1NCDL

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIVMTQSPKFMSTSVGDRVTITCKASQDVSTAVVWYQQKPGQSPKLLIYWASTRHIGVPDRFAGSGSGTDYTLTISSVQAEDLALYYCQQHYSPPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1992-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdL01
2VKWA 1R3HA 3GUTB 2YBRA 1I8MB 4GW1A 3HE7B 3QEGL 5L2KA 4XXCC 2X1QA 1I3GL 3WHE1 3LB6D 3I6GB 3C09B 4KDWA 3PIQA 4LEXL 2F19H 1JNLL 5CEXB 3ULVD 3G6DL 1BJ1J 5DURB 4WU5A 4KRNA 4KRPD 4PJ8A 3H2WA 4QNPE 4UBDC 3DVGB 3GSWB 1HOCA 2E3VA 2P8LA 3DI2B 3MGOA 2JIXB 3QG7H 4RMRA 1NBYB 5C0JB 35C8L 1PFCA 1WTLA 5DJ6A 4YDLC 3M1BA 4XC3L 1U8HA 1T3FA 5ILTL 3SKOA 5B3JF 1Y18B 5E5MB 1C12B 2E7MA 3H7BB 1VEOA 4D9QE 4ODHH 5C08A 2IEPA 5IKCB 2DKUA 3PABB 4YPJA 3LKQB 2XXCB 3DRQB 4HCRH 4PJHE 4YZFF 2HTLD 2ADIB 5KSBB 3KLAB 1T0NA 3IFPA 2HT3D 2R69H 5I17B 1JVKA 4L4VE 1HEZB 2WLZA 4LSQL 5EOQH 5F7DB 1JNLH 4EZMA 4DGVL 4U1HB 3MLUH 4LCCC 1ES0B 3BJLA 1AY1H 3KR3H 3RVWD 3SE8H 1ORSB 4L4TA 5SX5H 3S34H 1T66D 2MFNA 4Y4KD 3REWA 4I18A 2QBWA 4JY4B 4OLWL 1CDJA 2DWEB 3NFPA 5EC2A 1SEBA 2VLRA 4H25B 2APTA 3HFML 4F3FA 4NQXA 4WGVB 3U9UA 3ULUF 4Q9RL 4F2MB 3QDHA 5I1KL 4O5LH 4PP1C 5FO7A 1A3QA 2KQMA 4FABL 4MB5A 4ZTOH 4IRJC 2DLTA 2ICWB 3DSNA 5IIEB 5IW3A 1NDMB 3H8NA 1EH9A 5E24E 3N9GH 1E4KA 2B0SL 3D2UB 4WHTA 4S1RH 3U4EA 2NY1C 1FFOA 4O2EA 5CEZD 5ESAA 5C0FB 1H0DB 2B1AL 4X6EA 4UAOC 2R1WA 1Z9OA 5DJDA 1CCZA 1TZGL 3O6FB 3S3JA 2PW2A 4Q6IB 1JNNH 4GT7A 2PTTB 3CFBA 3L1OH 1DDHB 3HCVA 2FIKA 4LKCB 1BM3H 1WAAE 1F3DJ 4IRSB 3MJ9L 1HZHL 3SPVB 5IEKA 4KWUA 5F6IC 5FF6A 3D39E 3EJYD 3LPGA 5JPMB 3RJDA 4ZUSB 4XH2B 1UEYA 2H9GA 2M8XA 3LKOA 3MV9D 4P9MH 1YEKH 5L7XH 1Q9WA 3P4NA 3UZQA 4OV6F 3OMZA 5I18H 3ZDXE 5EZLB 3QPQC 1C5CH 2ZUWA 1CTOA 3GB7B 1DUYB 1VFMA 2Z93B 3C8HA 5GRJH 4P59H 1PZUB 5EO1A 2B2XL 3QPQD 3VI3F 2ENYA 3HC0A 5DK0A 3OKOB 1A7RL 1ZLUK 5DVMA 2N1KA 4Y16A 1J0KA 2Z91A 5ICXA 5A2IH 1ZVHA 2P5WB 3OG4B 3PP3K 2PTVA 1XH3A 1QSFB 5AG9A 5GSRB 2OX5A 5CMAA 2P4AB 3P30H 4YFLI 2EDBA 3BGFC 4ZS6C 4LLUA 1IQWL 2C1OA 4KAQH 1G7MA 3TPKA 1IM9B 4Y8AA 5DD6A 1IAIL 2MCG1 3EDEA 3HNSL 3BSZL 3OBAA 3U7YL 1T4KB 2C3HA 3KPMA 1O5DT 1ZMYA 3QH3B 4DTGL 4PV9A 2GT9B 1GL4B 1S8DA 4B7IA 4YBLB 1MJJB 5E6ZA 4LNRB 3C5ZA 4PBWD 5I9QC 5JZ7D 2A6DA 4JFOB 3U36B 4LVNB 5C7XH 5KS9F 5IROC 4NWUL 5MENB 4JB9L 3TP4A 4K55A 3I85A 4I0KA 5GRWA 3AUVA 4Y4KC 4B5EA 3B9VA 4M1GH 5I74C 4R0LC 3PHQB 2Q8BH 3QUZD 2HN7B 2HJFB 2KDGA 2VL5B 1F6AA 3J8F7 4GBXC 4ENEC 3Q6FA 3NIGF 2XZAL 1QP1A 1MCOH 5BVJA 4TPRL 4PGEA 4UU9B 2E8ZA 3ARFD 5E6IC 4JFEE 4DAGH 3ULVF 4QHMB 3F7VA 2D0FA 5DLMH 4P5TB 4OCRH 5IMLA 1T22B 1YYLH 2IADA 3SJVA 1UACH 4Z7VF 1Q94A 4ZFFB 1FNEA 3QIBA 3HMXA 1S7UB 4MSWA 5L9DH 1FZMA 4KZDH 4BQCA 5IFAL 5I1GL 3BKYL 3I3EA 2CRIA 2NY1B 5C0BB 4TNVK 1OD9A 3CUPA 4L8CB 3LSOA 2IPTL 3TWCL 3LN5A 1T0NB 4BUGA 2YUZA 4Q58C 3T3MF 1ONQA 2FX9H 4P2QB 2A6KA 2JE8A 3W9DB 4QYOA 5D1ZB 3CX5K 4NC1E 1AO7B 3FHQA 4Z7UA 3QHZL 4G9DA 5D5ME 3KGRA 3EOBA 4MJ6B 3DVIA 1FG2B 4KXZI 3WNPA 3VGHA 5D2LB 2XACC 1ORSA 2F15A 4L4TB 5F3HB 2VZUA 2YA1A 4RX4A 3IF1B 1R3KA 4FFYL 5E7FA 3GSNH 3HZYB 3CFKB 1S7TA 2BSSB 2VUOA 4ZG1A 4PGDB 3KPLA 5JO5A 5HVHB 4NQED 3SKOB 1QBML 4F2MA 3MRLB 4N5ED 1GGUA 4IM8A 2R8SL 4PB9H 5B8CA 2HP4A 1CTNA 4XPBL 3EZJB 3MUY1 4XP4H 3BP5A 3F8UB 1S7RA 3UCRA 4XX1E 1QFWL 1OWRM 3EW3B 4HS6B 3MOAH 3ZE2F 4K3HA 2UUDH 2IALB 2OTUB 4NRZB 8CGTA 3DX7A 5F71A 5F6IB 4GKNA 4DVBB 4ODTH 2JCCF 4XPTH 5DJZB 2NXYC 1PY9A 4KQ4L 1AO7D 3ZYJA 2APBA 3KPSD 4RISL 4GBXD 5EH1A 2R4SL 4LQFL 1LP9F 2PTTA 3CFBB 3G5ZB 1WCQA 4IS6B 5HYJE 1GGBL 5D7LE 2IH1B 3IJSB 3ZT5A 1SVZA 3SDCA 3CFEA 2HLAB 4YXLH 1KYOK 1LDPL 3AY4A 3ET9F 4NQVA 5J12C 1NEZB 3BZFA 1MUJA 4L8BA 4GW1B 5CIPA 4ZUVA 1CICC 1DVFB 4FFZH 3KPRD 2ICWA 3OHXB 3TJHD 4BFGA 4X99A 4KUZL 1ZHBB 5KN5A 2OLDA 3QXDA 1KFAL 4LCYB 5DJCA 2I27N 3WSQH 1BBDL 3EOTL 3S5LA 5EO1B 4XNQB 1JZ2A 5JW4M 4ZFOL 4ZODA 3QI9D 4EJ1C 1UXWA 4M8QA 5E00A 4ZFZB 3F5WB 1RJLA 4LP5A 4MZ3A 4KMTH 5J9PB 1JP5A 2EEBA 1XGTB 4BSWA 4AQOA 4YX2L 1YY9C 3VXMB 1I7ZB 1B4JL 5FF6B 2O61A 4JKWA 5KJRH 2DF3A 4FZ8L 5JPMA 2DQJH 4TTDD 2ADGB 1DL7H 4CUCA 5BMFH 5FECA 1XR9B 1OGAD 3L5WA 3BQUC 4AIZB 3K2UL 4Y4KA 4GQ9H 3V6ZB 4XHQA 4OGYL 3MLPA 1B2WL 1D3CA 4EKXA 3KPPB 1YA5A 3BXNA 4RBPK 4AH2B 1D6EB 1G6RB 4QHUB 2CUIA 4Z76A 2NLJA 2VXUH 1NCCL 2VL4A 5E4EC 3TEUA 2ZUQC 4P3DB 2GJJA 3ZE1F 1B2WH 1PZ5B 2VRAA 4XXDB 2IANB 5I8EB 1I3VA 1KB5B 1E0OB 5SX4I 1KSRA 1KB5L 1IGCL 4NQCD 4R26H 4GG6F 3MNWB 2FL5A 4V1DB 3SQOL 2DMKA 1T7WA 5ANMB 4RAHA 2EIDA 3WHXA 2X89D 1A6WH 2DQDH 4YJZL 4ZNEE 1XT5A 3TCLB 1RK0A 2RFXB 4X6DF 3C9NA 3GHEH 4MA3A 1EA9C 5F9WB 1ACYL 1Q0YH 3N06B 3T4YA 3W0WB 5I30L 4KJQD 4G9FB 2BNQD 3MOAL 1T7XA 2YKLL 4GXVH 3UC0L 3CU7A 5TPWL 4G6MH 1JFQL 4YUEL 2PTUA 1NAMA 1Q94B 2JJWA 3BUYA 4POZC 3ALWA 4NNPH 1Q0XL 3M07A 5C0AB 4QXTB 1IC7H 5LAXA 3C60D 5L2KD 5I30H 2YRZA 1Q9OB 4JR9L 3E3QC 4PLKC 3MA7A 4KK5D 1FAKT 4PRNA 2CRMA 4FQCL 3QDJA 1A0QH 4K8RL 4X5WB 1DBBH 3BKMH 3S35H 4GQPH 5I1JL 5DUPH 4LCUB 1II4E 5GS1A 1AQKL 3O2DA 3BKCL 2WQ8A 2DOCA 2VITB 1MIML 2Z9TA 2VDML 5DF0A 4YHIA 5T1DL 2XN9A 1S9WB 1KCSH 4JY6B 1FPTL 2WLYA 3HG1B 4QTIL 1CD9B 4PGCB 1YZZA 