1NCQC

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
molecule keywords COAT PROTEIN VP1
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqC00
1HXS1 3LOBA 4IV1C 1C8NA 4CDQB 1RUF2 1EAH3 5J96B 1HQNA 1AR92 5ABJA 1VBC2 4Z92B 1R1A2 3VBFC 5C8CC 4N53B 2HWE2 1RUG1 5CFCB 1R091 1A6CA 4PDWC 2RMU3 1C8M3 1VBD2 5CFDB 1ND3C 4CDXA 4CDUA 1QJY3 4CEWC 3S6PA 5C9AB 1VBB3 4CEWA 4CDXC 1QQP3 5BNPB 1PGL1 3VBRC 1RUD3 1VRH3 2HWB3 2R041 2RMU2 3VBSB 1ND3A 1FOD1 4CDUC 1AR71 2RS52 3J8F2 4PDWA 3DPRC 1RUH2 2RR12 2WZR2 1RHI1 1VBB1 2RS12 3VBOB 1RUJ3 2BPA2 1BEV1 5AC91 4IV1A 4Q4Y1 1POV1 1W39A 5FOJB 1CD3G 1NY71 1VBA2 1ZBE1 4GMP3 1HRV2 4CEYC 3VBRB 3IDEA 5K0UB 1RUJ2 4EJRA 1C8M2 5A32A 1V9U1 1HRI1 1VBE2 1POV0 2RMU1 4IV3A 4Q4W1 5C4WA 1AUYA 3VBSA 1ASJ1 1NCQB 1EV11 1RUJ1 1R081 1ND2C 5A33A 5AC93 1MEC3 1WCDJ 1HRV1 4Q4X1 2Y26A 2R063 1Z7S3 1TMF2 4GH4C 1AYM3 4Q4Y2 2WS92 4Q4X3 3JD73 4CDQC 4SBVA 1VAKA 1H8TA 1NA1B 4RR3B 4IV3B 1OHFA 4WM8B 1AL0G 1RUD1 4LLFA 3TN91 1RMU2 1BMV1 1PO11 3J8F1 4YVWB 2HWE3 5L7OC 5LK7B 1ASJ2 3VBFB 5C8CB 3VBOA 1RUF3 4N43A 1MQTB 1RUC3 1EV13 4RS5B 5FMOS 2TBVA 1QJU3 5ABJC 1ND3B 1QJX2 4RHV2 1AR62 1PO12 3JB8A 1RUI2 1RUD2 2R071 5DDJ2 4CDQA 3ZFGB 1PO21 1VRH2 2WLPA 4FSJA 1GFF2 4YVWA 1ZBA1 4JGYB 2WS91 3VBFA 5C8CA 5AC92 2X5IC 1QJU2 5D8AC 1H8TB 2RS11 1R083 4RR3A 1OOPA 4WM8A 2WZR3 1PIV3 5DDJ3 4BCUA 2RS33 4JGZA 2HWB1 1TME3 2R043 1QJZA 4NWVA 1EV12 3M8LA 4QPGC 4Q4W2 5C9AA 5ABJB 5JZGB 1AR83 2R073 4RS5A 4Y4YA 3VDDC 3NAPC 1K5MA 1NCQA 4FTSA 2RS13 1AYN3 1OOPB 5BNNB 1AR93 1OPOA 1ZBA2 1FMD1 1NG0A 2X5IA 3JBG3 2RS32 4JGYA 4N53C 4N43B 2PLV1 1QQP1 5BNOA 1X36A 1QJX1 3CJIA 1M06G 3JB4C 1RHI2 1COV1 2RR11 1DDLA 2FZ2A 1VB2A 4Q4Y3 3VBRA 2VQ0A 2FZ1A 3ZFEC 1HXS2 1NA1C 1RHI3 5JZGA 2WFF3 5FMOL 4YVSC 1R1A3 2RM21 1QJU1 3CJIC 1K5MB 3JBG2 1COV3 2RR13 5CFDA 4Y5Z0 2XPJA 3JD71 1FMD2 4PDWB 2PLV3 4Q4X2 3ZFFA 2IZWA 4NWWA 1R092 2HWF3 1FPN1 2RM22 5A32B 1AR63 4RHV3 1VBC1 1B35A 2ZZQA 5BNOB 4IV1B 1HX6A 3NAPA 1PVC1 1FMD3 1RVF3 3VBSC 1VB4A 4GMP0 2HWD2 1R093 1HRI2 2HWF2 5C4WC 4AEDC 1F8VA 1BBT3 2WWSA 3VBUA 3FBMA 3VBHC 5A33B 1NCRC 4WM7C 1COV2 4CDWA 1PIV2 1E57A 1K5MC 2XBO3 4RQPC 2PLV2 1NY72 4CDWC 2RS31 1FOD3 2HWD3 1TME1 3VBHA 4AEDA 1B35C 2GH8A 1NOVA 2R061 1VBB2 1HRV3 2BFUL 2R072 5DDJ1 3ZFFB 4CDXB 4JGZC 1AYM1 1AR81 3VDDB 4Q4V3 4RR3C 1FOD2 5BNPA 1BBT2 2MEV1 4YVSA 1F2NA 1VBE1 2RS53 1RB8G 1SMVA 2HWC1 3VBHB 1RUG3 4YVWC 5L7OB 1ZBE3 1IHMA 2HWB2 3ZFGA 4QPIA 1RMU1 1RUC2 1MQTC 4Q4V2 1HRI3 5ACA2 4CDWB 4CEWB 1QJY1 4RFT0 3TN93 1RUE1 1PO13 4GH4B 5BNPC 2ZAHA 2MEV3 2HWE1 5D8AA 1BEV2 1D4M1 3ZFGC 1VRH1 4JGZB 3ZFEB 4Q4V1 2WZR1 1RUC1 5L7OA 1POV3 1RUH1 3VBUB 1Z7S1 2X5IB 1FPN3 3DPRB 1CJDA 2ZTNA 1RUH3 1H8TC 1AL21 2R042 4GH4A 4RS5C 1V9U2 1PGL2 1HXS3 1D4M3 1NCRA 1C8M1 1PGW1 4WM7A 2XBO1 5J98B 1BMV2 1QJX3 3TN92 2BFUS 4GB31 2R062 1MEC1 4QPGA 5K0UA 1TMF3 1BEV3 1ZBE2 1RVF2 2WS93 5K0UC 1RUE2 1TMF1 1V9U3 3HAGA 4IV3C 4WM8C 1PVC3 1RVF1 1OOPC 1QJY2 4GMP1 5D8AB 5C4WB 1MEC2 2DF7A 1R1A1 2RM23 3VBUC 1RMU3 4AEDB 3ZXAC 4Q4W3 5BNNA 1R082 1NCRB 4WM7B 5CFCC 2XBO2 1ASJ3 1PGW2 4RQPB 4CEYA 2HWF1 5CFDC 1RUE3 1ND2B 4FTBA 4QPGB 3DPRA 1PVC2 1AL22 1BBT1 3J8F3 1B35B 1AR73 5JZGC 1Z7S2 1AR82 1NA1A 1AYM2 1QQP2 3NAPB 3ZFFC 3ZFEA 4FTEA 1D4M2 1VBD1 4CDUB 1VBA1 1AL23 1ZBA3 1RUG2 1MQTA 5GKAC 2BBVA 4N43C 3CJIB 4QPIC 3VBOC 5ACA1 2QQPA 1AR91 1VBE3 2RS51 1AR72 2HWC2 2HWD1 1VBC3 1RUF1 4CEYB 1RUI3 1VBA3 2MEV2 1ND2A 5BNOC 1PO23 2BUKA 3VDDA 4GB33 4JGYC 4N53A 5CFCA 1VBD3 5ACA3 2WFF2 5BNNC 1AYN1 4YVSB 1FPN2 2HWC3 1EAH1 1NCQC 3JD72 4RQPA 1TME2 1EAH2 1PO22 4QPIB 3JBG1 4GB32 1AYN2 1RUI1 2WFF1 1AR61 4RHV1 5C9AC 1PIV1 1X33A 2GSYA
chains in the Genus database with same CATH superfamily
1OLME 4HXCA 3SHRA 3LOBA 2CGOA 3S5AA 4FPOB 4COUA 2K46A 3A21A 4CUBA 4IL7A 4UFMA 3OYWB 3ZLIA 1W2UA 3ZXKA 1WLWA 4C90A 5J96B 3AJZA 4BDVB 4A3XA 3MPPG 3X29B 3FUQA 1QU0A 4PLMA 1U12A 3T4HB 1HQNA 1US3A 4D8MA 1LOGA 4ZZ5A 1IS3A 2YDEA 3GCWA 4AK3A 2DUPA 3H0OA 3ZMOA 4PIXA 1ZZ9A 3AVRA 1GWMA 4XILA 3WP3A 4C8DA 2YBPA 3H8UA 3GZUC 1LGBA 5C8CC 1Q5OA 2HWE2 4X8PA 2P17A 4AGVA 2AREA 4KWKA 1A6CA 5IFPA 1ULGA 4FPGA 2RMU3 5IJRA 2VMCA 1E5HA 1N47A 3KGLA 1ZZCA 4CDXA 2YC0A 3L2HA 4Q1PA 3WG3A 2WKKA 4NO4A 4CU6A 3BN6A 4CEWC 2QFEA 3Q9OA 2DTYA 3B7MA 3VN4A 4AVTA 3J9SA 4GIQA 5BNPB 3PVBB 2BNOA 1RUD3 2WA4A 2X09A 2G1MA 2Z4FA 5T5PA 5KC5A 5L73A 2ZEYA 4L2NA 1RXFA 4XXAA 4ZONA 4L97A 4MH0E 3VBSB 1G9FA 4MOAA 1VE0A 2IVJA 2ZEZA 3NKTA 4C91A 1C4RA 5GALA 1ND3A 4E4HA 2GH2A 4UWDA 1C57A 2XJPA 4E2GA 3J8F2 5FZKA 5F3EA 1RUH2 2QBXA 3N36A 5EHDA 2UY8A 3IIAA 1XNAA 3WNKA 2BVVA 2ZXQA 5T5OA 5LA1A 3BTZA 4MX3A 2BGCA 4JQRA 5CEHA 4UAPA 3AB0A 4IEZA 1S0FA 3VV1A 3POSA 4CCNA 4ZPIA 2CV6A 1LULA 2Y6KA 4CP9A 1K45A 1CD3G 3CZUA 2IXKA 4YM2A 1CGPA 1NY71 4BMBA 1VBA2 4GMP3 4K1ZA 3OPWA 2XONA 2Q30A 4CEYC 3N9NA 5ISLA 1IG0A 4MGSA 3IN9A 1CX1A 4XF0A 3VBRB 3C2UA 3LF7A 3P6BA 1W8TA 5K0UB 1RUJ2 1OKQA 1C8M2 2AC1A 2XJSA 2OPWA 1HRI1 1WLCA 2WQZC 3VZJA 1L3JA 3HVDA 2GN7A 1Q3EA 5EFUA 4IETA 2RMU1 3ATGA 3NJYA 4IV3A 2XWBB 3LA2A 5C4WA 4QX7A 4AR2A 2JE9A 1E5IA 1U5IA 