1NCSA

Nmr study of swi5 zinc finger domain 1
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
47
structure length
47
Chain Sequence
TLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL FACTOR SWI5
publication title The solution structure of the first zinc finger domain of SWI5: a novel structural extension to a common fold.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription regulation
total genus 6
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1996-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1ncsA00
2EMYA 2EN1A 2WBTA 1B69A 1A1KA 2EMZA 1YUIA 2EPCA 2WBSA 2WCC3 3EPJA 4WSGA 2M9AA 2EJ4A 2LV2A 4F2JC 4R2CA 2EOYA 1X3CA 2EMAA 5KL3A 1UBDC 2EN6A 2EOIA 2RSIA 1LLMC 1YSAC 2EM9A 2YRKA 2GLIA 2EPRA 4R2EA 1Z1BA 2YRMA 3UK3C 2EM0A 2RPCA 4R2RA 2EM8A 1BB8A 2A25A 2EQ0A 3VHTB 1WJPA 2PRTA 1A1JA 3EPHA 4F6NA 1KJKA 2EPPA 1A1HA 2CTDA 2MKNA 2YTEA 2CT1A 2EM4A 2LCEA 2EL4A 4IS1C 1G2FC 5KL4A 2D9HA 1ZR9A 3M99B 1G2DC 1JK2A 2YSOA 2LVHA 2DRPA 2I13A 2EOXA 2EN3A 2R1FA 4GZNC 2EL6A 2WBUA 1F2IG 2EE8A 4F6MA 1TN9A 3EPKA 1A1FA 1A1IA 2ADRA 2EOFA 2YTFA 1RMDA 1NCSA 2YTDA 2JPAA 2DGCA 2YSPA 1X5WA 2EQ1A 2ELZA 2EOSA 2EQ3A 1BBOA 2LO3A 2YTNA 1TF3A 1AAYA 2YTOA 5KL6A 2DLKA 2EMWA 2ENHA 2EPAA 2EPUA 2EOOA 1P47A 2YU8A 4IJDA 2E72A 2EN8A 4R2PA 2EMGA 2EMBA 4R2SA 2J7JA 2NABA 1YUJA 5KL7A 1JK1A 1DGCA 2EOJA 2EMIA 2YTJA 1X6HA 1UN6B 4M9VC 2EM6A 3MHHC 2EMCA 2EPZA 4R2AA 1ZAAC 1A1GA 2YTGA 2EM3A 2EM7A 2MKDA 4FK5C 1MEYC 2EN2A 2EPXA 2CSHA 3MHSC 1ZU1A 2YTPA 2EMLA 1X6EA 1TF6A 2JP9A 2YU5A 2ENAA 1X6FA 2EOHA 4R2QA 2EMHA 2EM2A 2ELYA 2MDGA 5KL2A 2EORA 2LT7A 2HGHA 2GHFA 2EM5A 2EOQA 2YTQA 2EL5A 5KL5A 2BB8A 2YRHA 2EOZA 3EPLA 2EMFA 4X9JA 4R2DA 2EP3A 2EMXA 2EN7A 2EOMA 2EOEA 2YTIA 1A1LA 2EMKA 2DMIA 2VRDA 2ENCA 2DLQA 2EN4A
chains in the Genus database with same CATH superfamily