1U0QA 1KLUA 5IBLD 3R0MA 5HYQB 1HXMB 3MV9B 3OKNB 5ETUB 3BUTA 3UAJC 3UEZA 2BNRD 4I5BA 2OK0L 1XCTB 1U36A 1X5FA 1WZ1H 5DFWH 1DSFL 4TTDC 1MCHA 5TDNB 4TUKL 1K8IA 4K7PX 3VU2A 4CW1A 3E6HB 3NZ8B 2JELH 1X3DA 3AB0C 3FQNB 1S7SA 3IDJA 2YPVL 1YYML 1FYTD 2ZCKL 2XI9A 3VWKD 4W4OA 2OXGA 2P8MA 3JTSB 3DVNB 4QXGL 3KPMB 4CGTA 3DX7B 4Y5XB 4OCSL 4F58L 3TVMB 1AP2A 1I8LA 2K7PA 4XP1H 2P5WE 3TH2T 3ULVC 3Q0HA 4LSPH 5EFIA 4Q9BA 3BD4A 4EUPG 1FNHA 3DJ9A 4NFDA 2BVYA 5D2NA 1MCDA 4LNRA 4F37K 1MHEB 2WSKA 1E28B 2MQ3A 3FFDB 5J1SC 3EO9L 2YPLE 4FNLH 1JI1A 1FNGB 1OP5K 4AJ0A 2FX8L 4YC2B 4Y5VA 2Q7YA 4Z7QE 3BPOC 4UOW0 5CZKA 3SO5A 4FQHA 4IOSD 3KJ6L 4NZRL 4ZUTB 2G60H 2FX9L 4PJFE 4GXVL 2ZNXA 3RA7L 4ZUVB 2V7HA 1IKFH 3DMMD 3TNNB 3NCCB 3OJVC 1YEIL 1UKSA 1XGRB 1MH5B 4UU9A 5GGRB 3QA3B 5I1GH 5GS0L 3DETC 1M7XA 32C2A 1EBPA 1EFQA 1SQ2N 3LHPL 4S1SH 1YEDB 1U3HB 2YWZA 5JR1L 3KPNB 3ISWA 3U9PL 2VR5A 2I9TA 4TRPH 4DUWA 5ESQB 2W0KA 5JW3H 1ITBB 1HHKA 1VESA 1YMMB 4JG0L 3PDDA 4C56A 4JZNA 3KAAA 2E6JA 3CPLA 1NEZA 4AEFA 1A1NB 4XXCA 4NZRH 3PV6B 2C7UB 3QEUA 1W72H 1UENA 2A6KB 1I8MA 2A73A 2QADB 4OUUA 2IH3A 4XHJC 3EYQD 2BMKA 4BQ6A 1Q9LA 3EJZC 5C7XL 2EIZB 3VGAB 4O2FB 5D7IE 3VXUB 3S5LB 3T77B 3VE0B 3ZZ1A 4OCYH 1CI5A 5F3HA 3VWKC 1ND0B 4DJMA 3MZTA 3WS6A 4FMFA 3MJ7B 4KI5F 2ZOLB 3F7YB 4MNQB 1UA6L 4LEOB 3WS6C 4MD4A 1IBGH 4J2XA 4PJCF 3GSOB 1EXUB 3BPLC 3CVIH 1YDPB 4XMKH 3N0PB 1FORH 4JFDD 2W9EL 2HJKA 2YSSB 4PJAB 3EHBD 5BS0A 1ACZA 3ZDXF 5B21A 15C8H 3HC3H 2BDNH 4P4KD 4OZFA 1S7RB 1F90H 1FVEB 1QSFE 3V0WL 1AJ7H 3T0AA 1B9ZA 3AVEA 1KG0B 5D7JA 3C5SA 2B4CH 1A64A 2ID5A 2OTUA 1TPXB 3IFPB 4IOIA 4KY1H 1FZKB 3SHSA 1GXEA 2Y07L 5D7KE 5L9DL 5DC9B 3QULA 2ZUQB 1T6VN 1UWXH 4XNMB 2VAAB 3C5JB 2GTZA 4JN2A 3OGCA 4FQPA 2VH5H 5GGUB 4OB5L 4IS6A 3HI6H 2NQCA 1EVTC 3BIAX 1QEWB 4F37F 1N3NA 3DYOA 2AEWA 2EDFA 4PJXF 5H37H 1WLHA 4L8BB 1A0QL 5SWQB 5ANMA 2IBZX 4HS3B 4O00A 1TJGH 2VITA 3QNZA 3ROOA 3OAUH 2PYED 3BPNC 4PY7B 1BF8A 4U1LB 1HHJA 4OM1H 5F6HI 3NACL 4HK0A 1HCVA 3MLWH 2KBGA 3GBML 1A6VH 2NMSA 2EH7L 3VWKA 1HXMA 1DVFD 3MCKB 3UPCA 3BIKA 3K80A 1J1OL 3BP4A 1C16B 1XF4B 2AGJL 2E9JA 2NY6B 3MLXL 3VFOA 1AIFA 1F11B 5T3XE 5LGHL 3RVXD 3NIGE 2B0SH 3U0PA 3NCBB 5DS8A 3G5XB 3UX9B 4K9EH 4QHKJ 5IB3B 1NGXA 4M03A 3WMSA 1MRFH 3Q3GA 2YMXH 1MSPA 4JQIH 3FQNA 4RMVA 2BNRA 4LLWB 3KNBA 4P2OA 4XNZB 5E94B 1A6UH 4GRLB 2ENSA 2GCYA 2XG5A 4A6YA 2NW3A 2F54A 1Z0NA 3ARDA 3HB3C 3ZLQC 3T2NL 4R0LB 3RX5A 1EBAA 3U2SA 2VXVL 4LPWA 4BK4A 1XR8B 4ODVH 1RMFH 4XRCB 5MEOA 1LDSA 3MRFA 5D1XC 3S34L 4Z7NE 3TLRA 2EEAA 4X4XA 4JCMA 3UTTA 3WFBL 3EDFA 3K2MC 4S1QL 1HN1A 1EX0A 4J1UA 4PJEA 4O02L 4QLRA 4APQA 5IEKB 4OBSA 4OGAD 4ACPA 2ZUTA 5KJRL 5DD5H 2D7PA 1JZ7A 2W9DH 4U05A 3RX7A 3MRCA 4RZCB 5AG8A 3IJYB 5GSRA 3T0ED 1OM3L 4D0BB 3G5YB 4TNWK 3B5HA 4AEHH 5D1XD 2NY3B 1ORQA 3VFTA 1XGRA 1MHPH 1Q9WB 2DMBA 4U33A 2AJVH 3H3KA 4JVPA 1UYWH 3L3JA 5FYLL 2X1OA 1ZLUH 1SEQL 5J1AA 2IGFH 2UZXB 4YHZH 2X89A 1SMAA 2EE6A 3CSPA 4IRZL 5C6PB 3QNYA 1I9JH 5IM7A 5DURD 2HKHH 1G9EA 4I8DA 4JVWA 4ISVA 4NO5A 4XGZB 2AJ3B 4KUZH 3RWJB 1MCRA 1QSFA 2UWEB 1I1AD 2ZSVA 4HLZH 4M9OA 5FHBL 1QBBA 3O2VL 3MRPB 2CDFA 4LLQA 4YQXL 3ARQA 4ZUTA 2H6PA 1LO2L 2C7UA 1R0AL 1KPRB 3IS0X 4AL8L 3RWHA 4OIIL 2DDQL 2YD3A 2E7BA 4YXLL 5L2KB 4JFHD 1RAMA 1KIPA 2VLLB 3NN8A 2W60B 4UIKL 4Q9RH 1BVKA 4OLYH 3AB0B 3TF7C 3AM8A 4TSCH 2DBLL 3OKYA 1NKOA 4JFYB 1JBJA 1QVOA 4PJBA 3RU8H 2X4SA 3N1MC 4KQ4H 5DD3H 4LF3A 1U3HA 5FAAA 5HGAA 3W2DH 4JLRB 1LO4L 1ZT7B 4E42A 1CDBA 5DK2A 2JIXD 1KB5H 5C07A 3K7UA 4ORZC 4GAYB 3NIFF 4LSVH 1T3FB 5FYLD 3DO7A 1FE8L 1KJ3H 5AYUH 3ZT6A 1DN2A 1EV2E 5EOQL 3UJIH 5GS1C 2UZYB 5CFHA 4P59L 1Y6KR 5C0CD 1Y6MR 1A1NA 3CDGA 2ADJA 2QR0A 4PRIE 3OJMB 2BVQB 4M6NH 2CLZA 3MRBA 4DW2L 3LCYA 5IGXL 1A7PL 3C5SB 3RFZC 5SWSE 3TPUB 25C8L 5F7DA 4DZ8B 5KVFL 3OR7A 3KPRB 1FFQA 3KPQB 3FB7B 3IXAA 5SX5K 4XC1L 1FCGA 4HPYH 3SGJC 1KCVH 1RUML 4F7MA 2HFEB 3MJ9H 1YNTB 3I3BA 4MB4A 5GGUA 2OR9H 4XP9L 3DXAB 3MRNB 5FO9A 1WWWX 3VD3A 3L1OL 3F7YA 4QT5B 1RD6A 3IF1A 3UTQB 1FH5L 5DMIH 3BE1H 4PJGB 4I9WD 3G6DH 2FECL 3WDJA 2I60H 2FBJL 3O4LE 3CAFA 5DZLA 2FB4H 4HKBB 2Z8RA 4R8WH 5HYSB 3EFFB 2OJZH 1IAIM 2DKMA 2AEQL 2X44D 5D1QC 4M5ZL 4ZUWB 4DOHB 1F4XH 4XX1G 3F12A 2YPLB 4HK0B 2DQFB 4WNQB 4S1QH 3QZWB 4MA7H 1X5AA 1JPSL 1CL7H 5D70L 2Y72A 2ATPA 1AFVH 4KK8C 1UB5A 2H2PD 1UWEL 1D5ZB 2DQHL 4KDTA 5ESVA 1RIVL 2D7NA 1BHGA 3U0PB 1CE1H 3OTTA 2OI9B 4Z7WE 5JXEC 4E41B 2BHZA 4TPRH 1J1PL 3LEYH 3KHQA 4Z0XB 2EC8A 1ETZB 2ITCB 4OAWB 4B53A 3DUSB 2BNQA 1XZ0A 1ZSDA 3EO1B 1MQ8A 1AY1L 1ZKAA 3KYMA 4KK9C 2V2XB 5E5UB 3HZVA 3QEUB 4R4FH 4M4PA 1EK3A 4OGZA 5JZ7C 4BSVA 3QDGA 3ELAT 1HHJB 1RZKL 2AI0H 3MLTB 3V5KB 3GBLA 4YHOL 3ROLB 5DJAA 4F57H 3HMXL 5ICZA 4ZXBC 1F4YL 3D0VB 4JRXB 2YEZB 5INCA 4PRHA 3MRFB 1RJYB 1NEZG 3NA9L 3GMNA 5IHZA 1HQRA 3ZDZF 3TBYA 3BKJL 4LDLB 3HC0B 5HVFB 3O4OB 4NQSB 2FX8H 4UILL 1MJ7H 1C16A 1F3DH 4JRWA 5DUML 3X3GL 3BN9C 1EPFA 3GSOA 4H88L 1MNUL 3FZUD 2XZCH 3L5XL 1QSED 1H3GA 4Q2ZB 1MFBH 1JNJA 3O6LL 4PJIA 3CMOH 2P24B 2IBBA 1T20B 2BVOA 4YC2C 4J3TA 4X99B 3VXOB 5F9OH 1IC4L 2I5YH 2FSEB 4A6YB 5D7JB 5CIPH 4LCYA 3FQUA 