1NCQC

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
236
structure length
236
Chain Sequence
b'GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHTKDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGPALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDTYTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
molecule tags Virus
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 38
structure length 236
sequence length 236
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ncqC00
4CEWC 4YVSB 1QQP3 1AR92 4FSJA 5C4WC 2MEV3 3CJIB 1QJU3 4FTBA 1FPN1 4YVWB 1K5MC 1PVC1 2PLV3 1R093 1RUH3 3VBOB 2VQ0A 1RVF2 2HWF2 2RS52 4GMP1 1HRV1 2FZ2A 1TMF2 1R083 3JBG3 5CFCA 1AYM1 1EV11 5DDJ3 1MEC2 3VBFA 1COV2 1CJDA 2RS12 5BNOA 1M06G 1OHFA 1Z7S2 1RUJ3 1HQNA 4IV3B 3VBSC 1QJU1 2GSYA 4AEDC 1VBA1 4GMP0 3DPRC 1RHI1 4GB31 4QPGC 4JGZC 1EV13 4IV3A 2WFF1 4CDWB 5CFDA 2RM21 2HWF3 1C8M3 1K5MB 1QJX2 1AR62 2XBO1 2R042 4JGYC 1OOPA 1ZBE3 1EAH2 1VB4A 1VBC2 4QPIA 2BFUL 1H8TA 1AR72 1PIV1 1VBE2 1VBA3 1OOPB 1NG0A 4Q4W3 3CJIA 1RUI3 5BNOC 2RM23 1RUJ2 4IV1A 3ZFGB 2HWF1 2ZAHA 1E57A 2WFF3 2R061 3VDDB 5BNPC 1R1A2 1VBB2 1BEV1 1HRV2 1RUC1 1BBT2 4N53A 5C8CC 3JB8A 4RS5A 4CDWC 5FMOL 4NWVA 1AR63 3LOBA 4FTSA 1QJU2 2XPJA 1HX6A 1VRH3 4QPGB 3S6PA 4Q4X2 1VBE3 1POV0 4CDUC 5BNNA 1RUH1 2R043 3ZFFA 5L7OB 2RS31 1RUG1 4CDQB 1C8NA 1AR61 4RR3C 1F8VA 1OPOA 3VBRA 1X36A 4CEWA 2WZR3 2BUKA 1VBE1 4WM8B 5C4WA 2HWC2 1MQTC 1RUF1 4RQPC 4YVWC 3JD73 1WCDJ 1NY72 1AR82 1D4M1 3JD72 1R092 4Q4V1 4Z92B 1R1A1 2RS33 4YVSC 1PO13 1RMU2 1FOD2 5CFCC 1TMF3 1PGW1 1VRH2 1VBB1 5J96B 2QQPA 2RR12 5CFCB 5AC91 1Z7S3 1COV3 3J8F3 4QPGA 5C9AB 4JGZA 1R1A3 4RQPA 1AL0G 1POV3 4BCUA 5AC93 3DPRA 5C4WB 4QPIC 1AL23 1B35B 4RQPB 3TN91 1RMU3 4CEWB 4IV3C 1RHI3 5ABJC 2TBVA 2HWD2 1AR91 3ZFGC 1BMV2 4JGYA 1RUI2 2R072 1AYM3 5L7OC 1VBD2 1RUD3 1AL21 1PGL1 2Y26A 5DDJ1 3VDDA 3JB4C 1RUD2 2BBVA 4JGYB 5JZGC 1RUG2 1QJX3 1PGW2 3HAGA 1MQTB 1NCQA 4Y4YA 1FOD3 1MEC3 1AR73 1FPN2 5J98B 5C8CB 3FBMA 4CDWA 1ASJ2 4CDQC 1TME3 5FOJB 1VB2A 3VBRC 4FTEA 1QQP2 1MEC1 2FZ1A 1RUE3 1NCRB 1HXS1 2HWD1 2RR11 5K0UB 1PO21 5JZGA 1RVF3 1DDLA 3VBSA 1BEV3 1RUC3 4RR3A 2WS91 1VBD1 1NCRC 1TME1 1BBT1 1SMVA 1RHI2 3VBRB 4Q4X3 5K0UA 1QJY2 4YVSA 1QJY3 5JZGB 3J8F2 1PO12 5ACA2 4N53B 4YVWA 2XBO2 1PGL2 2HWE2 4RS5B 2HWE3 1ASJ3 1C8M1 1FMD2 4EJRA 1A6CA 4Q4Y3 1BBT3 1D4M3 2WS93 1EAH1 1VBC1 5FMOS 3VBFB 5D8AC 1PIV3 1ND2A 2R062 1AYN3 1RUI1 4N43A 1RUG3 1QJZA 1ASJ1 4RFT0 4LLFA 1RUE2 1FPN3 2HWC1 5A32B 1QQP1 3ZFEC 1RUF3 4WM7A 5K0UC 2MEV1 2RMU2 4Y5Z0 1VBC3 1EAH3 1NY71 4N43B 4CDXA 4RHV2 2RS51 3DPRB 3ZXAC 3JD71 5ABJB 1K5MA 2ZTNA 5BNPB 1ND3A 1EV12 1NA1B 2PLV2 1HRI2 1R081 4QPIB 1W39A 4GH4A 5ACA1 1V9U1 2IZWA 4CEYC 2R073 4PDWB 1RMU1 4IV1B 3ZFGA 1COV1 2RS13 1Z7S1 1VAKA 2ZZQA 1X33A 4AEDA 4PDWA 1VBA2 3ZFEA 3NAPB 4WM7C 3VDDC 2WZR1 1FMD3 1MQTA 4JGZB 3VBUA 1NCQB 5CFDC 2WFF2 3VBOA 1R091 2XBO3 5A33A 4CDUB 4SBVA 3ZFEB 5GKAC 3TN92 1RB8G 2RS11 2WLPA 2GH8A 1HRV3 4GH4C 3VBHC 3NAPC 4WM7B 5A32A 1NOVA 1CD3G 4NWWA 4CDQA 5D8AB 4IV1C 1FMD1 1AYN2 4Q4W2 4RHV1 1NCRA 1BMV1 1NA1A 1ZBA2 1V9U2 1ND3B 5C9AC 4PDWC 4WM8A 1QJX1 1R082 4GH4B 1HRI3 4GB33 4RS5C 2RR13 1AR71 1PIV2 2X5IA 4RHV3 2HWC3 2R041 2MEV2 2WZR2 4CDUA 1RUJ1 3TN93 2BPA2 1AR83 3VBUB 3ZFFC 1RUH2 1BEV2 1RUC2 4CEYB 2R063 1HRI1 5A33B 1AR93 5DDJ2 3VBHB 1V9U3 1ZBA3 1PO23 1PO22 5C9AA 5D8AA 3VBFC 1D4M2 4CDXC 1ZBE1 1TME2 2BFUS 1ND2B 3VBSB 4Q4X1 1NCQC 1GFF2 1ND3C 1QJY1 1AYN1 1AR81 1OOPC 1H8TB 5CFDB 1VRH1 4CDXB 4GMP3 1B35A 1TMF1 2HWB2 4Q4W1 2HWE1 1VBB3 3JBG1 5AC92 2RS32 1FOD1 1ZBA1 3CJIC 3J8F1 4Q4Y1 1IHMA 5BNPA 1H8TC 2X5IB 1PVC2 1RUF2 4CEYA 4AEDB 1HXS3 2DF7A 1POV1 5LK7B 2RM22 1RUE1 1RVF1 1HXS2 2HWD3 2RMU1 1PO11 5BNOB 1B35C 2WS92 4Q4V2 4Q4V3 5BNNB 2HWB3 2WWSA 1VBD3 4N53C 5C8CA 3VBUC 1ZBE2 3IDEA 1AYM2 3NAPA 3VBHA 2RS53 3VBOC 1C8M2 5ABJA 3M8LA 4GB32 5ACA3 1RUD1 2RMU3 3ZFFB 5L7OA 1NA1C 2R071 3JBG2 1PVC3 2PLV1 2HWB1 1AL22 4WM8C 5BNNC 1AUYA 4Q4Y2 1ND2C 4N43C 4RR3B 2X5IC 1F2NA
chains in the Genus database with same CATH superfamily
5H9PA 2JENA 3NKGA 4AE2A 1ZZ8A 2JDUA 4L8QA 4FFIA 2WO7A 4MG2A 2YBSA 3N9MA 5JOYA 2J1VA 2WT1A 1QJU3 2XJVA 1VMHA 3MBWA 1PGSA 4B4RA 4YVWB 2R6QA 1A78A 3T08A 1I5ZA 4D7YA 5HPOA 4MXWA 2ET1A 2ZGKA 1RVF2 1T2XA 3T0AA 2Z4FA 5FZ1A 4HPKB 3OBAA 3O5SA 1HRV1 4FP2A 3FX3A 5FZFA 1CPNA 1R083 4LK7A 4QHZA 3HN3A 3OPTA 3O1MA 4BIFA 4Y4RA 3VL9A 4OYUA 2JB8A 5CFCA 4JKMA 3H1YA 3AP5A 5LY2A 3AKTA 4BOWA 4IESA 1ULDA 3F2ZA 5KXDA 4Y26A 3VBFA 1GZWB 1LOGA 3ZYGA 1OHFA 1UY4A 4TZDA 1RUJ3 5EPAA 4EE2A 4K3UA 4OCTA 4FPLA 4GA9A 2WZEA 3PUAA 4O61A 5BUVA 3GHMA 4FAGA 1DFQA 5KXBA 3ZPOA 3DPRC 3S7EA 4YZ1A 2FBEA 4P9LA 2RDSA 1T6GC 3AP4A 2DURA 4GB31 2Y34A 3GBFA 4MH0E 1NE6A 4UW6A 5C3QA 2AC1A 1LNSA 1UMHA 1ENSA 2VR4A 4HVQA 5CFDA 2W1WA 2HWF3 4W65A 4Y20B 2DCYA 2LROA 1AR62 3QBQA 4QDQA 4LBOA 4YW7A 1VBC2 1LOFC 1ZZ6A 2P3YA 5L9VA 3WQ1A 4KBBA 1H8TA 2LS6A 4DXSA 5JXHA 2Z69A 1Q8PA 1VBA3 2BTVC 1YC61 1N3OA 4XIOA 1UQXA 1FNYA 1NG0A 5DG2A 1JODA 1RUJ2 3T0BA 4M3CB 4UI9L 3NNJA 3L2YA 1PZ9A 2QQLA 1W28A 4QX3A 1VR3A 2WQ4A 2B46X 3ASIA 2VCAA 