5FZ4A 4D0QA 3KS7A 3VBSA 5FZ8A 3MW4A 1ASJ1 2XLGA 4A6SA 5E6HA 2VOKA 2CYFA 1DGRN 1F4AA 2DVAA 2QZ3A 4IGOA 1EV11 1RUJ1 3TNQA 3HEIA 5A3MA 5CG9A 1UU6A 1R081 3OBRA 2A5ZA 2YPJA 4M01A 3MBWA 4WZFA 5C71A 5FO7B 4CE8A 4MXWB 4HN0A 2JDMA 2D43A 4Q4X1 4B3NA 2R0FA 4DOUA 4MSVA 1AYM3 1URXA 3POFA 3G6JB 2ZX4A 3HQXA 2GNDA 3JD73 3KVAA 4Q4X3 2D6OX 3WCRA 4SBVA 1VAKA 5F9TA 5DUVA 4IV3B 5C6CA 4WM8B 1AL0G 4Q0PA 1AXKA 1X9PA 1X7NA 4BMEA 1I3HA 1ULPA 2DVDA 3VHOA 1D2SA 1Y3TA 4I3GA 4I0WB 4UT5A 4CYDA 4YW7A 3J8F1 3LIGA 2HWE3 4EV0A 5LK7B 5C8CB 3PNAA 5FFOC 4OI1A 1MQTB 2UYBA 2XJUA 1WBLA 1EV13 1HLCA 2HEWF 1O4ZA 2QJVA 3LEKA 5KWRA 2Q1FA 4HZFA 2TBVA 3J7LA 3PHMA 2OPKA 3AVSA 5FY1A 3KV4A 4QQOA 1UIKA 3VB9A 1CAWA 3WDYA 2R071 4XDQA 5DDJ2 3ZFGB 2ZGTA 4YW6A 4BA6A 3T1LA 2WLPA 1OQDA 4LBQB 4J1WA 3HNYM 3CBNA 3CQOA 4QQ2A 5C3SA 4IQPA 4FSJA 4AI0A 2R6QA 4XUNA 3BPSA 3QBQA 4IEWA 4UBHA 1WUVA 2VMDA 4UXAA 5C8CA 3K2OA 2X29A 3VZOA 4ZU5A 4BWOA 2X5IC 4CA9A 5AC92 2JDAA 4CUGA 2ZGPA 3LSEA 4CCKA 4E4SA 2ID4A 2WT0A 3E6CC 1N1TA 4EN0A 2H6CA 3MO4A 4WM8A 2WZR3 2DVGA 2XHNA 5FR3A 4C0BA 3O1SA 1ODMA 2ADEA 4URTA 1WCKA 1PMIA 3HD8B 5EYYA 5DABA 1CAVB 1K42A 3QCWA 3T3YA 3M8LA 1H4HA 3ZO0B 4QB6A 5HXVA 4QAWA 4LKFA 5F5AA 2ZA9A 4IEXA 4KNCA 4XUOA 3D4KA 1DQ1A 1SHWB 2GC2A 3HN1A 3NAPC 3R4UA 4K8RB 3BTYA 1LTEA 2P1BA 4HKOA 4QU1A 4XURA 2RG4A 2VMFA 1AYN3 1E5RA 1W3VA 2P6CA 2QNKA 2V4VA 1EYBA 3FUOA 3UGHA 3AKRA 4ARYA 4XJUA 4AFAA 1WW5A 3IPVB 1UU5A 1CAVA 1SZBA 1W2OA 2CAVA 4FOWA 5SV5A 3H3LA 3K48A 3U07A 2JWPA 2PELA 3I3BA 2WZEA 1BZWA 1S2EA 3OGSA 4P08A 4ZU4A 2B42B 2VBPA 3ALQA 1QJX1 5EQUA 1XXNA 4KWLA 3CJIA 3FZ3A 4S2HA 3JB4C 3WOGA 1PM7A 1COV1 4KWUA 3LAGA 4FPJA 4FBFA 3LCPA 3HMYA 5F32A 2FCUA 3WP5A 5L36A 3OBZA 2NMOA 3V65A 3SITA 1DDLA 3AC0A 1VB2A 3NKGA 4Q4Y3 1ALYA 5FYCA 1HV0A 4Y22A 5FAXA 3KHCA 1QOOA 2VQ0A 2DBIA 2V5DA 2YV8A 4CU8A 2Z2SB 4JCKA 4XAAA 4LLOA 3NVCA 2VY0A 1OLRA 3N9PA 4L11A 1V6IA 5KR7A 1RHI3 1AJKA 3RS6A 2CWSA 2WFF3 4LBJA 3OCPA 1FNZA 1UMIA 5L9BA 4HOOA 3EO6A 4YZ3A 2WNOA 1QHDA 4Y24A 3CJIC 3FJSA 3JQWA 3JBG2 4E4ZA 1AF9A 4PBPA 1GQHA 4Y5Z0 4QU2A 5FMCA 4QPWA 1V6NA 3RQ0A 2W1QA 3I3DA 1FMD2 1I6XA 2JKXA 1J3RA 2IZWA 3BIEA 4GZ9A 1QXJA 3O12A 4NWWA 2HWF3 1GLHA 4C1WA 4COYA 2IFWA 1FPN1 1O3QA 1UYPA 2RM22 1O8SA 1JS9A 4BE3A 2KD7A 4R4XA 1GZCA 3OTFA 4LBQD 5DAPA 2XJTA 1PHMA 4KBBA 4GJYA 5KHIA 1SEFA 2PHRA 2CTVA 1W0NA 5LA2A 2P3JA 4UW3A 1DQ6A 1HX6A 3OBTA 3NAPA 2WNUA 5A3UA 4EROA 3O1VA 5FYYA 4CU9A 1FMD3 2A6VA 4F83A 5FZCA 4B29A 2W2IA 2RV9A 1D7PM 3IDAA 4GMP0 4I01A 5C8WA 1R093 2WABA 4BB3A 2C1FA 5A33B 3FBMA 1NZIA 3EMRA 5CKMA 4WM7C 1COV2 1X9TA 1LRHA 4CDWA 2WSUA 3S57A 1PIV2 2QQNA 1K5MC 3IKWA 3BUCA 4RQPC 1RITA 3I2IA 4QKFA 1YC61 3RVHA 5A7OA 4QKNA 1V6KA 3R4DB 1P8JA 3VBHA 4YG3A 3NW4A 4ONUA 4B8EA 4M3CB 3MYXA 2GAUA 4AEDA 5F5IA 2GH8A 2KM2A 3SKJE 1V6MA 2AH2A 3VDBA 4EN6B 1W9YA 2G19A 1MZ6A 2W08A 3ZXJA 2BFUL 2D3PA 4DEVA 1AJOA 3M3OA 3MF6A 3B00A 5GLUA 3IT8A 5KC6A 1AYM1 2TUNA 3VGIA 1YRZA 2Y6LA 5FCCA 2W9XA 4Q4V3 2YGMA 2ZGRA 2W52A 4PCRA 4AVVA 3M3QA 2VL4A 1Q8QA 1W9TA 3FE5A 1BBT2 4XQWA 5DXDA 2MEV1 4LA3A 2YUEA 3WNOA 5LATA 2RS53 5A1FA 5CNAA 1SMVA 3D8CA 3BI3A 3VBHB 4LR4A 4I30A 1RUG3 1OUXA 1OLMA 3ZXDA 1NX9A 2QCSB 4AG4A 4D7YA 2QUOA 5FP3A 1JOPA 1IHMA 4H7LA 1RMU1 2HEVF 3HN3A 4MGIE 3GGLA 3ZIXA 2P3KA 2C4XA 3WW1A 5ACA2 4CDWB 1A8MA 4CEWB 1V6JA 3RZKA 3VZKA 3RJRA 1WBFA 3GXUA 2PYTA 1JH5A 4FCAA 5EYXA 4CCJA 2GU9A 2Z79A 3GHNA 2OYZA 4BQYA 1H2MA 1GZ9A 3PMEA 1VMHA 4IE6A 4P5HA 5C70A 5IK4A 2UY9A 1D4M1 2D6KA 2PHWA 2JX9A 5JUVA 1G86A 1VRH1 3NV1A 5FZGA 1GZTA 4Y1XA 3WQ7A 5FZOB 5C33A 3I4IA 5AFEA 5FWJA 2WZR1 3LDBA 1RUC1 3OD0A 5A7QA 2WAAA 3RZLA 2XGXA 3LGRA 3VBUB 5FYMA 1ZX5A 3PURA 1JMUB 1Z7S1 1YJLA 1D2QA 4QWNA 1NLRA 4XFAA 5F37A 3R4SA 4E2QA 4RGGA 4FFIA 4UW4A 3KCYA 1H8TC 2Q0AA 3ROUA 3D5OA 1HIXA 1DU3D 4L8QA 2CWMA 1H1IA 2JIGA 2CAUA 4JV4A 4GA9A 4RS5C 1SBEA 1W9SA 4UFLA 5HCAA 4IXLA 5FPAA 1D4M3 2Q5TA 3GJAA 4WM7A 3V0AB 2VUJA 2XBO1 2XQRA 4BYYA 5A1LA 3MUZ1 2Y38A 1UZZA 3T2QA 5CISA 4QPGA 3NSTA 4CP0A 2UU8A 4UOJA 2BWCA 4PF5A 3UKVA 3B5LB 3AP9A 1HJGA 5K0UC 3IMNA 1RUE2 5GM0A 4A45A 4BHPA 1TMF1 4ES8A 4IV3C 5C3RA 1PVC3 1OOPC 4Y1ZA 2CHHA 4WBBA 5DUWA 4DINB 3PVEA 4H55A 1MEC2 4CCLA 1R1A1 2DCJA 1G7YA 2JD9A 4IERA 2OW4A 3ZXAC 5BNNA 1UY2A 4MHUA 2R49A 3KSCA 1R082 1QXPA 4LOTA 2DU1A 4WM7B 5FZOA 3T0AA 1MPXA 2XBO2 4A7YA 1OSGA 5CFCC 3V0AA 2LW8A 2R1BA 3I59A 3WW2A 3CU7A 1W8OA 4OCTA 3R05A 4P9XA 1LB2A 2XJQA 3WDVA 3FWEA 2RE9A 4AWDA 3AP7A 2AR6A 2YROA 5J3UA 3C7OA 2ORXA 4QPGB 3VLBB 3ZOIA 3VUOA 5IK7A 4FTBA 5JI7A 1YQ5A 1CN1A 2CL2A 4NHLA 4BXSV 3BTXA 2K9ZA 2YB7A 4E8CA 4O7XA 2V73A 1A78A 3RJ2X 4YW1A 3J8F3 3O1UA 4MG2A 1AR73 2W1SA 3K51A 3OUJA 3ITQA 4GULA 5FYTA 1NA1A 1W0PA 3ZX7A 3KGZA 1GNYA 3EJKA 1JZ3A 1LGCA 4KI5M 3AYAA 3ZFEA 1XB9A 3ME2A 1E5SA 3N9QA 5FLHA 4FTEA 3POBA 5FY9A 4Q1RA 3VL9A 4FAHA 4XPVA 3TAYA 1RGSA 1VBD1 1YO8A 1N1YA 3I2HA 2A3YA 5A7NA 3NV4A 2QQVA 4B7EA 1U5ZA 3RWNA 1RUG2 2FDJA 1SDDB 1A8DA 2WUHA 3O1OA 5A7WB 3LWCA 1OURA 2NMNA 3K77A 1DLCA 5ACA1 4AI1A 5E1RA 4YGCA 4WZCA 2ZJCA 2FCVA 4IEYA 4Q0SA 1F15A 2OUJA 4QHBA 3O0VA 4NN0A 4AW7A 