4ONFL 3MZTA 3HNVH 4RAUB 4XXDA 1KIPB 1Z9LA 5IJKC 3ORJA 3D25A 1K6QL 1LO0L 1HIML 4KVCL 4OLUL 3FO2A 1GGTA 3CFJA 3O3UN 4X9FA 3LV3B 4PJHB 5FKPB 1NCUA 4E42A 4F3FB 2XWJB 3STZB 5D1QD 4NNPL 3NCJL 4OZGE 1KELH 4JFEA 1JZ6A 2CH8A 4EN3B 3MOBH 2NMSA 3BH9B 5IBUB 3UTOA 3RX7A 2YPLB 3ARSA 4HH9A 1IRAY 3VMPA 1YYML 3PP4H 1MPAH 4L3EB 3KPSE 2HFTA 3SGKC 2E9BA 1CYGA 2W91A 5SX4I 5JPNA 2EKSB 2CGRL 5FYLH 3P9MA 3VA2C 5AUMB 2HLFD 1DLHB 2J8OA 5JOEA 3MLWH 3VDBA 1T0MA 3HZKA 5K93A 4X9HA 5IMKA 3MA7A 1FSKB 1ZANL 3CD4A 2CIKB 2EDNA 4K07A 3AM8C 5I9QB 1MHHA 5JXAH 1UXWA 3ZHKA 1S7SA 1MOEA 3U30B 3H9ZA 4CN6A 4MD4B 3DVIA 3O3DA 5DQDL 4NUJA 1A3QA 4G5ZL 3ZHDA 2R2EA 1EAPB 4NWUH 1U8JA 3KLDA 1AXSA 1BX2B 3CDYA 1T89A 2IAMA 3TBVB 2R69H 2Y6SC 1QYGH 3BXNB 1TJHH 1MFBL 1L7IL 4NQDE 4K7PL 4QRPD 4CVXA 4YXKL 1H8OA 3FFCD 4MJ2A 2XFXA 4WWKA 5HGHB 3ZYOA 5IGXL 1EPFA 4CBPA 4QY8A 3B2UC 1MJUL 4S2SB 2Z92A 3DGCR 4XMLL 2XI9A 3U4BH 1F11A 4LK4A 3VFRB 2ZJSL 3V7AE 4CVZA 4GUPA 1JGLL 1JTTA 5DURB 1QSEB 4OD1L 5HGBB 3VH8G 5C0BE 2ZUTA 4RMTA 3OJVC 3DGGB 2X1WL 1BFOA 4QTIH 2YD1A 3NIGF 2Z31D 4LIQH 2BHYA 3HAEH 3X12A 1I8IB 4JG0H 1INEH 3U1SH 2Q76A 2OI9C 3BEWB 1LO4L 3M17A 3OJDB 3G5YA 5C09E 2VDKH 4OLZL 2NY2B 2MKWA 3BVNB 1MVFA 5D7LA 2A74A 1KF9B 4ONGL 2N4IA 1XMWA 4FQHB 5GGVH 3B9KD 5E8DH 1HHIA 1KEGL 5I71C 5IB5A 1I4FB 2V7HB 1A0QH 2R56L 3N1QC 1UH4A 3VWJB 1I3RA 1U8IB 4V1DA 4LDOB 2EH7L 1EHNA 4X0KB 5IOPA 1FZOB 2R1YB 3KNBB 5DHVH 3KDMA 2XZCL 1TNMA 3HZVA 5LXGL 2NY4B 3WIIL 1CTOA 4YNYA 5E70A 1FJ1A 1YNTA 5CZXD 1MFNA 5F7FA 2HVJA 2EECA 4AEHH 3QJHB 1H3GA 2YXMA 3IDIB 4F7EB 3T0AA 1NMBL 1XR8A 1OTSC 1U41A 4W4OA 2AABL 2YKLH 1ZVSB 1VEMA 3E0GA 1T20B 1E28B 1JV5A 2PXYB 2ZUUA 3L5WB 4K55A 3PWJB 4IRZL 2CMRH 4NBXB 3JXAA 4U3HA 2CIIB 3LEVH 4ODXA 4XNUL 4X6DB 3TO2A 5E6IA 4AM0B 1OGAA 2L7JA 3GGWB 5DD3L 1G7MB 3VWKA 3LN4A 1U6AL 1MUJA 1YEJL 3CFBB 5IW1A 4P57A 1TZGL 3FB6A 1FCCA 2V6HA 5EOQH 4JO1H 