2EN1A 1B69A 2DMYA 4DR1E 2KONA 2WCC3 4DUYE 4BHCA 4F2JC 4WXCA 5LLQA 2EOYA 1XMQE 5KL3A 2EN6A 4F9CB 4L8NA 1YSAC 4OX9E 2EPRA 4P7DA 1GTKA 1SFEA 2YRMA 3UK3C 2EM0A 4R8OA 1A1JA 2GPIA 4F9AB 2EM4A 4BC7A 2LCEA 1ZBQA 5KL4A 2EPLX 1IBME 3HXLA 3OMLA 4O43A 2JOXA 4OOGC 3ECRA 2N3GA 2F8BA 3OTOE 4F6MA 3F6GA 1TN9A 3EPKA 1A1FA 2LUQA 3H09A 2YTDA 4JI7E 3ADLA 2YPNA 2EQ1A 4DKKA 1TF3A 2LE2A 2ENHA 1HNXE 2CPNA 3MSWA 2EPUA 5AE3A 4BC9A 4R2PA 1EKZA 2HJJA 1WRJA 2L2MA 2NABA 5T6JA 5IT9C 3DF6A 4JYAE 1X49A 4M0VA 1JK1A 1DGCA 1T38A 1YPNA 2EOJA 2YTJA 1L4SA 1IQSA 2EM6A 4BCAA 2VE7C 1ZAAC 3VYYA 2YTGA 2EM7A 4MLQA 4FK5C 2EPMX 3IWBA 2LTRA 2KOUA 1T4LB 1YYOA 1X6EA 4HTGA 1TF6A 2L3CA 3RMPA 3THOB 4JI6E 5ADZA 1IQOA 2UU9E 2EMHA 3ADJA 2ELYA 2LT7A 1T39A 3VYXA 2JR1A 3LLHA 3JU0A 2VF1A 1HNZE 2BB8A 2YRHA 5AE2A 3EPLA 4JI0E 3K6QA 4HEIA 2EPNA 2EN7A 1PJQA 2EOMA 1WHQA 2HHHE 2NUEA 4LF4E 2DMIA 2EN4A 2WBTA 4BMJA 2MDRA 4LF6E 1YUIA 2EMZA 2WBSA 2M9AA 2UXDE 2ODRD 1DI2A 1PKPA 2RS6A 1UBDC 5DNYA 2EOIA 1LLMC 4B3SE 5AE1A 2YRKA 1QNTA 4X65E 1YFHA 2EPOA 4DV1E 4J8ZA 2UUBE 5AC5A 2A25A 2B9DA 1WJPA 3VHTB 4DV4E 3EQ1A 2LJUA 2MKNA 1G2FC 2L3JA 1ZR9A 1JK2A 4RHBB 2E1MA 2EOXA 2EL6A 2WBUA 4RH8A 2B3TB 4TUIA 4KWYA 4JI3E 4NXNE 4JI8E 4ZYEA 4DR5E 2YWQA 2LUPB 1A1IA 1FJGE 2EOFA 4BHBA 1N32E 2YSPA 3C6MA 4DMIA 1X5WA 1N36E 2LO3A 1UILA 4DUZE 2YTOA 1XNRE 2K4VA 4MLVA 4DR2E 3J81C 2JY9A 2EOOA 1T4OA 1P47A 2JWOA 4X62E 2H36X 4IJDA 3QG5C 2UUCE 3HQ1A 1WHNA 3KZYA 1EH8A 2EMGA 3L00A 3HTXA 3J7Yp 5KL7A 3T1YE 4LF9E 4GEQB 4YY3E 4X66E 1J5EE 4JI2E 5LL6R 4JI4E 4LFCE 2JXPA 1UN6B 4K0KE 4M9VC 1AH5A 4DR7E 2MKDA 2N3HA 1ZU1A 1DQ3A 5AASA 2EMLA 2UXBE 2JP9A 2ENAA 1X6FA 2NA2A 3FIGA 4LF7E 2MC6A 2V8QB 2M7QA 4DV0E 2V85A 2FTXB 1ZBTA 2GHFA 4F9BB 1HNWE 2EMFA 1SR9A 4X9JA 1UHZA 2EP3A 2YTIA 4DR6E 2V86A 1A1LA 2EMKA 3VK6A 5F3WA 1YYKA 4L5NC 3KWRA 4DV7E 2ENCA 2DLQA 4WXDA 3TQMA 2FV4B 4DV5E 1A1KA 1YZ9A 2EPCA 1N34E 3C4BA 2WZOA 3JTZA 5LMNE 4R2CA 2EMAA 3J7AG 4M30A 2RSIA 2RTXA 2EM9A 4R2EA 2L6MA 2LMZA 2RPCA 5A6BD 3IWDA 2KHXA 2EM8A 1BB8A 3EPHA 2PRTA 1KJKA 4F6NA 2EPPA 2CTDA 4B3ME 1O0WA 3AUZA 2EL4A 4IS1C 1G2DC 2LVHA 2I13A 2NUGA 4GZNC 4LF5E 4ZYGA 1F2IG 2DB2A 2ADRA 1RMDA 4O24A 2E5LE 2BBGA 2V83A 