3I3QA 4XFCA 3MFCA 1DQ0A 3HT2A 1WCSA 2HBTA 3MIFA 4BQ5A 2XHKA 1AR72 3O1RA 2HWC2 1W6NA 2HWD1 3CDZB 1JU3A 1Y9MA 2QVSB 3FFQA 1OA2A 1BQPA 3N7MA 4W4ZA 1RJ8A 2QQMA 1WLDA 2VNRA 3FFZA 3LPFA 3SEPA 3VDDA 1CAUB 2JKBA 1ST8A 2LRPA 4GB33 4DXZA 4YWAA 3VKLA 3KLSA 1JZ5A 1N1SA 3KQRA 4Q5OA 4RL7A 5FY4A 5C3QA 2VZPA 2D5FA 2WFF2 3AP5A 1Q8SA 1AYN1 1FPN2 3P3NA 2E7TA 3APBA 4FP2A 2Y8KA 4XUQA 3T09A 2P5BA 1NUKA 3W9AA 3TWIA 1SFPA 1OKOA 3RYRA 3DEMA 5LBBA 4QQHA 1AVBA 4QPIB 1W6OA 4GB32 4GWMA 5C5TA 3KMHA 4R9AA 4BZ4A 2LUWA 4YPJA 1KJLA 2ARXA 4RHV1 4M4RA 4EWAA 2ZGSA 1BK1A 2WZPP 1PIV1 3JU9A 4GWJA 2W1UA 3M2MA 3MV01 4XFGA 3RI9A 2GDFA 4IV1C 2BVBA 3KVBA 4Y33A 3OBAA 1XNCA 2J22A 2WNUC 1RUF2 3PTYA 2VZ1A 3G7DA 5DUXA 1JODA 3D6EA 4LBQA 3KT4A 4R9BA 5HPOA 2P37A 4I09A 3AYCA 4AEKA 1OH4A 3FLTA 2FBEA 3EBRA 5EJ3A 3KHBA 2I2SA 1KXGA 3N7KA 5FXWA 4MO3M 3CKHA 5JLVA 3PLQA 4Y4RA 4M0HA 1XNTA 1M4WA 2BP6A 3AKPA 1H1AA 1OUSA 5IFTA 1CESA 4DRRA 3TEXA 5FOBB 3H50A 2VMIA 1VPHA 2RJLA 4ZHNA 1WMDA 1IPKA 2A73B 3OGJA 3ZSEA 5CFDB 4QT6A 1APNA 3DV8A 4CDUA 4YW2A 3CIHA 4UF0B 3S6PA 5KHGA 2RJKA 4D7SA 2BV4A 4DMIA 5F1RA 2QQIA 3O5SA 5FPVA 3NL1A 5JOXA 5FP9A 1ZZ6A 1UY0A 1ZRDA 3E6BA 4NAMA 2MNGA 2SLIA 1FT9A 1S1AA 4XFBA 4FAGA 5FO9B 3JQXA 5FP8A 3UESA 1VRH3 4LEJA 3LB9A 2R041 3I3MA 2RMU2 2VXRA 2W94A 3R0RA 2GNMA 1UW8A 1FOD1 3AZZA 4LMFA 2RS52 1FV3A 4FPKA 2XVLA 3IPVA 4PDWA 5LY2A 4N8MA 1RC6A 4YM1A 3AL5A 2WZR2 4YZ4A 3WQBA 3MPBA 3NJVA 5A6ZA 1KDMA 3ELNA 1W6MB 1GYKA 2BPA2 1BEV1 4D7TA 4QM8A 4IV1A 2E26A 3RNSA 4NIDA 1LHUA 1QJFA 2J1AA 1REDA 4OQ8A 1ZBE1 2VOXA 3O7OA 4IEPA 2NM1A 5IATA 3WZ1A 4YG6A 2ATFA 4RFRB 4XCBA 5ANQA 3C3VA 3IDEA 4J1XA 3ZKYA 4AYUA 2WZ8A 4FPYA 1EPZA 1GUIA 2WLQA 2ZABA 2IXHA 3HT1A 4FOYA 3TEYA 2O14A 3NWKA 5F2WA 2OT7A 1VBE2 2JDKA 4MGQA 2ERFA 4AXOA 1NT0A 4XUTA 3MLKA 2QDRA 2BDRA 1J1LA 2IXCA 4H2AA 1AUYA 3POIA 5IWFA 2KR2A 4ATEA 3LFIA 2D3RA 1S0BA 2WSVA 1OFNA 3O0WA 1YHFA 2D6MA 3MICA 4JRLA 1ND2C 1NQJA 3ON7A 2FCTA 4AQ2A 4BK5A 1W06A 2YU1A 1DLLA 2A7AA 4H14A 1NE4A 1NXMA 1RTVA 2R063 2H6BA 3A7QA 3K4AA 4JDOA 4KH9A 4KL1A 5JCTA 3DYOA 1SPPB 4Q4Y2 4NR1A 2WNUB 3BALA 5JXGA 4GKXA 1FI2A 5FZ1A 4W65A 5FY5A 2OZJA 4NPRA 2R7EB 3H1MA 4K40A 3GALA 4A3ZA 3CJXA 3ZXFA 4QPYA 3TN91 1RMU2 1SFYA 1Z78A 3DXUA 3IIIA 2ZX2A 1MS0A 5FUPA 2F4LA 3NO8A 3TB0A 1HN1A 5HBAA 1ASJ2 3VBFB 3K75B 3VBOA 2BOIA 4L99A 1RUF3 1T2XA 4BK4A 2PHFA 4KQ7A 1RUC3 3L9JT 5J1XA 5HCFA 3TRSB 2G9ZA 5CVRA 4FXGB 5FBJA 3VDAA 1SPPA 4LHLA 4RS5B 5FMOS 2O8OA 5A3NA 2JG9A 2A75A 4J6GA 1QJX2 5E8AA 1O8PA 4ISQA 4RHV2 2ZMLA 1ZRCA 3D0SA 1JBCA 4K9SA 1XE8A 1PO21 4JKKA 4Y22B 3K3NA 1GFF2 3U14A 2DTWA 2ILMA 1ZBA1 4JGYB 2WS91 3T2TA 3VBFA 3PU8A 4P14A 4B4RA 4COZA 3HJRA 2CY6A 4Q2FA 3MZHA 2LALA 1QJU2 4Y20B 3ZYPA 3GBFA 5BV6A 2GN3A 4LE3A 4XJ8A 3ACIA 3RGBA 4XE9A 1XOYA 2ZX1A 3AKTA 5LASA 1W8FA 1OOPA 4TN7A 4QM9A 1I5ZA 2RS33 1UYZA 4JGZA 2HWB1 1QJZA 1POQA 3B02A 4LKDA 3ACLA 3POEA 3KF3A 4BIFA 2ZHLA 2EA7A 4YSFA 1H6YA 1VAVA 4QPGC 3E5UA 2D6LX 4CXWA 4BJ0A 4G4FA 4AAXA 5C9AA 4BIOA 1PMJX 2JICA 1QOTA 5ABJB 3H8XA 3TBDA 2XKPA 4M3CE 1MR5A 4F7ZA 1HKDA 2HJIA 1ZZ8A 3LDRA 4RS5A 1PGSA 4WV8A 5C7GA 5JWPA 3F95A 1NCQA 4FTSA 2AZ5A 3TYJA 1OOPB 1XC6A 3GCXA 3HR9A 4FVVA 4QDQA 2B39A 2WN2A 2Y6HA 1IKPA 4YYOA 2Q1MA 2ZMKA 1B09A 2WWJA 4K21A 2RDSA 2ES3A 1CZVA 3DN7A 3NRUA 1AHSA 4UBGA 3ZVXA 1FMD1 1EUUA 4A6OA 3ECQA 4QX8A 2VOWA 2FDHA 3V56A 4XF9A 5C3PA 5BYNA 4JGYA 4N53C 4BQ1A 2AYHA 3WQ1A 2VMHA 4Z2WA 2WO1A 4E27A 2G4IA 1QQP1 1PX3A 5BNOA 2OS2A 4S2DA 1OMIA 5IW0A 1OBNA 1M06G 3USUA 2ZKLA 3O0XA 4NE9A 4XABA 1KFXL 1PVXA 4QB1A 4Z82A 4TTGA 3SLIA 2ZGMA 4YZ2A 1QOSA 4NHMA 4BQWA 4BXFA 3S7EA 1KRIA 4YARA 4Z2AA 1JXNA 1YLLA 3AKSA 4K8FA 1W8HA 2P3YA 2FZ1A 2XL9A 2YBKA 4OLLA 4CTEA 1I9RA 2K2SA 2B8MA 2DCKA 5CG8A 3I8TA 4F8AA 2H0VA 4XVHA 2Y64A 2Y6FA 3OEAA 3J4UH 1UQXA 4JTNA 5FMOL 4E2SA 3PVNA 1RJ7A 2PMWB 2QQJA 2RM21 3FHAA 5C5UA 2D3SA 1FXZA 1DHKB 1GBGA 1Y4WA 2RR13 1JZ6A 3JD71 1N1VA 4R9DA 4BISA 4ES9A 1MZFA 2QQKA 2Y0OA 3UGFA 2LS6A 3EHKA 3WUDA 1R092 2WNVB 3VKMA 5CKNA 3N9LA 3USSA 3DL3A 2X53S 4O9GA 1UYYA 5A32B 3GZAA 1AR63 5LRRA 4HVQA 3E6DA 1LU2A 2DUQA 3FHIB 5BNOB 4COWA 5E89A 5GZFA 3MV11 1ZA4A 3MI8A 2VZQA 2P3IA 3B9CA 1CPMA 2UWCA 2VD7A 1DYOA 4OHWA 3RDIA 4Z07A 1VB4A 2XLFA 4Y5TA 4CCCA 1EP0A 2HWF2 4XAEA 3T2OA 1BK0A 3LEIA 2FMDA 5E88A 3B94A 3H3ZA 3NMBA 4GJZA 1W8NA 4FQZA 4AEDC 1W04A 5F39A 5CZKA 3VBUA 3WT3A 3VBHC 4CCDA 5F3IA 4XQ4A 5DAVA 1PZ9A 1S0CA 3DCQA 1QIQA 1C1LA 4XFIA 1E57A 2IXJA 1H6XA 4Q0QA 2E33A 2PLV2 3QH6A 4LHNA 1OA3A 4X6QB 4AFMA 4MADA 3N7LA 5H9QA 4CDWC 1LEMA 2RS31 4Y3OA 1FOD3 1TME1 2VAUA 3N35A 4A2UA 2QE3A 3WR0A 1QEXA 3VD3A 3HNBM 3WQ0A 4DS0A 2EXKA 4IE4A 4AFDA 1OVSA 1W6NB 1TVGA 3OYWA 4TXWA 4FI9A 5L9RA 1HRV3 5CA6A 2JECA 1HJFA 3A23A 4QKDA 4HPKB 2RDNA 3C8XA 1UAIA 2VQAA 4R8HA 2I45A 2MPFA 3OGVA 5F7UA 1JZ7A 4OMCA 3VDDB 1OVPA 1PM4A 3H8OA 5FZMA 1SBDA 4OUSA 4RR3C 1FOD2 3ZPYA 2F6BA 2PA7A 4IUGA 2NP0A 4E9KA 4KBZA 2TEPA 4AI2A 4CXXA 4DXSA 5IT6A 1IKQA 4YZ1A 4M4PA 4N7UA 5FUIA 2Q8OA 4Y5SA 2FDGA 1NQDA 3ILRA 1W2NA 3ST7A 1CIWA 4YVWC 5L7OB 1U0AA 3VZMA 5FRAA 2VQUA 4PQQA 2E51A 4QPIA 2JDNA 4DXTA 