4LVOB 1JZ2A 3V7AG 4LHJB 3V5DA 4FN0A 3WXVH 4AYFA 1IGCH 2AK4E 2GSGA 2OJEB 32C2B 3S8WA 2XQYK 1ZGLM 4N90E 1MWAA 1UWEL 3HNTL 3VW3L 3HG1B 3GMPB 1T1YA 1BWMA 1WZKA 1DBKH 3NZHL 1KJ2B 4LARH 2MNUA 1A7QL 1KN2L 1CLOH 3TO4A 1F3RB 4PJEE 1CFVL 6FABH 3KPSD 5ADOL 1DFBH 5K9OB 4ZFGL 1IEHA 2CR6A 4IOFD 1ZVHA 3FN0H 5ERWA 3NFNA 4NC0B 2NXYB 3SJVB 1MY7A 1FNGB 4GG8B 4WV1B 5LQBH 4LCIH 1B4JH 3IXTA 4OZ4B 3LDBB 3ULVL 4QXWA 3U0PA 1Z5LA 2JJTA 3QO1A 1RURH 1MJ8L 4HWUA 2R0WL 4OCSL 2HFEA 4NP4L 4GG6A 3QUMH 4Y2OA 5ANME 4DK6A 4I13B 1S7XB 3ZTJH 1NAKL 4XCEA 4BK5A 1HI6B 4O2CB 2XTJB 4GKZB 4MJ5A 4U6XA 1PKQA 4TRPL 1H5BC 3VFPB 3GJEA 1NBVL 3AY4A 3ARFC 2GT9B 4Y4HA 1C5BL 4YDKL 3Q5TA 4Q6IA 3G9VA 2NY7H 3D39B 2A9ML 4H5SB 5BRZE 2ED9A 2QQKL 1W2KT 2O5ZH 5CJ8A 3C6LB 4KK5C 4OM0L 2IQAB 1J12A 3QAZC 3MZGB 2QBWA 3DUSB 3JWDH 1TXKA 3LVEA 1CLZH 3MLRL 2XN9E 4BKLB 4F15B 1XCTA 2AEPH 4Y0GA 3TN0C 4QNPF 3A6OA 1FYTE 3INUL 1C5CH 4M9PA 4OFYA 4KRMB 2IADA 3FT2A 1T0NB 5C0BD 3V6FA 5D72L 3V6ZB 1B6DA 5C0EA 5T1KB 5CZVL 3FMGL 1NEZA 4K8RL 2D4DA 3G5XB 1X4YA 4X8XA 2E27L 4MCYA 5C09D 3FT4A 1RMFL 3AB0C 4LPVA 2HFFB 4OT1H 4QHUA 4APQC 5KSAA 5DVNA 1GGIL 2APTA 1GZPB 4FQIL 4XC1H 4Y5VB 4KZDL 1Q0XH 2DQCL 3X13A 2W0KA 5BJTB 3OKKB 5C2UB 2IG2H 4GLRI 3E2HC 1QFWL 4LPCA 1E27A 2R4SL 1NGPL 1ADQH 3CXHJ 4PJCA 3RUGF 4WNQA 5JO5A 1NC2B 3RGVB 1XR9A 3TYGL 1OTSD 3CVHL 5HHMB 4J3WA 5EOTB 4EUPA 4NJ9L 1U2CA 1MJ7L 4PJFF 2WNGA 4H1LB 2MFNA 2X6MA 4OZHF 4ENEC 2EDXA 3KWWB 3TP4A 1I9IH 1KIRA 4DFIA 2WBJA 1N0XL 3OPZH 3SE8L 1OM3H 4M5YH 4I0KA 2X4UB 4JY4B 3OJMB 4PJAE 3OSKA 5D1XD 3SKJL 4RQQB 3MGOB 5IFHH 4YQXH 1WTGT 3ALWA 3K3QA 3VXTA 4XNYL 3W9EA 3QG7L 1U8KB 5L7XH 4PRBA 3NOIA 1VFAA 5TPWH 1R5IB 4TPRL 1M71A 3EO9L 1QD0A 2NX5D 3NFSL 3ZSSA 4LU5L 1D6VH 1KENH 5F1SA 1TTUA 2F15A 1AGDA 3T3ME 4PP2B 5DJ0B 1JPFA 5AZEH 5TDNB 2W65A 1XZ0B 3QCTH 1KCVL 4JHAH 2DKUA 1KN4H 4K3DL 5HD8D 2G9HB 4QLRA 4PJHF 1IZKA 3HC0B 