3FZ3A 5LASA 4FPCA 3VD5A 5BNPC 1S0CA 3WF4A 2XKOA 4LXLA 3HOBA 1W6PA 2CSGA 1UOFA 3K3NA 2WDBA 4XZUG 4QDRA 4XDOA 1GWLA 4Z82A 5GLWA 1AHSA 3GCXA 3PVOA 2QKDA 3ZYRA 2YU2A 3JB8A 4BQYA 4B1LA 1G6NA 4CDWC 4S2GA 3CEWA 3D5OA 5IYYA 4LK6A 1GSLA 3HVDA 3LOBA 4PLOA 5FPXA 4FTSA 1QJU2 3H8XA 1HX6A 4FPKA 4KG0A 1M4WA 4ZXKA 1HIXA 3OJBA 4QB2A 2XJSA 3ZR6A 5J09A 1YQ2A 1VBE3 4FOVA 2YPDA 4JHTA 2BOJA 2VQAA 4RL7A 5FJKA 4NHMA 3VZLA 5T5LA 3RZKA 1ZA7A 2VJXA 5FPZA 4ASKA 4B4QA 3NNFA 3BTYA 2C0ZA 2FQPA 3DXTA 4KG8A 4B29A 4A7KA 1RUG1 2DVDA 4CDQB 5CKNA 1SFNA 3LZZA 1XNAA 4F83A 1F8VA 1MZ5A 3HR9A 1OUSA 2V72A 1KGYA 5DAPA 1OT5A 1V6JA 4BE3A 4YG0A 2KXLA 3E5QA 1ZZBA 1HB2A 1PMIA 4ASMB 1MQTC 3WG4A 1LKNA 3WX5A 2VZSA 4UYBA 3LDBA 3EQEA 3Q8AA 1J3RA 2BEOA 1FX5A 2B5HA 4RFRB 2EIGA 5EYYA 2CHHA 2P3JA 3OSDA 5E6HA 2JDNA 1O3QA 1SHWB 1FOD2 2ORZA 2W94A 2ZHKA 4HETA 4JX0A 4NAOA 1PGW1 5FZ0A 3BVCA 3UYJA 1ZREA 2QQUA 3IB3A 2R32A 4XIKA 5FZ8A 5F6LB 1YFUA 1S2BA 4NROA 3ZM8A 1KEXA 4Y1UA 5FO9B 3N4MA 4AFBA 4D8MA 5KXCA 1COV3 1W8FA 1OVPA 1UY1A 3J8F3 2YBPA 3W5NA 5FYCA 5BYNA 2YY1A 3KMHA 2PHLA 4DMIA 2D3PA 1ZRCA 3INAA 2MPFA 3DXUA 1QDOA 3O1RA 1CZTA 2VCCA 2H0BA 5I0TA 3ZSEA 1AL0G 4AQ6A 4CP9A 1REDA 1MS0A 1POV3 3ZX7A 5LCWL 4X8NA 5AC93 1UF2C 4K8RB 5C4WB 4RA0A 4FAHA 3WG2A 3HQXA 3S30A 5T5JA 2JWPA 4GKYA 4LR4A 1OA3A 1W6MB 4HOOA 4R9DA 3TN91 3WP4A 3M3IA 4CEWB 2YROA 2VZQA 3RI8A 5C8WA 1YQ6A 3AXDA 1JOPA 2TBVA 3R05A 2FHRA 4YM0A 3ZFGC 4AXOA 3V64A 1VMFA 1RUI2 4AQ2A 3OGVA 5FYYA 3AK0A 1RYYA 1WD4A 1AYM3 3ZN4A 4XFCA 2LM3A 3I3EA 1AL21 5F7UA 1TZOA 4AAPA 3RQ0A 1RIRA 2E51A 3A0NA 4UFLA 3JB4C 4AK3A 1SG3A 2JDYA 3GXUA 4Z07A 2BBVA 3MYXA 3PVBB 1E5HA 3ACIA 1N1VA 1RUG2 2G19A 4QB6A 1QJX3 1DHKB 4YGCA 4I09A 3T3YA 3HAGA 1GQGA 4J1WA 2CAVA 4YGDA 2QZ3A 1DZQA 3HMYA 3WP3A 1DYKA 2YHJA 3HQRA 2AH2A 3VZKA 1OFSA 4LO5B 4S2DA 4F3JA 5AVPA 1GP4A 4IQPA 4LMFA 4XTMA 3KS7A 4CCLA 4EN6B 3AJYA 1LTEA 3S5QA 2O0OA 1HN1A 1PNGA 1CAVB 1VB2A 4I0AA 5IWFA 4QX2A 2ZGNA 3NNMA 5JMCA 3GHNA 4W6XA 4IEUA 4AHZA 2VZVA 5DAWA 4LT5A 3DN7A 4TWTA 3ZN6A 3DKQA 4HFSA 1NCRB 3LA2A 2B9UA 2X29A 4A41A 3TEXA 4DIQA 1PO21 4ZZ8A 4JRAA 4JTNA 3I49A 2WYFA 1DDLA 1H4HA 3MO4A 3VBSA 2JE8A 3MLLA 4RR3A 1W2OA 2WS91 3ZYJB 1VBD1 1FNZA 4XABA 4FPEA 2KM2A 1ULOA 1SLLA 3T09A 3ST7A 2I2SA 5LZ6A 2AGSA 4C1XA 1SFYA 1O91A 2EIBA 2YXSA 1PK6B 3VL8A 5ACA2 1EUUA 3J7LA 4RD7A 2HWE2 5F5CA 3P3PA 2OUHA 4O9EA 4LPLA 1H1IA 4KWUA 5IUQA 1C8M1 3THCA 1FMD2 1UKGA 2FCUA 4LBKA 1RITA 1W2AX 2WO2A 4M01A 2WS93 1GLHA 4UFIA 2P6HA 3B9CA 5F8PA 2ORXA 4KMQA 2Q30A 3BTZA 1XNKA 2RDRA 3HN1A 4YM2A 3SQOA 1MACA 1PIV3 1ND2A 1W6OA 2C1FA 4K40A 2ZZJA 1QJZA 1ASJ1 1S0DA 4HXCA 3VZOA 4ARXA 3MW4A 3KQRA 4KL1A 5JAXA 1GICA 1S4CA 5J1XA 4PI2A 5FZGA 1QQP1 1RUF3 2VCBA 2MEV1 4OUSA 1MZEA 5FXVA 1EAH3 3AL6A 3FLRA 4N43B 2X05A 5JSRA 2ZOEB 4RHV2 1JZ2A 3H9AA 3JD71 5JSOA 1WCKA 2YV8A 2ZX4A 4AHXA 3LE0A 2VMFA 4X6QB 3MF6A 3I2OA 1ND3A 5EJ3A 1LOEA 5ERLA 4KBZA 4AFDA 4GKXA 3I8TA 3ZLIA 4ES9A 3ZMOA 2BU9A 5FUNA 1W8WA 2IZWA 4JRLA 4K1YA 4OFGA 4QM8A 5F39A 2D3RA 2R073 1JTZX 4OI2A 1RMU1 1JZ5A 3ALQA 4IV1B 2F4PA 2G9GA 3LCPA 4Q1RA 1JYTA 5K4LA 2RS13 4DRRA 4MYEA 1CVNA 1LU2A 1PVXA 4NMIA 1REEA 1WMXA 2PAKA 5I93A 5C33A 3WLUA 1UX6A 4QGLA 4URAA 1VBA2 1GNZA 1I9RA 2ATFA 2GC1A 1V6NA 3DGTA 4NRMA 2IFRA 4NHXA 4EWDA 2IWGB 1DYOA 1CR7A 4ISRA 4RGGA 1QIQA 3U4XA 3VBUA 1BHGA 1NCQB 4CU8A 1MS4A 3NL1A 5CFDC 5DAXA 2E9QA 5C70A 2XBO3 1ZRFA 5FZLA 3KCXA 1NLSA 3D3AA 3KM5A 1E5RA 1UXZA 2WNVB 3O7OA 5EV7A 4XJWA 5GKAC 3N9LA 5FMBA 3SCGA 3ELNA 5FQ0A 3ORJA 1JYVA 1V00A 3FLTA 3N35A 2IFWA 4XZPA 3ZDSA 3CDZB 3VDCA 2XJPA 3NAPC 2PHTA 4WM7B 4BDVB 1YWKA 1NOVA 4FPGA 4AGRA 5EZWA 4C0HA 5JUVA 1H9PA 3ZXDA 4Y1ZA 3L2HA 1ODMA 3PURA 5FK8A 5HXMA 1BZWA 4CP2A 4NRPA 5HCFA 4RHV1 3WNXA 1O8PA 1BMV1 1ZRIA 2J1AA 3LIHA 1V9U2 5FZ3A 3BYWA 5C9AC 2WNUB 3OEAA 2EAAA 2EIEA 1R082 4YG3A 2YBKA 3WXPA 2D6OX 2XVGA 1HJGA 2D97A 3W20A 5C5UA 2A1XA 2J1EA 1DGWA 2RR13 2WR9A 1UY2A 3ZO0B 2ZEWA 4HPKA 5FYMA 1AR71 1GZCA 1OQDA 2VU9A 2X5IA 4NRQA 2DU1A 2WRAA 2ZXQA 2SLIA 3FHQA 3I59A 1F15A 1H8VA 2GN7A 2R041 1W99A 2XLGA 4LEJA 3ZXEA 4YRDA 3E97A 3PIJA 1WA4A 4IE4A 4CDUA 4LBQD 4CA9A 1SLAA 3TN93 3AFGA 3IIIA 3RWKX 1CZSA 2V73A 5A7OA 2BPA2 1RUOA 4XXAA 5C6CA 4J1XA 1QJFA 4K7JA 4FXKB 1MVEA 1I1EA 1JU4A 2JDAA 3KHBA 1BEV2 1RUC2 4HN0A 2XXZA 2VVDA 2VE1A 1VLNA 3EB7A 4P5YA 4YZ4A 5FWEA 5F1RA 1KS4A 1FAYA 2WKKA 4KWLA 5I8TA 4UFJA 1Q8QA 4ZPIA 1F4HA 3WUCA 5A33B 1AR93 3AM2A 3GYDA 4N7UA 1ZBA3 1G7YA 1SBEA 1J3PA 4XILA 1YXWA 2YZ4A 2ZGQA 3JUUA 5D8AA 4MXVA 5FZEA 3ZKUA 1KS5A 3PUIA 1RJ7A 1KITA 2BGPA 4QQLA 1ND2B 3VBSB 4BU2A 2BJSA 4Q4X1 3ZKYA 2ZACA 2R0FA 2EF6A 2HEYF 1GFF2 1AYN1 4YW1A 4OZOA 1H8TB 5FP9A 2NMNA 4CDXB 4DRVA 4N9IA 3G6JB 1B35A 4FI9A 2VTXJ 1WMFA 3HT1A 4QWNA 4CU7A 3JBG1 2JDHA 1JUHA 3WW1A 4A7YA 1XSQA 2QQJA 4COVA 1ZBA1 5KHJA 4B8EA 3NJVA 4IETA 3WQ0A 4JCKA 1IHMA 2Y6JA 1JI6A 1VMJA 1UYXA 4QX8A 3UETA 4B1MA 3E6DA 3PJQA 4HONA 4IE5A 1O4YA 1GV9A 3KF5A 1X82A 4XUOA 3ZYHA 4O65A 4AI3A 2BGCA 2P3KA 1GQHA 1ZZ7A 2D5FA 4LE3A 4CEYA 1ULGA 4MZUA 1X9PA 1X9TA 1HXS3 4JDNA 1GOFA 4N7IA 4Y1VA 1RUE1 1NT0A 4HBNA 4IW3A 2DFBA 3AP7A 1ST8A 1HXS2 1Y9QA 2HWD3 3MLJA 