4GKKE 3P1XA 2ELZA 3THNA 1BBOA 3HPZA 4DR3E 2DLKA 4BS9A 4JV5E 2EPAA 2IHR1 5A6BA 4GKJE 1PJSA 1HR0E 4KHPE 2ZM6E 2J7JA 4KZSA 1YUJA 2Q8UA 1J26A 4LU9A 2L2NA 4YHHE 2EMIA 4LTYA 1T4NA 2EPZA 1GZ6A 5IV8B 1A1GA 4AQYE 1MEYC 2EN2A 4B3TE 4Q35B 2YZTA 2CSHA 4LF8E 4DR4E 2RQLA 2V87A 2MC5A 1RQ0A 4X8WA 4B3RE 4DV6E 2EOHA 2R76A 2UUAE 2EZ6A 2EM2A 4Q28A 2MDGA 5KL2A 2M4IA 2B7VA 5CFFE 1X48A 2L33A 4LFBE 2EM5A 2YTQA 5A6AA 2EL5A 1KYQA 4X64E 1BBGA 4R2DA 3ADGA 2V88A 2EMXA 2L2KB 3BF2A 4NXME 2NUFA 4BBYA 2VQFE 3KZZA 1MGTA 1IBLE 2EMYA 4WYQB 1YYWA 3EPJA 4WSGA 1IMUA 2EJ4A 1STUA 2LV2A 4I8OA 1X3CA 4DV3E 3J80C 2DIXA 2M1SA 2EPKX 2GLIA 3T1HE 1Z1BA 4R2RA 5A6JA 2EQ0A 1A1HA 2L92A 2YTEA 2CT1A 1WXRA 2F4VE 2D9HA 3M99B 1QU6A 3BBGA 2JOBA 2YSOA 1GQEA 1RC7A 2DRPA 5A2QC 2EN3A 2R1FA 3F6HA 1FKAE 4WFTA 2EE8A 4DV2E 4NHRA 5BR8E 1XMOE 1PDAA 2ODRC 1I94E 2K7IA 1NCSA 2YTFA 2JPAA 2DGCA 1PJTA 4WX9A 4JI5E 2EOSA 2EQ3A 4R03A 3C6KA 2YTNA 4N4RB 1AAYA 5KL6A 2JYAA 2HC5A 2YT4A 3LMLA 2EMWA 2B7TA 4P78A 1N33E 3HPSA 4O4KA 2JVAA 2YU8A 4O5GA 2I9IA 2E72A 4WSPA 2EN8A 4F54A 2EMBA 1XNQE 1EH6A 2V89A 3JAMC 2G7HA 1X47A 4ZYDA 2DSYA 2UXCE 5LMUE 4ZYHA 1X6HA 1IBKE 3MHHC 3AV0A 2EMCA 4R2AA 2LTSA 4TUGA 2EM3A 1N3GA 3C4TA 4JI1E 2EPXA 3MHSC 2YTPA 3BGHA 5FLXC 3BIDA 2YU5A 5IXMB 5IWAE 1EH7A 4R2QA 3IWCA 2RSMA 2RS7A 2EWLA 2FGGA 4NZVA 5A69A 2EORA 2N8XA 5TSEA 2HGHA 2EOQA 3DJWA 4WPYA 5KL5A 2EOZA 4LFAE 3ZOQB 4M2ZA 5A6KA 2VQEE 2LRSA 1NEIA 2EOEA 5AC4A 2L8TA 2LBSB 2LJHA 4R2SA 2VRDA 3ADIA
chains in the Genus database with same CATH topology
2EMYA 2EN1A 2WBTA 1B69A 1A1KA 2EMZA 1YUIA 2EPCA 2WBSA 2WCC3 3EPJA 4WSGA 2M9AA 2EJ4A 2LV2A 4F2JC 4R2CA 2EOYA 1X3CA 2EMAA 5KL3A 1UBDC 2EN6A 2EOIA 2RSIA 1LLMC 1YSAC 2EM9A 2YRKA 2GLIA 2EPRA 4R2EA 1Z1BA 2YRMA 3UK3C 2EM0A 2RPCA 4R2RA 2EM8A 1BB8A 2A25A 2EQ0A 3VHTB 1WJPA 2PRTA 1A1JA 3EPHA 4F6NA 1KJKA 2EPPA 1A1HA 2CTDA 2MKNA 2YTEA 2CT1A 2EM4A 2LCEA 2EL4A 4IS1C 1G2FC 5KL4A 2D9HA 1ZR9A 3M99B 1G2DC 1JK2A 2YSOA 2LVHA 2DRPA 2I13A 2EOXA 2EN3A 2R1FA 4GZNC 2EL6A 2WBUA 1F2IG 