3NAAL 2DQUL 3MRMA 3ARSA 4Y88A 5EZIL 3WD5L 5CLWA 3UTZB 4JPKL 3ME0A 1S9YA 4PIRF 3S97C 1U8QA 1LK2B 2V2TA 2VXQL 3R0NA 2Y07H 4AH2A 3EJYC 5KSUB 2Y23A 1FNSL 3LN4B 1DBMH 1YN6A 4P9ML 3QUMH 5GZOD 1MFNA 3JV4A 1JF1A 2YC1B 3MUHL 2F74A 5B4MC 5E99L 3CVHA 3QI9A 4LSUL 3DVFA 2APXA 1JN6B 2IMNA 2VDKH 4OV5B 1M05B 4XWGH 2PW1A 2LV4A 4YO0A 1PZ5A 3MJ8A 1MHCB 4TTGA 2VL5A 2N56A 5F6HJ 3RPIB 2YXFA 3LD8C 3QUXB 3FFCB 3VWJA 1PG7X 4J3WA 4HJGA 4QHMA 4Y5VC 3R8BB 1MCFA 2SEBA 1UWGH 2J2ZA 2ICCA 3H0TA 5C0NC 4G3YH 4YFLF 1MPAH 5I2IB 4AENA 1EHAA 4M5YH 2FZ3B 5FA4A 1KJ2A 3F6LA 3O2WL 5IB1B 2ATKA 2IC2A 4KK5C 1J88A 3L3GA 4ENED 1EUUA 3FO1A 5TQ2L 3BFOA 3P40A 3V5DB 3OR6A 3HS0B 3CZFA 2X1WL 2QR0B 3AREC 2E7CA 3WUWA 4M9PA 2C1PB 1OAUH 4NQEB 2D4FA 3DUUA 1WISA 4PD4K 5GGTL 3E2HC 4K7PH 4J4PD 5EORH 4LCUA 1OAKL 3DBXB 2DQDL 5FFLA 3UZVB 4MJ6A 1DN0B 3L7FA 4MJIB 3U7YH 4HWBA 5ADOH 1ZAGA 3VXRA 5D2LA 4Z7OE 4MQ7A 4RGOL 3VA6A 4YR6B 1V7NH 3EKCA 4M43L 4PGCA 3DXAA 1LO3L 1MWAB 1NCBH 4QXTA 4OZ4B 5KOMC 3UTSA 4M6MH 2GUOA 4LSQH 1CDHA 4PJGA 2XG4A 3C8KA 3OKNA 3QDGE 2AK1L 4RX4D 3IKCB 3ULUE 1KELL 3AS2A 1NCBL 1NUNB 2FLRT 3MUJA 1ZA3B 5FCUH 5F7NC 4G80B 3CGTA 1WIPA 3OKDB 5B4MD 2JJTC 3O6KL 2O5ZH 1KBGL 5GZOC 1IGIH 2KZ1B 2X70A 3IDNA 4DVBA 5CP3H 4RFOH 4PJHB 1OWWA 4NN5C 1I7RB 5C07D 3KXFE 2X4PA 1T03H 1UZ8B 1WBYB 1BQHB 1S3KL 3BPLB 1REIA 3ZL4H 3O9WC 3ZYOA 1PKQB 3LB6C 5DEGB 3K74B 1J9CT 3L95B 4HXBH 4LAJH 1A2YB 5D2NB 4KMTL 4YDIH 3WDHA 5H35A 2Z8VC 1YEHL 4IIQC 3X14A 4OZGE 1U3JA 2AJZB 3VGBA 4GAGL 3K46A 3VXPA 5E8NA 4O58L 3FN0H 1XZ0B 1ZSDB 3EO1A 4YAQA 5HYJA 3KHOA 4W68A 3D39D 5GRZA 1CK0H 4HX1B 1XF1A 4G7VL 5TF0A 4PJ7F 3TVMA 1XGYH 4G8GD 4KJPD 5MEPB 3VCLB 2DQFA 5MENE 1YEEH 1BX2B 2WMPA 3VH8G 3TBYB 3M45A 3L9RA 2XOTA 3QHFH 5C6WH 4FABH 1F58H 1N26A 2B20A 3WKNA 4XPAL 4URTB 4LCWA 4CMMA 1LP9A 1YEEL 2XTJC 4IMLA 5C07B 1GGCL 1I9RL 1IEAB 2CKNA 2NY7L 4E41A 1EIBA 1MF2L 1CLCA 1AXSB 4N90D 3X13A 1CDIA 1PLGH 1YN7A 2P44B 3V9FA 2O61B 3OPZL 4XPTL 2ED9A 3BX7C 3PP4L 3HZVB 1IMHC 1P2CA 3IDUA 4JR9H 4JFZH 2HLFD 5I8CA 1VEMA 4X7SH 1PX3A 3QA3A 2QTEA 3CFIC 3VMNA 1FNFA 4NOFA 1Q1JL 3QCVL 3D39B 5KVGH 4G6ML 3UBXG 1XIWC 2PO6C 1FGNH 4LAQL 4WY7H 3TIEA 4F33A 4Q6IC 4JDVB 1I9EA 4M7KL 2P8LB 3AXLB 2BY3A 3AS3A 4P2QE 2HT3C 3MGOB 1NMAL 1Z6JT 2EIEA 5E5MA 1W0VB 3FB8A 4XXDA 3RPKA 2F54D 1D9KB 5GSVA 4NGHL 2OZ4H 1EAPA 4HJ0D 4RFNC 3BKJH 4P49A 1P9MC 3BH9B 4FRWA 2EZ0D 1ZOXA 3ZKSD 1I1CA 1Y18A 1C12A 3I6GA 3CK0L 4BQBA 2EO1A 4UTAL 3G5VB 1FG9C 3DXAE 3MRJA 1IRAY 2WIIA 4MA3B 1MQKH 5AZ2H 4CN6A 4PJGE 2P5ED 4GRWF 4Y8DC 5DRWA 5ALBH 3PGCA 2AKRB 4OZHB 3EJZD 4J8RB 3REWB 1J0YA 1KJ2L 1TQBC 3HZKB 4OCWL 1GGCH 4OD2A 5EC2B 3K0WA 5MI0B 2OI9C 5LAXB 4FQQB 5E2WH 2VAJA 5KW9L 2X4QB 2BNUA 2FD6L 2PW1B 4YO0B 4G43A 1UCTA 4MMZC 1AR1D 2DICA 2PN5A 4Q0XL 1AFVL 3LIZL 1WGOA 3PWVA 1DUZB 1OP9A 4U1NB 5DJ8A 4YNYB 3EYSH 4UINL 3MRHB 3GO1L 2BOCB 4YHIB 2D7TL 4HWBL 4QOKA 4BFIB 4F9LC 1FL3B 5AYQA 4H0IA 1YEGL 3T65B 5HYSG 3O6FA 4FQ2H 1JZ8A 2VDLH 3F58H 4G42B 4JN2B 4MXWL 3OGCB 5JIHA 1V8HA 4Y0GA 4PGJA 5IT2H 4EQ2A 4AG4L 5ESAB 5F3BB 1NAKL 1SEBB 2VLRB 1OAYH 4NDMB 3DROA 4X9BA 5D93C 1YEJL 1KACB 1M7IA 1RFDL 3PWLA 2G75A 2CKBB 2X4UA 2ZSWB 3S37L 2EXYC 4P5KB 4P4KA 3A6OA 2C4FU 4J3SA 5E1HB 2UYLA 4XP5H 4XI5D 1NGQH 4U31A 4ELKA 2FSEA 2EZ0C 2OP4L 4IMKC 3RHWF 3VA2C 1H3PL 2IBGA 1NCAL 2F8OA 3L3IB 4ELMB 1WBYA 5BRZB 5C08D 2ICWI 1NMBH 1AHWB 3NPZB 3LQZB 5CCKL 4HS8L 2VE6A 2C3VB 3GBNH 1E27B 2HJLA 5EZIH 2P5WA 4OZ4A 4V2BA 2V5TA 5L88H 1OD7A 3ARBD 4OGAC 1FNGA 5LQBH 1MFAL 2CJUH 1I9IL 3OX8A 4P3WA 5HYIA 2YD4A 2Q7YB 4MQSB 3HG1E 4YGAB 2XPGB 5FK9B 5IV2A 1W8NA 4R97B 1WWBX 3BGFB 2V7HB 3ZHKA 4OF5A 1T4KA 2HLFC 1OAKH 2UY6A 4MLSA 5J8OA 3BPCA 4ZUUA 1G0DA 1UZ6E 1MH5A 4R0LA 3U2SB 4G6JH 5GGVY 4HQQL 2J88L 4B41A 5L6YH 1QSZA 1DFBL 3GK8H 3X3GH 1K6QH 4DZBA 3JVGA 3HLAA 3ZTNH 5HVHC 3T0XA 2R0LL 4X4XB 5I2IA 2A74B 2XWJB 3IFNL 5B3NA 3QH3A 4ZOAA 4NKDB 2YPKA 1IKNC 2GT9A 2D2OA 3STLA 1BM3L 1MFDH 1TJIL 1WSST 4I2XB 3PWPE 3B2UC 5MERA 4HGMA 2IWGA 1RPQA 3UPRA 1HHKB 3NCEB 3RNQB 2DI9A 2X4NB 1KIQA 2VIRB 4KKAC 3LEVH 2C1OB 4XWOC 2QQQA 1CGVA 4L4VB 4H26A 5KVDH 2R29L 3BKYH 4NQDA 4HX1A 3MBXH 5E7BA 3TBSA 4I0PA 2NY4C 1AQDA 2RJMA 3NVQA 5IQ7H 5IR1A 2CLRA 4UUJB 1FSKB 1Z3GH 5FDWB 3VXRB 4FQLL 4IRJD 4F33B 4OCRL 4JFOA 4RGND 3IU3A 1FNEB 3VFSB 4PUBH 1QR1A 2GJ6B 2GTWA 2QLVB 3AXLA 1JYNA 4XNXH 4G7VH 3PWUA 5D6DC 3I02B 3OKMB 3SGJA 1MJUL 1JGUL 3MOBH 3QQ4A 2GIYA 1UKTA 3L3KA 1CICB 3QIBB 1A3RH 2E7LC 5AWNL 4HBQA 1S9KC 2E7HA 2WBWB 3RWHB 1QBLL 1VPOH 4GAGH 3EDJA 5I16A 1VDGA 4FQJL 4XBPA 3MLUL 4UV4L 4LLYA 3ZDZE 5D72H 1PEZA 1RQ5A 4XCYA 3HC4H 1A1MA 1KG0A 5C0DA 5T5NF 3RTQA 2R2CA 1MLBB 4WFGE 2NTFA 4N0RA 5CD5D 3V6OA 4LFHD 4J12A 2LAAA 1JV5A 1NC4D 3LAFA 4HCRL 4LHUB 2I26N 5DT1H 4R7NB 4KGLA 4UDUB 3MGAA 4JO3H 1U92B 4NO2B 4HWZA 3S37X 4F9LA 3EYVA 4WGWB 4OLVH 3PDOB 3DHJA 4NNYB 4X9GA 4JFQB 2DB8A 1MCKA 3BSZH 4JO3L 1N59B 2DD8H 1NCTA 5D1QB 5IGXH 3RZCD 4I77L 4G6FD 2NY1D 3HRZA 5C0BD 1K4CB 3MNZA 1VFUA 1NGZA 5CJBA 3QDME 2ZP0T 2V17H 4PJ8C 5C09B 4G8IB 4X6FA 4N9GA 3RDTD 4YH6A 3G5VA 5B8CB 1F4WH 4M7JH 5L88L 2QSCL 4M43H 1A5FH 4NYLA 