5JMOA 1WMDA 2X53S 3OD0A 4Q0PA 1REFA 1Y43B 5HXVA 1O8SA 4D94A 1O3RA 1QY4A 3DUIA 2BGOA 3KHCA 1IS4A 2HWB3 4ORFA 1J58A 1ZBE2 4HSLA 4LQRA 2RS53 2NPIA 2CU5A 1C8M2 5J7MA 2XJQA 2XOMA 2BNMA 4GIQA 1YIFA 1OLRA 4IL7A 4P5HA 2VTFA 2OW4A 2VUCA 4WVVA 2VTXA 3B9IA 1TVGA 3S57A 1LENA 4ONUA 3ZFFB 5F32A 2ZMLA 2Y0IA 1H9WA 2BWAA 2E7AA 4W6WA 1QH7A 4C90A 1PVC3 5KHIA 3I2IA 1SEFA 4DOUA 1CAUA 5A1FA 1NUKA 1H0BA 3OG2A 2VW2A 4Q4Y2 3Q8CA 3GZTB 2E33A 3NSTA 1MS1A 1LHWA 2K0GA 2W47A 2VECA 3B93A 4DY3A 1MZ6A 4RR3B 1UYYA 2QDNA 1XE7A 1MS3A 2DVBA 5DABA 3RS6A 4AGGA 4BQXA 1J59A 4R9CA 4CEWC 1G86A 3SISA 4YVSB 2YC2A 3LEMA 4D69A 2E31A 4FT8A 3M3EA 1AR92 2B45X 4FSJA 2MEV3 1DG6A 2P34A 1LHUA 2UY8A 4FBFA 4R9BA 2DVFA 1K5MC 4P08A 5FYUA 1PVC1 4HVOA 1R093 1HB1A 3TNPB 5FY7A 1H1MA 5FY5A 5IATA 1A3KA 2HWF2 2GU9A 4XXPA 4URTA 3O1PA 4QHOA 1TMF2 3WG1A 1YFYA 4XJ8A 2W95A 2W1QA 1W0OA 3Q8FA 1AYM1 3URFA 3H7YA 4C0BA 3SLIA 4CCJA 1DQ2A 1TNFA 2RS12 3KT7A 2P5BA 1M06G 4E2SA 3A23A 2XDVA 1HQNA 4IV3B 1ULCA 4AEDC 3LQCA 1F4AA 2J1TA 3GZUC 4XTPA 5L9BA 5A1AA 2DVGA 1RHI1 4XUPA 4L97A 1BVP1 1Q56A 4JGZC 1JU3A 1CESA 4IV3A 3WQ7A 4WBBA 1PK6C 1Q3EA 1O4TA 5F9TA 2WSUA 5FXWA 3QD6A 4B7EA 4Y5TA 2R042 4JGYC 5FY0A 1EAH2 2IVJA 4QT6A 4QPIA 4R9AA 4RYDA 4AFMA 2ENRA 1Q5OA 2BFUL 4UBGA 1PIV1 2XR4A 3B3QE 3VN4A 5FJHA 2D6NA 4QGNA 2WQ8A 2WSVA 4LIVA 5CU1A 4OQ9A 1V6LA 2NP0A 2DCJA 3CJIA 3VZNA 2RM23 1PX3A 3PHMA 3KVAA 4IV1A 1LESA 5IVJA 3RMXA 3VD9A 2ZAHA 2BQPA 4IERA 2K9ZA 2QQWA 3AYAA 3WCRA 4B7KA 3GZEA 1G9AA 1R1A2 1UZWA 2PHUA 4FVVA 2RDQA 1MVQA 4C8DA 2EALA 4NPRA 3U1XA 1C5HA 2ZHMA 4GQ7A 4CYDA 4BMBA 3P5BA 3I3MA 4I0WB 1J3QA 2XJTA 2V5DA 2WO3A 5FMOL 2Y6FA 3H8UA 1S0EA 5IK5A 2H6BA 2FDIA 3RSJA 2XPJA 1ALYA 4AI9A 5CBLA 1ZA4A 4DXTA 4SLIA 3S6PA 4NPMA 4HL0A 4YW6A 4XJ9A 3ZYPA 4MVTA 3MFAA 5FQ0B 2ZHNA 5FYIA 1POV0 4CU9A 1IS6A 1NZCA 3FL7A 1CIYA 1JOJA 3OCPA 4H7MA 1VAVA 1TEIA 1BK0A 3AJZA 5GZEA 2I74A 5GZDA 4COZA 3AZZA 3BU0A 5L7OB 3U75A 1G9BA 5FIXA 1C8NA 4DO0A 1AJKA 3N7LA 5CZKA 1AVBA 5FPBA 1OPOA 1U5YA 2OVUA 5I0RA 3OBTA 3VDBA 1AX2A 4CEWA 1QEXA 1W2UA 1NYWA 1QNYA 2E26A 4XE9A 5FZ7A 1VBE1 2VW1A 1QDCA 4JKKA 1RUF1 4YVWC 5A70A 4COYA 5CIRA 2KD7A 1NY72 5JI7A 1HDKA 3QCWA 3IWZA 1JMUB 4E4HA 1D2QA 1W2TA 1NKGA 4OULA 3JD72 5LBEA 1R092 3V56A 4P02B 1VALA 4V2VA 1VP6A 4HT1T 5EJZB 2RHPA 3LDKA 4MSVA 1S0FA 2A71A 1JZ7A 3IMMA 4HN1A 1DQ1A 1W9TA 4YVSC 5JIAA 4YYOA 1XYOA 3ACHA 5CFCC 1LEDA 2Y60A 3HBZA 1QOOA 3VKMA 1F9KA 5IK7A 4XBNA 5C71A 4Q0QA 4CUAA 2AYHA 1NX9A 5DAQA 4GXLA 5GZFA 4LO4B 2AZ5A 2TEPA 3MFCA 1C1FA 4N8MA 2Z79A 4AZZA 4CCOA 1Y4WA 4KI5M 2WNOA 5F5IA 1GOHA 3ACGA 4GULA 2PHRA 2LRPA 1WLDA 5A3MA 1E5SA 1FV3A 2QQNA 3LFMA 4AQTA 3W59A 2CDOA 5C9AB 1K3IA 3BGAA 4JGZA 2JG8A 4JDMA 5SV8A 1F31A 4YZ5A 1W6NA 1QOSA 3I7DA 3FJSA 3BU7A 4AOCA 5LA0A 1F35A 4BCUA 3ZMNA 2VQTA 2JD9A 2ZGOA 1W8NA 4NJ4A 2VAUA 2Y0OA 4ISQA 1QXJA 1I3HA 1OKQA 1W6NB 4L9BA 4FOQA 1RMU3 4LIUA 5T5OA 4DINB 4ITCA 1XE0A 1UOJA 4OZXA 2ADEA 4AEKA 1UMIA 2OYZA 3QLQA 5ABJC 4W4ZA 4QHBA 2CDPA 2HWD2 2VNGA 5JXGA 4NPLA 3HIFA 5FYZA 4XMIA 2R072 2VL4A 3BB6A 1XNBA 3FC0A 2WNUC 3WVJA 1O3TA 1VBD2 2XH6A 3BALA 2UURA 4AVBA 5FO8B 1ZZCA 1OLMA 3RRDA 2Y26A 5DDJ1 1HQLA 2DTYA 3VD3A 3PMEA 3O14A 5AVAA 2DUQA 2RVAA 1Q8OA 1JZ8A 2UU8A 4GAZA 1SACA 5EWSA 4N90A 2Q4SA 1JBCA 2VNOA 1OVSA 1PGW2 4XCBA 1MQTB 1H6XA 4ZKTB 3AB0A 2ZX0A 5HCHA 3IBMA 1OA4A 4FPJA 4LNVA 4QM9A 1FOD3 1LHNA 1ZYBA 1AR73 3ZIWA 2WA3A 2LALA 4TXWA 4HK9A 1IPKA 5J98B 2UYBA 4MADA 2PHWA 3BPSA 4ZS3A 2ADDA 1KDKA 2A6ZA 4XBLA 5GLUA 1ASJ2 4CDQC 5KXEA 5F5QA 1O5LA 1RGSA 1PX4A 2YGMA 3A4UA 4EZ4A 1UZ0A 1SPPB 4LBLA 1W3XA 5TSWA 4AVVA 2WNUA 1QQP2 4LBMA 3ZIXA 4FTEA 2GZWA 5J48A 2A6YA 1RUE3 3Q9OA 2QZ2A 3PLQA 4X8PA 2RR11 3MW3A 5K0UB 3IPVB 5ANQA 1OBNA 1GNYA 2FMDA 5C3SA 1BEV3 1RUC3 3ZR5A 4NOTA 2VMHA 1AF9A 2EXJA 3U4SA 2YC4A 1NCRC 3AXEA 4H55A 4MHUA 4A3ZA 2JX9A 2W46A 4I3GA 2VY0A 3GJAA 2G1MA 4OVEA 4YVSA 5K0UA 2HH9A 3RNSA 4BQ3A 5JR2A 3J8F2 1PHMA 4K21A 2WZPP 3PUSA 3ILRA 4XF9A 2DUOA 4ASLA 5FFOC 3AMPA 4AFCA 3KV9A 1ASJ3 2ARBA 2ZGPA 4A2UA 2BNNA 3MUZ1 4NAMA 1A6CA 1YCIA 4LO6B 2NQYA 4ZXEA 3T4HB 2V4AA 5EXOA 4M00A 5A80A 2D5HA 1YNAA 2X10A 4META 2QQIA 2XVKA 3GDBA 1RXGA 2J1UA 3KF3A 3NMBA 4WVZA 1W05A 3NW4A 5FWJA 2QQVA 3K4AA 5FP8A 1DQ6A 2WA4A 2GC0A 4Y33A 5E88A 3U78A 1O3SA 1TG7A 1RUE2 3SXWA 5IT6A 5LEKA 1CAVA 2OS2A 2JG9C 5CKMA 5K0UC 3WZ1A 1XU2A 2AEZA 3M7AA 1YJLA 1VBC3 1NY71 1V6KA 3SC7X 1TNRA 4LJHA 3ZXAC 3DV8A 2C9KA 1LJ7A 4YG6A 1XXNA 4Q27A 4X6RB 3JQXA 1Z0HA 3KSCA 5FUPA 1LHVA 1G9FA 2DCKA 4XJZA 2PLV2 1RJ8A 3B00A 3UT0A 4C91A 4QKNA 2XL7A 4D7SA 2BV4A 3N3HA 5K7PA 2E63A 1V9U1 4Y24A 5GALA 3H42B 4NHLA 3RYPA 3QACA 2ZKNA 2X8KA 4Z2WA 2YB7A 2GMEA 1COV1 1TQ5A 2VCMA 2ZA9A 4MGSA 1Z7S1 3HD8B 3DYPA 1W8UA 1WGPA 1YO8A 3W9AA 1HW5A 3LIGA 3GF6A 4AEDA 3NVCA 3OY8B 3U0ZA 2VZPA 3I2DA 4U36A 3V65A 5JPMB 4L11A 2Y33A 2JG9A 3NAPB 2WZ8A 4WM7C 3VDDC 4BHPA 5GM0A 3OBZA 4JGZB 3ON7A 1QU0A 1EUTA 5BV6A 2D40A 4AI0A 3VBOA 3T1MA 4E4DX 1J84A 2EA7A 1NQJA 1WBLA 5C3OA 2RV9A 4G9SB 4BZ4A 3KWVA 2RJ2A 3ACLA 1LOFA 4AL9A 3I4IA 3R6SA 2FDFA 2R1BA 4BLJA 3WW3A 4ES8A 4BLIA 2BP6A 1W8TA 2R0HA 2XLAA 5E1RA 1JYWA 1OMIA 2P2KA 2WJSA 3UK9A 