1NCWL

Cationic cyclization antibody 4c6 in complex with benzoic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG2A
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL01
1T5WB 1FNSH 2Q8AL 3RVTC 4AZ8A 1UXSB 2HVJB 3MSPA 4NQEE 1IEBB 2VDMH 3PWJA 3REVB 1SYVB 4XI5C 2P8LB 5D72H 2V2TA 1TVDA 1RURL 4R4BA 3W39B 5HHVL 4XVTH 4YHZH 5FUZH 4S0TD 4XPAH 5D1XB 3KPLA 4FNLH 3ULVL 4KROC 2MOVA 1Z2KA 2KKQA 4YFLF 3G5YA 5EU3B 5D9SB 4LVEA 4N0UB 3QIBA 4JRYE 5DEZA 1TQBC 3IDJA 3ZDYE 4HULB 3WS3B 5T5NF 3OAZK 1TXKA 3KPOB 3PWNB 1NCBL 5F6HI 4F7EA 3LEXB 3RL1B 5E8PA 4LLWB 4HC1A 1QPXA 5CHNA 3OKLB 5MEPB 4WTWA 4M1DL 3K7UA 5JHDE 1BIIB 2OI9B 4Z7UA 1NCNA 5IR1A 3BWAA 2IH3B 3RWHB 2FBJL 1NFDE 3DSFH 4LGPB 3QHZL 1V3KA 4JKWA 4A2LA 4Z76A 3MA7B 5HHQA 3BYTA 4Y4KD 3D3VA 5C6TH 1FH5H 5JPNA 3DX6B 3C5SB 4P2QB 3PWPD 1EA9C 3QDGA 2BRRL 1T0MA 3HMXA 3ULSA 3V6FA 4RGND 1CI5A 1BVKA 4PJDB 3FQNB 1JHKL 2FIKA 4LCWE 5JIHA 1BLNA 4UDUB 4JAMA 3ARWA 4JJ5B 1NGXA 4FQ1H 2ZCLH 4QO1A 3BDYL 2IQ9L 5CGTA 4PRHB 2NY0B 1DBBL 1SYSB 4Z5RB 4PJEA 5FDYA 4PGEA 1NBYA 3OL2A 1A4JA 4F57H 2NY2B 3I84A 3O3AB 1DBAH 3X11B 1L6XA 4ZFOA 1NFIB 4LKCB 1CD9B 3UJTL 4DW2H 3TBTB 5SWQB 2FX7H 1CU4H 2W65A 3QEQD 4KZEL 4JHWL 5E9DE 4LL9A 3H8NA 3HE7A 1PKQE 1XIWB 3RRQA 5E7FA 3PWNA 3HE7C 25C8H 4IS6A 1KB9J 3RGVA 5DO2D 5DWUH 3NACH 5HGBB 5B4MD 4DTGH 1ZA3B 3IDYC 1J5OL 4Z0XA 2WQRA 3L3DB 3QNXA 1OARH 1XEDA 5EOTB 3BMVA 1KEML 3P4NA 1EO5A 3QDJD 4ZAKC 5MERA 4Y4FA 3HS0A 4HXAH 4OZHB 1KBGL 3HAEA 4RFEB 1L9NA 5DJ0B 3C2SA 5ESAB 4PIRF 3TN0A 3NBNA 2B5IB 4QHLA 3QHFL 5C0CA 2A9ML 4HCRA 2P4AB 4HUMB 5T1MB 5CIPB 4MD0B 2ZNXA 3P11H 4JPVH 4YNYA 5HYEA 1BVKB 3M1BA 4PJDA 3FT3B 1A3LH 4R2GB 2XWBB 2ESVD 5D71L 3MJ7B 1KSRA 4U33A 3MGTA 1S9YA 4DUVA 3OAZH 3SDCB 1K6QH 1FVEB 2IPKA 5SWZE 3FN0H 4JO2H 2Q7NA 4I5BA 1I1AA 4MA7L 3MRGB 4H0IA 1T7YA 5C0AA 1CR9L 1QRKA 1UH4A 1I3GH 1M05A 3KYNA 1IJ9A 4GMSL 4MS8C 1I1CA 2DQGH 3MV9E 5E2UH 1QYGL 3FFCA 4NWUH 1HHIA 3L7EA 1NC4A 2UY6A 5ISZB 3P0YH 4EDWL 2G5RA 3WYRA 1ZTXH 3KNBA 3OMZA 3D39D 3R1GH 5IQ7H 1IT9L 2DLFL 3QQ4B 3UMTA 2P46B 2JK5B 3I9GH 2NZ9D 1GIGH 2FBOJ 4BK5A 5HY9B 2CXGA 5C08E 3SGKC 1S7TB 1WAAE 1O5DT 4LP4A 5BOPA 1UJ3C 2XZQL 4ZSOA 3CK0L 2CRZA 2GJJA 3MV9B 2E9JA 4X4YB 3IXTB 3B9KD 4DCQA 4P9HC 3V5KB 5C86A 4U1KA 5HVHC 4HMCA 4YDVA 3RAJH 1RJLB 5C0CB 5E99L 5GRWA 4JN1H 1I8KA 1XFPA 1K5NB 1DUZB 4FQCH 3RVTD 2YS4A 3WV0A 3ULVF 1JWSA 4FFYH 1HYRC 4M7KL 4GKSB 3P77A 4Q6YA 3IDUA 1MCKA 4PY8J 3L95A 5A3IC 