2DQIL 3IGAA 2XKNB 4HK3J 4P57A 2JTDA 5K9QG 1BZ7A 4D9RD 3VFPA 5FYKD 1KLGA 3QQ3A 3BYYA 1FZOA 1U8KA 2BSSA 4ZPVA 2NY2C 5JO5B 3W0WE 4JRYD 4TSCL 4UQ3A 4A2MA 1VERA 4XPAH 5F88B 1MUJB 1CYGA 5E2TH 1RHHA 1ZEAL 4OLZH 5HYSA 4M62H 1SJHA 4MXVF 4PP2B 5TQ2H 4E0RA 3RL2B 4HIIA 1JHKH 3RWFA 3DPBA 4L9LC 5I8CB 3KVQA 2CRZA 2AEQH 5DJCB 2EDLA 2CK2A 1IL1B 3H6JA 4Y4FD 4PG2A 4N0UE 1FL3A 1AJ7L 4EUPH 2XTJD 4G3YL 2R0WH 5K33A 3SDXE 2ZCHL 1HHIB 1D5ZA 3GSUA 2XA8H 1I9JL 3MX0A 4UMGA 1CLOL 2AABL 4XPHH 5KOVC 5ADPH 2Z92A 4S1RL 5TE7H 3CFDA 3I3DA 1P7QA 3GMNB 5LCVL 1YNLL 4EEEA 1HIMH 4NQDE 5F1NB 2LVCA 4APQB 4F7CB 4NQVB 5F7YC 2CPCA 5DVKA 4LLAA 2YZ8A 2R2HA 5IP4A 1RZIB 1FNAA 3FOMB 3FQXB 1NCWL 3MRCB 4RZCA 5HJ3B 4Z8FL 5HHNA 2VZ1A 4L5FH 1ZHLB 3QUML 3BO8A 1M71B 5DC4B 1NGWA 4ELKB 4NCC2 1YJDH 4OLWH 1T5XB 3D0VA 4JRXA 3ARZA 4HSQA 3RZWA 3SE8L 5F9AC 1EDQA 1AHWA 3S8WA 5JW4N 2YR3A 4WUKL 1X6NA 3WLBB 3NPSB 4UOJA 5C0BE 3TVMC 4LSRH 4OLUL 2CK0L 4UZGA 4K94C 2EDHA 4JREB 1NBVL 5CEYA 4OZIB 4FTVB 1HKLH 4Y4FA 5BV7B 1CVSC 4I4WA 1I7ZA 2YD7A 5IV2B 3CXHJ 1KPRA 5JR1H 5EUOF 3UAJD 1RY7B 2H3NA 4Z78A 4XMPH 4JQIL 2F8VA 4X9FA 4M6AA 3DRQA 3RVTD 2J6EL 1J8HA 2ADIA 3IDMA 2EDDA 4HLZG 1QYGH 3SCMB 2P5EA 1M4KA 1QVOB 3WYRA 4AL8H 3WHXB 2X42A 1IAMA 2NTSP 3IFOA 4WFGD 2X4SB 5A2KH 1IGYA 2BFVH 1J1OH 3U0WL 5EA0H 2V2TB 4U7SA 3NFNB 1H9VA 5C3TA 2DQEL 1OAYL 4LIQE 4JAMB 1YN6B 3VGGA 4I2XA 4N9OB 3AFLA 3Q1SL 3QQNA 4PLKD 2VDOH 5CJQH 5TDOA 1KJVA 1KJ2B 1MAKA 1SM3H 4Y1AE 3VFRB 3VRJB 4QF1A 3MJ8B 5D7JC 2XWTA 2UZIL 1KB9K 4KJWC 2H26B 1MFEL 4N0FB 4NIKB 4P2RA 2BY1A 3NABL 2UUDK 1WBZA 2P7TB 4Q9CA 2G5RA 4H0HB 4UINH 1S78D 2A6JA 4FTVD 4F7PB 1NKRA 3RZCA 2C1PA 5L8JB 4NQEA 3VJ6A 5MHSD 3QIWC 4ZFOB 5D70H 3CZJA 4H20H 4I0CC 3DBXA 5J6HB 1K9TA 5FM8A 1RZFL 3T8XA 4DQOH 5D7LB 5EUKA 1WAAA 2ATKB 3MBXL 1CVRA 1IT9L 2OJZL 5LGJB 1GGTA 1WZ1L 2ILLA 1I8IA 2BY2A 4PY8J 1CICA 3H3PH 4U6VL 3UMTA 1XCTA 1QKZH 1JMXA 1G7HB 3HR5A 3VFVB 3JV6A 1NGZB 3FCTA 2HRPL 1A7OH 3BISA 1MCQA 5EC1B 3HE6B 4X98A 1NLBL 4G8EB 3TA3B 3U83A 3O4LA 3U6RB 4ALAL 5F72S 5D8JL 5JTWA 2L7JA 3T1FB 5A2FA 2R0LH 3ZYIA 1TQCB 4KXZH 4F9PA 4GAFB 1XMWA 4DZBB 1DR9A 1XGQA 4E5XA 5HGBB 5I1JH 1BZ7B 1UB5B 4OCYL 3SJVD 3BVNA 2R0ZL 2J88H 4QRQB 4XZUB 4OGXH 2E9BA 2X4PB 4U6TA 3MFFA 2HFGL 1INEH 2I07A 4MLIA 4WJ5B 2HH0L 4N5UA 4YGVA 1A1OB 1KEML 2AEPL 1IC7L 3S88L 1KPVA 3LKRA 3VFMB 5KZCD 1AGCB 4PD4J 3SE3C 4I0PD 5I75B 1K2DA 2RCSH 4PP2A 1H3XA 1E4XL 1E6OH 1S7SB 2PCPB 1INDH 2R0KH 43CAB 3QI9C 3OKDA 4BH7A 5GGRA 1RJZB 1IL1A 3GNML 2MNUA 2B8OT 1AP2B 2BNQE 3FZUC 3ARBC 2ESVD 2A6IB 1HDMA 1KC5H 1UZ8A 1TVBB 1E4WL 2X1XR 4XP6L 2XKNA 4GS7C 2FECI 4LCIL 1NLDL 5I75C 1VFBB 1LEGB 4WEBL 1QR1B 4BFBD 4GFTB 4M6OL 2NNAB 1CFVL 5H35B 2ERJC 1XIWA 2PO6A 4K7PL 2DDQH 2WP3O 4XCEB 1WT5C 4YIQA 5BOZG 1A7QL 4U1KB 3FOMA 1IEAA 4HF5H 3VFNB 5C70A 5DWUL 4KY1L 2DN7A 4I13B 5GGVL 2A73B 3KJ6H 4E0RB 4D9LL 4JJ5B 2N7AA 4NKQB 2PR4L 5DGQA 2R2EA 5CBAA 5DDHA 1LE9B 4P5MB 2DLFL 3DTXA 2Q3ZA 3O2WH 5F1IA 4PTUA 4UOW1 4M5ZH 5HPOA 3CFCH 1ROWA 4R7NA 3PP3H 2GFBB 1WCBA 1B4JH 3T08A 1CDGA 1RZ8A 2WBJA 2Q8AH 3RUGB 2CKBL 4OQ1A 4O4YH 4LEOA 4YDIL 2W92A 3IS1X 2P49B 3MRKA 4LLVA 1NC4B 3B8YA 4DGYL 5FB8A 3R1GL 4ZFFA 1OTSD 4X4MA 3ZKXC 5JW5A 1S7UA 4MSWB 3MLVH 1FZMB 4YK4B 3TO4B 1JRHH 1J7VR 1S5HA 4HUNB 4RFOL 1TVHA 4HPYL 5DMKA 4XC1H 3E6FA 4EI6B 3NGBB 3WNNA 4P46A 4K71C 3ZKNC 1CU4L 4OCWH 4OI7A 3W9EA 3FFCD 3T0BA 4G9DB 5HGDA 3B3IB 5DMGD 3QAZB 4HV8B 5I0DA 1V7MH 5FYKL 3EYFA 3V4UL 2GTZB 2DLGA 5HI4C 5JW3L 1CS6A 1GZPA 2OMNA 3F7PC 4AZ8A 1FZOB 1RZJH 4ZAKA 5C0RH 5I73B 1XF3B 5DEFB 3FQRA 3N1QC 1EAPB 5DMYA 1ZHNA 3RUGF 1RHHB 4FQQA 5D9SA 1PSKH 4FQ1H 1TXKA 4P46C 4JRYB 4JJHA 5KVEH 1QEWA 3T2OA 1U8PA 1AO7E 4QGTA 1NC2D 2FHFA 5D5MF 4OFPA 3RA7H 1CXLA 3GMPA 4KVNL 4ZFGL 5DJDB 2FJFB 5EU6E 3GBMH 4PJFF 4BFIA 1MCWM 1XFPA 2AP2A 2FJGB 2Y7QB 1S7XB 2VSCA 1CXFA 1PG7L 1U58B 3T65A 3TN0A 4HJJL 3MLYH 3GSXA 3MZGB 1OT1A 3KG5A 3G5XA 2GUOB 4JFZL 1MCPL 1VGEL 3ZKQD 4Y4HD 3VXRE 3SCMC 5GJSL 2QQLL 3G6JA 3IAGC 4ODWB 3HR5B 3VFVA 2EXWD 4NO0D 1KPUB 4YHZL 5ISZD 1NAMH 2ZSWA 4XNZC 3MV8B 1YNKL 3LKOB 2ZCLL 1KLFA 2ADFL 4MCZA 3RL1B 4QKXB 4G6KL 3QB7C 2MQCA 5C2UB 3RDTC 1URLA 3DLQR 3SY0A 2CGRL 5IJKA 2W38A 2NY5H 4AEHL 4FFWD 3B9EA 1OM3H 4G42A 1A9BB 4JGMA 4U1JB 5I1DB 4KHXH 4U6VH 4U1GC 1KCLA 3L3IA 2NZ9C 3VI4E 2I07B 4FG6D 4JGJA 1AIFB 2WINB 4PJ9B 1ZTXL 2C3GA 3PWLB 4X7CC 5ID1A 5CHNB 2EDRA 1H3TA 3KLDA 4WW2F 1LHZA 1U8NA 1G7MB 2DQUH 4D0BA 3JV6B 3NCMA 5HHQA 3SEPA 1FJ1B 5TDPB 3FN9A 5JOPD 4Q7DA 2VC2H 3FMGL 4HWNA 4X98B 2GW5A 2J6EA 3E3QE 3ARDB 4K94L 5MEPA 3KPSB 1NFDB 4M8VA 4XNUH 5J1AB 5DHVB 5IB5B 1FNLA 3ZL4L 2J7LA 4PJ7E 3V0AC 1BMGA 1TZIA 3IFOB 3GSRA 5HGBA 4Y16D 5I8OH 3RI5K 2WP3T 1AKJA 4NN5B 1GCFA 3EOTH 5IWLA 4LCWB 4CMMB 4PJEB 3T0WA 4GW4B 1A7NL 5IWLC 4M00A 2WBKA 1TPXC 1UM6H 1OW0A 1MI5D 3I50L 3OB0K 5LWYH 2X4NA 4M93C 3UO1L 1A7QH 3RIFF 3NCJL 3F7QA 1ORQB 1UCBH 4E41E 4ESKA 3SO3B 3QWRD 4DN4H 2NY4D 1T5WB 1YPZE 3MODH 1DQQB 4Y4HA 2YK1L 4R4FL 1GGBH 4PJBB 2QL1A 3HLAB 3NN8B 1RURL 5IBUB 1SJXA 3IDXH 5J6HA 2D7MA 1IQWH 4BUHA 5DD3L 5F9JA 5GS0H 1CQKA 5D71H 2VXTL 5C8JB 1PBYA 