1LULA 3VBHC 1IS3A 3IDBB 1CD3G 1HLCA 3VKFC 1SDWA 5FZMA 2G9ZA 2Q8EA 1T6BX 1NCRA 3VGIA 2ZCWA 3TRSB 1V6IA 4LBJA 3KCYA 5F5AA 1NA1A 1OLME 4P9WA 3TEYA 1LOCA 1ND3B 5LEJA 3A22A 3WDUA 2RJKA 4WM8A 1QJX1 3LA7A 4TLFA 5DPNA 4XFGA 2A3XA 2DYCA 3VKOA 3ITQA 4QKBA 4S2FA 4CXYA 1IZ3A 4Q5OA 2O1QA 1LODA 4RHV3 4CPBA 4EWAA 1L3JA 1Q43A 2ZX2A 4E9KA 1LAJA 1H2LA 1JS9A 3ZSLA 3N7JA 2AENA 4JKLA 3OY8A 5FOBB 2ZGLA 3KV5A 5L9RA 5I0DA 4QKFA 1JOBA 5HI0A 1HRI1 3ZXKA 2LUWA 4QX7A 3UL2A 4JZRA 1APNA 2JE9A 5T52A 4LUMA 4RGKA 1UIKA 5DDJ2 4CUCA 4YWAA 3UESA 3VBHB 1SLIA 1W0PA 4XDPA 4LO7A 5BXXA 4COUA 4OI0A 1HV0A 1BQPA 2EXKA 1SDDB 4NN0A 4KGGA 3ZVXA 3EO6A 3RPQA 1UW8A 5JIUA 4OHXA 4TYSA 2ID4A 4IGQA 4JTOA 1NCQC 1ND3C 3HNYM 1AR81 2XGXA 3JXSA 4DUVA 5CFDB 3VB9A 5DXDA 2ZAAA 4GMP3 4P9GA 4L99A 4YZ2A 1TMF1 4JDOA 5LBBA 5I8YA 5A3LA 1CZVA 2RS32 2FMYA 4W6YA 3WV6A 1JYXA 4FFFA 4QXHA 4CVUA 1UU5A 4Q4Y1 3WDYA 2CNAA 5EQUA 5C5TA 1K42A 5A6ZA 2D6PA 4A44A 3D0JA 3KD4A 1NQDA 5IJRA 5BNPA 2H0VA 4LBQA 1MS9A 2A6VA 2X5IB 3POGA 5FY8A 4A3XA 1S0JA 3O1VA 5FTTC 2E7TA 3WY6A 3ILNA 2JG8C 5FXXA 5LK7B 1SCRA 1L7QA 2RM22 4QQ2A 1RVF1 1AX0A 3SEPA 1ULFA 5HBAA 5JXJA 3AZVA 3RVHA 3POFA 1BKZA 3RJRA 3POIA 2DDUA 5FYBA 1DIWA 1UY0A 2GDFA 4QXCA 1JW6A 5BNOB 4Q4V2 2JIJA 4I02A 4H2AA 1RXFA 1VBD3 4N53C 3USUB 3V0BA 5FO7B 3AC0A 1C5IA 2W87A 3VBHA 3NAPA 4CCMA 2J7MA 4QDSA 3OB8A 1WCQA 1XOYA 2KR2A 1D0HA 5DMYA 3NO8A 5H9RA 2ZEYA 1G9CA 3AZWA 1WLTA 2DFCA 1UXXX 1X7NA 3VDAA 2W0XA 3NV4A 4HSJA 4LOTA 4OMDA 5F3IA 2RMU3 1QHDA 3USUA 3E1F1 5FLHA 3V0BB 3RMYA 1NA1C 4IEWA 5IVCA 4PHZA 3LSEA 4U2AA 3SCHA 2HWB1 5BNNC 5LA9A 1XE8A 3Q8BA 4ARYA 4GWJA 1JZ3A 2W2IA 4Y20A 2HYXA 4MGTA 4LHKA 1UX7A 4QMAA 1W6QA 3WNNA 3T2OA 1CAXA 4AQSA 2X5IC 2D3SA 5A3UA 2W08A 2DU0A 2E7QA 1JXNA 4J25A 5F2SA 3C2UA 2QBXA 3EYPA 2ZGTA 4MGIE 4AFAA 5JVVA 2HEVF 5SV5A 3CJIB 3C7GA 3CJXA 1FPN1 1ZNPA 3LEGA 1UZZA 2WINB 3M4FA 4CU6A 2PLV3 2W9XA 3VD4A 4B3NA 1LB2A 3VBOB 1KRIA 2VQ0A 4GALA 3RI9A 5FPAA 5IVEA 5LRSA 3I54A 1R1ZA 4GJYA 2XG3A 2RS52 4GMP1 3THDA 1UAIA 3T2QA 2FZ2A 4OUMA 4FPHA 5B4NA 3KT1A 5HCAA 2VMGA 1OI6A 5E16A 1EV11 2QNKA 1MEC2 5HCBA 4E8DA 1W8OA 2XUMA 3T2PA 3OD4A 1MS5A 3PMSA 1COV2 2J1SA 4LKEA 1CJDA 4M4RA 4PIYA 1X8EA 2GH2A 2WN2A 5DG1A 4DB5A 3H3ZA 4DEQA 1GU3A 2C24A 1MZFA 1QJU1 3VBSC 1IQAA 3WP5A 4O7XA 1O59A 4BYYA 2GSYA 1VBA1 2CAUA 3MIHA 3UV9A 2GMPA 5IAVA 4LUKA 4MGQA 1LR5A 2PTMA 3JZVA 5FV3A 4AYUA 2FD8A 2WN3A 4QPGC 4Q8KA 2WAOA 4CCNA 5K9YA 1CQ9A 4H14A 3ROUA 1K12A 3VHNA 4CDWB 1YJKA 3J9SA 3S7IA 2YG0A 2K2SA 2RM21 1UY3A 4Y22A 1NE4A 1C8M3 3CMGA 2V5YA 4OI1A 3GNEA 1OOPA 1ZBE3 2BOIA 2Q1ZB 1EYBA 4XUNA 5FYHA 5FZHA 1JZ4A 1ENXA 3B7MA 2WQZC 5G04L 2R7EB 2C6SA 1CIWA 3WDXA 3H3UA 4BK4A 5A3PA 3U37A 5G05L 1OOPB 4Q4W3 5BNOC 1YUDA 5JOZA 4AVCA 1FYUA 2R061 3VDDB 3ZSJA 3MIEA 3BCWA 3LPFA 1VBB2 1BEV1 1HRV2 1RUC1 1Y9MA 3GALA 3OTFA 4YW3A 2Q8CA 3T30A 3UGHA 3DF0A 5FAXA 5CG9A 2W91A 2XONA 2D93A 4MLOA 1BJQA 4IEQA 4N53A 3WEZA 1UMZA 1R64A 4F7ZA 2BW8A 4M0HA 4IEPA 4RS5A 3JCIA 5D1IA 1GZWA 4QQPA 3U11A 3WNKA 2WABA 5FY1A 1AR63 2XQRA 4OLLA 1SBFA 4IEZA 4P9XA 2XJUA 4IEOA 1VRH3 4QPGB 3O1SA 4E8CA 2IXIA 1L7RA 4Q4X2 1XBFA 2SBAA 5A1LA 2ILMA 5KWRA 3M3OA 2OQ6A 3RZGA 5BNNA 4I3PA 4CP9B 1RINA 4OHVA 5H9SA 2VXJA 3NV2A 1IOAA 2R043 2FDHA 3ZFFA 4TSVA 3FUOA 3CLPA 2OT7A 4LHLA 4QXKA 5APAA 4LORA 4H3WA 4RR3C 1W8ZA 3ZOIA 1H1AA 1BYHA 4UBHA 3BOWA 3WNLA 2VG9A 2HEWF 4XFAA 4YGEA 1YEWA 1W06A 3AYEA 1ZM1A 4BQ4A 5GLZA 1GANA 1U12A 1V0AA 2NYYA 1WKYA 3MICA 2ZPXA 3JD73 2ZKLA 5DUXA 4XOGA 2I45A 1FI2A 4Y3OA 5FZ9A 4CZSA 2PMWB 3IAQA 4Q4V1 1ULPA 3RZMA 2XHNA 2QVSB 3CU7A 3FN9A 5CYYA 5FY9A 1PO13 2C4XA 1RMU2 1OPMA 4MV2A 1TMF3 3ETPA 3UJQA 3BN6A 1VRH2 1O7FA 1VBB1 5A6YA 2CWMA 3HJRA 2RR12 5HV4A 3AVSA 2GC2A 1LOBA 1VE0A 2JDZA 5CFCB 1ENQA 2XWJB 3R4UA 5FYVA 5FZCA 4E27A 2A3YA 4YLZA 2O8OA 4LA2A 4W8JA 2HJIA 4XQWA 1JYNA 4IUGA 3P3NA 2NLRA 5LATA 3ZXFA 4C1WA 1XU1A 4A45A 1A8MA 5GJ6A 3KVBA 2YU1A 4DFSA 2LW8A 4QPGA 4LKFA 2FDGA 3RG0A 3ILFA 3C7OA 2ZX1A 3OUJA 3USSA 3MV11 1B09A 3SKVA 3I3DA 1ZRDA 4P14A 3NRUA 3K51A 5KC5A 2Z5WA 4GWIA 1PMHX 3DPRA 1CN1A 4E2GA 1EP0A 3AKSA 4QPIC 2Y6GA 4XVHA 3CO2A 2Q0AA 4BM8A 5DUWA 1O4ZA 1XYPA 3HBKA 2PHFA 1CX1A 4QX1A 4M0NA 1RHI3 3KV4A 4IE7A 2G9FA 3WT3A 2VULA 1XSRA 4K20A 5A7SA 4EN8B 1C57A 1BMV2 3BKZA 2JECA 3FBYA 4COWA 2GNTA 3BODA 1XNDA 1ZRRA 4JGYA 1DP0A 5LBFA 1CGPA 4YZ3A 1YHFA 3K2OA 1U5IA 1RUD3 5L7OC 4XHXA 1PGL1 5FLJA 2B4KA 1UYZA 3OUHA 5EIYB 5JI9A 1DQ5A 1RUD2 5JR7B 1DZRA 3SEEA 2CV6A 3FE5A 3C8XA 4LO8A 1O5UA 5CA6A 2CGOA 4A4AA 3MF9A 2VMCA 1N3QA 1NCQA 3EBRA 4Y4YA 1FXZA 3PTYA 1JHNA 3U07A 1MEC3 4FOWA 5GZCA 2PQSA 5IAXA 1YQ8A 4JV4A 1W2NA 1Q8SA 5JPNB 2ARXA 4HVRA 4OQ8A 3J7MA 3WP6A 4DS0A 2ZHLA 3OYWB 2O14A 3FBMA 1WW7A 3AYDA 4CDWA 5A7QA 2D44A 4XF0A 3PNAA 3J26N 3EJKA 3PJYA 1TME3 5FOJB 3GGLA 3HNBM 2V4VA 4PBPA 4ZS2A 1OD5A 2GP3A 1WWYA 2FZ1A 3AP6A 3IIAA 3WD5A 4OHYA 5KR7A 1NZIA 4OUEA 5BY5A 4MX3A 4NE9A 4O9GA 1HXS1 3MDPA 5IFTA 1QKQA 2AUYA 3ZXLA 3AFKA 3WF2A 2E32A 1IKQA 2QFEA 2WBKA 2ZEXA 4Q26A 3OGGA 4M4PA 1RHI2 4HMZA 1GBGA 4GZ9A 3SCFA 3X29B 3ZXGA 4D6SA 4PQQA 1X8MA 3VBRB 2K46A 1HQWA 1QJY2 1US3A 3HWJA 1OD3A 3UKTA 4A6SA 