2EE8A 4F6MA 1TN9A 3EPKA 1A1FA 1A1IA 2ADRA 2EOFA 2YTFA 1RMDA 1NCSA 2YTDA 2JPAA 2DGCA 2YSPA 1X5WA 2EQ1A 2ELZA 2EOSA 2EQ3A 1BBOA 2LO3A 2YTNA 1TF3A 1AAYA 2YTOA 5KL6A 2DLKA 2EMWA 2ENHA 2EPAA 2EPUA 2EOOA 1P47A 2YU8A 4IJDA 2E72A 2EN8A 4R2PA 2EMGA 2EMBA 4R2SA 2J7JA 2NABA 1YUJA 5KL7A 1JK1A 1DGCA 2EOJA 2EMIA 2YTJA 1X6HA 1UN6B 4M9VC 2EM6A 3MHHC 2EMCA 2EPZA 4R2AA 1ZAAC 1A1GA 2YTGA 2EM3A 2EM7A 2MKDA 4FK5C 1MEYC 2EN2A 2EPXA 2CSHA 3MHSC 1ZU1A 2YTPA 2EMLA 1X6EA 1TF6A 2JP9A 2YU5A 2ENAA 1X6FA 2EOHA 4R2QA 2EMHA 2EM2A 2ELYA 2MDGA 5KL2A 2EORA 2LT7A 2HGHA 2GHFA 2EM5A 2EOQA 2YTQA 2EL5A 5KL5A 2BB8A 2YRHA 2EOZA 3EPLA 2EMFA 4X9JA 4R2DA 2EP3A 2EMXA 2EN7A 2EOMA 2EOEA 2YTIA 1A1LA 2EMKA 2DMIA 2VRDA 2ENCA 2DLQA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMY A;  2EN1 A;  2WBT A;  1B69 A;  1A1K A;  2EMZ A;  1YUI A;  2EPC A;  2WBS A;  2WCC 3;  3EPJ A;  4WSG A;  2M9A A;  2EJ4 A;  2LV2 A;  4F2J C;  4R2C A;  2EOY A;  1X3C A;  2EMA A;  5KL3 A;  1UBD C;  2EN6 A;  2EOI A;  2RSI A;  1LLM C;  1YSA C;  2EM9 A;  2YRK A;  2GLI A;  2EPR A;  4R2E A;  1Z1B A;  2YRM A;  3UK3 C;  2EM0 A;  2RPC A;  4R2R A;  2EM8 A;  1BB8 A;  2A25 A;  2EQ0 A;  3VHT B;  1WJP A;  2PRT A;  1A1J A;  3EPH A;  4F6N A;  1KJK A;  2EPP A;  1A1H A;  2CTD A;  2MKN A;  2YTE A;  2CT1 A;  2EM4 A;  2LCE A;  2EL4 A;  4IS1 C;  1G2F C;  5KL4 A;  2D9H A;  1ZR9 A;  3M99 B;  1G2D C;  1JK2 A;  2YSO A;  2LVH A;  2DRP A;  2I13 A;  2EOX A;  2EN3 A;  2R1F A;  4GZN C;  2EL6 A;  2WBU A;  1F2I G;  2EE8 A;  4F6M A;  1TN9 A;  3EPK A;  1A1F A;  1A1I A;  2ADR A;  2EOF A;  2YTF A;  1RMD A;  1NCS A;  2YTD A;  2JPA A;  2DGC A;  2YSP A;  1X5W A;  2EQ1 A;  2ELZ A;  2EOS A;  2EQ3 A;  1BBO A;  2LO3 A;  2YTN A;  1TF3 A;  1AAY A;  2YTO A;  5KL6 A;  2DLK A;  2EMW A;  2ENH A;  2EPA A;  2EPU A;  2EOO A;  1P47 A;  2YU8 A;  4IJD A;  2E72 A;  2EN8 A;  4R2P A;  2EMG A;  2EMB A;  4R2S A;  2J7J A;  2NAB A;  1YUJ A;  5KL7 A;  1JK1 A;  1DGC A;  2EOJ A;  2EMI A;  2YTJ A;  1X6H A;  1UN6 B;  4M9V