3PUAA 1KFUL 2VCCA 1GZWB 1SACA 4W8JA 3I2KA 2Y0IA 3EYPA 3ZR6A 5JOYA 3MF9A 1V70A 4RFT0 3TN93 1RUE1 2R30A 3WG4A 1PO13 4GH4B 2ZHKA 2VGDA 4P9GA 1A34A 2HWE1 4NIIA 3ZYRA 1DGRA 4RYDA 4SLIA 4IW3A 5CYYA 3ZFGC 4IGQA 1FV2A 5HCHA 3ZFEB 5BPXA 1LR5A 4RGAA 5C3OA 5L7OA 4AHYA 1POV3 4LE4A 2LROA 2WBKA 3AK0A 4XMIA 3J26N 2X5IB 3WNLA 3DPRB 1FX5A 5H9PA 2GC0A 1CJDA 2ZGUA 3U4XA 2YFUA 5A3LA 1RUH3 5A6QA 2X05A 1IGOA 1MS5A 1YFYA 1S0GA 4XHXA 4H3WA 1JUIA 2R042 2WO3A 4GH4A 3AZXA 1V9U2 3OGRA 3AMNA 3JZVA 1QNWA 4META 1CAWB 1PGW1 1C8M1 3AL6A 3V64A 5J98B 1UMZA 1FAYA 1BMV2 3KV6A 2ARCA 3TN92 2YYOA 3CO2A 4GB31 4RN5A 4FP3A 4XXPA 1HB4A 3MIHA 5KXDA 2IFRA 3LPGA 5K0UA 1XSQA 3PMSA 5AFBA 1ZBE2 1GZWA 1C1FA 1UPIA 1RVF2 1S0IA 1VIWB 2I07B 4N9IA 3BU0A 5EZWA 4MLOA 1XYNA 4BLJA 1OLQA 4KMQA 3KV9A 3S5QA 4Q0UA 5LRSA 5JSOA 4QMAA 1PNFA 4O9EA 4NHKA 1GOGA 1ZZ7A 4HSJA 5KXBA 5C4WB 2VUAA 5LA0A 1G9AA 5I0SA 4EQVA 1EY2A 2F17A 2RM23 2WT2A 3OGGA 3VBUC 4B1LA 2ZGKA 4QXBA 3QOPA 3WG2A 1WKYA 5JVVA 3FHQA 1UOJA 4O61A 5I8YA 3T08A 4TZDA 1ASJ3 2J7MA 1H1MA 1MS1A 2D6NA 5FZ7A 4LIUA 4AI9A 4LKEA 1HN0A 1RUE3 4NUBA 1ND2B 4S2GA 4XEZA 4YRDA 3DPRA 5D2AA 2WFPA 1BBT1 1GOFA 3OUHA 5GZGA 1GWLA 3JUUA 3HQRA 3SEEA 1B35B 2ADDA 4TLGA 1SCSA 3C7FA 5JZGC 3C7GA 4LHSA 1S0DA 4KU8A 2Q4SA 4XYXA 3BU7A 1QQP2 4PLOA 3VD4A 2BERA 3I2FA 3AMQA 2W87A 1AXZA 2D98A 1QY4A 2DVBA 2YC4A 4P9WA 4Q27A 5FZEA 2Q8EA 3AYDA 4AGGA 1QMJA 3WINE 1DP0A 5GZEA 4CDUB 2FQPA 5JOZA 4UF0A 3B69A 3H42B 4QHOA 3AXEA 3WLUA 1YQ8A 2VNGA 1MQTA 3WP6A 3UJOA 3CJIB 4CZSA 2EICA 3PJQA 2D5HA 1JHNA 1S2BA 2B5HA 3QACA 3MIGA 3AZWA 4KG0A 4MGKE 4OHXA 3RPQA 2C24A 1GU3A 1NLSA 5JXJA 3UKNA 3KM5A 3BB6A 3HIFA 3KB5A 3ZIWA 2BNMA 5FP4A 1RIRA 2FMYA 3KZ4C 1LOCA 3BIWE 4BH9A 1BHGA 2AEYA 2WINB 2JG8C 2A6XA 3BOPA 1VBC3 4QXHA 3SXWA 2AENA 2MEV2 1N3QA 1F5JA 1YNAA 1ND2A 3VZNA 3ETQA 2VZRA 5D21A 2J1RA 4QDSA 4HVOA 4LO8A 2VW1A 3GHMA 2VO5A 4JGYC 2YFZA 4N53A 3WF2A 2XDVA 3A0KA 4HL0A 2WO2A 1QNYA 5FIXA 2DYCA 4AI3A 4P00B 3TEWA 1KD7A 1HDKA 2VNOA 4NIGA 1WW4A 4W50A 5FPBA 1D0HA 1UZWA 1W6PA 5J09A 5LZ6A 1JYTA 1NCQC 1ZRFA 4HONA 4RQPA 5HXMA 3FC0A 2ET7A 1EAH2 1GNHA 1YYNA 2CSGA 2QQLA 3IB3A 3JBG1 4HANA 4OZXA 1L7RA 3SMHA 1AYN2 1JYWA 3IM0A 1V6OA 4Q0VA 1XU1A 2ZGNA 3H7YA 4AEMA 1AR61 2E31A 2EXHA 2EXJA 5GZDA 3VHRA 4XFFA 5I0DA 4FPHA 1HXS1 1DGWA 3W5NA 1TEIA 2VH9A 1OF4A 2VJXA 3THTA 1C8NA 1GSLA 3JCIA 4CP1A 2VZTA 1J3PA 3FBYA 4QKBA 3LIHA 1W8UA 2GP5A 1EAH3 4M3CF 2VULA 3T2PA 4AVAA 1JN2P 4LKSA 4QX2A 5DG1A 5GJ6A 4I3PA 5JR2A 4FOQA 1LOAA 2JB8A 1G8WA 1A3KA 1CQ9A 3P5BA 1AR92 3QD6A 1CIYA 4KU7A 5EIYB 4Z92B 1R1A2 2BBAA 1H2KA 2PAMA 2DBNA 4N53B 1JU4A 3WEZA 1RUG1 4JVAA 1UX6A 5FYUA 4D6QA 1V0AA 1O3TA 1R091 4QD2A 2A70A 4PDWC 5L19A 4MZUA 2J42A 5FV3A 2VC9A 5I8TA 1VBD2 4AGRA 2KXLA 3V0BB 4I2OA 1OA4A 3O1PA 1YCIA 1QJY3 1UXZA 4BQ2A 2W91A 3SCHA 5C9AB 5IVFA 1VBB3 3AP6A 4CDXC 1QQP3 4W6YA 3ZYFA 4OMDA 4EZHA 1NKGA 5F2SA 2BGPA 4TYSA 4B7KA 1STMA 4XW3A 3L2YA 4ZS2A 3WV6A 1G9DA 3ZXEA 1LOEA 4MVTA 4CDUC 1AR71 4XTPA 4NRPA 1O7FA 3WCSA 4QGLA 4K6BA 4NPMA 1OD3A 1DFQA 2EALA 2ZZJA 3HBKA 1DZTA 1RHI1 2JD4A 4CU7A 3KWVA 5LWBA 1VBB1 3VBOB 3GDBA 2WJSA 1DIWA 1FNYA 1JOJA 3DKQA 3WY6A 3RG0A 1XE0A 4HSLA 4JZRA 4XJZA 3UGGA 5GZCA 1KGYA 2IWGB 2VUCA 4NRMA 1KJRA 3BOWA 3LEGA 4Q4Y1 3KD4A 1GV9A 2XJVA 1W8WA 3F2ZA 1ENSA 3M7AA 1LGNA 2A1XA 3LSDA 5LA9A 2JG9B 4KGGA 5APAA 3A0NA 1W03A 1HRV2 1PK6C 5FMBA 3RZGA 3V0BA 2GZWA 1OQEA 4HFSA 1YEWA 4XF3A 4OQ9A 4A44A 2QDNA 2PAEA 1PK6A 2VW0A 3POJA 1LKNA 4LTAA 4EJRA 4ZKTB 3SCFA 4FPCA 2BEOA 1V9U1 3OEBA 4Q26A 3AYEA 1XNBA 2OX0A 3SISA 2ARBA 2YZ4A 4NOTA 3NNLA 2A6YA 4QX0A 2VVEA 1GWKA 2VG9A 1SBFA 1DF0A 1K12A 2QQUA 4L92A 5FYVA 5FZ9A 1GP4A 5DMYA 1NCQB 4AQTA 4GKYA 3NJZA 2VM9A 5A33A 1LEDA 1S55A 2V09A 3GBGA 2YG0A 2WYSA 1MEC3 2Z69A 4LBLA 3MW3A 1DBNA 2P4EA 5F8PA 2YPDA 3DXTA 1Q8OA 1TMF2 2RJ2A 4GH4C 5FYSA 4I0AA 1VP6A 1H4GA 2C5DA 1UY4A 2VCBA 3AFGA 3MDPA 4JHTA 4RR3B 5DG2A 2Y34A 3A4UA 4NAOA 5FZFA 3U1XA 1IS6A 3DKWA 5IVBA 1VJ2A 3O14A 1ULOA 4NHXA 2IXIA 1CX4A 1BMV1 1PO11 4B1MA 5JPMB 5LCWL 2HH9A 4YVWB 5L7OC 5DZEA 3E97A 3I7DA 4HK9A 4LITA 1YQ6A 1WD3A 4GXLA 3AZVA 1Y9QA 2WNEA 1R1ZA 3LKJA 3AX4A 1DQ5A 3WSOA 4AFBA 4AE2A 5A70A 5ABJC 5CBLA 1GNZA 5EWSA 1O6UA 3W59A 4V2WA 3BPZA 5FZBA 3WD5A 5J36A 1AR62 5J37A 4RSUA 1BJQA 4D69A 3JB8A 4D3WA 3SH5A 2IVIB 1RUI2 2VPVA 4AHXA 2A3XA 2XUMA 4CDQA 5IUQA 3ZM8A 2ZS6B 5LBFA 1VRH2 3ILFA 3ENRA 1J1TA 4CUAA 4Y1YA 4FFHA 3H9AA 1XE7A 1Q43A 4PIZA 4YVWA 5G05L 4AEJA 2XVGA 4LUMA 4HK8A 5IYYA 3C7EA 3ASIA 1UZYA 5D8AC 1C28A 1DCSA 4ATFA 2E7AA 5I8SA 4YM3A 2VVFA 3I2GA 1GR3A 4RR3A 1PIV3 5DDJ3 4OHZA 1SLIA 4BCUA 2G9FA 5JOWA 1SG3A 2DFCA 1TME3 1ULFA 2OQ7A 4NWVA 3PU3A 1EV12 4CRQA 5I93A 5T50A 3GJBA 2VMEA 5FXXA 2ARAA 1ZZBA 2QQOA 1IQAA 2JDUA 2O1QA 4YM0A 5FKCA 2HKXA 3AMHA 5FUNA 4A7KA 2PN5A 5JZGB 1UZVA 2R073 1WWYA 5AVAA 1LHWA 5DN2A 1ZM1A 3BVCA 4TSVA 4N7IA 5JI9A 1RL3A 3SKVA 1AX1A 1W3XA 2RS13 2XWJB 4XJWA 1F5FA 2EIBA 3U4SA 2VOVA 4INDA 5BNNB 3WX5A 2YY1A 2E32A 2DU0A 1N3OA 1OPOA 2X5IA 4YFWA 2RS32 4LO4B 2J1SA 4DB5A 1TE1B 1XSRA 4N43B 4NJ4A 4PBOA 3ZSJA 4IDZA 4WVMA 4A41A 4RD7A 