4NIIA 2DTWA 3C7HA 1PO12 2PXJA 2B42B 4IE6A 1UYPA 4N53B 4YVWA 3NV1A 4ZY9A 3E6CC 2VVFA 5J37A 3RZZA 1PGL2 4RS5B 2HWE3 1V6OA 3H1WA 1CPMA 3CF6E 3ZSMA 1LOAA 4CUGA 3NJZA 2WUHA 1RL3A 1S0BA 3E5XA 3OGSA 4AAXA 4JQTA 4OMCA 3W58A 1UPIA 4Q4Y3 4EJRA 2V09A 4ZHNA 1CAWA 1BBT3 1C28A 1D4M3 3DYMA 2JG9B 1QH6A 3CBNA 3FFQA 3PUHA 4UFHA 5DZFA 5EP9A 3TEZA 4QX5A 1AZDA 1PZ7A 1VBC1 4B4PA 1IG0A 3PTRB 5D8AC 3F95A 1XC6A 1K45A 4QD2A 1CONA 2R062 5IHRA 1QNWA 2WNVA 4AI8A 1RUG3 1W3VA 1WBFA 2FDJA 4RFT0 5FBZA 1OA2A 3G7DA 4LLFA 5BNQA 4AVAA 1IPJA 3NJXA 2F4LA 3ZDVA 4NIAA 1C3HA 2P17A 1FPN3 2HWC1 4BB3A 4XDQA 2CGNA 4V1PA 4WM7A 2RMU2 3M2MA 2WYSA 2VXRA 4PCRA 4AG4A 5IVVA 4CDXA 4XYXA 1KDMA 2RS51 5ABJB 1JYCA 2Q5TA 1K5MA 1QOTA 3AVRA 1S1AA 5CKQA 3RZJA 4XQDA 5BNPB 5A3NA 1AXYA 4CCEA 1EV12 1NA1B 2PAEA 1HRI2 1NLRA 1YLLA 5F6KA 5FYTA 4XQ4A 4QPIB 1SQ4A 1W39A 3J7HA 1MR5A 1BVVA 1O6UA 5ACA1 4XACA 1LCLA 3VD7A 4UW3A 3PL0A 1W04A 5CB7A 4CTEA 2A7AA 2RJLA 4CEYC 4PDWB 3WNOA 2VOXA 3GJBA 3ZFGA 3TAYA 1A8DA 4IGOA 4Q1PA 4W50A 2DBNA 2HBTA 4YW5A 1VAKA 1W8HA 2ZZQA 3POBA 1VJ2A 1X33A 1SCSA 3VLBB 3ZPYA 4PDWA 2QQMA 1XRUA 5DUVA 1ENRA 3ZFEA 4AHWA 2JDKA 3AL5A 3ZYFA 2ARCA 1KXGA 1MQTA 4YM3A 1SFPA 2GNMA 3VZMA 4IEVA 2WFF2 4D3WA 1R091 2BNOA 4HKOA 4AVSA 3C7EA 3U14A 1WD3A 3MPPG 4M3CF 5FZDA 2QCSB 1K5JA 2ES3A 3HEIA 3ZSKA 5JWPA 5IVFA 1RB8G 2RS11 1JYIA 3CHXA 4QKDA 1KQRA 2WIIB 4FQZA 1W90A 4PBOA 3AMMA 2GH8A 1HRV3 1W0NA 2GNDA 4LTAA 1UKRA 1WW5A 3H0OA 4UT5A 5FDBA 2CWSA 3AMHA 3P1IA 4LKSA 3MIDA 3PVEA 3J4UH 2YYOA 3UKNA 2JIGA 4FPFA 2VZTA 4IV1C 3AX4A 2ARAA 1GP6A 1UZYA 1AYN2 2Q1FA 4Q4W2 3VZJA 2OPKA 1DLCA 2VD7A 1D7PM 4KWJA 4JVAA 1YYNA 3FHIB 3OEBA 4PDWC 4KWKA 4GH4B 1GZTA 4GB33 2JKBA 4BXSV 2VZRA 1WCSA 1W9SA 2OZJA 4G4FA 1PIV2 4XFHA 4YGBA 1OF3A 2HWC3 4N9HA 3H8RA 2Y6LA 3POSA 3W21A 4EQVA 2WZR2 3OGJA 3V0AB 3R0RA 4ZONA 2XHKA 4AW7A 1RUJ1 2D6MA 2VMIA 2Y8KA 4NIDA 4BWOA 1PNFA 3MW2A 4S2HA 3SH3A 4D7TA 1QJEA 3CZJA 3ZXJA 1UPSA 4G3YC 3O12A 4HG6B 4LHSA 4YW2A 5M0TA 1RUH2 4P9JA 2DVAA 3I2FA 5IK8A 2PQQA 4HKWA 3M1HA 3DKWA 5C3RA 3NNLA 3MUY1 2G4IA 1S2EA 4BXFA 2GP5A 3EMRA 3LDRA 3PVNA 3IAPA 4IEYA 2AEYA 5LBCA 3RJ2X 4H7LA 4XF1A 3WR0A 2D98A 3LKJA 2OX0A 2Y6HA 1ZBE1 1BXHA 2ZABA 2DV9A 4CP1A 2GN3A 1YRZA 4XFFA 1H2KA 1S0IA 2ZX3A 4XHBA 5FYSA 1HB3A 1N1TA 3SHRA 1WUVA 1QJY1 5FKCA 5FZ4A 4XAAA 3WINE 2HYKA 4CCDA 3BTXA 4AI2A 2YFZA 5CVRA 1NAEA 3AKPA 4Q4W1 5A3WA 3A7QA 4TTGA 3LAGA 2IXLA 1FOD1 1CJPA 2JD4A 3KGZA 4UFKA 2XVLA 3CJIC 2GNBA 3J8F1 2E6VA 4FFGA 4LOSA 4QU2A 4QAWA 2FDKA 1N1SA 2NZ9A 3VHRA 3POYA 4J6GA 4QPWA 2IXKA 5FZIA 3BOPA 2VMDA 3KCCA 1YFXA 4PF1A 3I2JA 5IFPA 4NIHA 1S55A 1Y3TA 5IVBA 2YFUA 3A21A 1JHJA 2YGLA 2PELA 2WT2A 4YPJA 5L73A 2DF7A 2H6CA 2JJ6A 4AVTA 4XPVA 1N3PA 4DNYA 4LBQB 4D6RA 3N9NA 1S0GA 3C3VA 4EYUA 4QQOA 3OOXA 2RMU1 5HV0A 2NN8A 4WV8A 2XB6C 1ZX5A 4WVWA 5LA1A 1SLTA 2AR6A 2A73B 3OBRA 4Q4V3 4EN9B 5BNNB 5JCTA 1UOGA 2P3IA 5BPXA 1UN1A 1GOGA 5C8CA 3VBUC 1STMA 3IDEA 1AYM2 2XKPA 4MGYE 3FHAA 2O8QA 2R49A 4K8FA 4Q8LA 5ABJA 3BIEA 1W9YA 1RTVA 1DGWX 4GB32 3RZLA 3N7KA 2AREA 3BTAA 3IT8A 1GQPA 3WNMA 3SMHA 1I6XA 3R4DB 1DYPA 1H2MA 1LGCA 2XUEA 3LFIA 4KGQA 3JBG2 3ZN6B 5L7OA 1WA6X 4P00B 2WC2A 4WM8C 1PZ8A 1AUYA 1CWPA 3NV3A 2DCTA 5LWBA 3IM0A 4DZGA 3IPVA 1AXZA 4N43C 5A7PA 4TN7A 3LSDA 3NJYA 2WLQA 1RC6A 5LA2A 1WLWA 1F2NA 5LK5A 1J83A 5F37A 1DLLA 3I2KA 4KU8A 3ATGA 1LECA 1UNBA 1QQP3 1JZ6A 2Q8DA 5C4WC 5KHGA 3SH4A 2I07B 4FTBA 5JDBA 4TLGA 4R4ZA 2GMMA 4Q0VA 1RUH3 2IUWA 1LEMA 3MIFA 2JICA 4Q29A 2CY6A 4IDZA 1WLCA 4YM1A 3FFZA 3TWIA 5I0SA 4I30A 5LW9A 5FRAA 3IDAA 3ABZA 3KQ4B 4CE8A 3LEIA 3LGRA 3WF0A 2EAKA 3JBG3 1QGLA 3S0MA 1LGNA 5DDJ3 2Z42A 4PI0A 3CNAA 4JAAA 3BUCA 3WF1A 4WZCA 2R16A 5BNOA 4FCAA 1Z7S2 2OKXA 4KH9A 1UZVA 2JDMA 4OI4A 2EICA 1Z78A 2JG8B 2B7YA 3GZAA 4IGPA 2YDEA 2W92A 4GMP0 4YW4A 5A7WA 4ZU4A 5FP3A 2W39A 3C7FA 3O0XA 1Y9GA 3H1MA 2VUDA 1EV13 2WFF1 2CYFA 1DBNA 1IKPA 2VOTA 1L7LA 3AMNA 3M3CA 4DXZA 2OA2A 2VGDA 2YPJA 2OPWA 1OQ1A 3B69A 3ZYIB 1K5MB 1QJX2 5DUUA 4LULA 2XBO1 2VZ1A 1VB4A 3I3BA 1W6QB 1YI9A 3MLKA 1AR72 1VBE2 3GCWA 1FATA 1YI7A 1KJRA 2GC3A 2ZMKA 3ENRA 4KQ7A 4Y1XA 5DZEA 4FFHA 4XF3A 5D21A 2P37A 2J1RA 5IK4A 4XUTA 4Y5SA 4EZHA 1RUI3 2Q1MA 3ZFGB 3AP9A 3K3OA 1FT9A 2HWF1 3BIWE 4LA3A 1E57A 2PFWA 2WFF3 2JXAA 4K1ZA 4MUVA 1D4VB 4NR1A 4BPZA 5AFBA 2ZBJA 4CCCA 4BMEA 3TEWA 1QXPA 1GWKA 3IN9A 4MOAA 1VAMA 3UNPA 1XPWA 1C4RA 1BBT2 1VIWB 3OYWA 5T5PA 5I8SA 4CUBA 4FP3A 3TB0A 5C8CC 3VUOA 5EJ1B 1BCXA 4DY5A 1ZZ9A 4PF5A 4XFBA 4NWVA 2CL2A 3M3QA 3KB5A 3ETQA 2VNRA 4L0PA 3WG3A 3UJOA 1DQ0A 3LD8A 3UGFA 1W03A 4XEZA 3K4ZA 4QX0A 3LB9A 4Y22B 4P9YA 5F3GA 4CDUC 1DQ4A 1XYNA 5ANNA 4UAPA 3CQOA 4R4XA 2VOWA 2ZEZA 3AKQA 2XWBB 2OQ7A 3DCQA 1RUH1 3N9OA 2QUOA 1XJAA 1OKOA 3WDWA 4NHKA 2EXHA 1YIPA 3LPGA 5FXZA 2RS31 3HPNA 1KFUL 3OUIA 1AR61 1OC1A 3GBGA 3Q8EA 4PIXA 4Y1YA 3VBRA 1X36A 2FCVA 2VO5A 4HANA 2OXBA 1OFNA 1HV1A 3APBA 3THTA 3L9JT 2WZR3 2BUKA 4NHYA 3WF3A 4AR2A 1XNTA 4WM8B 5C4WA 2HWC2 4RQPC 4E4ZA 3ES1A 4XJUA 4R8HA 3B5LB 1WCDJ 2WWJA 1UWWA 4CSWA 1AR82 2ERFA 1D4M1 4Z1VA 3VHPA 4GWMA 5FLIA 5F3EA 3NKTA 4Z92B 1R1A1 2DBIA 3I59B 3GBWA 2RS33 3PDQA 5J36A 2R30A 3MZHA 1H4GA 