C;  2EM6 A;  3MHH C;  2EMC A;  2EPZ A;  4R2A A;  1ZAA C;  1A1G A;  2YTG A;  2EM3 A;  2EM7 A;  2MKD A;  4FK5 C;  1MEY C;  2EN2 A;  2EPX A;  2CSH A;  3MHS C;  1ZU1 A;  2YTP A;  2EML A;  1X6E A;  1TF6 A;  2JP9 A;  2YU5 A;  2ENA A;  1X6F A;  2EOH A;  4R2Q A;  2EMH A;  2EM2 A;  2ELY A;  2MDG A;  5KL2 A;  2EOR A;  2LT7 A;  2HGH A;  2GHF A;  2EM5 A;  2EOQ A;  2YTQ A;  2EL5 A;  5KL5 A;  2BB8 A;  2YRH A;  2EOZ A;  3EPL A;  2EMF A;  4X9J A;  4R2D A;  2EP3 A;  2EMX A;  2EN7 A;  2EOM A;  2EOE A;  2YTI A;  1A1L A;  2EMK A;  2DMI A;  2VRD A;  2ENC A;  2DLQ A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 2EN1 A;  1B69 A;  2DMY A;  4DR1 E;  2KON A;  2WCC 3;  4DUY E;  4BHC A;  4F2J C;  4WXC A;  5LLQ A;  2EOY A;  1XMQ E;  5KL3 A;  2EN6 A;  4F9C B;  4L8N A;  1YSA C;  4OX9 E;  2EPR A;  4P7D A;  1GTK A;  1SFE A;  2YRM A;  3UK3 C;  2EM0 A;  4R8O A;  1A1J A;  2GPI A;  4F9A B;  2EM4 A;  4BC7 A;  2LCE A;  1ZBQ A;  5KL4 A;  2EPL X;  1IBM E;  3HXL A;  3OML A;  4O43 A;  2JOX A;  4OOG C;  3ECR A;  2N3G A;  2F8B A;  3OTO E;  4F6M A;  3F6G A;  1TN9 A;  3EPK A;  1A1F A;  2LUQ A;  3H09 A;  2YTD A;  4JI7 E;  3ADL A;  2YPN A;  2EQ1 A;  4DKK A;  1TF3 A;  2LE2 A;  2ENH A;  1HNX E;  2CPN A;  3MSW A;  2EPU A;  5AE3 A;  4BC9 A;  4R2P A;  1EKZ A;  2HJJ A;  1WRJ A;  2L2M A;  2NAB A;  5T6J A;  5IT9 C;  3DF6 A;  4JYA E;  1X49 A;  4M0V A;  1JK1 A;  1DGC A;  1T38 A;  1YPN A;  2EOJ A;  2YTJ A;  1L4S A;  1IQS A;  2EM6 A;  4BCA A;  2VE7 C;  1ZAA C;  3VYY A;  2YTG A;  2EM7 A;  4MLQ A;  4FK5 C;  2EPM X;  3IWB A;  2LTR A;  2KOU A;  1T4L B;  1YYO A;  1X6E A;  4HTG A;  1TF6 A;  2L3C A;  3RMP A;  3THO B;  4JI6 E;  5ADZ A;  1IQO A;  2UU9 E;  2EMH A;  3ADJ A;  2ELY A;  2LT7 A;  1T39 A;  3VYX A;  2JR1 A;  3LLH A;  3JU0 A;  2VF1 A;  1HNZ E;  2BB8 A;  2YRH A;  5AE2 A;  3EPL A;  4JI0 E;  3K6Q A;  4HEI A;  2EPN A;  2EN7 A;  1PJQ A;  2EOM A;  1WHQ A;  2HHH E;  2NUE A;  4LF4 E;  2DMI A;  2EN4 A;  2WBT A;  4BMJ A;  2MDR A;  4LF6 E;  1YUI