4JM4L 4HWBL 4PJ7B 3ZKNC 5B8CA 4JPWH 2GJ6E 1HNGA 2V9TA 2D7PA 4P0DA 4TUJB 3QIUB 3LAFA 3CMGA 1DVFD 2BNRE 2UWEE 4J12A 2DIBA 1T5XB 2GITA 5TQ0L 4CU6A 4GMTL 4XPGH 3CUPA 4OZFG 3SDAB 2VLKB 12E8L 4AZ8A 3TVMC 5K9QG 2Z91B 2EDKA 3CLFL 4UQ3B 3BGAA 2B1HH 2R2HB 4PP1D 3MGTA 4JPVH 3SBWC 1ZT1B 2AXGB 5GGSA 4KJQC 1JTPA 2OLDA 3F8UB 5FK9A 2BVUA 5JIHA 2QADB 4FXKA 5C0IA 2Z35A 1B88A 1UH3A 3TNMB 5C0RL 1MI5D 1QPXA 1QQDA 3LQAC 1MQ8A 2OK0H 1MFDH 2VRAA 3UZEA 1P5UA 5IVZA 3ARFD 5J6GB 3C87A 3IFLH 1NCBL 3QUXB 5D9SB 4U0RB 3RDTB 3RWIB 1UEMA 1CFNA 4XPHL 4RWYH 1LK2A 1UJ3B 1G6RA 4OF5A 4PB0L 4FMFA 4WFFD 4KK5D 4GAFB 5C70A 2QQLL 4U0QB 3AAZA 3H9YA 4TUKH 2XYCA 1DQQB 5DT1H 4O02L 3T77B 3FO9A 2CPCA 4Z7WE 1Q1JH 2Q8AL 3RHWK 4KUCF 5BRZD 1HYSC 5JIIA 2FGZA 5KVFL 3F7RA 5ILTL 1SBBA 5EO9A 1CFQA 5FO9A 2YXFA 3QUZA 5A16A 4JAMA 43CAB 1CR9L 1E4XL 1JNLL 1HQ4A 2XN9D 3HUJA 4UAOB 4KAQL 2D7QA 3IKCA 3ZE2E 3D69B 1NAMA 4P5TD 1JIBA 1FYTD 1RJYA 5F44A 2HRPH 4GRWB 4M1CC 3GSOA 4JKPH 5JZ7C 3IETB 4CKVX 3CLEH 3DROB 4OUUA 4NZDA 5EWIH 2CJUL 4Z8FL 2F53B 3F7QA 3IDYC 3MV9E 2KDGA 4PRIB 3S96B 3N50A 4CDHA 4DGIL 2DQJL 2OR9H 3AROA 4X80L 3ELAT 3MREB 3LS4L 4MWFB 4NQSA 4LKCA 4M43H 4PB9L 5FDWA 4PJDE 4PREA 4S1QH 2J5LB 1A7NH 1YZZA 1HKLH 2VABA 3HZYA 5E1HB 2BDNL 2PUQT 2OP4H 4RNRA 3HLAB 2VAAB 1ADQA 2E6QA 2DLEA 3Q1SH 4I0PB 3GBML 2D2OA 4P46C 4NQEB 2X4PA 4X4XA 3MUHL 3BUYB 4LRIC 4ENED 1EV2E 1ZMYA 5KSBE 5HHVH 2D7TL 3I6GA 1WBZB 3IDNB 1BOGB 2QR0A 2ZUXA 3RKDD 4E41B 3G6JA 5I16A 1MVUA 3V6OC 1BQHG 3ILPB 1I85A 2J8UE 3RX5A 3VGAC 2FYYA 2YUWA 8FABB 4O58L 5D7JB 1MEXH 4Y5YB 2H1PL 1N2RA 3EOBB 4PY7B 4UV7H 2D31A 4L3CA 2X4RB 4NKOA 5ID1B 1I9JH 5IM7A 2LTQB 1T4KB 2LQRA 1INQB 2ZSWA 5E8EA 3GMQA 1SMOA 5GGRY 5I76B 3QXDA 1SJHB 5D1QA 2W1NA 3H6JA 4FQPA 2PW1B 4X6DF 5F93C 1I9EA 4LLDB 4YGVA 3PHOB 1DQDL 1T7XA 1ZS8A 2R0ZL 4P2CG 2ZCKL 4OQTL 3ZKND 1OTTC 4OLVL 2VIRB 5E94A 1OSZB 1C16A 4K7FA 1FAIH 