2AACA 3OUIA 3UETA 4YW3A 4AHZA 4PHZA 4BOWA 4Z1VA 1RHI2 1IS5A 1GQPA 3ZYBA 4BPZA 3ZSMA 2RR11 2JG8A 3Q8CA 1O91A 1D4VB 1UF2C 2ZGLA 4H7MA 3SH4A 1NLQA 1YWKA 3MLJA 1QDCA 4BQ4A 4DNYA 4FO9A 5A7PA 4IE0A 5G04L 4HPKA 2DCYA 3ES1A 5DZGA 5I0RA 1HB3A 1NZCA 3H1WA 2Q8CA 1HXS2 3ILNA 2BNNA 3AZYA 5JZGA 1RUOA 3P1IA 1MS8A 5IHRA 2MHFA 3J7MA 2FDKA 2EAKA 1R1A3 2EIEA 1QJU1 2JB4A 1COV3 3VD9A 4MGYE 2A71A 4GD4A 5CFDA 5KHKA 1JI6A 2W0XA 4IGPA 2PTMA 4Q4X2 3HBZA 4R4ZA 1YIFA 2FHRA 2VCAA 5F5QA 3SH3A 4AAPA 1AZDA 4RHV3 2DFBA 4N9HA 1B35A 2VTXA 3WVJA 3ZXLA 3B93A 4XFHA 4BQXA 4CP9B 4Y1VA 1WCUA 2SBAA 1L7QA 3EXUA 1PVC1 2GMMA 2PHDA 1LOFA 2HWD2 1J83A 5CU1A 2ZKNA 2ET1A 1LJ7A 2ZACA 3GM8A 2VTFA 3THPA 3ZKUA 4WVZA 3WHTA 2Q1ZB 3D0JA 1I5PA 1NCRC 1YI9A 1XU2A 1W6OB 1ULCA 1H2LA 1H2NA 4JDMA 2C26A 4FT8A 5FP7A 4FOVA 4IEUA 3ZXGA 2XBO3 2B45X 4LK6A 5T5LA 4TLFA 4JHZA 1Z0HA 2VCMA 4GALA 1QF3A 2HWD3 1Y7BA 1DQ2A 1JHJA 2XH6A 3RZMA 3GYDA 3RYKA 1ZREA 5JXIA 5DAXA 3PJYA 1NOVA 2XKOA 1JW6A 1VBB2 1SLCA 1ZRIA 2WQ8A 2XQXA 4CDXB 1WCQA 2NQYA 3CEWA 3H8RA 1FATA 2B9VA 4JGZC 3VHPA 1XYOA 1AR81 1XQNA 5EV7A 2VBBA 1SLAA 5T5JA 5BNPA 3LD8A 4M00A 1CVNA 5KXCA 2VECA 2YMZA 3ZN5A 5KHHA 2VZ3A 1J3QA 3Q8EA 4XBLA 2EXIA 1U5XA 2Q8DA 1RB8G 4YG0A 3UKTA 4P9YA 2FD8A 5FZAA 5EPAA 1UPSA 3ZFGA 2HWB2 1F31A 3USUB 4B4PA 2OZ6A 3ZN6A 3MIBA 2D6PA 3P3PA 4NPLA 4Q4V2 4FXKB 3UK9A 2WL1A 3ZYIB 1SDWA 3SC7X 2FDFA 1W6QA 5FJHA 1IPJA 5F6LB 5BNPC 2J1VA 2MEV3 4IE7A 3ETPA 3UYJA 5J7MA 1BEV2 1GMMA 5FY7A 2JDPA 4Q4V1 2W68A 4U2AA 3T4VA 3J7HA 1RUH1 2QZ2A 3NQHA 4AFCA 1DZQA 1G6NA 2BQPA 4MGZE 1F9KA 2XR4A 2JIJA 3SCGA 2XL7A 5JR7B 1HV1A 2ORZA 3DECA 4K20A 1O3SA 2GC1A 2XVKA 4DEQA 4FFGA 1X8MA 4YGEA 2NPIA 5FDBA 4UFJA 1OFSA 1H30A 4UYBA 3T0DA 4Y26A 4N90A 1K5JA 4IE5A 4V1PA 4XIKA 4HT1T 3DGTA 1NCRA 5JPNB 1ZNPA 2JE7A 5FYHA 1WMXA 5EJ1B 2BFUS 5FWEA 3A22A 4JRAA 4GWNA 4KWJA 5FXVA 3ZN6B 1VMFA 2BOJA 4MUVA 1TMF3 2BTVC 1BEV3 1MACA 3URFA 4XTMA 4CVUA 5J48A 4XUPA 1W6MA 3AFKA 4GWIA 2E63A 3AXDA 1G9BA 3O1MA 1T6BX 1WLTA 1UO9A 1UZ0A 1W6QB 1NXD1 1FYUA 2BWAA 5EP9A 2H0BA 2R1DA 2VE1A 4WM8C 3VHNA 4GMP1 3TOJA 3WF1A 1UCXA 2DF7A 4OI4A 1IPSA 1CAXA 4Q4W3 5FQ0B 3RMXA 3I49A 4XBNA 2GMPA 1I1EA 1TNFA 2F4PA 3W58A 1NCRB 2CDOA 1O5UA 2B9UA 3FMGA 3E5XA 2A6WA 1SLBA 1VRBA 4QQPA 5F5CA 4RQPB 1RINA 2HWF1 5CFDC 4UFKA 5T54A 2RHPA 2OXBA 1AL22 2LTNA 1YI7A 1UOGA 4UFIA 5A1AA 2YXSA 4OYUA 3RMYA 3WDWA 3GZTB 3QH7A 5GLZA 3AP4A 5CAZA 5LK5A 3BODA 1Z7S2 2HEYF 1AR82 2BYVE 1AYM2 4CUCA 2D97A 2ZCWA 4C0HA 4YFZA 2VVDA 3RZHA 5KXEA 4ORFA 4DPNA 1NYWA 4QHZA 3POYA 5DZFA 2C6SA 1VBA1 1AL23 4R9CA 2GC3A 1ZBA3 1AX2A 4LULA 5HV0A 3I54A 1Y43B 4Y1UA 3ZYGA 2B46X 4V2VA 5GKAC 3RSJA 5LB6A 3N4MA 4JTOA 3I2JA 4W6WA 2BBVA 1SLLA 4AHWA 1UKRA 1ZRRA 2V72A 3CZJA 4FFFA 4XOGA 2JE8A 2A3WA 4K3UA 4CCMA 3ACFA 1CAXB 5EJZB 3N7JA 5K8SA 5A3TA 3AKQA 2CU5A 5LBEA 2JJ6A 3GNEA 4YGBA 3H3UA 2RS51 3FN9A 3ZYHA 1RUF1 1KS4A 5GLTA 1VBA3 2WAOA 1WD4A 3I2OA 5BNOC 3WF4A 1PO23 3IAQA 1UKGA 2NYYA 4AI8A 3U11A 3U10A 2W5FA 1K3IA 2JDZA 5JMCA 4G3YC 5CFCA 1S2KA 5M0TA 2AGSA 4DRVA 1WZXA 4HN1A 5BNNC 4YVSB 4M3CA 4A42A 2VUDA 4DZGA 1SFNA 2GALA 2HWC3 3E1F1 3JXSA 4DUVA 1ULDA 3UV9A 3FLPA 2WNVA 1OT5A 4XBQA 4HKLA 1TME2 1PO22 2X8KA 3WNMA 5LY1A 4JKLA 1AXYA 1F4HA 3WP4A 2WNVC 1RUI1 3MGUA 3I2DA 3RYPA 4Y20A 1ZA7A 3CHXA 4LUKA 3RRDA 4E4DX 1D0GA 5C9AC 5D8AA 2EIGA 1YQ2A 1X33A 4JDNA 1MS4A 5H9SA 1LOFC 2AUYA 2CDPA 3PTRB 3S30A 1DZRA 2GNTA 3OD4A 2YGLA 3PUQA 4LA2A 4CDQB 3KT1A 4IEQA 3VD5A 2BRTA 2W92A 4M0NA 4NRQA 5L9VA 4EN8B 3WUCA 5IVEA 1X50A 1DYPA 1LHNA 2PQQA 3FX3A 5DAQA 3U78A 3U0ZA 2WO7A 4ITCA 5ABJA 3THCA 5A80A 4JC1A 1VBC2 3WDUA 2C0ZA 4QX3A 5SV8A 3VBFC 2J1EA 1BLZA 4Q8LA 5CFCB 3M3EA 2ZEWA 2WN3A 3OF1A 4P9JA 4PLNA 1IOAA 1JYVA 1XJAA 1YXWA 5JSRA 4ZXKA 4YLZA 1C8M3 2XOMA 3SQOA 1ND3C 5FPLA 3RWKX 4YW4A 3ZPOA 2JG9C 3EB7A 2E9QA 4PF1A 2W46A 4I02A 4CEWA 1RXGA 3OOXA 5FXZA 3PUIA 4EZ4A 1PGL1 3VBRC 2O0OA 3WDTA 3TEZA 1F35A 3ZDSA 5FZ0A 2HWB3 5IVCA 3OY8B 2YHJA 1DGLA 3Q8AA 2WA3A 3MHZA 4LOSA 4AVBA 4QX1A 4BU2A 2V5YA 2VTXJ 2JDYA 1VR3A 1WA4A 2B4KA 3RZJA 3NNFA 1RYYA 1JTZX 2JENA 1ACCA 2VBDA 2XXZA 2GNBA 3IMMA 3DPRC 3LE0A 4LBMA 3AMMA 5FY0A 1IS4A 2RR12 4MGTA 2DDUA 4IEOA 3ZSKA 2RS12 3MFAA 3VDCA 4URAA 4LK7A 4NVPA 1RUJ3 3ABZA 4AF9A 5FPXA 1GQGA 3I97A 1O5LA 1BXHA 4EE2A 5LEJA 5AC91 2VZOA 1TG7A 1POV1 1W39A 5DQ0A 5A6YA 5FOJB 4JX0A 3ACGA 4LXLA 4LNVA 1HW5A 2ZOEB 3OY8A 3UNPA 1SQ4A 3PUSA 3CLPA 5FMDA 3S7IA 3W5MA 1W28A 4DFSA 1QH7A 1S4CA 1XNKA 2YU2A 1OPMA 5FZ3A 2WR9A 1J58A 2OUHA 3BCWA 1GKBA 1LCLA 1US2A 5A32A 1ENQA 1IQDC 1Q8PA 4U36A 2VR4A 4ET7A 1Q56A 2K0GA 1ENXA 4ZY9A 4X8NA 2XMLA 1POV0 2WRAA 3OB8A 3MIDA 4Q4W1 5FYIA 4QXKA 4YW5A 5FPUA 3IZOA 3KCXA 3CL1A 3DUIA 3IDCB 4Q29A 4FPLA 5FYZA 1WW7A 4QGMA 5DPNA 2OVUA 3RZZA 3C7HA 4PT6A 2I74A 4L0PA 4AQ6A 5AC93 1WCDJ 1HRV1 4EN9B 2Y26A 3VKNA 5FZLA 1W2AX 4UFHA 1Z7S3 2VQTA 4HBNA 2EIDA 4QQLA 4K1YA 2VOTA 2WS92 2OIIA 1DQ4A 4CDQC 1H8TA 1NA1B 5FZDA 2ZMNA 1OHFA 2E6VA 1ONAA 2Y60A 3CF6E 3VD7A 4ASKA 3IBMA 1RUD1 4LLFA 5FK8A 2R0HA 2ZHMA 5FZIA 1AX0A 1S0JA 2J1TA 1WA6X 1HB2A 1O4YA 4IESA 3ES4A 3LA3A 1LHOA 3ZYJB 