A;  2EMZ A;  2WBS A;  2M9A A;  2UXD E;  2ODR D;  1DI2 A;  1PKP A;  2RS6 A;  1UBD C;  5DNY A;  2EOI A;  1LLM C;  4B3S E;  5AE1 A;  2YRK A;  1QNT A;  4X65 E;  1YFH A;  2EPO A;  4DV1 E;  4J8Z A;  2UUB E;  5AC5 A;  2A25 A;  2B9D A;  1WJP A;  3VHT B;  4DV4 E;  3EQ1 A;  2LJU A;  2MKN A;  1G2F C;  2L3J A;  1ZR9 A;  1JK2 A;  4RHB B;  2E1M A;  2EOX A;  2EL6 A;  2WBU A;  4RH8 A;  2B3T B;  4TUI A;  4KWY A;  4JI3 E;  4NXN E;  4JI8 E;  4ZYE A;  4DR5 E;  2YWQ A;  2LUP B;  1A1I A;  1FJG E;  2EOF A;  4BHB A;  1N32 E;  2YSP A;  3C6M A;  4DMI A;  1X5W A;  1N36 E;  2LO3 A;  1UIL A;  4DUZ E;  2YTO A;  1XNR E;  2K4V A;  4MLV A;  4DR2 E;  3J81 C;  2JY9 A;  2EOO A;  1T4O A;  1P47 A;  2JWO A;  4X62 E;  2H36 X;  4IJD A;  3QG5 C;  2UUC E;  3HQ1 A;  1WHN A;  3KZY A;  1EH8 A;  2EMG A;  3L00 A;  3HTX A;  3J7Y p;  5KL7 A;  3T1Y E;  4LF9 E;  4GEQ B;  4YY3 E;  4X66 E;  1J5E E;  4JI2 E;  5LL6 R;  4JI4 E;  4LFC E;  2JXP A;  1UN6 B;  4K0K E;  4M9V C;  1AH5 A;  4DR7 E;  2MKD A;  2N3H A;  1ZU1 A;  1DQ3 A;  5AAS A;  2EML A;  2UXB E;  2JP9 A;  2ENA A;  1X6F A;  2NA2 A;  3FIG A;  4LF7 E;  2MC6 A;  2V8Q B;  2M7Q A;  4DV0 E;  2V85 A;  2FTX B;  1ZBT A;  2GHF A;  4F9B B;  1HNW E;  2EMF A;  1SR9 A;  4X9J A;  1UHZ A;  2EP3 A;  2YTI A;  4DR6 E;  2V86 A;  1A1L A;  2EMK A;  3VK6 A;  5F3W A;  1YYK A;  4L5N C;  3KWR A;  4DV7 E;  2ENC A;  2DLQ A;  4WXD A;  3TQM A;  2FV4 B;  4DV5 E;  1A1K A;  1YZ9 A;  2EPC A;  1N34 E;  3C4B A;  2WZO A;  3JTZ A;  5LMN E;  4R2C A;  2EMA A;  3J7A G;  4M30 A;  2RSI A;  2RTX A;  2EM9 A;  4R2E A;  2L6M A;  2LMZ A;  2RPC A;  5A6B D;  3IWD A;  2KHX A;  2EM8 A;  1BB8 A;  3EPH A;  2PRT A;  1KJK A;  4F6N A;  2EPP A;  2CTD A;  4B3M E;  1O0W A;  3AUZ A;  2EL4 A;  4IS1 C;  1G2D C;  2LVH A;  2I13 A;  2NUG A;  4GZN C;  4LF5 E;  4ZYG A;  1F2I G;  2DB2 A;  2ADR A;  1RMD A;  4O24 A;  2E5L E;  2BBG A;  2V83 A;  4GKK E;  3P1X A;  2ELZ A;  3THN A;  1BBO A;  3HPZ A;  4DR3 E;  2DLK A;  4BS9 A;  4JV5 E;  2EPA A;  2IHR 1;  5A6B