3W11D 3SCMB 1I7RA 3C60C 4JANB 4QXTA 3AMKA 2DYPD 1GHFL 3W0WB 5T3ZE 3SOBL 3PQYA 3WJLC 1RZKH 4NZRH 1TETH 4PS4L 4UT7L 1N5YL 3QDHA 1RHFA 4Z7QF 3L7EA 4MQ7A 1VKXB 3FB7A 3CSGA 3TVMD 1EMTH 1WGOA 2BNRD 3QDJB 3MPCA 3V0VB 3DSFL 4FQ1L 3I2CL 4KJQD 3O4LB 5J1AB 4QXUH 2IH3B 2VLMD 1CICC 1FN4B 4L4VB 1WCBB 1BJ1H 1HXYA 2N56A 4EZMA 2XZZA 3IU4L 1X5LA 4XNXL 1YEFH 2EH8H 1JWMA 2VC2H 1QLEL 3VXMB 4OB5H 1TCRB 5I15H 1UQSB 2YBRA 5C8JB 5LCVH 2AJYL 3A6CL 3B43A 4H25A 4BSJA 3IAQA 1A14L 4JQIH 4KJWC 2DQEH 5DD1L 1RUML 3OR6A 4LVNC 5SWSD 3LQZB 4MLSA 5D96C 2FWOB 3OHXB 5H94B 5I1DB 1S7TA 4F7CA 2GY7B 4GJTB 3TV3H 1JFQH 2BY2A 3SDXA 1H8NA 4QRPA 5B38G 1MRCH 2DLGA 1TNNA 2JJWA 5LGJA 3FFCA 1D9KC 2KQMA 2NZ9C 1MRDL 2YOCA 5KN5B 1DBMH 1OAXH 4JHBA 4MDJB 3UYRL 1NFKA 3CZFB 4BSWA 2F54E 1A8JH 1QHOA 3AU1B 4YDIL 4HKBB 4XCCH 5I1HL 1RU9L 5TE7L 2O5XL 2Y06H 3PF2A 1NGZA 1GGBH 4G9FE 3IVKA 1HK6A 5A2FA 1A6UL 4LKXA 2AJ3A 2CDGA 5IFAL 4AMKH 2D9CA 4M1CD 1NFIB 1ONQB 4OLWL 3G6AA 5JLZB 2DKSA 1DDHB 3ZHLA 5JZ7D 3V6BR 1RZ7H 3FQXA 3SDYH 4M5ZH 2UV3A 1WEJL 2DTMH 4UNUA 5HHQA 3MRQA 2MPAL 4QRRB 4TTDC 5JPMB 1PAMA 4Z7UB 2OCFD 3O2DH 2BC4A 3B9KA 4KKAD 2UUDH 4XP5H 2AJVL 1UM5L 1ZWIA 4GQ9L 3BD3A 3MV9D 1DN2A 4OGXL 4OI8A 5J89A 3ECBB 2VLJB 1Q9WB 3RWDA 1K4CB 3N1MC 2J4WH 2W0FA 5FHAL 4LSTL 3UTSB 4AL8H 3O6LL 5JNYA 3O3AA 1N6QH 1HSAA 1SM3L 4ZUTA 2IFFL 5C3TA 2VXTL 4NPYA 1YY9C 4Q7DA 1UYWH 1JBJA 4HWZB 2UZXB 1LE5B 2DLFL 1U91A 3ILQC 3E3QE 3MRBA 4ZS7L 5CEYB 3T65A 5HHOE 3TIDA 4LVHB 1LO3H 5IFJA 3QFDA 3ARDC 4U3XA 2AJUL 3BP5A 3ARVA 3E3QC 4M6NH 3BAEL 5JR1H 2QHRH 2Y7QA 3ZT6A 4EIGB 4KJYB 1FNSL 4PRDA 3BDYL 4ZTOH 1DLFH 4UT9H 1NGQL 4DVBB 1F00I 3MUJA 2BRQA 3ULVE 4XPBH 4JCMA 3VH8A 3UTQA 3MA9H 5LWYL 3U6RA 1V7NH 1KV3A 4OZGA 2WM0A 4ZAKC 1BVLA 4ODTH 3MRHA 4YDJA 5HGGS 5E2WL 4U1KA 3ET9F 4K7PY 2DL2A 5DD0H 3UTPE 4HWEL 3BO8A 5IMKB 3C60D 2YUXA 4JCLA 4NM8H 3SGKA 1DQLL 5C6TH 5A2IH 3BGFB 4ZNEE 