5ITFA 5I16B 1F8TH 5DA4A 3F12A 4XBGA 1DBBH 3ESUF 5CILH 2A0LC 3DBXA 1ZHKA 3BD3A 3KPRE 5IEHA 5HHMB 1IGFH 5CEZH 4MNGB 5HHPA 3QH3B 1FZMB 5FYJL 4APQD 5ERWA 3OR7A 4O4YH 1F11B 5SWSB 5TFSH 4WFHE 5F1IA 2BCKB 1CFQA 1HHKA 1JPFA 2CQVA 4MDJB 1UCBL 3C5ZC 3IDXH 5GHWH 5D2LA 1OTTD 1ADQL 2DBLL 2IJ0C 4MJ5B 5B39A 5KVMC 1FH5L 2YWZA 4JDVA 3WFHA 3MA9H 3Q5TA 4LKXB 4HH9A 2AJSH 4ZXBD 4RCAA 3WIFB 2YPVH 1RK1A 2DWEB 4TUOB 5IBLD 5DHVA 4H20H 3L3IB 3WN5A 1UM4H 1UKSA 1DQMH 1J1XH 1GOFA 4OF5A 4I9WD 3I6LE 4DWHA 2APVA 2NXYB 4V2BA 5CP3A 5IBUG 3QUYC 4Y8AA 3RX5A 5D1ZC 1C7SA 3LKOB 1O0VA 1QEWA 3MV8B 1LO4H 4KY1L 4X7FC 3P73B 4D0CA 2H2PC 3E6HB 4NGHL 4WTZA 4YHNA 5KSVA 1DVFA 1URLA 2PYEA 5DJXB 4ZYKA 4WCYH 4Y4FD 5E94A 1Q9WB 3HKFA 3MGOB 1MHHA 3JUYA 5T1KB 1G7PB 5DMIL 1H3PL 5FUZL 2YUZA 4YHZL 1DE4B 2CMRL 4MNHB 4YDJA 3ECBB 2OR7A 5ENWA 5D72L 1CFTA 2FATL 3PIQB 4MSWA 3QDMD 3FQWA 1GGCH 4Y19D 3SDDC 3M17B 4OM1L 1KJ2H 3SE4C 1S9VB 4X7TA 2VWEC 4P2OD 3LV3B 1YDPA 3CAFA 1TLKA 2FRGP 1UJ3B 5DQDH 3TT1L 5LQBL 2JF1A 4KUZL 4G6JH 3C5JB 3IGAA 1MCWW 2PW1A 3C6LA 4EI5B 4UT7L 4JN1L 5T3ZE 3RKPA 3JWOH 3RAJL 1E4XH 1AQDA 2IMNA 4GMTL 4Y4KA 3S5LB 1UACL 1S5HA 1T7WA 3FKUS 3MRFB 4FQXC 4XPBH 3VXPB 3U2SA 4ODXB 4ZDHB 1SHMA 2R1XB 4BQ8A 1LEGB 1S7VA 4BFIB 1HQ4A 2V2WA 4WY7L 3U30B 1JF6A 4PRPE 3IRZA 1CE6B 2VDRL 3VXOA 2ZZUT 3QPXL 2GW5A 3ARBB 4P0DA 3WBDA 1OP9A 2BNUB 1A9EB 1EXUB 1BVZA 5DQ9A 4PFEA 3VWJA 2R1YB 5D1XC 5CJ5A 3CDYA 2A9NL 1ZT4B 3MLXL 3W11C 5D7IE 4ZQKB 3RY5A 2EE6A 1ZGLM 3NMEA 4KMQA 4RIRB 3P0GB 3VG9B 1KCVH 4FQXD 2PW2A 2E7LA 3ME0A 1WAAF 4LOUD 1PAMA 4O2FA 3LB6D 4WW2A 1DBKH 2X1PA 3I85A 1JI2A 5ICXB 1KCSL 1MAML 1RUML 3ARXA 1OP3H 4K07A 4LSUH 2YBRA 2ADJB 2GCYA 3J7HA 1A3LL 3GSNB 3ZKXC 5BW7C 2C3VB 2Z93B 3MRKB 4LK4A 4Y5XA 2BSSB 4N90E 4JO4L 1BP3B 1L6ZA 4DKFH 1CG9A 2ATPA 1INQA 2XTJE 4EXKA 2A9MH 4I2XA 1N0LA 1P4BH 4BFEA 2IBZY 1MQKL 1OPGH 1QA9A 1Z5LA 2R4SH 3N1QC 3KPSB 3QHFH 4X6BA 2E9WA 3CXDH 1KTLB 4NUJA 3V7MA 3KDMA 1AD0A 5GGQL 1IAOA 1HQ4B 4XCFH 4YFDB 4EI5D 2PETA 2EEDA 1RZGB 1DQDL 3GBML 2CJUL 2XQBL 5DS8B 4X8XA 5L9DH 4O5LH 7FABH 1N6QH 1U3HD 3RDTB 5T3ZL 2GJZA 4K7FB 2WIIB 3BN9D 1P69B 1EO8H 5DWUL 4MJ6B 2H8PB 5JIPA 5I73C 2YMXL 1X5YA 5JW5A 1D6EA 3VMOA 1T1ZA 5I1AB 3VXUE 3VW3H 4JHWH 5DT1L 1CU4L 3NFPB 4L1DA 2IANE 4XP4L 1IFHL 3JXAA 4MB3A 3CFIC 2FGZA 1R3JB 2JB6B 4L4VA 1QNZH 1JFQL 2P8PA 4TTGA 4UINH 1CYGA 4F57L 3H0TA 4LCCA 1U95A 1UADC 4XCYA 2JLLA 4UT6H 2OLDA 2ZCLL 1E4KC 4FQ1L 4RQQA 2YSSA 