A;  4GKJ E;  1PJS A;  1HR0 E;  4KHP E;  2ZM6 E;  2J7J A;  4KZS A;  1YUJ A;  2Q8U A;  1J26 A;  4LU9 A;  2L2N A;  4YHH E;  2EMI A;  4LTY A;  1T4N A;  2EPZ A;  1GZ6 A;  5IV8 B;  1A1G A;  4AQY E;  1MEY C;  2EN2 A;  4B3T E;  4Q35 B;  2YZT A;  2CSH A;  4LF8 E;  4DR4 E;  2RQL A;  2V87 A;  2MC5 A;  1RQ0 A;  4X8W A;  4B3R E;  4DV6 E;  2EOH A;  2R76 A;  2UUA E;  2EZ6 A;  2EM2 A;  4Q28 A;  2MDG A;  5KL2 A;  2M4I A;  2B7V A;  5CFF E;  1X48 A;  2L33 A;  4LFB E;  2EM5 A;  2YTQ A;  5A6A A;  2EL5 A;  1KYQ A;  4X64 E;  1BBG A;  4R2D A;  3ADG A;  2V88 A;  2EMX A;  2L2K B;  3BF2 A;  4NXM E;  2NUF A;  4BBY A;  2VQF E;  3KZZ A;  1MGT A;  1IBL E;  2EMY A;  4WYQ B;  1YYW A;  3EPJ A;  4WSG A;  1IMU A;  2EJ4 A;  1STU A;  2LV2 A;  4I8O A;  1X3C A;  4DV3 E;  3J80 C;  2DIX A;  2M1S A;  2EPK X;  2GLI A;  3T1H E;  1Z1B A;  4R2R A;  5A6J A;  2EQ0 A;  1A1H A;  2L92 A;  2YTE A;  2CT1 A;  1WXR A;  2F4V E;  2D9H A;  3M99 B;  1QU6 A;  3BBG A;  2JOB A;  2YSO A;  1GQE A;  1RC7 A;  2DRP A;  5A2Q C;  2EN3 A;  2R1F A;  3F6H A;  1FKA E;  4WFT A;  2EE8 A;  4DV2 E;  4NHR A;  5BR8 E;  1XMO E;  1PDA A;  2ODR C;  1I94 E;  2K7I A;  1NCS A;  2YTF A;  2JPA A;  2DGC A;  1PJT A;  4WX9 A;  4JI5 E;  2EOS A;  2EQ3 A;  4R03 A;  3C6K A;  2YTN A;  4N4R B;  1AAY A;  5KL6 A;  2JYA A;  2HC5 A;  2YT4 A;  3LML A;  2EMW A;  2B7T A;  4P78 A;  1N33 E;  3HPS A;  4O4K A;  2JVA A;  2YU8 A;  4O5G A;  2I9I A;  2E72 A;  4WSP A;  2EN8 A;  4F54 A;  2EMB A;  1XNQ E;  1EH6 A;  2V89 A;  3JAM C;  2G7H A;  1X47 A;  4ZYD A;  2DSY A;  2UXC E;  5LMU E;  4ZYH A;  1X6H A;  1IBK E;  3MHH C;  3AV0 A;  2EMC A;  4R2A A;  2LTS A;  4TUG A;  2EM3 A;  1N3G A;  3C4T A;  4JI1 E;  2EPX A;  3MHS C;  2YTP A;  3BGH A;  5FLX C;  3BID A;  2YU5 A;  5IXM B;  5IWA E;  1EH7 A;  4R2Q A;  3IWC A;  2RSM A;  2RS7 A;  2EWL A;  2FGG A;  4NZV A;  5A69 A;  2EOR A;  2N8X A;  5TSE A;  2HGH A;  2EOQ A;  3DJW A;  4WPY A;  5KL5 A;  2EOZ A;  4LFA E;  3ZOQ B;  4M2Z A;  5A6K A;  2VQE E;  2LRS A;  1NEI A;  2EOE A;  5AC4 A;  2L8T A;  2LBS B;  2LJH A;  4R2S A;  2VRD A;  3ADI A; 