4WFEE 4K3JH 4PS4L 3RNQA 3CX5J 3GNMH 3QDJE 3QIWD 2E5EA 4EXKA 5HHOB 4OB5H 3GKWL 4ONOA 1U2HA 1QHOA 4OZFH 3IVKB 4PJHF 1MLCA 2VABB 3EYUL 5IK3A 1X6LA 3VH8B 1JL8A 5T1LA 4Y2DB 1U91B 1FC2D 3AC0A 3TA3C 3Q6GL 5I1EH 1FFPB 2WIIB 4UT9L 4KKBD 5T3XH 4FZ8H 2VQTA 1A4KB 1H5BA 2CLZB 3MRBB 2DJ4A 4YXHH 3D3VD 2PXYD 5DRWB 3UTSD 4KVCL 4EDXA 2XTJB 3KPRA 5LG1A 3BRGC 1VEPA 4JLRA 3VFWA 2GHWB 2LQRA 1G9NC 2AVGA 1GH7A 5ID0A 1BVLB 4NQCB 4RAUA 1B90A 4JFXB 3OKLA 3SE4A 4GAYA 4U0RC 2AJVL 5EN2A 5KG9A 5CJOH 3PL6D 1NCNA 1U3YA 4HZAA 1TTUA 5F96H 5IOPB 5DA4A 4ZSOE 4QT5A 4PRHE 3CDGB 1K8IB 4CW1B 3KXFB 5DHYA 1J0ZA 1XF5B 4GBXA 1JGDB 3T09A 4CN1A 4HWEL 4OI8A 1D5XA 5DQ9A 3MXVL 5GRVL 1XF2B 4GRWH 4WNQA 1FNSH 5FHAH 2H2SC 1RJZA 3QZWA 2WM0A 4PRPA 1WC7B 5KSAA 3MXWH 1KN2L 1VKXA 4IJ3B 1QLFA 3KPQA 1QQDB 4HGWA 3I75A 1B0GA 2NY2B 1DP0A 3C2AL 2R56H 2COQA 5CGYC 1HYRC 1IILE 4ODSH 3T0EA 3QFJD 4QOKE 4NCC1 3IDYB 4QRRD 1E28A 5EG6C 2MMXA 2F5BH 1QSEE 3M17A 1DBBL 3BKML 3S35L 5IB2B 3VDBA 4OZFG 1RSFA 4U1KA 1BGXL 4YDKL 1P4IL 3CSYA 2Q8BL 4Y5VB 1MNUH 3LV3B 1ADQA 2PETA 4KJYA 3ESVF 4LPXA 4K9EL 5T3ZE 4NJ9L 5D5MA 5IUSA 3SY0B 1N4XL 4L9DA 3FRUB 3NCJH 2QKIB 5ACZA 1ADQH 3HI5L 2DQEH 4LARH 5HPMA 5IHZB 3UC0H 3RIFK 2R8SH 1K3IA 4P57B 3D9AL 3VI3E 4DEPC 4HG4J 2C4XA 4I3RH 4NM8L 5BVPH 4IDJH 3RJQB 4QHLB 3QPXH 4RDQG 2NY0B 1Q0YL 4FQXC 1S7XA 1LEIA 2OMBA 2C3VA 1YEDA 4JKLA 4QY8A 1G0XA 5SV3A 1H3UA 2HVKA 5IMMA 3VI4F 2I9TB 4I3GA 4ODUA 3EO9H 3TM6A 1MWAL 5JW5B 1DQJB 4Y19B 4BH8B 1IAIH 3DUSA 2V2WB 3SDAD 1YMMA 2HT4D 4LPTA 3W82A 1G1YA 1EMTL 4XVJL 5INDA 3TVMD 5FA3B 1R6VA 4KTEL 3C2SA 4Y4KB 2R2HB 4P5TD 3KYAA 5HI5D 1ZWIA 2PF6A 1BECA 3MLTA 3V5KA 3QIUB 2VC2L 3ZKND 1FFRA 2APWA 4GKSA 2YEZA 4WUKH 5E4IA 3UTZA 2ORBL 1LK2A 4P23B 2H2PC 2VR4A 2R4RL 4YBQD 4FA8A 1YJDL 4GS7B 1JF1B 3BESR 5FHAL 4PRHD 1CGYA 1XAUA 3GDBA 3O4LD 1JZ4A 5DTFA 1JTPA 3ARUA 1U8MB 1N0LA 5KSUA 1TETH 1CFQB 2J8UE 4JO2L 3V7AG 5CS7A 1G6RL 5HHVH 2YC1A 3LKNA 1T20A 2BVOB 5DMIL 2DTML 1CICD 2Y5TB 1AXTL 4L8DA 4YPGA 1DEEA 3C5ZD 4OZFB 4K3EH 1IAKB 5AAWA 4OM0L 1FN4A 1KCKA 2CLRB 5CINL 1TCMA 3DIFB 1O7VA 3FFCA 1TZIB 5DUPL 1N7ML 2Y36L 2HT4C 2YMXL 1G7PA 1KFAH 2FJGA 4ZSOA 3P0YL 4PRID 2SEBB 4DVRH 5CLTA 3QULB 4LVHB 4HG4K 5JMRA 2P48B 3RBSA 3MMEB 2F74B 4L9LA 1NJ9A 4FTVA 3EIFA 3CXDL 2Y36H 5I1CH 2FZ3A 1J11A 4NBZB 3Q48A 1BWWA 1P4BL 2PNDA 1OGTB 2Z31A 1KJVB 2JF1A 3NACH 1CFTA 3MO1B 1A6TA 1J8HB 3MV8A 5D1QD 1F6AB 5FGSA 1JPST 3CMGA 4RQQA 3NCYS 2E7LA 4CMHC 3MV7A 4RISH 2EDTA 4XP6H 3GMRA 1CBVH 4OZGA 4KTDL 1SYVB 2QSTA 5L0QC 3MV9A 3VJ6B 1QRNE 5A3IC 4WHTB 1U92A 4NO2A 5IVOA 3U4EB 3TCXA 4JFHE 4O51B 4ZTPH 1GOFA 2VN7A 3ULUC 2Q76A 1W2KT 2IBZY 3LRHA 1ZLVH 4NKOB 2R56L 1F11A 1FV1B 2B2XH 1WEJH 4K3GA 1K4CA 3MNZB 2YRLA 4KI5E 3C8KB 1MCNA 4PJ9D 4PB0H 3VWJD 1RZ7H 1P84J 2AJXL 5T1LB 1D5XB 3L3DB 4F7PA 4HWEH 2BERA 5ELIA 1A3LL 1FFPA 3VGFA 5IB4B 2BXZA 4PRAB 1JUFA 3RGVA 1B88A 3FT3A 2ESVA 3CXHK 2W9EH 5K9JL 1MWAH 2IMMA 4K3EL 3CH1B 2FH6A 1CFSB 1BOYA 2D4DA 5JOPE 1T1XB 1UA6H 1OOAA 2BX5A 1RUPL 5IHUH 3P0VL 4L8SC 1MREH 3TT1H 4MYWB 4RGMB 5CBEB 4GRWE 2FHCA 2QQKH 5EBMB 3WFEL 4JFEA 1S7QA 1PKQA 4AG4H 3G9AB 4IDJL 2LAGB 4YXHL 1BFOA 2ZCKH 5JOFB 1A1OA 3LS5H 5EC1A 1KPVB 3LKRB 4UV7H 4G8EA 2GK0B 1BBJA 1ZK9A 1LEKB 2I24N 7CGTA 2R4RH 4UNVA 4PRPB 4DQOL 4JPVH 4ZPTA 3MUGA 1D5MB 4P2CG 5C0EA 3L7EB 3MRIB 1BQHA 2X4TB 1RMFL 1CFBA 4CNIB 2F5BL 5M7QA 4OF7A 1FPTH 5D96C 1I8KA 3X13B 4V1DD 1FDLL 1T80A 5KAQF 3U30C 2OSLA 1LP9B 3ARWA 1QLRB 1I1AC 3FQXA 3QUYD 5CJ8A 4LLQB 1I3RB 5HDBE 3WLWC 3TBVB 1MAMH 3TH4T 3G08B 1ZWIB 1M71A 1UCBL 1NCUA 4N0YH 4OUUB 3SKMB 4NM8H 4I3RL 4HUXA 1BX2A 5MHSE 3I2CL 2XTLA 1TVBA 2I25N 1X9QA 2EIZA 3IB4A 4XP4L 4Y2DD 4GXUN 2OL3B 3JVGC 2ZZUT 2DWDA 1GC1L 1K6QL 1T2QL 3MLWL 1JWMA 4NKIL 3BIBX 5JHDD 3TV3L 1UXWB 1T89C 5C6TL 2CDEB 1LMKA 3D3VB 2AV1B 5CP7B 1H3VA 2Y1VA 1RUKL 3NA4A 4XAWH 6CGTA 1MHHA 4NPYA 1L0YA 1FGVL 5HHMD 3V52H 3BZEB 3BH9A 2V2WA 1DE4B 5JHDA 1OARH 3VG9C 1H15A 4K7FB 5I1HL 4PJFA 1YY8A 2H3NB 5C0BA 1AR1C 5EOCH 3QCVH 1Q1JH 5DHXB 1CLYH 3Q6GH 1JGDA 1RULL 1UH4A 4P9HH 3TO4C 4P5MA 4GRLC 3IDMB 3RI5F 2ADGA 3JWOC 5FUOL 4LMQI 3E6FB 3QBTB 5EBGA 5L2JB 2AKRA 1CQYA 2BVUA 3HNVH 1IGYB 1Z0MA 3VD7A 3MXWL 4Z7VA 5HGDB 2NLJB 3QUYA 3O2DH 2VJXA 4O2CA 2VXSL 3MR9A 4W6WB 4LFHG 4ZQKB 3ECBB 1KTLB 1G6VK 1BIIB 1N8ZB 1U95A 2CXKA 3DSFH 2YD1A 5I15H 1OSZA 5GSVB 3QSKB 4P4KC 5T1KA 1HZHH 1FO0L 2XKUA 4PJDB 1R5VA 1DBAL 1SHMA 4KK6D 3VRLE 3MO1A 2DM3A 4XPFH 3D1MC 2RHEA 3C8DA 2FL5B 4ZXBD 3T3ME 2Y5TA 3S98A 1YEJH 2BNUB 4EQ3A 5D9SB 1V3MA 4KKCC 1AQKH 5SWSB 5K9KA 3LKPB 1AGFA 2K1MA 1EAJA 4U3HA 2GY7B 1PKQE 4JRXD 4KK9D 5D7IA 3KYOA 5EU5B 3QP3A 1S78C 1KENL 1SM3L 2F8XC 1DLFL 2XRAL 3LS4L 2VDOL 4XT1C 1S9XA 3MLYL 4Y4HC 3QG6A 4Z7OF 1U93A 4L4JA 5DEFA 3UBXI 5EOCJ 3MV01 4BQ8A 1ZLVK 1G7HA 3BW9B 5E1AB 3GHBL 5TE4H 1JPGB 5C1MB 3OXSB 1UFUA 2FIRT 3P4MA 3W5MA 2QSVA 5ENWA 5GHWH 2EKJA 3RIAF 3NTCH 3PWPA 1MRCH 3IDXL 3U9PH 3MV7B 3QIBC 3SQOH 2FJFA 2IAND 4MWFB 4RFNB 1FAIH 5FUCE 2QSCH 4F80A 2EDXA 3OAZH 5INCB 3TN0C 3WXWL 5I6XC 4DGVH 1EO8L 4Z5RB 2X41A 3WN5B 3CDYA 1UEMA 4WJ5A 1MCIA 2FEEL 5F3BA 5HD8D 3H9SD 