3RVVC 4H5SA 4DZBA 3SGJC 3HG1E 3C2AL 3VXUB 3SN6N 2BY2A 2Q8BL 1KN2L 4A6YA 4WI8A 5GS1B 1DEDA 3FQXA 1HE7A 1M6OB 1T1YA 5DTFB 3VFWA 1X5ZA 4JY6A 3WKNA 1CD1B 2CLZB 4M7JL 2BVPB 3VA2C 3BIAX 2Q6WB 3KYAA 1I75A 5DRZA 3SJVE 4MQ7A 2OSLB 1BD2B 3HR6A 3O3AA 2ZUUA 5D2NE 2NXZB 2VAAA 1P1ZA 3V8CA 2E7BA 4X6FA 4UAOB 4L3EA 2ZUYA 4FRWA 3T65A 3MLUL 3UTOA 3GI8L 5TF1H 3U0PA 4NYLB 5F1IB 4R26L 1IAIH 4OUUB 2Z92B 5JORA 1A4KA 2D4FA 2F53D 2K3TA 3HUJE 3TZVA 1INDL 3GB7B 4HS8H 3RTQB 3QFDB 2V5SA 4NO3A 2WSKA 4FFWC 3WDJA 5F8RC 5ADOH 4KVNL 3CVHB 5LGJA 2FB4H 1OD7A 4U6XB 4WU5A 4X99B 3VI4E 1R3JA 3OKLA 4MAYC 3BKCL 1BM3L 4MAYA 4P2QE 3GJFH 4Y1AE 1VB9A 3GSWA 3GI8H 4S1SL 2R2BB 2W9EH 4FABL 6FABL 3UZQA 3VXTB 4WUUA 1V5JA 1CZ8H 2ZG2A 3EFFB 3OQ3B 1XGTA 4JRYA 5EN2A 5FHBH 4OLZL 2W9DL 4FQXB 4PJAE 4O9HH 3HI1B 4PRIA 1J1OH 3DV4B 4ELMA 5I15H 3SKOA 3X17A 5IMKB 3F7VA 5DHVH 3N85H 2ADGB 2F9BT 3ZE0F 1CGSL 3CU7A 4BKLA 3QQ9C 5KBNC 3SDCA 3QCUL 1T89A 2IPKB 3KJ6L 4D9RD 1EAPA 4G5ZH 4QOKD 5CZVH 2Q8BH 2X4UB 3T1WA 4GUPA 3W9EA 2WW8A 4K8RD 1T3FA 2OK0L 3OJDB 3H9SD 1AGBB 1XCQA 3A6BH 4HUWB 1XR8A 2Q20A 1N6UA 1GPOH 2B4CL 2Y6SD 5HDBE 2P7TA 3UAJC 1AC0A 4NYLA 1MPAH 4PGJA 1C5DA 3FQTB 3LQAC 4HK0B 1IKFH 5AYUL 4KV5E 3NPSB 5C70A 3NCCB 1VFMA 1QSFE 4N5EC 2VB5A 4F80A 1MVFA 4I3SL 3I50L 1MHEB 3WO4C 1KFAH 3OF6D 5FYKD 3RWDB 3ZYZA 1WC7B 4HBCH 1MH5A 4Q6IB 1FG2A 4HWZB 4XBEH 2V7NB 5C07E 5CGYD 2YPLB 3BO8B 3CCHA 4P2OB 4PPTA 4PR5B 1XGUA 2SEBA 2APBA 2NR6D 4M5YH 4DQOL 5FGBC 5L9DL 1JNHB 1UQSB 3EO0A 5T1LA 2UWEB 4MQXD 3PL6D 5ESAA 5DUBA 3TN0B 3B2UD 2HT4D 1IC7L 1PLGH 4JDTL 4TUOA 3C8DA 5C0ND 3GMRA 1CT8A 3STLA 3CXDL 4XT1C 3UTSE 4JPIB 1LHZA 1OPGL 1MQKH 1UZ8B 1KGCE 2DJSA 4HPOL 3T0EA 1QR4A 3KHOA 2XRAL 1RZFH 4MZ3A 2BNRA 2HFEA 2GJ6D 3V2AR 1E27A 4HLZG 4PY7B 4KHTH 2VISA 4BSJA 4NOBA 3CZFA 4OKVA 4U1NA 3SPVB 3HE6B 1NSNL 3DETC 3OAUL 4PJXE 3MRCB 3D2UA 1E28B 4EQ3A 2Z93A 1LMKA 2DM7A 1ZS8A 1DBKL 3UBXI 3BKYH 1I85A 1P5VA 3UTSB 3RX7A 3VGAB 4JEGB 4X5WB 4OBRA 3EOTL 2OTUB 3H9ZA 3IDMA 1KCVL 1A1OA 4QXUH 3CH1B 1F6AA 3GSXA 4YEFA 1H3GA 1RK1B 2LAAA 4L5FH 4J23A 4PJGE 5J4MA 4RFNB 2GK0B 4Z7NF 4P48A 1M71A 3NCEB 5I75C 1D5XA 1SJHB 5FO9A 3JWDC 2X4PB 1ND0A 5DHYA 1C08A 1OAUH 3C5JA 3OB8A 3QPXH 5I9QC 5I0DA 3W5MA 3MRJA 1RD6A 3QUYB 1H5BB 4W4OC 4Z7VB 5F7DA 4TQEH 3GK8L 3TO2A 4MJ6A 2J5LC 4OF6A 1ED3B 1PEWA 5F7KC 2OBGA 3B5HA 4OLXL 4PBWD 3V9FA 5I1LA 3FFDA 4XPBL 1SMOA 3LH2L 4CAGA 5F7UA 3O11A 3UTZA 3QWOA 4NFDA 4PJ9C 5A1AA 3T0EB 