#chains in the Genus database with same CATH homology
 2EMY A;  2EN1 A;  2WBT A;  1B69 A;  1A1K A;  2EMZ A;  1YUI A;  2EPC A;  2WBS A;  2WCC 3;  3EPJ A;  4WSG A;  2M9A A;  2EJ4 A;  2LV2 A;  4F2J C;  4R2C A;  2EOY A;  1X3C A;  2EMA A;  5KL3 A;  1UBD C;  2EN6 A;  2EOI A;  2RSI A;  1LLM C;  1YSA C;  2EM9 A;  2YRK A;  2GLI A;  2EPR A;  4R2E A;  1Z1B A;  2YRM A;  3UK3 C;  2EM0 A;  2RPC A;  4R2R A;  2EM8 A;  1BB8 A;  2A25 A;  2EQ0 A;  3VHT B;  1WJP A;  2PRT A;  1A1J A;  3EPH A;  4F6N A;  1KJK A;  2EPP A;  1A1H A;  2CTD A;  2MKN A;  2YTE A;  2CT1 A;  2EM4 A;  2LCE A;  2EL4 A;  4IS1 C;  1G2F C;  5KL4 A;  2D9H A;  1ZR9 A;  3M99 B;  1G2D C;  1JK2 A;  2YSO A;  2LVH A;  2DRP A;  2I13 A;  2EOX A;  2EN3 A;  2R1F A;  4GZN C;  2EL6 A;  2WBU A;  1F2I G;  2EE8 A;  4F6M A;  1TN9 A;  3EPK A;  1A1F A;  1A1I A;  2ADR A;  2EOF A;  2YTF A;  1RMD A;  1NCS A;  2YTD A;  2JPA A;  2DGC A;  2YSP A;  1X5W A;  2EQ1 A;  2ELZ A;  2EOS A;  2EQ3 A;  1BBO A;  2LO3 A;  2YTN A;  1TF3 A;  1AAY A;  2YTO A;  5KL6 A;  2DLK A;  2EMW A;  2ENH A;  2EPA A;  2EPU A;  2EOO A;  1P47 A;  2YU8 A;  4IJD A;  2E72 A;  2EN8 A;  4R2P A;  2EMG A;  2EMB A;  4R2S A;  2J7J A;  2NAB A;  1YUJ A;  5KL7 A;  1JK1 A;  1DGC A;  2EOJ A;  2EMI A;  2YTJ A;  1X6H A;  1UN6 B;  4M9V C;  2EM6 A;  3MHH C;  2EMC A;  2EPZ A;  4R2A A;  1ZAA C;  1A1G A;  2YTG A;  2EM3 A;  2EM7 A;  2MKD A;  4FK5 C;  1MEY C;  2EN2 A;  2EPX A;  2CSH A;  3MHS C;  1ZU1 A;  2YTP A;  2EML A;  1X6E A;  1TF6 A;  2JP9 A;  2YU5 A;  2ENA A;  1X6F A;  2EOH A;  4R2Q A;  2EMH A;  2EM2 A;  2ELY A;  2MDG A;  5KL2 A;  2EOR A;  2LT7 A;  2HGH A;  2GHF A;  2EM5 A;  2EOQ A;  2YTQ A;  2EL5 A;  5KL5 A;  2BB8 A;  2YRH A;  2EOZ A;  3EPL A;  2EMF A;  4X9J A;  4R2D A;  2EP3 A;  2EMX A;  2EN7 A;  2EOM A;  2EOE A;  2YTI A;  1A1L A;  2EMK A;  2DMI A;  2VRD A;  2ENC A;  2DLQ A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...