3PJSB 4X7CC 1MHHB 2YMXH 3O3BA 3RKPA 1J7VR 4LNRA 5IMLA 4QRSA 3MXWL 3PWVA 4NIKB 3KPSA 4P48A 5T3ZD 1IAII 4KROC 2D03L 3MRFB 3GSNL 3O3DB 2W0LA 3IRPX 4NUJB 2R2EB 1MHEB 3T0EB 2X4QA 1U8JB 2X4NB 1CICD 1AXSB 4PJ7F 1A1MA 3S3PA 4YXLH 3AM8A 1N64L 1IEAA 2GK2A 2IAMB 4UV4L 4LDEB 1IT9L 5C0CE 4U1LA 3R8BB 3C2AL 1QBMH 1BJ1J 3DUUA 4TSAH 4P9HC 4Y8DC 5I74C 3WFZA 4LHUD 3Q6GL 1NKOA 5F9AC 3GSWA 5BCAA 4YHPA 3ZL4L 2XFXB 3MJ8A 2Z92B 3GMLA 3MFFA 2Y07H 1F11B 2NCMA 4FTVB 4CVZB 4GUPB 5TH2A 3MJ9H 2EE6A 3JWOC 3ZYJA 1ZHBA 4NYLB 5IBTH 2QLVB 2NQCA 3OXRA 1FL3B 2I26N 2NZ9D 1WZMA 3X12B 1MAJA 1QO3A 2FHFA 1AGCA 5IESH 5C0FA 2Q76B 1MQKH 4M6OH 1B9ZA 1GC1L 2XWBA 3M17B 5E8OA 1E6OL 3G5YB 4K7PX 2PTTA 2A74B 3MRCB 1AQKH 1G9ML 1FFQA 2VLRE 1HINL 1HHIB 3KLAA 4RWHA 1U9KA 3RIAK 4K71C 1K5NA 4GBXC 1JHKL 2VXQL 3BMWA 1P2CA 2F54D 2NW2A 1RIVL 3ZTNL 5JORA 4G9FD 3DRQB 1I3RB 4V1DB 1CD1B 2NY1B 3QZWA 5C0BA 3K8KA 4IMLA 4TTDD 5IOPB 1LO2L 1OAZH 1A3LL 1ORQA 4XPTH 5J0BA 1GL4B 4R96A 3GSXA 3WFDH 1MFAL 3KDMB 4BZ2L 1EZVY 4GAJL 2DQIL 2WWKO 4IDJH 4S1RL 5C09A 1A4KA 1YNTB 4Z7VF 4ODUA 4TSBL 2HVJB 1DUYA 4AIXA 4GRWF 4C56E 2FATL 3N85H 1ZEAH 4LCCC 1MIML 4OZFH 4EJ1C 1ZLUK 1MCKA 5GS0C 4Y4KB 4L9LC 4M6MH 2DBJA 4YFLI 1YPZB 1YY9D 4LAQH 4WO4C 2YUVA 4GS7C 3F58H 5GRYA 1FVDA 2HKHL 4FZEL 5E6IB 1KLUB 3U0WH 3ILQD 1OGAB 5GZOD 2D4FA 3CXDH 3HE7B 4M7KH 4Q9RL 3VWKB 3LN4B 4HC1H 1MUJB 2FSEB 1W0VA 3FZUC 5KAQG 3IF1A 5CJQH 4U2ZA 1G7QA 5IW1B 5FDYA 2X4TA 4P57B 3FB6B 4HJ0D 1AI1L 3ARDD 2FGWH 3S37H 4S1DD 1R5VA 1DZBA 5I6XC 2DQHH 4XPFH 5HHOD 3L9RB 1GXEA 2CLRB 1I1RA 3TYFA 1MWAB 3RBSA 4ODBD 5C07E 3VD5A 1XFPA 4I3RH 5D1XA 2D7NA 2W9DH 5H8DA 3RWCA 5AZ2H 5EB9A 4CMMA 1HQRA 4GMSL 1EZVX 2NX5A 1ZTXH 4NCDA 3IRZA 4ZAKD 2ADIA 4M3KB 2F74A 1FPTL 3IFOA 3WCYA 1JF6A 2WMPA 1DANU 2X4OA 1KCSH 3OB8A 3U0PB 1Z5LB 3WIHA 5DFVC 3QO1B 3UTPD 2C4XA 1AHWA 4KROD 3VD9A 3CC5B 2FRGP 1AO7E 3DBXB 1NCAL 3NABH 2ZOLA 