5FOBB 5HYQB 4OIIL 2CD0A 5CP7A 3O41B 1M7DB 3W2DL 5D7JA 2Y36H 3WLWC 3F12B 4XBGB 1P84J 3AREB 5I1IH 1UB6B 3TH2T 1AY1L 5HSFA 3TA3A 1CGYA 2QADD 3ARSA 3PWUB 2Y1VA 2QQLL 3ILQC 3T0BA 1RY7B 4U6YA 2J4WH 1BF8A 3GNMH 2HVKA 4KTYA 2VE6A 1FNFA 4YBQD 5ERWB 1JJUA 4KI5C 5CZXD 1MEXL 5H94B 5CUSL 1DUYA 1ZMYA 3RGVC 1FL5B 2XWBA 35C8L 2NYYC 4V1DA 5DMIH 5DQJB 3MZTA 2QQNH 4TSCL 4U1SA 4XNYH 4DGYH 3DTXB 3U2SB 3ZE0E 1CD8A 2ZCKH 1LEGA 1R0AL 5SX5H 3WXVH 4KK8D 5D2LE 1RAMA 1HH9A 1INEH 3FO1A 4L4TE 1MCPH 3NCMA 5ISZA 4G6ML 4WWKB 1DQJB 1FFQA 2AKRA 4I2XB 4M93B 5F7LB 3VXSA 5I1JH 4QRPB 3IXAB 1JZ8A 2NY4B 4JFFB 3GO1L 2JK5A 3EOBB 2EIDA 1FYTB 2WWMC 2X4OB 1F5WA 4Y2OA 5SWSD 3FB5B 4UUJB 3DV6A 4H20L 1T20B 3ARDA 2CDFA 2AJSL 3ARDC 2HRPL 3MA9L 3D69B 1FFPB 3PV6B 5FYKL 3A6CH 1FZKB 4Y4HA 4UV7L 3C9NA 2HG5B 2IFFL 4N8VB 3BP7B 4HGWB 3UTPE 2NX5D 1Q0XL 3IDIA 1AQKL 4O4YL 4ZPTA 5KVGL 1RJLA 5CCKH 2N7AA 5ITBL 1G7IB 5CEZL 3OR6B 2X7LA 4M8QA 2ZSWA 1TTUA 1CFNA 2VE6B 1KTKE 4R7NA 4F37K 5D7KD 2BMKA 3MROA 1EMTH 1NQBA 3DRTB 5GS0D 1MCLA 1UXWA 5FGCE 3UYOD 4I77H 4ALAL 3U7YL 1AO7E 3TIDA 3PGFH 2X4RB 4TVSa 4LVNB 2HLAA 5IG7A 2XA3A 4RFOH 3SJVD 1KEGL 3LKQA 1U8OB 3FMGH 3ZL4L 1GOGA 3ZTNL 2ZP0T 3BHBA 1OSZB 2EH8L 2IAMC 2XXCB 4JQXA 5L7XL 1IM9B 4JM4L 4UAOC 3WHXA 1W0YT 3QDGB 1HHKB 1BOGA 5CEXA 5ACLA 1KENH 4GG6A 4HUVA 4XVUD 1F58H 1MI5A 1ROWA 3GJFK 2HN7B 4DOHB 5IVZA 3NABL 4NNYA 1N7MH 2OI9C 4PS4L 1ACYH 4Q0XH 2B39A 3L3OA 1JPTL 3L9RA 4V1DE 3SDDA 3EJJX 2X1QA 1MNUH 2BDNL 4ZXBB 5C0NC 1IL1A 1YPZE 3TWCL 2NY4D 1FO0L 3MLZL 4GKSA 5I6XC 3BESR 4L8CB 6CGTA 4EN3A 4PJGF 1EEQA 1DANT 3QO1A 3P0YL 2GHWB 3TO4D 4HEME 1QTYT 5BO1L 4BH7B 2GUOB 4PJFA 5DD5L 1FE8H 1CXEA 2DQGL 4FA8A 3QXAB 5JQ6L 3FT2B 4OFPA 1LD9A 1F3RB 2YEZA 3Q3GA 1JPSL 4P49A 4L3CB 3STZB 1MJ7L 1NAMB 1NJ9A 4OKDA 4XMKH 5B8CA 3FOMA 2LE9A 3SQOL 5KVFH 3SDAA 4U7SA 5C7XH 1IAIM 3L3DA 4PTUA 3SO3C 4YBHA 2FIKB 3HMXL 4I9WE 3WN5C 2EXYD 3R0NA 2NW3A 2EDQA 1G7HB 1S7XB 4PJ8C 5BQ7A 2BNRB 2HFEB 4OZ4A 5CEYB 2CRIA 2QKIA 1M1SA 4KJQD 2AV1B 2CIKB 5I66B 1B4RA 2RCSH 3NGBC 2D31B 3WNNA 2A6KA 1IGIH 2JCCF 4LLQA 1JGUL 3CLFL 5GS0L 3QUKA 1QSEE 4Y1AD 4PJFE 3F5WA 5DS8A 1F4YL 3EYUL 3O3DA 3NZHL 4YXHH 1FBIH 2IGFH 1C8PA 3VXRB 1BIHA 3WSQL 5F9AC 5JO5B 1MCEA 1JZ6A 4Z7WE 4PJDF 4L9LC 5ID1B 1GJIA 5D93C 2H9GA 1GXEA 4HG4J 1GCFA 2X44D 4JREC 4S0SD 5J7CC 1ZA3A 2GEEA 4XX1E 2FX7L 3C60C 1HOCB 1YC7A 2IADA 2KPNA 2UV3A 2VL5A 2J8UF 2M8XA 3U36A 3ARGD 3DWTA 3H9YA 5C0DB 3UJTH 