1FV2A 3MIBA 2BVBA 4JQRA 1W6PB 3QOPA 1H6YA 3K75B 2ZGUA 5J96B 3H7JA 5C7GA 3RWNA 2QQPA 2VZOA 3SITA 4EV0A 3IZOA 4EROA 1EY2A 3K48A 2WO1A 4WVMA 5FP4A 5AC91 1Z7S3 4MXWB 3WSOA 4UOJA 2MNGA 4PQ9A 5DAVA 1WZXA 1WW6A 1AX1A 2IXJA 4BISA 1A34A 4PLMA 1YQCA 4LITA 5KHHA 4OHZA 5K8SA 1IG3A 2VUAA 3POEA 4UWDA 1R1A3 4XCAA 1ACCA 3R4SA 3O1TA 4RQPA 3U10A 2VOKA 4KNCA 4PLNA 1G9DA 5LY1A 3I3QA 1SPPA 3RDIA 2VBBA 3D6EA 2WAAA 2VH9A 3T0DA 4MGZE 1AL23 1B35B 1GR3A 4I0BA 1OQEA 2OUJA 1J1LA 2EXIA 4RQPB 3WQBA 4CRQA 2W68A 3FLPA 5FUIA 3PU3A 4IV3C 4M3CE 3ES4A 1P8JA 3ZN5A 3MI8A 1LGBA 1AR91 3TOJA 4HK8A 1KJLA 4CPBD 2JE7A 1BK1A 3VKNA 1GP5A 3ME2A 4XMAA 5A6XA 1OLQA 4RN5A 3WCSA 1HJFA 3M70A 1DF0A 2Z2SB 5FPUA 1F5JA 4XW3A 3D8CA 1V70A 3MHZA 5L36A 1UCXA 3E5UA 4BQ5A 2YMZA 3VDDA 2XQXA 1PM7A 4JGYB 5JLVA 2BERA 4Q2FA 1E5IA 5JZGC 3RZHA 5IW0A 2N7GA 3RGBA 4DEVA 4HKLA 2DCZA 2B39A 2IVIB 5CEHA 4BQ1A 4AHYA 5DQ0A 1J1TA 4YNIA 4AGVA 4XFIA 5D2AA 3QH7A 3POJA 1FPN2 1UIJA 3MEPA 4ATEA 3WUDA 2X09A 2E53A 5C8CB 4UW5A 4GWNA 4FOYA 4QXBA 5JSPA 5I0UA 1YFWA 1SLBA 1DGRA 1UOBA 3LEKA 3D0SA 2VZUA 4KU7A 4QPYA 3O0VA 4DXRA 2BWCA 2P6CA 5FY4A 2BBAA 4BQ2A 1AXKA 5JOWA 3VBRC 3WW4A 5FMCA 4CP0A 3K4DA 3KZ4C 5AFEA 1MEC1 3K46A 3OGRA 1F5FA 2A6WA 2IC1A 1XB9A 3SH5A 1HB4A 2XLFA 3W5MA 1GKBA 4LBNA 2VBDA 4HZFA 2QQKA 2HWD1 4YFZA 4UFMA 1XQNA 5JZGA 4EN7B 1RVF3 2ZMNA 2B8MA 2PYTA 2R1DA 3KLSA 5DN2A 5KBFA 3N9PA 3DL3A 2Y64A 3IMNA 3OPZA 1CAXB 3H50A 3OPWA 1JN2P 1TME1 1BBT1 1SMVA 1V6MA 3ECQA 3FUQA 2OZ6A 4ZU7A 4LLOA 4Q4X3 2BRTA 3O0WA 1EPZA 1QJY3 5JZGB 5GLVA 2A70A 3RFRA 2WT0A 1ODNA 1JH5A 4AF9A 4DUWA 3LF7A 1LRHA 5FPLA 5FZAA 2W1SA 2XBO2 3N7MA 4K6BA 2EVXA 3WW2A 1QMJA 1W9FA 3SNMA 2IXHA 3T2TA 3UGGA 2A75A 1SBDA 3B01A 5EHDA 2C9AA 3KV6A 1Q8VA 5GZGA 4GJZA 2KA3A 4MHRA 4A7ZA 5B2GB 1N47A 2Q8OA 1WW4A 1IQDC 1EAH1 1IGOA 3NQHA 1H2NA 2D6KA 5FMOS 3VBFB 1GUIA 3O1OA 3H8OA 4I2OA 2UYAA 2NMOA 1AYN3 3IDCB 1EPWA 4XAEA 1RUI1 2VZ3A 4N43A 3VHOA 3WHUA 1AJOA 2ZGSA 5F3CA 2QQOA 4LKDA 4XUQA 3ACFA 1W9WA 4WVMB 4ATFA 4XJAA 1OXCA 5A7WB 4DUXA 3PUQA 1HKDA 1US2A 3VV1A 4YARA 5KC6A 5A32B 3LA3A 4XETA 3ZFEC 1MPXA 5IVYA 4Y5Z0 2EIDA 4BA6A 4ET7A 3PU8A 2VM9A 1G8WA 3DYOA 3DPRB 5ISLA 1KFXL 5J3UA 5L19A 3GM8A 1VPHA 2ZTNA 4FXGB 1SZBA 3WDVA 5FBJA 1R081 1GNHA 5A7NA 2QJVA 4A42A 4AEMA 2J42A 5E89A 5C3PA 4GH4A 3J7NA 4XF4A 4AI1A 4BK5A 4JC1A 1X50A 2UY9A 4FO9A 1POQA 1GWMA 3B02A 2F17A 3JQWA 4FPYA 5CNAA 4XBQA 3FMGA 1I5PA 2HKXA 1PM4A 1XNCA 2BZDA 2MHFA 4FPOB 5FZOA 1C1LA 1OSGA 3DEMA 4R52A 4DPNA 1LHOA 1UO9A 1QF3A 3CIHA 4WZFA 1OH4A 2P4EA 4QB1A 2WNEA 2ZJCA 3WNPA 1CAWB 1ONAA 1HN0A 2WZR1 5LRRA 4NUBA 1FMD3 4Z8BA 2PA7A 3EHKA 3I2GA 1DCSA 4EN0A 3CL1A 5I91A 2RG4A 4K9SA 4L92A 4PT6A 3I2HA 5B4XA 1U0AA 1W6OB 3IKWA 2VOVA 4SBVA 5A33A 4CDUB 1UU6A 4V2WA 2XL9A 2QTWB 2JKXA 3ZFEB 3TNQA 1DZTA 3TN92 5E8AA 1KD7A 1D2SA 2WLPA 4Z2AA 3RYRA 1WCUA 2PAMA 2BYVE 1W6MA 4GH4C 5CISA 3QH6A 3E6BA 2RDNA 1URXA 4DQAA 2VMEA 3D4KA 3OF1A 5A32A 1GMMA 4NWWA 1N1YA 2PHDA 4UF0B 4ZU5A 4CDQA 4PIZA 5D8AB 3WOGA 1FMD1 1CAUB 1OF4A 2LTNA 2B9VA 4HLTA 3KGLA 4QQHA 4BQWA 1DGLA 2HBUA 2VVEA 2YUEA 2UWBA 1ZBA2 1ULEA 1BLZA 2GAUA 3WHTA 5F2WA 1RUNA 5CG8A 4NVPA 2W3JA 3ZYBA 2QE3A 1HRI3 1NXD1 1D0GA 1YQ5A 2BVVA 2D43A 3THPA 5FMDA 4RS5C 3UKVA 4Q0SA 4UXAA 4XURA 5FZ6A 5CAZA 2VNVA 2VPVA 3BPZA 3SKJE 1IPSA 1U5ZA 5GLTA 5T55A 2MEV2 3TBDA 2DUPA 3N9QA 3AZYA 4AEJA 3CKHA 4F8AA 3O1UA 1CX4A 2A6XA 2J22A 3AMQA 3MPBA 5T54A 2VBPA 3MIGA 3CZUA 2VUJA 4P9IA 1AR83 1SLCA 2VC9A 4PJYA 5DZGA 5A6QA 1S2KA 3VBUB 4M3CA 3ZFFC 2ZGMA 1VRBA 4MGKE 3HT2A 4JHZA 4QU1A 2R063 4FQ4A 4CEYB 2GALA 3NWKA 4INDA 2DWRA 3D82A 2W1UA 5KHKA 5H9QA 3PIGA 2TNFA 2C5DA 5T50A 4E4SA 5FR3A 1V9U3 2PHXA 1Y7BA 1PO23 1PO22 5A3TA 3K77A 5C9AA 3VBFC 1D4M2 4Q0UA 1NLQA 2C26A 4UW4A 2UWAA 1MS8A 4BIOA 4CDXC 4YFWA 2Y38A 5FKBA 2BDRA 1TME2 2WNVC 3AKRA 3P6BA 5A3OA 3EXUA 4RSUA 2BFUS 4GD4A 4BJ0A 1OOPC 3N36A 4UF0A 1VRH1 3LOIA 2NM1A 3HQUA 2Y6KA 5LB6A 3AYCA 2VQUA 3T1LA 2ZGRA 2HWB2 5EYXA 4EWEA 2WL1A 1QXRA 2IXCA 2HWE1 1VBB3 4YSFA 4ZZ5A 1PK6A 5AC92 4NIGA 3VKLA 2ETEA 5FPVA 2CGPA 3B94A 3POWA 4AWDA 2ET7A 4CXWA 2JDPA 1PMJX 1DGRN 2VW0A 3JU9A 3MGUA 1OURA 2UWCA 5T3NA 1H8TC 3KT4A 4CXXA 1QWRA 1PVC2 1RUF2 2CTVA 2FCTA 3H3LA 3BI3A 2RE9A 2TUNA 1JUIA 3RYKA 1U5XA 3V0AA 5EFUA 4AEDB 1GYKA 4MO3M 2D6LX 4D6QA 1POV1 3A0KA 3FWEA 5FCCA 2D7FA 4CCKA 2PN5A 4OHWA 2OIIA 4RGAA 1UD1A 4IE0A 2WFPA 4D0QA 2W5FA 2XJRA 1OUXA 4XC9A 3MV01 5FZKA 1PO11 1B35C 2WS92 5FZOB 4IEXA 1WMEA 2A3WA 2WWSA 4IXLA 4LE4A 2QDRA 2AACA 2F6BA 5FK7A 2A5ZA 2W52A 2WWUA 3VBOC 1TE1B 3NNGA 1LU1A 1ZVFA 3S5AA 3M8LA 3DECA 4NO4A 1DU3D 2HLEA 1GZ9A 5FZBA 5JOXA 2P1BA 5ACA3 3AZXA 1UL9A 1RUD1 1UU4A 2ZS6B 3TYJA 3I97A 2R071 3LWCA 2PLV1 1AL22 1OH3A 2JB4A 2YC0A 4I01A 5JXIA 3T4VA 2XMLA 4QGMA 5FREA 1ND2C 2JEMA 4E2QA 4LHNA 5FP7A 3HNMA 4A6OA 2L9LA 3WDTA 1IS5A 5CADA 1NXMA 4L2NA 4BH9A 1H30A
chains in the Genus database with same CATH topology