3LQZA 3N85H 3SGDH 4ZMAT 3EHBC 2CKBA 1BFOB 1LO3H 5E00B 3VFUA 4KK6C 4CDGC 3W0WD 5IMOB 4U49A 4ODHL 3NCYP 1U8IB 2YPLD 4EI5A 5D7IF 1UJ3B 4OGYH 5B39G 3VG0L 3UYPA 5FK9A 4OJFL 5J11B 3MNVA 2X7LB 1YQVH 3UJJH 3FAWA 1I4FA 3QG7L 4OGXL 2P5WD 4JM2B 3D18B 4OCNC 5DT1L 4MNHA 5FKAB 2R0ZH 2H32B 5BRZA 4X6BB 2ESVB 1HILA 1MCCA 4LGRB 4R3SB 1BF2A 3SBWA 3U82B 2L7UA 1GGIH 3QR2A 3O4OC 1AH1A 1KIRB 4K07A 3RDTA 1EEZB 3OF6D 1D5BB 4N1CA 4XGZA 5MERB 1I8KB 2F19L 3FO0H 4LEXH 1KF9B 2WUBH 1NPUA 1C1EH 1TCRA 3CVHH 1NLBH 4LGSB 4QHNB 3LN4A 3QEGH 1U8NB 2AEIT 2H6PB 2JELL 2YN3A 3VFNA 4L4VA 4OV5A 1VFAA 1U8LA 3VXME 1UWGL 3G04A 1UG9A 3P0GB 3G08A 3KJ4C 4BZ2L 3BWUC 4M48H 2NY7H 2X4RB 3IJHB 4HC1H 4NZUH 3QFDB 4U3XA 3VXQB 3DTXB 3PQYE 3EDDA 2YXMA 1E6JH 2OZ4A 4HPOH 1H8NA 5CKGA 2A74A 2XWJA 4OBRA 4RDQF 3H0TB 5T1DH 3OKMA 4HC1L 4NZUL 1T1YB 1NAML 3MGTB 3FHAA 5HY9B 4AENB 3HUJB 2Z8WC 4N68A 1FBIH 3B2UD 1S5IL 1OTTC 2GTWB 3RGHA 3RQ3A 1A14L 2C3WA 3QAZC 2DKSA 3WD5H 4NHUB 4H26B 3ARED 1NBQA 3K1DA 3PHSA 5FOBB 1NCDH 2EYSB 3S9DB 1MFDL 1TJIH 4NQDB 1P7KA 4RMUA 2BJML 2A83A 5IVXB 3Q1SH 2I9LA 2YD2A 3VH8A 5L2JA 5DSCA 3O3BB 2PYFB 4OF6A 3DRTB 3V8CA 3P11H 1GGIL 4QRPD 4XCYB 3T0EC 4HV8A 3QWQB 2NTFB 4H1LA 2H2SD 3DVGA 5JW4Q 3V0VB 1DJSA 4MQ7B 3MR9B 5C0ND 3PWUB 3UTPE 3IAPA 4JFQA 1QLEL 2VLME 2CDEA 2J6EH 1HI6B 1C08B 3WBDA 3MJ6A 1EJOH 5ETUA 2ZOLA 3ZO0A 5DUMH 4J3OC 4JQVA 4X6CF 2VLJB 5EN2B 1Y6NR 5FYJL 2VLKA 3MC0A 2FHBA 2ZUUA 1BQSA 3CC5A 2EDOA 3H3BC 5HYEA 1GIGH 1MLBA 3F6IA 5FO8B 3S7GA 4CVZA 1NCCH 5EU4A 4GBXB 2UWEF 2FCBA 1EFXB 2WBJC 1D5MA 3C60A 4LPCA 1IFHH 5ESVB 3PDGA 5GISH 1MRCL 2FWOB 2VKXA 3QG6B 3EYVB 2VDNH 3MRDA 4X6DE 5D6CA 2CR3A 1EERB 1SYSA 3T0EB 4L3AA 5HGGS 2HVJA 5JHLH 3D87B 3ZTJH 5JDSA 4C58B 4QRRA 1LD9B 1CDCA 3NIDE 1KC5L 4HH8A 4U0QB 3VXUD 4R2GC 5IFJB 2YA0A 5IQ7L 1YY9D 3P4MB 5IT2L 3ZE1E 4GUPA 1ZS8A 3F65A 5I0ZA 3P2TA 4JFFE 3LKPA 5ICZB 2DQCL 2FATL 1OQXA 1AGFB 5GRUL 3TNNA 5KSAD 4MWFA 2ZPKL 3K1KC 3O3EA 1RJYA 3TYFB 1X5KA 2HKFL 4LCWE 2R0WL 1EEYB 4CADA 1R5IA 2BSED 5C0FA 3WN5A 5EIVA 3UYOD 4ZPVB 3QQ9C 3C6SA 4XWOD 3VGAC 3TGXA 5EUOB 2V5SA 4Q6IA 1JTOA 3U46A 4CAGA 3QISA 1MCBA 1QFWI 2VZ3A 3CFDB 1RZIA 2LE9A 2P5EE 4WI9A 4PJ5D 4ZOBA 5FEBA 5D7LD 2CXGA 3DGCR 1SJHB 5HHQB 1D9KD 5FCSH 5JHDB 1OGAA 2P24A 3U48A 4XPGH 3BO8B 5E2TL 4O5LL 5I15L 3IKKA 4C56B 5L6YL 3BRFA 3ULUL 1T5XA 2MCPL 4I3SH 1P2CB 4QXUL 2QKIA 3B6SA 3O6FD 4MNHB 5FKAA 4JVUA 5BOPA 2A38A 1QKZL 5JXEA 3OAYH 1ZLSH 1UH3A 4M1DL 4POUB 2DQIH 3LKQA 2AERT 3GIZL 3WLBA 3LMJL 1TCRB 3OB0H 2GKIA 1CZ8H 3C5ZC 1QZ1A 1A7RH 3LOWA 4GG8B 3U1SH 4BH8A 4HS8H 2YHGA 3RAJH 3SDDA 4X7DC 1OSZB 1PAMA 3J7HA 2Q87A 4HDIB 1FGVH 3V52L 1KEMH 2AEPH 3WUWG 3QIWB 1R5VB 3WNOA 2H1PL 5J11C 1ZV5A 3HRPA 2NZ9D 3S36X 5JORA 4I4WB 2VDQL 2OP4H 4JDTL 4LSSH 3P3YA 5DR5L 5JQHC 3IT8D 1GC1H 1T2QH 2AQ2A 4OFYD 5HDOA 4XCCH 3C08H 5C0AD 3DXAD 1BVZA 2AXHA 1LO2H 1R0AH 4KPHH 3PGFL 4JEGB 5ITFB 2CUHA 1F4YH 3PE9A 3X11B 4JCLA 3ZKMC 4ERSH 3DO3A 5IM7B 4N0YL 1FCCA 2ZNWA 5TDOB 4ZSOB 3JXAA 4LKXB 1IM9D 4UV4H 3ILPB 4WHCA 3EAKA 2H26A 4LCCB 5ALCH 1RU9H 4U2YA 1FFOB 5GS2D 5T3ZD 5JXED 1YEGH 2P43B 2Z31D 2A6JB 5D2LF 1AD9A 4M1CD 4OFKA 1A02N 5HI3C 2VDQH 4PJEE 3SCMA 3T0DA 3K4DA 4M62L 4Y89A 4CBPA 1I1FA 4X0KA 4QOKB 5FIEA 4NSKA 4RSVA 4XVSL 5D7LA 4L3EA 4LSRL 4K3DH 3UTSB 5GZND 1HI6A 1QR4A 4YWGL 5CD3A 2NY2D 3BT2L 2WIMA 3BP4B 4W4NA 3GIZH 5DJYA 1IC1A 4WIQA 3EDKA 2Y25A 3SOBL 2EYRA 4I1NB 3RUGE 4NKOA 2X4UB 3LQAL 1EHLH 2NXZC 2VXVH 3D85B 2R15A 4DK3A 1G7LA 3CDCA 1XF2A 2BNRB 4LLWA 5E08L 4JREC 4WV1C 1TJHL 2R23A 4NO3B 3ARXA 3VXSB 5EA0L 1SYVA 5DMGC 3D18A 1XGQB 4AK1A 4E5XB 3GM8A 2J8UF 2DD8L 5D93B 3H9HB 2PUQT 4NKMA 4NGHH 1FG2A 4Z0BL 3TYGL 4KDVA 1XR8A 4XBEH 2Q76B 5DXWA 3O41B 1WWCA 1A3LH 3BP6A 1EO7A 1NMAH 2HG5B 3BH8A 5DJ2B 2VE6B 2VLRE 5HSFA 1FV1A 2ZUVA 2AJXH 1HNFA 4KRMB 2AGJH 4QRRB 1CFNA 5LVEA 5EBMA 4JFEB 1OTSC 1WEJL 1FC1A 1LK3L 1I85C 3HC4L 3RRQA 1IZJA 1BIHA 1QSEA 1PVHA 3HE6D 1RZGA 2NYYC 3OXRB 2A9NL 4X80H 1QBLH 1VPOL 3R4DA 5ACZB 3TYFA 2VB5A 5T1MB 3QJHB 3OPZH 1GPOL 3SE3A 4ELME 1CLZL 3I9GH 3OKKB 4UT6H 1CFSA 2C4FT 2A1WH 5E4EB 1J1XH 1QD0A 5EORL 4RGNB 2VDRH 5EO0A 2QQNH 1JWUB 5CBEA 4WVRA 4FXGA 1FLRH 3SKUD 2FJHB 3MGTA 2NZIA 1NGQL 1CLZH 1IGMH 3R8QA 3BRDA 4NRYA 1JHTA 3RIAK 1A5FL 3CX2A 4MDJB 1C7TA 2CSPA 5IMLB 1T22A 3MRPA 1BPVA 5GRYA 3KYMB 5TF1L 2MHAA 4BQ9A 4MNGB 1D6VH 5F1IB 3QT2A 3V0WH 1I3RA 2A77H 3KYNA 4M7LT 5C0EB 5IW6A 2HWZL 4JPWH 3RKDC 3AMKA 3DRTA 2GYSA 1WWAX 3LQMA 2GFBA 4FQ2L 3QFJA 4HCRA 5DJAB 4PJXE 5F7UA 2F5AL 4JM4L 1R5WB 1W72A 4S10A 4IOFC 3B5GA 2Z4QB 1A9EB 4PTUB 3MRKB 1X7QB 1PEWA 3GSNA 2Y6SC 4ZO6A 1FVDA 4NUJB 5BV7L 1FVCB 2XXMB 1JWSB 4ZS6D 1AO7A 4XCEA 1YUHA 1ZT7A 4E42B 1S7VA 1SY6L 4I0PC 2Q86A 3VD5A 5J9PA 2XA3A 2JB6B 3THMH 4LSUH 1KGCE 5AD0B 5B22A 4LIQH 3MA9H 4YHNB 5M94B 1J10A 3V6OE 1DE4A 4L3EE 1DEEB 4WWKB 2VDNL 2BJMH 3VXOA 5FECB 4FFVC 3RTQB 1FN4B 2KZWA 2VISB 3EYFB 3NAAH 3JBG7 4EIZC 1JWMB 3RUGA 3L6FB 3N85L 2OXHA 4WUUD 4ZAKB 1S9YB 3GRWL 5F1OB 3D3VA 1EFXD 4RIRB 4JZJB 4PUBL 5A16A 3QWOA 3BDXA 3HNTL 3JV0A 4NPYB 4OF8A 5FYJE 5JIIA 4G6AC 1F3JA 2IJ0C 4U6HB 5BJTA 2D7OA 