1ND0B 1JVKA 5DHYB 1TJHH 3GKWL 4LQFL 1MRCH 1FAIL 2HTKD 1DUZA 5DR5H 1A6UH 4MA1C 4RAUB 4FQHA 4X9FA 4OD1H 4GW4A 4NO0A 4PP2A 3UTQB 4Y2DC 4LNRA 5FEBA 4NJ9L 3HR5B 5GJSH 1KPUA 4QXTB 4YNYB 1AO7A 1WK0A 4W6YB 2UZXB 4Y5VA 1XGYL 3PDDA 1MLCA 1H0DB 4ENED 5JDSB 2DMCA 4OLYL 4RZCA 4IRJC 3I6KA 4JLRA 5J9PA 1AIFA 1EFXD 4LSPH 4G43B 3A67L 3C60B 3VFSB 3L5WA 5HI3D 3NPZB 5C0AB 4RISL 2OSLA 5C6TL 4DAGL 5D2NA 1FFOB 4M6NL 4PG2A 4WW1B 3QIUA 3FZUC 2FGWH 3CDGA 3HTLX 2ICEB 3C5ZD 3QHZH 2VDKL 4NC1E 4OCNC 4GS7C 2VC2H 2YXMA 1L7IL 4ELMF 4OGAC 3UO1H 3ZTJG 4U3XA 3EYSL 1KIRB 3F65A 5C0BD 1ZHLA 4M1DH 3VXRA 4TVPH 2DQTL 3HC0B 3TCXA 4B50A 3S97C 5JA9A 4S1RL 2FECI 3CVHA 4FXGA 4PYGA 4QRPE 3S36X 2YA0A 2HFGL 4MX7A 3MV8A 5DDHA 1F4XL 3GUTB 3OR7B 2IBGA 5D1QD 4XP6H 5F1KC 3BZEB 4LSQL 1DDHA 3IJYA 4N90D 5E9DB 1BQLL 3DSNA 1ZT1B 1KIPB 4I0PA 5AAMA 1FC2D 2VH5L 4TRPL 5HHVH 4QF1A 4XNXL 3MRBB 1D5MA 3PDOA 1DBJH 5T1KD 3VRIA 4CBPA 4DFIA 1KULA 2I9LB 1AR1D 2N56A 4WDIB 1NBVH 1WTLA 3QDMA 2Q8AH 4POYA 3Q6GH 3TO4B 3HHRB 5A43C 2UY7A 4GXVH 4Q97A 3LB6C 3ZE2E 1PSKL 3BN9C 4ZUVA 5L0QB 3QNZB 4GXUM 4RGNE 4IOIB 5F7DB 4NWTH 5I18L 3DGGA 1FNEB 2WIMA 3MRHA 4B41A 1E28A 5DVNA 3BRFA 1FZOB 3OJDA 5CP3H 1DFBH 4XWOC 5A2LH 4P46B 1BHGA 3UBXG 2EC8A 5GS1A 1QZ1A 1OL0A 1U58A 2GJZB 2RB8A 1KB5L 3VG0H 3SE9L 2ADIB 2NXYC 4FQLH 1WVZA 5LAXA 3VWKD 3UZEA 2Q6WA 2D3VA 1YNKL 4ODSL 5I1HL 3NFPA 4YDJB 4N8PA 2RFXA 3O6KH 43CAB 2UVEA 2D7OA 2X4RA 1QBMH 4Z5RA 1HKLL 4DVBA 4OGZA 4JM2D 2AP2A 2ICWB 2P8PB 3DX8A 2UWEE 3T3PE 1E4KA 1N6VA 5J12B 4UOW1 3L5IA 3IETB 2AJ3A 1NUNB 4XCYB 4OF3A 2DQCL 2P48B 4Z7VA 4PR5A 4G9FE 1GZPB 3BDXA 5F9WC 5EC1A 5AAWA 4ZQKA 1W8NA 5EOQH 4WEMB 1JGLH 3CX5J 5D70L 2LTQC 3QPQD 4RFNC 3P9LA 4ZOEA 4V2CB 2IH1B 1UEYA 3QUMH 4OLWH 4KRMB 4K7PY 2OQJB 1KN4L 1TETH 1T6WA 3NZ8B 1U8IB 4G3YL 3MLVH 3U9UB 4WWKA 5D7JB 2GCYB 3MOBH 4NKDB 1FYTA 2WQ8A 4JCLA 5IEKB 3RIFK 3ALXA 5DQ9B 2A73A 2R69L 2WLZA 1QBML 2ATPB 2B1AL 1T7XA 2EO9A 5C9JB 1NCAL 3OJMB 3LMJH 3D69A 1X5HA 4Z78B 1L7TL 2A6IB 3FZUD 2BNRE 3C6LB 2NY4C 4WHYH 3OKNA 4OD2A 3LKNA 1B0RB 4PJGB 4OFVA 4R4BB 3FO2B 2ESVE 4LLVA 5EBMA 3DYOA 4Z7VE 4YUEL 3RHWF 4Y89A 1J8HD 3GSNA 2RGSA 3WUWA 3EYQC 4PRID 1Q9KA 1H3VA 2A6KB 3FFCB 5JW3L 1LE9A 4Z7WB 5MEOB 4BZ1H 1NC4B 2FLBT 2I27N 3HE6D 1F4WL 1NAKH 4P4RA 3Q6GL 3OKKA 2DS4A 4QOKA 2P8MA 2C4FT 4TUJA 2VSDA 1RMFL 5DVOA 4UNTA 1LDPL 2HJFB 3TVMD 2JIXD 1U92A 5I8KH 4JHAH 3T8XB 2OJEA 5DC4B 2JJTC 3VI3E 3O4LA 4OD3L 2VH5H 1BQLH 3QEUA 