5H9PA 2JENA 3NKGA 4AE2A 1ZZ8A 4L8QA 5JOYA 2WT1A 1QJU3 2XJVA 1PGSA 4B4RA 4YVWB 2R6QA 1A78A 4D7YA 1I5ZA 4MXWA 2ET1A 2ZGKA 1RVF2 4HPKB 4FP2A 3O5SA 1HRV1 3FX3A 1CPNA 1R083 4BIFA 3VL9A 5CFCA 3H1YA 3AP5A 4BOWA 3AKTA 4IESA 1ULDA 5KXDA 4Y26A 3VBFA 1GZWB 1LOGA 3ZYGA 1OHFA 4TZDA 1RUJ3 4K3UA 4FPLA 4GA9A 5BUVA 3GHMA 4FAGA 1DFQA 5KXBA 3DPRC 3S7EA 4YZ1A 2FBEA 4P9LA 1T6GC 3AP4A 2DURA 4GB31 4MH0E 3GBFA 1NE6A 4UW6A 1ENSA 4HVQA 5CFDA 2HWF3 4W65A 4Y20B 2DCYA 1AR62 3QBQA 4LBOA 1VBC2 1LOFC 1ZZ6A 3WQ1A 4KBBA 1H8TA 2Z69A 1Q8PA 1VBA3 2BTVC 1N3OA 4XIOA 1FNYA 1NG0A 5DG2A 1RUJ2 4M3CB 3L2YA 1PZ9A 1VR3A 2WQ4A 2B46X 3ASIA 3FZ3A 5BNPC 4FPCA 1S0CA 2XKOA 1W6PA 5GLWA 4Z82A 1AHSA 3PVOA 2QKDA 3ZYRA 3JB8A 1G6NA 4CDWC 4S2GA 3CEWA 3D5OA 1GSLA 3LOBA 4PLOA 5FPXA 4FTSA 1QJU2 1HX6A 4FPKA 4KG0A 1M4WA 4ZXKA 1HIXA 3OJBA 2XJSA 5J09A 1VBE3 4FOVA 4RL7A 2VQAA 4NHMA 3VZLA 5T5LA 5FPZA 4B4QA 2C0ZA 2FQPA 4KG8A 4B29A 4A7KA 1RUG1 2DVDA 4CDQB 1SFNA 3LZZA 4F83A 1F8VA 1MZ5A 3HR9A 1V6JA 4BE3A 4YG0A 2KXLA 3E5QA 1ZZBA 4ASMB 1PMIA 1MQTC 3WG4A 1LKNA 3WX5A 3EQEA 1J3RA 2BEOA 1FX5A 2B5HA 5EYYA 2EIGA 2P3JA 2ZHKA 1FOD2 4HETA 1PGW1 1ZREA 2R32A 4XIKA 5F6LB 1YFUA 1S2BA 4Y1UA 5FO9B 3N4MA 4AFBA 5KXCA 1COV3 3J8F3 5BYNA 2YY1A 3KMHA 2PHLA 4DMIA 2D3PA 1ZRCA 3INAA 2MPFA 1QDOA 4AQ6A 2H0BA 5I0TA 3ZSEA 1AL0G 1REDA 1MS0A 1POV3 3ZX7A 4X8NA 5AC93 1UF2C 5C4WB 4RA0A 4FAHA 3WG2A 3HQXA 3S30A 5T5JA 4GKYA 4LR4A 1OA3A 1W6MB 3WP4A 4R9DA 3TN91 4CEWB 3M3IA 2YROA 3RI8A 5C8WA 3AXDA 2TBVA 3R05A 2FHRA 4YM0A 3ZFGC 4AXOA 3V64A 1RUI2 4AQ2A 3AK0A 1WD4A 1AYM3 3ZN4A 4XFCA 2LM3A 1AL21 3RQ0A 1RIRA 2E51A 3A0NA 3JB4C 4AK3A 2BBVA 4Z07A 3MYXA 3PVBB 1N1VA 1RUG2 1QJX3 1DHKB 4YGCA 4I09A 3HAGA 1GQGA 4J1WA 2CAVA 4YGDA 2QZ3A 1DZQA 3HMYA 3WP3A 1DYKA 2YHJA 2AH2A 3VZKA 1OFSA 4LO5B 4S2DA 4F3JA 5AVPA 4IQPA 4XTMA 4EN6B 3KS7A 3AJYA 1LTEA 2O0OA 1PNGA 1CAVB 1VB2A 4I0AA 2ZGNA 5JMCA 3GHNA 4W6XA 4IEUA 4AHZA 4LT5A 3DN7A 4TWTA 3ZN6A 4HFSA 1NCRB 3LA2A 2B9UA 2X29A 1PO21 4JRAA 4JTNA 1DDLA 1H4HA 3VBSA 3MLLA 4RR3A 2WS91 3ZYJB 1VBD1 1FNZA 4FPEA 2KM2A 1SLLA 3ST7A 2I2SA 2AGSA 4C1XA 1SFYA 1O91A 2YXSA 1PK6B 3VL8A 5ACA2 4RD7A 2HWE2 3P3PA 2OUHA 4O9EA 5IUQA 1H1IA 1C8M1 1FMD2 1UKGA 4LBKA 1RITA 4M01A 2WS93 1GLHA 3B9CA 2Q30A 1XNKA 3HN1A 4YM2A 1MACA 1PIV3 1ND2A 1W6OA 2C1FA 4K40A 2ZZJA 1QJZA 1ASJ1 1S0DA 3VZOA 3MW4A 3KQRA 4KL1A 5JAXA 1GICA 1QQP1 1RUF3 2MEV1 4OUSA 1MZEA 1EAH3 3FLRA 4N43B 5JSRA 2ZOEB 4RHV2 3H9AA 3JD71 5JSOA 1WCKA 2YV8A 2ZX4A 4AHXA 4X6QB 3MF6A 1ND3A 5EJ3A 1LOEA 4AFDA 4GKXA 3I8TA 4ES9A 3ZMOA 2IZWA 4JRLA 4K1YA 4OFGA 4QM8A 2D3RA 2R073 1JTZX 4OI2A 1RMU1 3ALQA 4IV1B 2F4PA 2G9GA 3LCPA 4Q1RA 2RS13 4DRRA 4MYEA 1CVNA 1LU2A 1PVXA 1REEA 2PAKA 5I93A 5C33A 3WLUA 1UX6A 4QGLA 1VBA2 1GNZA 1I9RA 2ATFA 3DGTA 1V6NA 2GC1A 2IFRA 4EWDA 2IWGB 4ISRA 1CR7A 4RGGA 3U4XA 3VBUA 1NCQB 1MS4A 3NL1A 5CFDC 2E9QA 1ZRFA 2XBO3 3KCXA 1NLSA 3KM5A 3O7OA 2WNVB 5EV7A 4XJWA 5GKAC 3SCGA 3ELNA 5FQ0A 1V00A 3FLTA 3N35A 2IFWA 4XZPA 3ZDSA 2XJPA 3NAPC 2PHTA 4WM7B 1YWKA 1NOVA 4FPGA 4AGRA 5EZWA 4C0HA 1H9PA 3ZXDA 4Y1ZA 3L2HA 1BZWA 4CP2A 5HCFA 3WNXA 4RHV1 1BMV1 1V9U2 5C9AC 2WNUB 2EAAA 1R082 4YG3A 3WXPA 2D6OX 2XVGA 2D97A 1DGWA 2RR13 3ZO0B 4HPKA 1AR71 1GZCA 1OQDA 2VU9A 2X5IA 2DU1A 2SLIA 3I59A 2GN7A 1H8VA 2R041 2XLGA 4LEJA 3ZXEA 4YRDA 3E97A 1WA4A 4CDUA 4LBQD 1SLAA 3TN93 3AFGA 2BPA2 2V73A 4XXAA 5C6CA 4J1XA 1I1EA 4K7JA 4FXKB 1MVEA 1BEV2 1RUC2 4HN0A 2VVDA 1VLNA 4YZ4A 5F1RA 1KS4A 1FAYA 2WKKA 4KWLA 5I8TA 1Q8QA 3WUCA 5A33B 1AR93 3AM2A 3GYDA 4N7UA 1ZBA3 1G7YA 1SBEA 1J3PA 4XILA 1YXWA 2YZ4A 2ZGQA 3JUUA 5D8AA 4MXVA 1KS5A 1RJ7A 1KITA 4QQLA 1ND2B 3VBSB 4Q4X1 2ZACA 2R0FA 2EF6A 1GFF2 2HEYF 1AYN1 4YW1A 4DRVA 1H8TB 2NMNA 4CDXB 4N9IA 3G6JB 1B35A 1WMFA 3HT1A 3JBG1 1JUHA 3WW1A 4A7YA 4COVA 5KHJA 1ZBA1 4B8EA 4IETA 3WQ0A 4JCKA 1IHMA 3E6DA 3PJQA 1O4YA 1GV9A 1X82A 4AI3A 2BGCA 2P3KA 1GQHA 1ZZ7A 2D5FA 4LE3A 4CEYA 1ULGA 4MZUA 1HXS3 4JDNA 4N7IA 4Y1VA 1RUE1 4HBNA 2DFBA 3AP7A 1Y9QA 1HXS2 2HWD3 3MLJA 1WMDA 2X53S 3OD0A 4Q0PA 1REFA 1Y43B 5HXVA 4D94A 1O3RA 1QY4A 3DUIA 1IS4A 2HWB3 4ORFA 1J58A 1ZBE2 4HSLA 2RS53 2NPIA 1C8M2 5J7MA 2XJQA 2BNMA 4GIQA 1YIFA 1OLRA 4IL7A 4P5HA 2OW4A 4WVVA 3B9IA 1LENA 4ONUA 3ZFFB 2ZMLA 2Y0IA 1H9WA 2BWAA 2E7AA 4W6WA 1QH7A 4C90A 1PVC3 5KHIA 1SEFA 4DOUA 1CAUA 1H0BA 4Q4Y2 2VW2A 3GZTB 3NSTA 1MS1A 1LHWA 2K0GA 3B93A 2VECA 4DY3A 1MZ6A 4RR3B 2QDNA 1XE7A 1MS3A 2DVBA 3RS6A 4AGGA 1J59A 4R9CA 4CEWC 1G86A 3SISA 4YVSB 4D69A 4FT8A 3M3EA 1AR92 2B45X 4FSJA 2MEV3 1DG6A 2P34A 1LHUA 2UY8A 4FBFA 4R9BA 2DVFA 1K5MC 1PVC1 4HVOA 1R093 3TNPB 1H1MA 1A3KA 2HWF2 2GU9A 4XXPA 4URTA 1TMF2 3WG1A 1YFYA 4XJ8A 1W0OA 1AYM1 3URFA 3H7YA 4C0BA 3SLIA 1DQ2A 1TNFA 2RS12 3KT7A 1M06G 4E2SA 1HQNA 4IV3B 1ULCA 4AEDC 3GZUC 4XTPA 2DVGA 1RHI1 4L97A 1BVP1 1Q56A 4JGZC 1CESA 4IV3A 3WQ7A 4WBBA 1PK6C 1Q3EA 1O4TA 2WSUA 3QD6A 4B7EA 2R042 4JGYC 1EAH2 4QT6A 4QPIA 4R9AA 4AFMA 2ENRA 1Q5OA 2BFUL 4UBGA 1PIV1 3B3QE 3VN4A 2D6NA 4QGNA 2WSVA 5CU1A 1V6LA 2NP0A 2DCJA 3CJIA 3VZNA 2RM23 3PHMA 4IV1A 1LESA 3RMXA 2ZAHA 2BQPA 4IERA 2K9ZA 3WCRA 3AYAA 4B7KA 1G9AA 1R1A2 2PHUA 4FVVA 1MVQA 2EALA 4NPRA 1C5HA 2ZHMA 4GQ7A 4CYDA 4BMBA 4I0WB 1J3QA 2XJTA 5FMOL 3H8UA 1S0EA 5IK5A 2H6BA 3RSJA 2XPJA 1ALYA 5CBLA 1ZA4A 4SLIA 3S6PA 3ZYPA 4HL0A 4XJ9A 4MVTA 3MFAA 5FQ0B 2ZHNA 1POV0 1IS6A 1NZCA 4H7MA 1JOJA 3OCPA 1VAVA 1TEIA 3AJZA 5GZEA 