4GMTL 4GKNB 5AZEL 2HTLC 2EKSA 5DRXB 3VRIB 1OAQH 2M1KA 3FT2B 5C0CA 3Q2CA 5ILTH 3JWDC 3LRSB 4OLVL 5FGCB 4Y7MA 4P46B 4HXAL 3D69B 4NUGL 4PJDA 2FO4B 5IESL 3W9EB 1N6QH 3HZMB 3S35X 4NOBA 4KU1A 3VWJB 3BN3B 3BEWB 5TFSL 3ULVE 2XT1B 2YPLA 4EI5D 1CT8B 5J06A 4LRNH 4CU8A 3T4AB 4EN3A 3S5LG 4FFWC 3ES6A 4JPIB 3W0WA 4MAUL 2E9IA 5F93C 1ULVA 3QIBD 4HGKC 2W0PA 4KRPC 1C1EL 4I18B 4Y16C 1MIEL 4OM1L 2GI7A 5EWIL 1M7IB 2HMID 4NP4H 1QSVA 4XCCL 4YXKH 1TNMA 4YDJB 3NMEA 3DV4A 4P5KA 3U79A 4YHLL 1JGUH 3MOBL 4PREA 1WFUA 5I66A 4JDTH 4HKXB 3QDJB 1CE1L 2DQGH 2BNQB 5C09E 1MCSA 2RIKA 5K9KB 1J1XL 4XVSH 3BQUB 4OJFH 3V6FA 4NO3A 1OTUD 5LXGL 1FYHB 3QUZA 4XVTL 4PG9B 3RWCA 2P46B 3RAJL 3FT3B 4HPOL 3HAEH 3TJEL 5FYJD 3U7WH 5DUBB 2A9NH 3KWWB 3O9WB 4KDTC 3QNXA 4Z95L 3MROA 4C56E 1VENA 5T5FL 1FL5A 1OAZH 4G6FB 1DBML 2ZWLT 5CCKH 3N50A 4GG8A 2R9HC 1ZGLP 3HCVB 5HI4D 1FJ1A 3FL7A 4OD1L 4KKLD 1Q9KB 1UVQA 3OXSA 1A4JB 5AZ2L 2OBGA 5CJOL 3E6HA 1QRNB 4EOWH 4L3ED 1BAFH 1LEKA 1MCEA 2XZQH 4XTRD 1OW0C 2OYPA 4L1HA 2ARJA 2H9GB 1DBJL 3KXFD 4L8SA 3OAYK 3SCMD 3O6LH 5DVOA 1A9BA 2E6PA 5DR5H 4H8WC 3S36L 2WUCH 1HE7A 4JM2A 25C8H 4Z5RA 5EO0B 3ZDYF 5DK0B 1RIUL 3JWDH 5EZJB 1J5OH 3DX9A 4M7KH 4K2UH 3STBA 4HIEA 4WO4B 4MXWH 1O0VA 1YMHB 4WU7B 3C9NB 1R3LB 3HMWH 2VDPL 4NRYB 2G5BB 1I1RA 1JFQH 4YUEH 4DGIH 4PJGF 4LCCA 4X9HA 1KN4L 2D7TH 4HWBH 3CVHB 3QI9B 4HUKB 2VYRE 4W4OC 4Y4FB 4FQIH 1T5WA 1X4ZA 2B4CC 3ARGB 4CKVX 2V6HA 1P9MA 3SN6N 4X5LA 1FO0A 4DWHA 1ZLSL 4Z78B 4LRIC 1LE5B 1AQDB 3ARFC 5C0AA 4EBQL 2H32A 1IGJB 3VCLA 3FO9A 2LU4A 3HAEG 4R4ND 4PV9B 3QYCA 2DAVA 4HFWA 1H3PH 1S8DB 4ZOCA 4AEIH 4D0DA 2LTQC 4LASL 1JZ5A 5E9DB 1ZE3C 3NH7L 5HHOA 3MODL 3L3HB 5GHWL 1QACA 1D5IL 4FXGB 4BZ1L 1F58L 5IJKC 2R2BA 3SDDD 5ANME 3WLWD 5DJYB 2NY0D 1MHHB 1G84A 4NZJA 3I6KB 2AJYH 2JLLA 4G8FA 4LNVA 5D4QA 4PYHA 1YY8B 3VFRA 3VRJA 1MQKL 2O93L 4YZFE 3TBTB 1B0WA 1T0MA 2BSTA 3PV7A 4JZJC 4OIAA 4GG6B 1KTDA 2HAZA 5HHPA 4P9HL 2MQ0A 1U3HD 5IK3B 1W8OA 1DQMH 3C60C 4CU6A 2ZUXA 3U4AA 2Y06L 3BHBB 2IH3B 3RVVC 1QA9B 5AAMA 4GAJH 5DGRA 2VLRD 5F9JB 1KCUH 3MRRB 3WIFA 1FQ9C 2OJEA 1AD0A 2KH2B 3KDMB 1SBSL 5TQ0H 1MREL 5HY9A 3SJVB 3BP6B 4OCSH 4QXWA 4F58H 3LPFA 2XQBL 4JM2C 4QWWC 2IF7A 3MJ7A 4LAQH 4Y2DC 3T0VA 3FKUS 4RWYH 1JRHI 3UPAA 5EIQA 1MLCB 2VABA 3U1SL 3BWAA 1X5XA 4JKMA 1NSNH 1OCWH 2YD8A 1DQLH 4WWKA 2K9UA 1EGJA 1IFHL 4APQC 2PYFA 5DHYB 2QHLA 4WI8A 4U2ZA 1CT8A 1KTKE 4MNQD 4IOIB 5EU4B 4NNXB 2WBJD 5T5FH 3EO0A 2XIDA 1KCSL 5D1XA 4JFXA 1I7TB 2RAMA 4UQ3B 4X4ZA 4OQTH 1T0PB 4U3CA 4XNMA 1PQZA 3BKCH 4WCYH 4O9HH 3L95A 3W2DL 3RTQC 4KC3B 5B39B 5I19H 3WIIH 3MRLA 1MFBL 3VFGL 4WHYG 3X14B 5DRXA 2BP3A 2HVJB 2OS7A 12E8L 1ZT4A 2DQGL 4R96B 1MCPH 1HHHB 1VGEH 3PWVB 1V5JA 4PJDF 4UIKH 2WZPD 2LVEA 3MRHA 4GW5A 2ZPKH 4FP8L 1B0GB 1HHIA 5EU3B 2WANA 5H94B 5TPWH 5ACLA 1MIEH 5M95B 5JW4R 3MRDB 1P7QB 4D0CA 3GSNB 3VWKB 2JCCB 2OTWB 3FB5B 4F15C 4TQEL 1F6LL 3ORJA 3PP4H 3ARFB 4GJTB 1G9NH 3GGWB 1TENA 1UM5H 2CR6A 3SDCB 1YQ2A 1QOKA 4YDJA 4PGBB 2JB6A 4IRZH 3S4SB 5K9JH 2BMKB 5CINH 3S4SG 5IFJA 4XB8A 4KI1A 3WEXB 2DYPB 4HEPG 5E2UH 3BZFB 4N8CH 1CF8L 3MFGB 5HGHA 4Y5YA 5DD1H 5SV4A 4LVOB 1ZS8B 1F2QA 2DIJA 4PJBE 3QIUA 4M7LL 1OAQL 3OHXA 4HKJA 1U8JA 2NW3B 2Q20A 3STZA 1KGCD 1HILB 4JM2D 2HJKB 1QFUL 2YSSA 1KIRA 2V5YA 5F97E 1U8OB 5IKCA 4QY8B 5DO2D 4NCDA 2HVKB 2GITA 1S9VB 4WW1A 5HHXL 3K2UH 3SGKC 5DEZA 2NXZB 3QWOB 2W0FB 2Z35B 2VOTA 3MV7E 3LDBC 5IG7A 2YOCA 1VFAB 5FYKU 2WWKT 4AT6B 3FT4B 5DTFB 2G2RB 1IC4H 1QRNA 3MRQA 3T1WA 1TVHB 2F58H 1IAKA 3G5YA 1OAUL 3CMOL 4XHJD 1ZLWK 2FX7H 3DIFA 2H8PA 1PY4A 4YPGB 4H25A 4NQDD 4R6UA 3O11A 5GIRB 3T4AA 4EN3B 4JPIA 1MRFL 4BK5A 2R39A 1T1YA 2QJDA 3FO2A 2F53D 4PJAE 4S1DD 5EZJA 1W72L 2YPKB 4DN3L 2XN9D 2IPUG 5IVZA 1GZPB 2V5MA 5CJXA 2H45A 1Z5LA 2YUVA 5F7EH 5DWUH 3VW3H 3TZVC 2OR8A 3A0OA 1N7MH 3DYPA 4S2SA 4N0FA 3HI5H 2ESVE 3RVTC 3LKNB 3UJIL 4OZIF 4ELMF 3RWGB 4U7KA 1L4IA 4WFED 3D5OF 2A83B 5IVXA 4RWHA 1CFVH 4DFHA 4NC2B 4RGOH 1PYWA 5DJXB 4LVEA 4JHZA 1P4IH 4Z7WF 3LHPH 4FMKA 4JO2H 4KAQL 1CBVL 3MLZH 5CILL 3GJFA 3SDAA 4UUJA 4D0DB 4N1HB 2YUWA 3SPVA 3QXUA 2RB8A 4BZ2H 1OTUC 5DRZA 1J87A 4D9RE 4ZUSA 5FUZH 4LLMB 2JKXA 1Q72L 1KT2A 4R90H 4BYHA 1G7JA 3MOQA 4JPKH 1CL7L 1DEDA 1VADA 3EYOA 1J12A 3ZE2E 4OIIH 3P4NB 2JB5H 1XEDA 4ETQB 3DO7B 3HUJF 5FKPA 3D0LA 3IYLW 3CVHL 4YQXH 3RWEA 1UQSA 1HINL 5HI5C 1B0RB 5I18L 2EYRB 2HH0H 5LBSH 2UVFA 1ZGLM 3CNKA 4HKZB 5I1HH 4PJCB 4RMSA 3D85A 3SDAC 1BFVH 2BHUA 1EFXA 2VQ1A 3GMRB 5TE6H 1EMTH 4XVJH 2BDNL 2VLKE 2FBJH 4QTHA 2FYYB 5CGYD 4WUUA 4XTRC 3SDYL 1XH3B 3PXJA 4L3EB 3LY6A 2UWEE 1KLUB 3QDAA 1OSPL 2HT2D 4TULL 4LU5H 3QEQE 2D0HA 1X5JA 5DO2C 4UILH 2WWMD 2DTMH 5CWSB 3WFDH 4U6YA 4GLRH 2XQYG 4XWGL 1R3LA 2HG5A 3BH8B 5B39A 5ID1B 1ITCA 2IPKB 3B9KD 2B1AH 2IAMC 5IFHH 3WKML 1S7QB 1ADQL 4DKEH 1ZT4B 4R96A 1A7PH 5EPMA 4WWID 4DW2H 5I1EL 1MRDL 3BZ4A 3JWOL 3UZEA 1AGDA 1MJ8L 2R23B 3LZFL 4UT7L 1LE5A 4MD0B 1HXYA 3HNVL 4WWKD 4GW5B 4GSDH 4YDKH 5K59F 2HMIC 2XNAA 4Y1AD 3BDBA 3PL6A 4ZXBA 1IGFL 4MXQD 2LU3A 2JCCA 5E9DA 4N8VG 4JG0H 2DJUA 5EBLA 1P5VA 1RZJC 5J7CC 4DAGL 5JUEL 5MEQA 3MLRL 4CNIA 4NKDA 4DKDC 4YIQB 