4OV5A 2C3XA 4AJ0A 2VZSA 1I7UA 5HPOA 4JR9L 5JPNB 3AREC 4MQXC 1H3UA 4FTVD 3J8F7 1IC4L 1NCUA 4DGVH 1N0XH 2HKFH 5IB3B 1IEHA 4Q9QL 3DURA 2DLGA 4G6AD 1Y0LA 2G2RB 1UM6L 3T1FA 1LEKB 2N1KA 1JF1B 4ZAKB 4CNIB 4QY8B 1DN2A 2D0FA 4N0UE 2G5BA 4ZFGH 4H26A 5ESVA 4QRRD 5T3XH 2DLIA 1A6ZB 1DEEA 4XAKD 4IIQB 4PJHE 4TNWF 2F19H 2W91A 4P5TA 5DRXA 4M6NH 3SPVA 3VD4A 3B6SA 2ED8A 3DX7B 5IGXH 4PGDA 4Q6IC 5JMRA 3MRCA 1FRGH 2Y7QA 1MCDA 3LV3A 1MH5B 4GAGH 4JKPL 4N0RA 4Q6IA 3S98A 3SE3C 2VJXA 3WJLA 5L0QC 4YGVA 2YEZB 3GI9H 3RKDD 5SWQA 4PJ9A 4E42B 4OCRL 5E03A 4WENB 1WTGT 4HUUB 4LPUA 2BCKA 4YDIH 2CGRH 5IIEA 1CLYL 1NLBH 3VFUA 3IDMB 3H2WA 3C08L 4YHLH 5DUBB 4X4ZA 3VXPA 5GJSL 4CN6A 4XMLH 4QRUA 1TENA 4PJHB 4LAQL 3TP4A 3VXNB 1A14H 4OM0L 4PRNA 4WFFE 5IHBA 2AJVH 1MCJA 5DR5L 4N9GA 2AK4A 1ZA6A 4LQFH 2J6EA 5C3TA 4DK3A 1HXYA 2H6PA 5F9WB 2GAZA 4CGTA 1OGTB 5JDJA 5C9KA 5M7QA 5DDHB 3GUTA 4Z7OF 4R4FH 1MFEH 4M43L 1BFVH 3ZE1E 1UC6A 3SE8H 1ZK9A 4RQQB 2D0HA 4JQIH 1QSFB 4WVRA 3D6GA 5AUMB 4RGMB 1HCVA 5INDB 3CVHL 4L3CA 3GMNA 3G6AB 4OQTH 3JWDH 3TN0C 4NZRL 5K9QI 5GGRB 2R0LH 4HWEH 1WFOA 5C07B 4F33A 3B2VH 4X5WA 4XB7A 5BMFL 1S9YB 2NY3D 3DRTA 1BVLB 3NZHH 3PXHA 3BIBX 2V17L 3WNOA 2GFBB 4B0MM 4TSAH 2DF3A 3FO9A 3OHXB 2VZTA 2FEEL 4F7PA 3HG1A 1KPVB 1TNMA 3D25A 4NZTH 3DGGB 5FB8A 1NCCH 2HAZA 1OGAE 3LY6A 4NO5A 2EDHA 2E27L 3O2VH 3CFDA 1P2CA 3CLEL 5FV1L 1DUYB 5HVWA 3OF6A 3HMXH 4KKAC 4ZG1A 5IMKA 3GB7A 4ZTOL 4NNYB 2AJYH 2Y5EA 3L5XL 2FJHB 1AGFA 2FZ3A 4EUPA 3FOLA 5F96H 1X5XA 1IAMA 1WZLA 4DUXA 4YHYC 1FFOA 3H3PL 1OP5K 3IKKA 3U0TB 3TJEH 4MXQC 1ODAA 1TVHA 1B0GA 4U1KB 4RBPH 4QRPA 3BX7C 2VRAA 1EBPA 3LPWA 3C87A 3O4LD 2OM5A 2XG4A 5IROA 3OG4B 3QAZB 1KPUB 3M45A 2R2EA 4JFZH 4QXTA 5JOFB 4QEGA 3OB0K 4Q0XL 3Q1SH 2VAJA 1D5IL 4PS4H 4UTAH 2VZ3A 3NABH 1G6VK 5FYLE 4IDLA 3IU4L 4RDQF 1RUQH 4H8WH 5DEGB 5DMGC 4ACPA 1DDHB 1IKNA 1FHGA 3QFJD 3QUZD 2IALB 1R3IL 2EH8H 1M7IA 3U1SH 3PDOB 2W1NA 3WXWL 4PJ7E 4RFOL 1KEGH 4XNUL 3QCVH 1AHWC 3ARFB 2J12B 4IMLA 4JM2F 2NY6D 4ALAH 4J6RL 2ARJB 1HEZA 4ODVH 4DK6A 1BECA 4BELD 3DI3B 4U2ZA 4IOIA 3D87B 4M62L 4ZOCA 5CJ8A 3BFOA 2YR3A 4X4XA 3O2DL 5IW6B 5CCKL 5IW3A 1FYHB 1CDJA 4Z7VF 1AQKH 1S9XB 2ZJSH 2X4SB 5DMJB 1JIBA 4UMGA 1K8IA 5J3HC 2A6DA 2E9IA 1S7RA 4NQVA 5ALBH 3S6CA 1RUKH 3X13B 3UTSA 1FQ9C 5FYKH 2IG2H 2CRYA 1IGTB 4B53A 1EEZA 2EKSB 1Y18B 5I30L 4JZNB 4R0LB 3ZT6A 4K2UL 2XIDA 4OAWA 1K2DB 1YJDH 2DKUA 3VGFA 1WICA 2RJMA 5I1JL 1V7NL 1JTTA 3QCTL 4UNUA 5GGSA 