2XUEA 4UW6A 5FY8A 5I0UA 3U37A 3SNMA 1YQCA 4N43A 4LBKA 5BY5A 4EWEA 4WVMB 2PXJA 2CGNA 1JZ4A 2E53A 3BTAA 1CAUA 4I0BA 1T6GC 2PHXA 2ZGOA 5A7WA 1XRUA 4P02B 4D94A 5IVJA 3D3AA 4XJAA 1HQLA 3N3HA 1QJU3 3H7JA 1ND3B 1GOHA 2ZBJA 3CNAA 3PL0A 3RFRA 4DY3A 2JEMA 2JG8B 2C9AA 1PO12 3LZZA 2DWRA 1RUD2 3RI8A 2PAKA 2Z42A 3HNMA 3LOIA 4PQ9A 5I0TA 4PI0A 2ZGQA 4BQ3A 1UN1A 1XPWA 4LO5B 3KCCA 3OG2A 4BLIA 1HQWA 3UT0A 3DYMA 1CR7A 1H8TB 2DURA 1R083 2RS11 4O65A 4CXYA 2IC1A 3M3IA 1EUTA 2YBSA 2R043 4HMZA 4DY5A 1MVQA 1LHVA 4XDPA 1LU1A 3MLLA 3IAPA 2WDBA 2Y33A 1PZ7A 5A7SA 3UL2A 4AL9A 1G9CA 1PMHX 4LJHA 2ZX3A 4Q4W2 1OH3A 4YZ5A 5HI0A 4D6SA 1DG6A 4LO7A 1O4TA 4ZU7A 3OPTA 1AR83 4P5YA 3UJQA 1W9FA 3KV5A 4XMAA 3BGAA 4PIYA 4Y4YA 3VDDC 2NLRA 1K5MA 1HB1A 5AVPA 3Q8FA 3I3EA 1UYXA 2R32A 1OXCA 1W6PB 1AR93 1ZYBA 3FL7A 3POWA 1ZBA2 4PI2A 5JXHA 1XYPA 4ZS3A 1J84A 1REFA 1NG0A 5KBFA 3VBOC 4AQSA 3JBG3 5FK7A 2DUOA 4KGQA 1QKQA 1PNGA 2WC2A 1CZTA 2PLV1 3ZSLA 3ZN4A 4A7ZA 3LQCA 5CKQA 1X36A 4CSWA 1UD1A 4OZOA 2B7YA 1IZ3A 4COVA 1YFXA 3K3OA 4CCOA 4BM8A 5ERLA 5A6XA 4EN7B 1ENRA 1JUHA 5LW9A 5ANNA 4NIHA 1BVP1 2FZ2A 2N7GA 1JZ2A 2BU9A 1CPNA 4ZXEA 3VBRA 4LPLA 3M1HA 3ZFEC 1W0OA 3CMGA 3B9IA 4YNIA 5DUUA 3NJXA 1MZEA 3WW3A 1NA1C 1VMJA 3NNMA 5IAVA 5EXOA 4CPBA 3QLQA 1QWRA 1UNBA 5A3WA 1GP6A 4XHBA 2IUWA 1KEXA 4DO0A 4YVSC 1K5MB 2GP3A 4QXCA 2BW8A 4GQ7A 1WMFA 4QB2A 4LBOA 4MXVA 5FJKA 5FYBA 2XPJA 3NV2A 5IK5A 4PDWB 2PLV3 1X82A 2D93A 2HLEA 3LEMA 4UW5A 3VL8A 3MIEA 3ZFFA 4Z8BA 5GLWA 5FREA 4XC9A 3WNNA 2O8QA 4MXWA 2EF6A 4LO6B 2NN8A 1LAJA 1VBC1 2R16A 3E5QA 4FPEA 3AJYA 2ZZQA 5D1IA 4Q8KA 2IXLA 4IV1B 2BZDA 5BNQA 3WXPA 4IEVA 1RVF3 2Z5WA 2PQSA 3MW2A 4LORA 4XJ9A 3VBSC 1IG3A 1HRI2 3K46A 3PIGA 5C4WC 1C3HA 1WMEA 1LESA 1NE6A 2XJRA 1BBT3 1L7LA 1H8VA 2WWSA 4JQTA 1F8VA 2C9KA 2V4AA 3BYWA 5A3OA 5FZ6A 3GF6A 3N9MA 4L9BA 3PDQA 4LT5A 2DVFA 3IDBB 5JMOA 1OI6A 2VW2A 1UMHA 4DUWA 5K9YA 1NY72 1KS5A 1DGWX 4F3JA 4XQDA 2D40A 2ZPXA 5A3PA 3KQ4B 4OHVA 3D82A 2EAAA 3T1MA 1B35C 3NNGA 5FQ0A 1CONA 3TNPB 4JAAA 1X8EA 2R061 1PZ8A 3BKZA 1PK6B 2R072 2E7QA 5DDJ1 3ZFFB 5IK8A 1TNRA 3HQUA 2HYKA 3OJBA 4DQAA 2PHUA 2NZ9A 3ZDVA 4OUMA 2VZSA 5K4LA 4C1XA 1CZSA 2CNAA 2P2KA 3NNJA 5T3NA 3W20A 2ETEA 1O59A 3IWZA 4NHYA 1W9WA 2AEZA 3GZEA 3T0BA 1LODA 4RA0A 3AM2A 1WGPA 4FPFA 1QJEA 5FO8B 1MS3A 4YVSA 1F2NA 2RDQA 1VBE1 5F3CA 3AMPA 2HYXA 2HWC1 4HLTA 4W6XA 4NMIA 3O1TA 4R52A 1U5YA 4K7JA 2ZEXA 5LBCA 4S2FA 4E8DA 1W90A 2FDIA 3POGA 1ZBE3 3M70A 4HETA 1CJPA 2UWBA 2XB6C 2VZVA 4OI2A 4AVSA 2W47A 1RUC2 3DF0A 1MQTC 5JIAA 4RGKA 1HRI3 2L9LA 4J25A 2X10A 4ASMB 2TNFA 2UWAA 1YJKA 1QJY1 3B01A 2PHTA 2PHLA 2DCTA 2KA3A 2PFWA 3PIJA 5CIRA 2VU9A 2ZAHA 1BYHA 2D7FA 2JDHA 1C5IA 1GICA 4B4QA 3EQEA 4DUXA 5CB7A 1UL9A 3WNXA 3WF0A 5HV4A 1GANA 1JYNA 4JGZB 4ISRA 1H9PA 3MUY1 2W95A 1Q8VA 5K7PA 1RUNA 3WG1A 2WWUA 4G9SB 1LENA 1LNSA 3PUHA 4TWTA 1FPN3 4P9IA 2YC2A 2ZTNA 4PJYA 3KF5A 1BKZA 3LFMA 1UWWA 3VKFC 2RVAA 4CP2A 1AL21 3VZLA 1JYXA 1J59A 1N3PA 1OF3A 1UXXX 1LOBA 1KQRA 1SLTA 2UURA 2EVXA 5IAXA 3S0MA 2J1UA 3GBWA 1PGL2 1HXS3 2WYFA 2RDRA 5FPZA 1NAEA 1V6LA 1MVEA 4XZUG 4CCEA 1VLNA 1QJX3 4MV2A 1SCRA 5DAWA 5FLJA 2R062 5BUVA 1VAMA 1MEC1 2ZX0A 4XZPA 1QDOA 2VZUA 3LDKA 3LA7A 4XCAA 5F6KA 4X6RB 5FBZA 3B3QE 3WNPA 3ORJA 2GMEA 3OSDA 1YUDA 1OC1A 2WS93 1ULEA 4NROA 5B4XA 5TSWA 4P9LA 1QH6A 1V9U3 3HAGA 1H9WA 2OA2A 1O3RA 1RVF1 1C5HA 1YIPA 1QJY2 2QQWA 4NIAA 4WVVA 4ASLA 5D8AB 4LBNA 1EPWA 4LHKA 5JAXA 4QGNA 5E16A 4EWDA 4AEDB 3THDA 1RMU3 1W99A 2Y6JA 2WT1A 3INAA 1PGW2 1ZVFA 4UI9L 4CEYA 1JYIA 2VMGA 2OKXA 3M3CA 1S0EA 3H1YA 2CGPA 1UX7A 2JXAA 2WQ4A 5IVVA 2LM3A 1OQ1A 1PVC2 4OVEA 4XACA 1MZ5A 3J7NA 4XF4A 5CADA 4ARXA 1Y9GA 1UY1A 3U75A 3VKOA 2UYAA 1TQ5A 5IVYA 1V00A 3HOBA 5FKBA 4XETA 2QTWB 4GAZA 1JZ8A 4XIOA 1LECA 3N9OA 4ZZ8A 2BJSA 3NAPB 3ZFFC 2VXJA 1MS9A 3FLRA 1XNDA 3MEPA 3W21A 2VNVA 4OUEA 3HPNA 3R6SA 3HWJA 5B4NA 1QXRA 1KDKA 1QGLA 1R64A 2XG3A 1BCXA 1D4M2 5BXXA 4AZZA 1TZOA 1UOBA 4QDRA 4XDOA 5FTTC 5I91A 1PX4A 2W1WA 4MHRA 2DV9A 3WF3A 4YGDA 1OD5A 2P6HA 1CWPA 2G9GA 4N43C 2W39A 4QPIC 1REEA 2QKDA 4DIQA 5LEKA 2QQPA 1VALA 3K4DA 4HG6B 1AR91 3ZMNA 5HCBA 2ZAAA 2W3JA 4OI0A 5KHJA 5JDBA 1VBE3 1KITA 4LQRA 3K4ZA 2A6ZA 3DYPA 1UU4A 3ZR5A 4XF1A 4FQ4A 1JYCA 1UY3A 3Q8BA 4CEYB 1RUI3 1GP5A 2Y6GA 1UIJA 4D6RA 2D44A 3ACHA 1W05A 5JIUA 2HBUA 5JSPA 4HKWA 2BUKA 5F3GA 4JKMA 1XBFA 4MYEA 1W8ZA 1WW6A 3T30A 2WIIB 1YFUA 5FLIA 4HVRA 4AOCA 4A4AA 4EYUA 1VBD3 2DCZA 3KT7A 3WHUA 5ACA3 5B2GB 4LIVA 4WVWA 5T52A 3NV3A 4OULA 1EAH1 4AVCA 1DYKA 2ZHNA 3WDXA 5GLVA 4CPBD 4DXRA 1W2TA 3I59B 3WW4A 3JD72 3PVOA 1H0BA 3OPZA 1BVVA 5T55A 4QX5A 2ENRA 2BGOA 2P34A 2WFF1 1UOFA 3M4FA 5H9RA 1YFWA 5FZHA 4OHYA 4OFGA 1ODNA 1JOBA 2OQ6A 4KG8A 2XLAA 2GSYA
chains in the Genus database with same CATH topology