4JZOA 5T3ZH 3MBEC 1PGRB 4ORGA 3UPRB 4OI9A 5GGRY 4S1SL 5KSVA 2GK0A 1BBJB 2XRAH 3LS4H 1HHHA 1MRDH 3JWOH 3CCHB 5IBTL 1QPXA 1IKFL 5F9DC 3I50H 1MY5A 2ZKHL 3H42H 5LWYL 3MCG1 5A43C 5MI0C 3BHBA 3BZDA 3GI8L 3QEHA 4KJPC 4ZDHB 4WI2A 4MCYB 1T83C 3BE1L 3QDMA 3MRRA 3WIFB 4ERSL 3GSUB 1DZBA 1A6WL 1HQRB 4GG6E 4ODBD 5DFVD 1DBAH 1NH6A 5GJTL 4BJLA 2Z4QA 4JDZA 1MVUA 3HNSH 1SVCP 4JFFB 4WRLA 2C5DC 2EH8H 4TOYH 1S5HB 1H15B 1JF5A 4HDIA 1HKLL 4H5SB 2EECA 2IQAB 5C0IB 3TBVA 5T3XL 4K94H 4HUWA 4LOUD 3IDGA 5ERWA 5LBSL 3D25B 1HH9B 1A6PA 3EJJX 3BMVA 4M6NL 4Y2DA 3SKMA 4XCFH 1HINH 1U91A 3P4OB 4XMLL 5I8KH 3VGDA 3TFKD 3WO3B 4UT7H 3X3FH 1U3ZA 4XCFL 3N1FC 1KN2H 3X11A 3FO2B 5DYOA 1RULH 2E9WA 4ZQKA 4QWWD 4IBLT 1NBYA 5C71A 4NRXB 1Z2KA 2EC9U 5EB9A 2VXTH 2M26A 5K59E 4NQCA 4RAUB 5DQJA 1NCWH 4Z8FH 1AKJD 4DUVA 1OT2A 5A16B 4X7TA 5IHUL 2W65B 1FORL 3UXFA 4JFFD 3KXFA 3RPIA 5J13C 4HUMB 4HIXH 3P9LA 3PHOA 5JXAL 5TE7L 4F8QA 3BPOB 1KCVL 3FRPG 4XI5C 4P4RB 2DMCA 2VISA 3MACL 3CDFA 5SWZD 4N8VB 3CXDH 3VXUE 4UDTB 5I1CL 1IM3A 5J57B 2GSGB 2NY0C 5FHBH 3HZMA 5HYJD 5KVFH 5LGHH 3V4PL 4O2CB 1L0XA 1U93B 2HFFA 4FFZL 4YHMH 4WI4A 4ZS7L 1BFTA 2V9QA 4HJJH 3VFPB 3LD8B 1XCQB 4U6XA 3ARFA 4X8XA 5IW1B 4M3KB 1Z5LB 1U8KB 3RP1A 8FABB 4Y5XC 5GPRA 1N6UA 2IAMA 2YN5A 5CSZB 3GKWH 4YHPA 1JYWA 4P2OC 5ENWB 1RUAL 3OAUL 3RWGA 3HFMH 3ZSSA 4J7RA 4MQTB 3A6BH 4JHWL 5E1AA 1BREA 4M8QB 1F4HA 3RGVD 4HIIB 2VQ1B 2VZSA 3BEWA 3ES6B 2DIAA 1R3HB 3KR3L 3GUTA 4OT1L 4CVWA 3L7FB 4MJIA 4OLYL 3MCKA 4FG6C 4O02H 2X1PA 3B4NA 3VXMA 1I1YB 1WZLA 5DRZB 1KV3A 1QFWH 4OFYA 5D1ZC 1M1SA 1HHGB 1HWGB 4PLOB 3ZSTA 3PQYA 3FQUB 2FIKB 3Q3GB 3UBXB 3EUUA 3KPPA 3BXNB 1RK1B 2KKQA 1RUPH 2NXZD 4G6KH 4UQ2B 2IFFH 1BEYH 5INDB 3QUZB 4X6CE 5FYJH 4PG9A 1OSPH 3S96A 5CP3A 3DNKA 1G9MH 5F44A 5HHME 5DUBA 1LO5B 3OJDB 4N0UB 3GSRB 3G6AA 2FYYA 3L5IA 3SGKA 3WO4C 2BCKB 5EU6A 2IFFL 1G9NL 5C9JA 1EGJL 1FL5B 1MHCA 3F62A 4P23A 3HTLX 3QPXL 4XZUA 2IPTH 1PG7H 4NQEE 1UB6B 4Z7UE 4MS8D 1A4JA 3G04B 2LABA 4PJIF 5HI3D 4R90L 1YMHA 2ARWA 2RR3A 3DX8B 4WU7A 1UC6A 3WSQL 1V3JA 2EDNA 4RAVB 3IETA 3QRGL 4MNGA 1VGKB 2VO5A 4IRJB 3QO0A 5DD6B 3KS0J 4OLXL 5ICYB 1QFUH 3HR6A 2Y5EA 4BH7B 2DWEA 3GMOA 5IB1A 4ETYA 3MLZL 5CILH 4KI5C 1PSKL 4FQ1L 4X6BA 3RVUD 4NQXB 2ZG2A 1NUGA 2GAZB 4HMDA 3IJHA 1A8JH 3MA7B 3K4ZA 1Y0LA 3BYTA 5C8JA 1FSKC 4FTVE 4GOSA 2CIIB 2XZAH 2VDMH 2PYEB 3CFJA 4WEBH 1INQB 2NNAA 5BZWB 3TZVD 4JAMA 1S7VB 3KLSA 3QXAA 1C7SA 1V7ML 5FYKH 4OZIE 4F7EA 3TT3L 4J3VA 4N0CC 4EVNB 3IDGB 4YR6A 1NUDA 4NC1C 7FABH 4TUOA 5IFHL 4G8FB 4K9EC 4RGNE 4ZD3H 1NANH 1CFTB 1BQHG 5FOBA 2EH7H 1T2XA 2EIBA 5LJYH 1INDL 1A6AA 3WFDL 4HIJA 5IROA 4PJ7A 3D48R 3PQYD 4PV8B 4P5TA 4PLJC 4MJ5A 2CRYA 5KSAC 4YDLB 3U7AA 2F58L 1TJGL 3QUXD 1SBSH 2P8PB 1XIWD 2PO6D 12E8H 1T7VA 3QRFM 1F6FB 5JIKA 1WUNT 2E8YA 4AYFA 2Q8AL 1KYOJ 2ZOKB 4LSPL 4LHJB 2EKSB 5LGJA 4NHUA 2IANE 3CC5B 4JFDB 5D8JH 3PNWA 4HAFA 5I1LB 4OQTL 3LH2H 3WS3B 3LSOB 3TZVB 4KMLB 4HMCA 4LHQB 5C0RL 1HH9A 3BZ4B 1MHEA 1T21B 1YYMH 4HLJA 3RNKA 2FDBP 1PJ9A 3RBGA 4QYOB 2FEDC 5D1ZA 1BLNB 3HE6A 1BWMA 5GRJL 4UIMB 1ZLWH 1AE6L 1Z9SA 2G9HA 4U1GB 3B3IA 3T1FA 3KDMA 1CU4H 1X44A 3PGCB 4OZHA 1EO8H 5CGTA 5BQ7B 2NXYB 1C08A 4OD2B 3BD3A 4OT1H 4GH7B 4IOFD 3UTQA 1NLDH 3B8SA 2WQRA 3WL9A 5GJTH 1XF3A 3V8OA 5HYFA 3ULVH 4BKLA 3VFMA 4NWTH 3V79C 3HN3A 1RUAH 1N0XH 2CKBH 1KN4H 4YNYA 1HSBB 1T2JA 1N5YL 2BOCA 4N8VA 2XFXA 4LCWD 4FP8H 1N4XH 5D2LE 1R5IB 4M02A 2GSGA 4B7LA 4ZDHA 2EC9T 3EO0B 2FWOA 4CVUA 1KUMA 1N5AB 5EUOA 1J5OL 1Q0XH 2Y7QA 4NNPL 3O9WD 1FRGH 2F53E 4J4PC 1IAOB 3EYUH 4PG2C 3DURA 4MNGE 1DQJA 1PG7W 4Y19A 5IW1A 4LVOC 4WDIA 3IU4H 3KJ4B 2FD6H 2NY4B 4Z0XA 4XP1L 1PKOA 2XWBB 3D39A 3RWDB 2IQAA 4YEEA 3HPJB 1QPPA 4ODSL 3HE7D 4GUPB 3QO1A 4JDVA 3O8XC 4YHYB 1CN4A 1WFNA 5HGHB 4Y5YB 4Q9QH 2O5XL 3C6LB 5FV2A 5IHLB 3DSFL 4PTTA 5KAQG 4KRPB 3H3PL 4DN4L 3FB5A 4N8PA 2R69L 1NSNL 1OCWL 1U2CA 3GJFK 3C09C 4QRUA 4K8RC 3ILQC 1OF2A 4LSDA 3BDYH 2GJZA 2YD6A 2VDPH 2RCSL 5I8KL 3QXTA 3U4BL 4J23A 4JANA 2FEDD 2ZCLH 3TO4A 4X7TB 3SDDB 4L8DB 3OB8A 1CF8H 4N8CL 5HDBF 4PLNC 4PYGA 3BJ91 4HZLB 1U6AH 3B9AA 2G2RA 1X5LA 2ICEA 3RY6C 1NGPH 4Z7VE 5TE6L 1GZQA 4WY7L 4M7ZB 1NFDA 1GC1C 5DHVA 2X4QA 2P47B 3QWRA 2XICA 3GSQB 4NZDA 1T1WA 1EHNA 2VMFA 4NKIH 3L3HA 2AJSH 5E9DD 1MI5A 5B38B 2YPVH 3QUYB 5DJ8B 1JNNL 3IRZA 3ROOB 4XPHL 4GW4A 4NRZA 2XA8L 3A67H 2NW2B 1QHPA 1KB5A 1YMME 2X5PA 2VIRA 5GGQL 1KULA 3FQWA 4C4KT 5T1KB 3N9GL 4MVBC 4Z18A 5KVEL 5KANI 4RQQB 3LEXA 5D2NE 3PUCA 3G5ZA 4OZHE 2HTKD 4XMPL 4OF0A 3ESUF 1RK0B 2RFXA 3OKEA 3B9KA 2BOBA 4NBYB 3TBSB 1YYLL 1NGXB 1QNZH 1JK8A 5GGSA 2D7QA 4G9FA 3GMQA 2W1NA 3MLRH 1VFOA 1R3IH 4PJBF 1HYSD 1XGYL 3ALPA 3KYOB 5EU5A 1DTUA 3V4UH 4MHHG 4GRMB 4GRLA 1MCOL 5KN5B 3I02A 1UM6L 1NGYA 2UZIH 1SMOA 3AAZB 3E1F1 4NT6B 4MNQE 3QCUL 3FN0L 4O58H 4MB3A 4V1DE 5CJQL 3WV0A 2CMRH 4ETQA 1ZXQA 5I16B 3RNKB 3RWEB 5GS1B 4RWYL 3MA9L 4LIQL 1Z9MA 1T89A 4X83A 1S3KH 3KLHD 4HKZA 1QBMH 4I77H 4PRDB 1H5BB 2F9BT 5DJ0A 4LVHC 1QFPA 4N5EC 5DC0A 1QYGL 4MJ5B 5C9JB 4QTHB 2JJTA 5GS0C 5ISZA 5BQ7A 2WW8A 4U1JA 5I1DA 1XR9A 3L5WB 1BVLA 4EIGB 5JPNB 3MBEA 5E03A 3GIVA