1VERA 2JE8A 3SO5A 3ARED 1OLLA 5L2JB 4HMDA 4HUXB 2BVTA 3P4LA 2J8UB 3BT2H 4G6KL 5B38A 1C1EL 2QHRL 1MF2L 4MDIA 2X1XR 4XCNB 1PYWB 4NRZA 1U8MA 3UTTB 2B0SH 4P9HH 4HFWA 1R0AH 5LCVH 3VGBA 1BBDL 1XCTB 5F7WC 1U41A 2CUMA 3TVMC 4BFGA 4PD4J 3CDGB 5IJKC 3D1MC 4G6KH 1T21A 3A0OA 4TOYH 4ZD3H 1G7LB 4DJMA 2NW2B 1SYVA 3QCTH 5E4IA 4JY4B 4F8QA 5D93B 3UP1A 3S4SB 1YJDL 2WBJB 2ENSA 3MUY1 5GZND 2JB5L 4Y4KC 5JW4R 5I1IL 5ADPL 3S88H 5T1DL 1F11A 5SWSA 3WNPA 2H3NA 2Y36L 4K7PH 4XPGL 1A7PL 1CFQB 3U4AA 4TTDC 3RWEA 5D9SA 4PJ7A 1ZVYA 4KQ4L 4NQDD 5ICZA 2BHYA 1S7UA 3BKML 1JCKA 3T2NH 1JZ7A 4QHUB 1XF5B 3NGBB 3TF7C 1BWWA 5CHNB 2RHEA 1ZGLP 5DSCA 4GSDL 4XBPB 4JFDD 3BH9B 3QDGE 1GGUA 2HFFA 1B0WA 2EDLA 3X14B 4Y4FC 3GKZA 5GGSB 4JG1L 5JOPD 1T83A 4E0RB 3BEVA 4URTB 2PF6A 3BYYA 1NL0H 2H2PD 4MQSB 3CFCL 1WFNA 3RWGB 3LEYH 1G9NH 2OR9H 3NA9L 4L4TD 9CGTA 5JA8B 3LDBB 1OAQL 4EVNA 5IMMB 2KDGA 1CIDA 4OSUL 5CIPH 5E2TH 4XC3L 4XNUH 1AXTL 4JG0H 3TPUB 1RJZA 1FIEA 3U83A 4U0RC 4RMQA 3IF1B 3C09C 3P4OA 1U58B 4N1EA 3H3BC 3QUZA 5H94A 5CJOL 1CICA 5EZOL 1UB5A 5FF6B 2E7MA 4YIQA 4JPWH 3S37X 2F5BH 1KCLA 5FK9B 5EU4B 2AJXH 1BJ1J 1X5FA 3IU4H 3C60A 3BPLB 4OTXH 4M8VA 2GJ6B 3H7BA 5BRZA 3M17A 4X7SL 4OZIA 1NSNH 3L3JA 3LEVH 5CSZB 3X11A 1D7FA 5EUOB 3VE0A 2NX5E 4BA8A 2FR4A 1RU9L 2J6EH 2AABH 1X5JA 3O6FA 4QT5A 2XRAH 4ZSOE 1KTRL 1F6AB 1U3ZA 1S7UB 1U6AL 5KTEH 4YO0A 4NP4L 1IGYA 4EN3D 4Y5YC 3ARDB 4JDTH 5AG9A 1PLGL 4PGDB 1J0YA 3MV11 2C1OA 5D4QA 5CBAA 3QQ3B 1WT5C 32C2B 5A16A 3HZKB 3C8HA 4WHTB 4FFVC 1U95B 5FOJA 5ISZE 4GW1A 1PZUB 1QP1A 4HXBL 3F7YA 5HJ3B 2BVQB 4ODTL 3SY0A 4P3DA 1A21A 3BSZL 4LASL 2BJML 5FUOL 5IESH 1WBZA 3OSKA 1ED3A 4YWGH 5HBBA 2VDLL 3BJ91 4O58H 4XNQA 2C26A 1VGKB 1LEKA 1ES0A 3SE3A 5FM5O 1NCCL 5E1AB 3TYFB 4NZTL 4I18A 2Y5TA 3MFFA 1RULH 1CF8H 5KZCB 2H6PB 3BE1H 4NNPL 4RNRA 4QRPD 2YXFA 1J05B 1HIML 4C4KT 3QJFA 1A7QH 1KB5B 2OXGA 4X7CC 3S4SG 5IQ9B 2DDQH 3GJFB 5AZ2L 3QBTB 3WMSA 3B2VL 3KR3H 3TH3T 4LEXH 5J12C 5TQ0H 4DN4H 1J8KA 4O2CB 3T04D 4CRPA 4HHAB 3RX8A 4PV8B 4PJBB 5IFHL 3QUXA 3GMQA 3IJYB 1INQB 4JQIL 4UILL 1GC1L 1CXIA 4KH2A 5HYJA 3N85L 1BFVL 4F9LC 1I1YB 1ULVA 2APXA 3CC5A 1MFEL 1BZ9A 5CBEB 1A47A 2XA8H 5HHME 1J1OL 2EDWA 1KTLA 1HWGB 4O9HL 2FNBA 1KXVC 4NC0B 1BJ1H 4KRNA 1UFUA 4D3CH 4YHPA 4EBQH 1XF2A 5DGRA 4YX2L 2OXHA 1ZSDB 4LEOB 5DEFA 1HXYB 1B90A 6FABH 3DXAD 3V6OE 2W9EL 4FABH 3B43A 4LAQH 3ZHDA 2BOCB 4JFEB 1AJ7L 2P24B 1ZOXA 3CPLB 4K55A 3DX6A 3VWKA 1AKJB 4EOWL 