3SHRA 3LOBA 2CGOA 4FPOB 4COUA 4IL7A 4C90A 3OYWB 3ZXKA 1W2UA 1WLWA 5J96B 3AJZA 4A3XA 3MPPG 3X29B 3FUQA 1QU0A 4PLMA 1U12A 1HQNA 1LOGA 1IS3A 2YDEA 4AK3A 2DUPA 3H0OA 3ZMOA 4PIXA 1ZZ9A 4XILA 3WP3A 3H8UA 3GZUC 1LGBA 5C8CC 1Q5OA 2HWE2 4X8PA 2P17A 4AGVA 2AREA 4KWKA 1A6CA 1ULGA 4FPGA 2RMU3 1N47A 3KGLA 1ZZCA 4CDXA 2YC0A 3L2HA 4Q1PA 3WG3A 2WKKA 4NO4A 4CEWC 2QFEA 3Q9OA 2DTYA 3B7MA 3VN4A 4AVTA 3J9SA 4GIQA 5BNPB 3PVBB 2BNOA 1RUD3 2WA4A 5T5PA 5KC5A 5L73A 4L2NA 4XXAA 4L97A 4MH0E 3VBSB 1G9FA 3NKTA 4C91A 1C4RA 5GALA 1ND3A 2GH2A 1C57A 2XJPA 4E2GA 3J8F2 1RUH2 3N36A 2UY8A 3IIAA 2BVVA 5T5OA 4MX3A 2BGCA 4JQRA 3AB0A 4IEZA 1S0FA 3VV1A 3POSA 2CV6A 1LULA 1CGPA 1CD3G 4YM2A 2IXKA 1NY71 4BMBA 1VBA2 4GMP3 4K1ZA 2Q30A 4CEYC 3IN9A 4XF0A 3VBRB 3C2UA 5K0UB 1RUJ2 1OKQA 1C8M2 2XJSA 1HRI1 1WLCA 2WQZC 3VZJA 1L3JA 2GN7A 1Q3EA 5EFUA 4IETA 2RMU1 3ATGA 4IV3A 2XWBB 3LA2A 5C4WA 2JE9A 1U5IA 3KS7A 3VBSA 3MW4A 1ASJ1 2XLGA 2VOKA 2CYFA 1DGRN 2DVAA 2QZ3A 5A3MA 1LB2A 1EV11 1RUJ1 3TNQA 5CG9A 1UU6A 1R081 3OBRA 2A5ZA 2YPJA 4M01A 4WZFA 5FO7B 4MXWB 4HN0A 2D43A 4Q4X1 4B3NA 2R0FA 4DOUA 4MSVA 1AYM3 1URXA 3G6JB 2ZX4A 3HQXA 2GNDA 3JD73 4Q4X3 5F9TA 2D6OX 3WCRA 4SBVA 1VAKA 5DUVA 4IV3B 5C6CA 4WM8B 1AL0G 4Q0PA 1AXKA 4BMEA 1X7NA 1I3HA 2DVDA 3VHOA 1D2SA 1Y3TA 4I3GA 4I0WB 4CYDA 3J8F1 2HWE3 4EV0A 5LK7B 5C8CB 3PNAA 5FFOC 4OI1A 1MQTB 2UYBA 2XJUA 1WBLA 1EV13 1HLCA 2HEWF 1O4ZA 2QJVA 5KWRA 4HZFA 2TBVA 3PHMA 2OPKA 4QQOA 1UIKA 1CAWA 3WDYA 2R071 4XDQA 5DDJ2 3ZFGB 2ZGTA 4BA6A 3T1LA 2WLPA 1OQDA 4LBQB 4J1WA 4QQ2A 4FSJA 4IQPA 4AI0A 2R6QA 4UBHA 3QBQA 4IEWA 4UXAA 1WUVA 5C8CA 5C8WA 2X29A 3VZOA 4ZU5A 4BWOA 2X5IC 5AC92 2ZGPA 3LSEA 4E4SA 2WT0A 3E6CC 1N1TA 4EN0A 2H6CA 4WM8A 2WZR3 2DVGA 4C0BA 4URTA 1WCKA 1PMIA 3HD8B 5EYYA 1CAVB 3QCWA 3ZO0B 3M8LA 1H4HA 5HXVA 2ZA9A 4IEXA 4KNCA 3D4KA 1DQ1A 3HN1A 2GC2A 3NAPC 3R4UA 1LTEA 4HKOA 4LO4B 1AYN3 2QNKA 3FUOA 1EYBA 3AKRA 4XJUA 4AFAA 1WW5A 3IPVB 1UU5A 1CAVA 2CAVA 4FOWA 5SV5A 3K48A 3U07A 2PELA 1BZWA 4ZU4A 2B42B 3ALQA 1QJX1 1XXNA 4KWLA 3CJIA 3FZ3A 4S2HA 3JB4C 3WOGA 1PM7A 1COV1 4FBFA 3LAGA 4FPJA 3LCPA 3HMYA 3WP5A 5L36A 2NMOA 3V65A 3SITA 1DDLA 1VB2A 3NKGA 4Q4Y3 1ALYA 1HV0A 4Y22A 5FAXA 1QOOA 2VQ0A 2YV8A 2Z2SB 4JCKA 4LLOA 3NVCA 2VY0A 1OLRA 4L11A 1V6IA 1RHI3 1AJKA 3RS6A 2CWSA 2WFF3 4LBJA 3OCPA 1FNZA 3EO6A 4YZ3A 1QHDA 4Y24A 3CJIC 3FJSA 3JQWA 3JBG2 4E4ZA 1AF9A 4PBPA 1GQHA 4Y5Z0 4QU2A 1V6NA 3RQ0A 1FMD2 1I6XA 1J3RA 2IZWA 4C1WA 1QXJA 3O12A 4NWWA 2HWF3 1GLHA 4COYA 2IFWA 1FPN1 1O3QA 2RM22 4BE3A 4R4XA 1GZCA 3OTFA 4LBQD 2XJTA 1PHMA 4KBBA 5KHIA 1SEFA 2PHRA 2CTVA 2P3JA 4UW3A 1DQ6A 1HX6A 3OBTA 3NAPA 2WNUA 4EROA 1FMD3 2A6VA 4F83A 4B29A 4I01A 4GMP0 1R093 2C1FA 5A33B 3FBMA 4WM7C 1COV2 4CDWA 1LRHA 2WSUA 1PIV2 1K5MC 3IKWA 4RQPC 1RITA 1V6KA 3R4DB 4B8EA 3VBHA 4YG3A 3NW4A 4ONUA 4M3CB 3MYXA 2GAUA 4AEDA 2GH8A 2KM2A 1V6MA 2AH2A 4EN6B 2W08A 1MZ6A 3ZXJA 2BFUL 2D3PA 1AJOA 3M3OA 3MF6A 3B00A 5GLUA 3IT8A 5KC6A 1AYM1 2TUNA 3VGIA 1YRZA 5FCCA 4Q4V3 2YGMA 2ZGRA 2W52A 4PCRA 4AVVA 3M3QA 1Q8QA 4XQWA 3FE5A 1BBT2 5DXDA 2MEV1 4LA3A 2YUEA 2RS53 5CNAA 1SMVA 3D8CA 3VBHB 4LR4A 4I30A 1RUG3 3ZXDA 4AG4A 2QCSB 4D7YA 2QUOA 1IHMA 4H7LA 1RMU1 2HEVF 4MGIE 3ZIXA 2P3KA 3WW1A 5ACA2 4CDWB 1A8MA 4CEWB 1V6JA 3VZKA 3RJRA 1WBFA 2PYTA 1JH5A 4FCAA 5EYXA 2GU9A 2Z79A 3GHNA 2OYZA 1H2MA 1GZ9A 3PMEA 4P5HA 5IK4A 2UY9A 1D4M1 2D6KA 2PHWA 2JX9A 1G86A 1VRH1 3NV1A 3WQ7A 4Y1XA 5C33A 3I4IA 5AFEA 2WZR1 1RUC1 3OD0A 2XGXA 3LGRA 3VBUB 1ZX5A 1Z7S1 1YJLA 1D2QA 4XFAA 1NLRA 3R4SA 4E2QA 4RGGA 4UW4A 3KCYA 2Q0AA 1H8TC 3ROUA 3D5OA 1HIXA 1DU3D 4L8QA 2CWMA 1H1IA 2CAUA 4JV4A 4GA9A 4RS5C 1SBEA 5HCAA 4IXLA 1D4M3 2Q5TA 4WM7A 3V0AB 2VUJA 2XBO1 4BYYA 2Y38A 1UZZA 4QPGA 3NSTA 4CP0A 2UU8A 2BWCA 4PF5A 3UKVA 3B5LB 3AP9A 5K0UC 3IMNA 1RUE2 5GM0A 4BHPA 1TMF1 4ES8A 4IV3C 1PVC3 1OOPC 4Y1ZA 4WBBA 5DUWA 4DINB 3PVEA 4H55A 1MEC2 1R1A1 2DCJA 1G7YA 4IERA 2OW4A 3ZXAC 5BNNA 2R49A 3KSCA 1R082 1QXPA 2DU1A 4WM7B 4A7YA 5CFCC 2XBO2 3V0AA 1OSGA 2R1BA 3I59A 3WW2A 3CU7A 3R05A 4P9XA 2XJQA 3WDVA 3FWEA 2RE9A 4AWDA 3AP7A 2AR6A 2YROA 5J3UA 5IK7A 4QPGB 4FTBA 3VLBB 3VUOA 5JI7A 1CN1A 2CL2A 4NHLA 2K9ZA 2V73A 1A78A 3RJ2X 4YW1A 3J8F3 1AR73 3K51A 4GULA 1NA1A 1W0PA 3ZX7A 3KGZA 3EJKA 1LGCA 3AYAA 3ZFEA 4FTEA 3ME2A 5FLHA 4Q1RA 3VL9A 4FAHA 4XPVA 3TAYA 1RGSA 1VBD1 1YO8A 1N1YA 2A3YA 3NV4A 4B7EA 1U5ZA 3RWNA 1RUG2 1A8DA 3LWCA 2NMNA 5ACA1 4AI1A 5E1RA 4YGCA 4WZCA 2ZJCA 4IEYA 4Q0SA 4QHBA 2OUJA 4AW7A 3O0VA 4NN0A 4XFCA 3MFCA 1DQ0A 3HT2A 1WCSA 3MIFA 2XHKA 1AR72 2HWC2 1W6NA 2HWD1 2QVSB 3FFQA 1OA2A 1BQPA 3N7MA 1RJ8A 1WLDA 2VNRA 3FFZA 3VDDA 1CAUB 2JKBA 4GB33 4DXZA 3VKLA 3KLSA 1N1SA 3KQRA 4RL7A 2D5FA 2WFF2 3AP5A 1Q8SA 1AYN1 1FPN2 3P3NA 2E7TA 3APBA 4FP2A 3W9AA 3TWIA 3RYRA 4QQHA 1AVBA 4QPIB 1W6OA 4GB32 4GWMA 3KMHA 4R9AA 4BZ4A 2LUWA 1KJLA 2ARXA 4RHV1 4EWAA 2ZGSA 1BK1A 2WZPP 1PIV1 3JU9A 3M2MA 3RI9A 4XFGA 2GDFA 4IV1C 2BVBA 1XNCA 2WNUC 1RUF2 3PTYA 3G7DA 5DUXA 3D6EA 4LBQA 3KT4A 4R9BA 2P37A 4I09A 3AYCA 4AEKA 3FLTA 2FBEA 3EBRA 5EJ3A 2I2SA 1KXGA 3N7KA 5JLVA 3PLQA 4M0HA 1M4WA 3AKPA 1H1AA 1CESA 4DRRA 5FOBB 3H50A 2VMIA 2RJLA 1WMDA 1IPKA 2A73B 3OGJA 3ZSEA 5CFDB 4QT6A 1APNA 3DV8A 4CDUA 4YW2A 3S6PA 5KHGA 2RJKA 4D7SA 5F1RA 4DMIA 3O5SA 5JOXA 3NL1A 1ZRDA 1ZZ6A 3E6BA 2MNGA 2SLIA 1FT9A 1S1AA 4XFBA 4FAGA 5FO9B 3JQXA 1VRH3 4LEJA 3LB9A 2R041 2RMU2 2VXRA 3R0RA 2GNMA 1UW8A 1FOD1 3AZZA 2RS52 1FV3A 4FPKA 2XVLA 3IPVA 4PDWA 