2NTFB 4OGYL 3GKZA 5F1NA 1DVFA 4PJEA 1DE4A 3NZ8A 4LFHG 1MF2L 1ND0A 5DA0B 3P0GB 4DGVH 5CD3A 1AR1C 3T2NL 3C9NB 2C1OB 4TOYL 4H20L 3GMNA 3TM6A 4ZODA 4XTRC 4Q6IB 5I2IA 5FUZL 4U6VL 2X09A 1AKJD 4L8SB 5CILH 3VI3E 4AJ0A 5C0CD 4PLJC 3S34L 3O4OB 4Y5XB 2VDRH 5I1JL 5AD0A 4HIEB 3DMMC 4KZEL 2C3VA 1P9MC 1H5BA 5ANMA 1MI5A 4P3DA 5GSRB 1I1CA 4X4ME 4X6EA 3O8XB 1I7TA 3ARFA 1YQVL 5CSZA 4R7NA 5IHZB 1X7QB 1T7ZA 4J1UA 2FEEI 5D2NB 4D8PA 4CADB 1QLFA 1I1AC 5DMYA 5MENB 2GAZB 4K8RD 3FT2B 4XVUC 3ZZ1A 1CGUA 3KS0H 2VE6A 3V6FB 2CKBH 1EBAA 1G0YR 2DM4A 4NQVA 1T1ZA 1UEYA 3DXAD 4GBXD 1QSVA 3BSZH 1YEDA 4PJIA 5C86A 1GZQA 4MCYB 3FT4B 5MI0C 1FE8H 4XMPH 4P4KC 3L1OL 2C7UA 1MCWW 2VLRD 5ADPL 4YPGA 2H41A 3MLXL 2XN9A 3RA7L 4P5TA 1IARB 4XP4H 1FYTA 2R2BA 4ERSL 2GY5A 3TH4T 5DHVB 4NKIL 1WTLA 5GS2D 1IGFH 3RIFF 4N0FB 3WJJC 3ULUE 1MNUH 3P4MA 5GSVA 4G43A 1S5HA 1N8ZA 1TQCB 5F6HJ 2LABA 2WANA 5JO5B 1GAFL 3BPLB 1RZJH 1D5XB 3RTQC 1NL0H 1R3JA 1XR9B 1RZKC 2C4FU 3VGEA 1JTOA 2YPVL 4EUPB 3ULUC 4LFHD 3OB0H 4ONFH 4IOIA 3WFBL 2B5IB 3DO7A 5GS0D 4C56D 2HJFA 2ZUQC 4WO4D 3BPNB 1LO0H 3ARGD 4Z7UF 1HIMH 1UADC 3IJYA 4KVCH 2FHCA 5AYUL 4OLUH 3QNYA 1V3JA 3BZ4B 3QPXL 3WO3B 3IFNL 1MRFL 4JY6A 1D5ZA 3HR6A 3MCG1 1FVCA 3BI9X 4YHKL 1O7VA 3MR9B 4X7EC 4NNPH 3NCJH 3W9EB 1YMME 4LDLB 2GYSA 2Z8SA 4P2RE 5TDPA 3V4VL 4PRNB 2RR3A 1RJCA 1ETZA 3GO1L 4WFEE 4R4FL 5CJ5A 5GZNC 1DJSA 1HWHB 2OZ4L 4K3JL 3SGJC 1AGDB 2WINA 3S35H 1YYMH 4J3XA 2W65B 4PUBL 1KPVA 2VISB 3RVXC 1YDPB 2ZG1A 1LEGA 1KIUA 3MV01 3MXVL 2CGRH 5C07D 4NN7B 4PJAA 1HSBA 4EI6B 3M45A 2I27N 3PDGA 4KC3B 4LAJH 2E9JA 2DDQL 3TT1H 5ALCL 1MCFA 1PX4A 1A5FL 4QHKJ 1B2WL 2R9HC 1B0RA 2VKXA 3DETD 4M62L 1OCWL 4HXAH 2UUDK 2A6IB 1AGEA 5EZJA 3OGOE 2OL3L 3ARBB 1MFCL 1INDL 2UZYB 3MGTB 3RY5A 2H3NA 4N1CA 4BQCA 5DQDH 1UENA 1KLGA 2DYPA 4A6YL 4ISVA 2H6PA 5ACZB 1MCIA 4G5ZH 1Q72L 4FXKB 3CSYA 5GGRA 3BIAX 4NSKA 1QQDB 5LGHL 3GIZL 1AO7D