2I74A 5GZDA 4COZA 3AZZA 5L7OB 1G9BA 1C8NA 1AJKA 3N7LA 1AVBA 1OPOA 1U5YA 2OVUA 5I0RA 3OBTA 1AX2A 4CEWA 1W2UA 1NYWA 1QNYA 4XE9A 1VBE1 2VW1A 1QDCA 1RUF1 4YVWC 4COYA 5CIRA 5JI7A 1NY72 1HDKA 3QCWA 3IWZA 1D2QA 4OULA 5F9TA 3JD72 3V56A 1R092 1VALA 1VP6A 4HT1T 2RHPA 4MSVA 1S0FA 2A71A 4YYOA 4HN1A 1DQ1A 4YVSC 5JIAA 1XYOA 5CFCC 1LEDA 3HBZA 1QOOA 3VKMA 1F9KA 5IK7A 4XBNA 4Q0QA 2AYHA 5GZFA 4GXLA 4LO4B 2AZ5A 2TEPA 3MFCA 1C1FA 2Z79A 4GULA 2PHRA 5A3MA 1WLDA 1FV3A 4AQTA 3W59A 5C9AB 4JGZA 5SV8A 2JG8A 4JDMA 1F31A 4YZ5A 1W6NA 1QOSA 3I7DA 3FJSA 3BU7A 4BCUA 3ZMNA 2ZGOA 2Y0OA 4ISQA 1QXJA 1I3HA 1OKQA 1W6NB 4L9BA 4FOQA 1RMU3 5T5OA 4DINB 4ITCA 4OZXA 4AEKA 2OYZA 3QLQA 5ABJC 4QHBA 2HWD2 2VNGA 3HIFA 4XMIA 2R072 3BB6A 3FC0A 1XNBA 3WVJA 2WNUC 1O3TA 1VBD2 3BALA 2XH6A 2UURA 4AVBA 5FO8B 1ZZCA 3RRDA 2Y26A 5DDJ1 1HQLA 2DTYA 3PMEA 3O14A 5AVAA 2DUQA 1Q8OA 2UU8A 1SACA 5EWSA 4N90A 2Q4SA 1JBCA 2VNOA 1PGW2 1MQTB 4ZKTB 3AB0A 2ZX0A 3IBMA 1OA4A 4FPJA 4LNVA 4QM9A 1LHNA 1FOD3 1ZYBA 1AR73 3ZIWA 2WA3A 2LALA 4HK9A 1IPKA 5J98B 2UYBA 2PHWA 1KDKA 2A6ZA 4XBLA 5GLUA 1ASJ2 4CDQC 5KXEA 5F5QA 1O5LA 1RGSA 3A4UA 2YGMA 4LBLA 5TSWA 4AVVA 4FTEA 2WNUA 1QQP2 4LBMA 3ZIXA 2GZWA 5J48A 2A6YA 1RUE3 3Q9OA 2QZ2A 3PLQA 4X8PA 2RR11 3MW3A 5K0UB 3IPVB 2FMDA 1BEV3 1RUC3 4NOTA 2VMHA 1AF9A 2EXJA 4H55A 1NCRC 3AXEA 2JX9A 4I3GA 2VY0A 5K0UA 4OVEA 4YVSA 3RNSA 3J8F2 1PHMA 4K21A 2WZPP 3ILRA 4XF9A 2DUOA 4ASLA 5FFOC 3AMPA 4AFCA 1ASJ3 2ARBA 2ZGPA 4A2UA 2BNNA 1A6CA 1YCIA 4LO6B 2NQYA 5EXOA 4M00A 2D5HA 1YNAA 4META 2XVKA 4WVZA 3NW4A 1DQ6A 2WA4A 2GC0A 5E88A 1O3SA 1RUE2 3SXWA 5IT6A 5LEKA 1CAVA 2JG9C 5K0UC 3WZ1A 1XU2A 3M7AA 1YJLA 1VBC3 1NY71 1V6KA 1TNRA 3ZXAC 3DV8A 1LJ7A 4YG6A 1XXNA 4Q27A 4X6RB 3JQXA 1Z0HA 3KSCA 1LHVA 1G9FA 2DCKA 4XJZA 2PLV2 1RJ8A 3B00A 4C91A 2XL7A 4D7SA 3N3HA 5K7PA 2E63A 1V9U1 4Y24A 5GALA 4NHLA 3RYPA 3QACA 2ZKNA 2X8KA 4Z2WA 2GMEA 1COV1 1TQ5A 2ZA9A 1Z7S1 3HD8B 3W9AA 1WGPA 1YO8A 1HW5A 3GF6A 4AEDA 3NVCA 3OY8B 3U0ZA 3I2DA 4U36A 3V65A 5JPMB 4L11A 2JG9A 3NAPB 4WM7C 3VDDC 4BHPA 5GM0A 4JGZB 1QU0A 5BV6A 2D40A 4AI0A 3VBOA 3T1MA 4E4DX 2EA7A 1NQJA 1WBLA 4G9SB 4BZ4A 3ACLA 1LOFA 3I4IA 3R6SA 2R1BA 4BLJA 3WW3A 4ES8A 4BLIA 5E1RA 2R0HA 2XLAA 1OMIA 2P2KA 2WJSA 3UK9A 1LULA 3VBHC 1IS3A 3IDBB 1CD3G 1HLCA 3VKFC 1SDWA 3VGIA 1NCRA 2ZCWA 3TRSB 1V6IA 4LBJA 3KCYA 1NA1A 4P9WA 5LEJA 1LOCA 1ND3B 3WDUA 2RJKA 4WM8A 1QJX1 3LA7A 4TLFA 4XFGA 2A3XA 2DYCA 3VKOA 4S2FA 1IZ3A 2O1QA 1LODA 4RHV3 4EWAA 1L3JA 1Q43A 2ZX2A 4E9KA 1H2LA 3ZSLA 3N7JA 2AENA 3OY8A 5FOBB 2ZGLA 5HI0A 1HRI1 3ZXKA 2LUWA 3UL2A 1APNA 2JE9A 5T52A 4LUMA 1UIKA 5DDJ2 3VBHB 1SLIA 1W0PA 4LO7A 5BXXA 4COUA 4OI0A 1HV0A 1BQPA 2EXKA 4NN0A 4KGGA 3ZVXA 3EO6A 3RPQA 1UW8A 5JIUA 4OHXA 4TYSA 4JTOA 1NCQC 1ND3C 1AR81 2XGXA 5CFDB 5DXDA 2ZAAA 4GMP3 4P9GA 4L99A 4YZ2A 1TMF1 4JDOA 5I8YA 5A3LA 2RS32 2FMYA 4W6YA 3WV6A 1UU5A 4Q4Y1 3WDYA 2CNAA 2D6PA 3D0JA 3KD4A 1NQDA 5BNPA 2H0VA 4LBQA 1MS9A 2A6VA 2X5IB 4A3XA 1S0JA 5FTTC 2E7TA 3WY6A 3ILNA 2JG8C 5LK7B 1SCRA 2RM22 4QQ2A 1RVF1 1AX0A 1ULFA 5HBAA 3AZVA 1BKZA 3RJRA 1DIWA 2GDFA 1JW6A 5BNOB 4Q4V2 4I02A 1VBD3 4N53C 3USUB 3V0BA 5FO7B 1C5IA 3VBHA 3NAPA 1D0HA 3NO8A 5H9RA 1G9CA 3AZWA 1WLTA 2DFCA 1X7NA 2W0XA 3NV4A 4HSJA 3USUA 2RMU3 1QHDA 3V0BB 5FLHA 3RMYA 1NA1C 4IEWA 3LSEA 4U2AA 3SCHA 2HWB1 5BNNC 1XE8A 4Y20A 4LHKA 4QMAA 1W6QA 1CAXA 4AQSA 2X5IC 2D3SA 2W08A 2DU0A 2E7QA 1JXNA 3C2UA 2ZGTA 4MGIE 4AFAA 5JVVA 2HEVF 5SV5A 3CJIB 3CJXA 1FPN1 1ZNPA 1UZZA 2WINB 3M4FA 2PLV3 1LB2A 3VBOB 1KRIA 2VQ0A 4GALA 3RI9A 5LRSA 3I54A 1R1ZA 2XG3A 2RS52 4GMP1 1UAIA 2FZ2A 4OUMA 4FPHA 3KT1A 5HCAA 2VMGA 1OI6A 5E16A 1EV11 2QNKA 1MEC2 5HCBA 2XUMA 3OD4A 1MS5A 3PMSA 1COV2 4PIYA 1CJDA 1X8EA 2GH2A 5DG1A 4DB5A 3H3ZA 1MZFA 1QJU1 3VBSC 1IQAA 3WP5A 4BYYA 2GSYA 1VBA1 2CAUA 3MIHA 3UV9A 2GMPA 4LUKA 1LR5A 2PTMA 3JZVA 4AYUA 4QPGC 4Q8KA 5K9YA 1CQ9A 4H14A 3ROUA 3VHNA 4CDWB 1YJKA 3J9SA 3S7IA 2K2SA 2RM21 4Y22A 1NE4A 1C8M3 2V5YA 4OI1A 3GNEA 1OOPA 1ZBE3 2Q1ZB 1EYBA 1ENXA 3B7MA 2WQZC 1CIWA 3WDXA 3H3UA 1OOPB 4Q4W3 5BNOC 1YUDA 5JOZA 4AVCA 1FYUA 2R061 3VDDB 3ZSJA 3MIEA 3BCWA 1VBB2 1BEV1 1HRV2 1RUC1 3GALA 3OTFA 4YW3A 3DF0A 5FAXA 5CG9A 4MLOA 2D93A 1BJQA 4IEQA 4N53A 1UMZA 4F7ZA 2BW8A 4M0HA 4IEPA 4RS5A 3JCIA 5D1IA 1GZWA 4QQPA 3U11A 1AR63 4OLLA 1SBFA 4IEZA 4P9XA 2XJUA 4IEOA 1VRH3 4QPGB 2IXIA 4Q4X2 2SBAA 2ILMA 3M3OA 5BNNA 4I3PA 1RINA 4OHVA 5H9SA 3NV2A 1IOAA 2R043 3ZFFA 4TSVA 3FUOA 3CLPA 4QXKA 4LHLA 4H3WA 4RR3C 1H1AA 1BYHA 4UBHA 3BOWA 2VG9A 2HEWF 4XFAA 4YGEA 3AYEA 1ZM1A 5GLZA 1GANA 1U12A 2NYYA 3MICA 2ZPXA 3JD73 2ZKLA 5DUXA 4XOGA 2I45A 1FI2A 4CZSA 4Q4V1 2QVSB 3CU7A 1PO13 1RMU2 1OPMA 4MV2A 1TMF3 3UJQA 1VRH2 1O7FA 1VBB1 2CWMA 2RR12 2GC2A 1LOBA 2JDZA 5CFCB 1ENQA 2XWJB 3R4UA 4E27A 2A3YA 4YLZA 2O8OA 4LA2A 2HJIA 4XQWA 3P3NA 2NLRA 3ZXFA 4C1WA 1XU1A 1A8MA 5GJ6A 4DFSA 4QPGA 3RG0A 3ILFA 2ZX1A 3USSA 1B09A 1ZRDA 4P14A 3K51A 5KC5A 2Z5WA 3DPRA 1CN1A 4E2GA 1EP0A 3AKSA 4QPIC 3CO2A 2Q0AA 4BM8A 5DUWA 1O4ZA 1XYPA 2PHFA 4M0NA 1RHI3 4EN8B 2G9FA 3WT3A 2VULA 4K20A 1C57A 1BMV2 2JECA 3FBYA 4COWA 2GNTA 3BODA 1XNDA 1ZRRA 4JGYA 1CGPA 4YZ3A 1YHFA 5L7OC 1U5IA 1RUD3 4XHXA