1RC6A 4YM1A 2WZR2 4YZ4A 3MPBA 1KDMA 3ELNA 1W6MB 1GYKA 2BPA2 1BEV1 4D7TA 4QM8A 4IV1A 3RNSA 1LHUA 1REDA 1ZBE1 2VOXA 3O7OA 4IEPA 2NM1A 3WZ1A 4YG6A 2ATFA 3C3VA 3IDEA 4J1XA 4AYUA 4FPYA 1EPZA 2WLQA 2ZABA 2IXHA 3HT1A 4FOYA 3NWKA 1VBE2 2ERFA 4AXOA 3MLKA 2QDRA 1J1LA 2IXCA 1AUYA 4ATEA 2D3RA 1S0BA 2WSVA 1OFNA 3O0WA 1YHFA 2D6MA 3MICA 4JRLA 1ND2C 1NQJA 4AQ2A 1DLLA 2A7AA 4H14A 1NE4A 1NXMA 1RTVA 2R063 2H6BA 4JDOA 4KH9A 4KL1A 5JCTA 4Q4Y2 4NR1A 2WNUB 3BALA 4GKXA 1FI2A 4W65A 2OZJA 4NPRA 3H1MA 4K40A 3GALA 3CJXA 3ZXFA 4QPYA 3TN91 1RMU2 1SFYA 1Z78A 2ZX2A 1MS0A 3NO8A 3TB0A 5HBAA 1ASJ2 3VBFB 3VBOA 4L99A 1RUF3 2PHFA 4KQ7A 1RUC3 3L9JT 5HCFA 3TRSB 5CVRA 4FXGB 4LHLA 4RS5B 5FMOS 2O8OA 2JG9A 2A75A 4J6GA 1QJX2 5E8AA 4ISQA 4RHV2 2ZMLA 1ZRCA 3D0SA 1JBCA 4K9SA 1XE8A 1PO21 4Y22B 1GFF2 2DTWA 2ILMA 1ZBA1 4JGYB 2WS91 3T2TA 3VBFA 4P14A 4B4RA 4COZA 2CY6A 4Q2FA 3MZHA 2LALA 1QJU2 4Y20B 3ZYPA 3GBFA 5BV6A 2GN3A 4LE3A 4XJ8A 4XE9A 2ZX1A 3AKTA 1OOPA 4QM9A 1I5ZA 2RS33 4JGZA 2HWB1 1QJZA 3B02A 3ACLA 4BIFA 2ZHLA 2EA7A 4YSFA 1VAVA 4QPGC 3E5UA 2D6LX 4G4FA 5C9AA 4BIOA 2JICA 1QOTA 5ABJB 3TBDA 2XKPA 4M3CE 1MR5A 4F7ZA 1HKDA 2HJIA 1ZZ8A 4RS5A 1PGSA 4WV8A 5JWPA 1NCQA 4FTSA 2AZ5A 3TYJA 1OOPB 3HR9A 4FVVA 4YYOA 2B39A 1IKPA 2Q1MA 2ZMKA 1B09A 4UBGA 4K21A 3ZVXA 2ES3A 4Z8BA 3DN7A 1AHSA 1FMD1 3ECQA 2VOWA 3V56A 4XF9A 5BYNA 4JGYA 4N53C 4BQ1A 2AYHA 3WQ1A 2VMHA 4Z2WA 4E27A 2G4IA 1QQP1 5BNOA 4S2DA 1OMIA 1M06G 2ZKLA 3O0XA 1KFXL 1PVXA 4Z82A 3SLIA 2ZGMA 4YZ2A 1QOSA 4NHMA 3S7EA 1KRIA 4YARA 1JXNA 1YLLA 3AKSA 4K8FA 2FZ1A 4OLLA 4CTEA 1I9RA 2K2SA 2B8MA 2DCKA 5CG8A 3I8TA 4F8AA 2H0VA 4JTNA 3J4UH 5FMOL 4E2SA 3PVNA 1RJ7A 2RM21 2D3SA 1FXZA 1DHKB 1GBGA 2RR13 3JD71 1N1VA 4R9DA 4ES9A 1MZFA 2Y0OA 3EHKA 3WUDA 1R092 2WNVB 3VKMA 3USSA 3DL3A 2X53S 4O9GA 5A32B 3GZAA 1AR63 5LRRA 4HVQA 3E6DA 1LU2A 2DUQA 3FHIB 5BNOB 4COWA 5E89A 5GZFA 1ZA4A 3MI8A 2P3IA 3B9CA 1CPMA 2UWCA 4OHWA 3RDIA 4Z07A 1VB4A 2XLFA 1EP0A 2HWF2 2FMDA 5E88A 3B94A 3H3ZA 4AEDC 4FQZA 3VBUA 3WT3A 3VBHC 4XQ4A 1PZ9A 1S0CA 1C1LA 4XFIA 1E57A 2IXJA 4Q0QA 4AFMA 2PLV2 3QH6A 4LHNA 1OA3A 4X6QB 3N7LA 5H9QA 4CDWC 1LEMA 2RS31 1FOD3 1TME1 3N35A 4A2UA 2QE3A 3WR0A 3WQ0A 4DS0A 2EXKA 4AFDA 1W6NB 5CA6A 3OYWA 1HRV3 2JECA 4HPKB 1UAIA 2VQAA 4R8HA 2I45A 2MPFA 3VDDB 1SBDA 4OUSA 4RR3C 1FOD2 3ZPYA 2F6BA 2PA7A 2NP0A 4E9KA 4AI2A 2TEPA 5IT6A 1IKQA 4YZ1A 4N7UA 2Q8OA 1NQDA 3ILRA 3ST7A 1CIWA 4YVWC 5L7OB 1U0AA 3VZMA 5FRAA 2E51A 4QPIA 1KFUL 1GZWB 1SACA 2Y0IA 5JOYA 3MF9A 1V70A 4RFT0 3TN93 1RUE1 2R30A 3WG4A 1PO13 4GH4B 2ZHKA 2VGDA 4P9GA 2HWE1 3ZYRA 1DGRA 4SLIA 3ZFGC 1FV2A 3ZFEB 5BPXA 1LR5A 4RGAA 5L7OA 4AHYA 1POV3 4LE4A 3AK0A 4XMIA 3J26N 2X5IB 3DPRB 1FX5A 5H9PA 2GC0A 1CJDA 2ZGUA 3U4XA 5A3LA 1RUH3 1IGOA 1MS5A 1YFYA 1S0GA 4XHXA 4H3WA 1JUIA 2R042 4GH4A 3AZXA 1V9U2 3AMNA 3JZVA 1QNWA 4META 1CAWB 1PGW1 1C8M1 3V64A 5J98B 1UMZA 1FAYA 1BMV2 3TN92 2YYOA 3CO2A 4GB31 4FP3A 4XXPA 3MIHA 5KXDA 2IFRA 5K0UA 5AFBA 3PMSA 1ZBE2 1GZWA 1C1FA 1UPIA 1RVF2 1S0IA 1VIWB 2I07B 4N9IA 5EZWA 4MLOA 1XYNA 4BLJA 1OLQA 4Q0UA 5LRSA 5JSOA 4QMAA 1PNFA 4O9EA 4NHKA 4HSJA 1ZZ7A 5KXBA 1G9AA 5C4WB 2VUAA 5I0SA 1EY2A 2RM23 3OGGA 2WT2A 3VBUC 2ZGKA 3QOPA 5JVVA 5I8YA 4TZDA 1ASJ3 1H1MA 1MS1A 2D6NA 1RUE3 4S2GA 1ND2B 4XEZA 4YRDA 3DPRA 2WFPA 1BBT1 5GZGA 3JUUA 1B35B 1SCSA 5JZGC 1S0DA 4KU8A 2Q4SA 4XYXA 3BU7A 1QQP2 4PLOA 3AMQA 4P9WA 1AXZA 2D98A 1QY4A 2DVBA 4Q27A 3AYDA 4AGGA 1QMJA 3WINE 5GZEA 4CDUB 2FQPA 5JOZA 3B69A 3AXEA 3WLUA 2VNGA 1MQTA 3WP6A 3UJOA 3CJIB 4CZSA 3PJQA 2D5HA 1JHNA 1S2BA 2B5HA 3QACA 3MIGA 3AZWA 4KG0A 4MGKE 4OHXA 3RPQA 3VBOC 1NLSA 3UKNA 3KM5A 3BB6A 3HIFA 3KB5A 3ZIWA 2BNMA 1RIRA 2FMYA 3KZ4C 1LOCA 3BIWE 4BH9A 2WINB 2JG8C 2A6XA 3BOPA 1VBC3 3SXWA 2AENA 2MEV2 1N3QA 1F5JA 1YNAA 1ND2A 3VZNA 3ETQA 4HVOA 4LO8A 2VW1A 3GHMA 4JGYC 4N53A 3A0KA 4HL0A 1QNYA 2DYCA 4AI3A 1KD7A 1HDKA 2VNOA 1WW4A 1D0HA 5J09A 1W6PA 1NCQC 1ZRFA 4RQPA 3FC0A 1EAH2 1GNHA 1YYNA 2ET7A 4HANA 4OZXA 3SMHA 3JBG1 3USUA 4COVA 1AYN2 3IM0A 1V6OA 4Q0VA 1XU1A 2ZGNA 3H7YA 4AEMA 1AR61 2EXHA 2EXJA 5GZDA 3VHRA 4XFFA 4FPHA 1HXS1 1DGWA 1TEIA 2VH9A 3THTA 1C8NA 1GSLA 3JCIA 4CP1A 3FBYA 1J3PA 4M3CF 1EAH3 4AVAA 2VULA 1JN2P 5DG1A 5GJ6A 4I3PA 4FOQA 1LOAA 1G8WA 1A3KA 1CQ9A 3QD6A 1AR92 4KU7A 4Z92B 1R1A2 1H2KA 2PAMA 4N53B 1RUG1 4JVAA 1UX6A 1O3TA 1R091 4QD2A 2A70A 4PDWC 5L19A 4MZUA 5I8TA 1VBD2 4AGRA 2KXLA 3V0BB 4I2OA 1OA4A 1YCIA 1QJY3 3SCHA 5C9AB 1VBB3 3AP6A 4CDXC 1QQP3 4W6YA 4B7KA 4TYSA 4XW3A 3L2YA 3WV6A 1G9DA 3ZXEA 1LOEA 4MVTA 4CDUC 1AR71 4XTPA 1O7FA 3WCSA 4QGLA 4K6BA 1DFQA 2EALA 2ZZJA 1DZTA 1RHI1 2JD4A 1VBB1 3VBOB 2WJSA 1DIWA 1FNYA 1JOJA 3WY6A 3RG0A 4HSLA 4XJZA 5GZCA 2IWGB 1KJRA 3BOWA 3WG2A 4Q4Y1 3KD4A 1GV9A 2XJVA 3M7AA 1ENSA 1LGNA 3LSDA 2JG9B 4KGGA 3A0NA 1HRV2 1PK6C 3V0BA 2GZWA 1OQEA 4HFSA 4XF3A 2QDNA 2PAEA 1PK6A 2VW0A 4EJRA 1LKNA 4LTAA 4ZKTB 3SCFA 4FPCA 2BEOA 1V9U1 4Q26A 3AYEA 1XNBA 3SISA 2ARBA 2YZ4A 4NOTA 2A6YA 2VVEA 2VG9A 1SBFA 1DF0A 4L92A 1NCQB 4AQTA 4GKYA 3NJZA 5A33A 1LEDA 1S55A 2V09A 3GBGA 2Z69A 1MEC3 4LBLA 3MW3A 1DBNA 1Q8OA 1TMF2 4GH4C 4I0AA 1VP6A 1H4GA