4HIIB 4RAVA 1C12B 3C08H 5TH2B 4AL8H 4H0HB 1S9WB 2DKSA 2G9HA 2DQHH 4HW6A 1FL6A 2X4TB 4G9FA 2VDNL 2EDTA 4JM2A 2I24N 1P9MA 2DQUH 4LVOB 4U0QB 5IFJA 2HH0L 1U8IA 2B1HL 4MB4A 1YYLH 3CX5K 3MBEA 3O9WD 4JFQB 4LLUB 1FNHA 3IDIB 3VFSA 1HSAA 1U91A 2CLVB 1I8IA 5GGUB 5EOCH 5HVHB 5JW4Q 5EU6E 2VLKD 4Y16A 4ZFGL 1G7MB 1TITA 2ZUXA 4LPCA 3QH3A 4XP9H 4X6CA 5ILTH 5E6IA 1MVUA 2I9TB 2JJTA 5IVXB 3GHEL 4DVRL 3B8YA 3ZDZF 3C6LC 2C1PA 5B38G 1GZPA 1PX4A 1XIWA 1K3IA 1AO7B 4K3JL 2DLEA 3SDCD 3FAWA 5F6IC 4ZS6D 4JRXA 4NRYB 4U6TA 3K8KA 4S1QL 3LS5H 5D1QA 2PO6C 3ARRA 4OFIA 3C2AH 3G6JA 1GSMA 3QZWA 4OD3H 1T0PB 4OFYA 5MERB 3O81A 4X6FB 2J1KA 1I4FA 4JHAL 1MFDH 1FORH 4F8TA 4UT9H 4ZS7H 2GTWA 1ZHNA 1LDSA 4KJWC 5JLZA 1YEFL 1YYMH 4MCZB 5D2NC 1FPTL 5JR1H 1RVFH 4PJIB 1F4WH 1NAKL 2NY7L 2NTFB 2VLRB 3IDNB 4JDZA 4WUKH 1DVFB 5DJXA 4ZYKB 3FB5A 4UUJA 4W6WB 3LRSB 3O8XC 3M1BB 3U6RA 1VEMA 1I1FB 5DT1H 1OQXA 2VXTH 3NPSC 4N5UA 2AXGB 5AG8A 4CU6A 5H35A 2CR6A 3MOAL 4Z0XB 5DO2C 2RR3A 4XWOD 3KPNA 5IKCA 2IMMA 3NIDE 5HGGS 1AH1A 4M03A 4GRMA 1GZQA 1CFTB 3PIQA 4QWWD 3MV01 4O5LL 3FO2A 4R0LC 4X9GA 4Y4FB 3QG7L 4GKNA 1WFUA 3QUMA 1IGTA 2BZDA 3G6DL 1QO3B 5D7IB 3MRBA 4J4PA 1NCAH 1WFTA 2RIKA 3VRIB 2B8OT 5FKPA 3RNKB 4KKBD 3DECA 4G80A 2BMKB 1EX0A 1QKZL 4KC3B 2R69H 4FQJH 3T09A 4JREB 1U42A 3HUJA 1P7QD 2R4SL 3OXSB 4M61B 4IIQA 3V6ZA 2YPKA 4F7CB 5BVJB 3MOBL 1QPPA 1A9BA 1OT1A 2EDNA 3U7WL 3LQZB 3D2UD 2WINB 2P5EB 1A02N 4RRPG 4M02A 1IGCH 2AK4E 1OSZA 2IQAB 1D6VH 4X4YA 4DGIH 2WBWB 3DMMA 1JZ3A 5JNYA 3MR9B 3ZO0A 4Z95L 5H37G 1FC1A 3MLWH 4ISVA 5E9DD 5E7BA 1WJ3A 2HKHL 1NGXB 4P5TD 3HI5L 2R1YA 3MLRH 3L9RB 3KXFE 1EHNA 5C2BL 4KJWD 3CSGA 1UWXK 4WFEE 2A9NH 3OPZL 1OM3L 1KGCD 3PJSB 5F70A 3RY6A 3O9WB 3DXAB 1ZA6B 2QSTA 2CKBB 2C1OB 3VGHA 3EUUA 3KYOA 1A6ZA 1PKOA 3LOWA 2NY5L 3O6FD 3PXJA 3D48R 3WJLC 4PJ7B 1UQSA 2GUOA 5HDBF 1RJCA 2WLYA 3ARQA 1T04B 1OWWA 3QRGH 4J8RB 4GW4B 4WY7H 4HPYL 3MLTA 5GGTA 1KB5H 2MHAA 3WFBH 4AMKL 3D0VA 4YEEA 5E5MA 2Z8WC 4QHKI 3C6SB 3IDGB 1DFBL 2AK4D 5IB1A 2ADIA 1G9MC 1E4XL 3BH9A 3HPLA 3TA3C 2VXSL 4HG4K 4H1LB 5I18H 4BQBA 4HS3A 4HEPG 1F2QA 4MXVE 4EUPH 1AIFB 3Q6FA 4G43A 2E3VA 1CL7L 2O5ZL 1E6JH 4G8GD 1LEIB 5DJAB 1F97A 2DI9A 4OM1H 5ESQB 3FFCD 4BZ2L 4MA3A 5CEZE 3ULUF 3BOVA 1I9RH 4PRPA 5J57B 5D5MA 2FATH 3D39E 4PJ5E 4PJBA 5DRNB 2J8HA 1BX2B 3MUGA 1VCAA 2DQJL 2JJWA 4P59L 5D7LB 1FNGB 3BW9A 1F4AA 2BHZA 4Z8FL 4LLDB 2YD5A 4OCWH 4HWNA 3AC0A 2A1WL 2ZKHL 4JFHE 1B0RA 3RVWD 4Q7DA 4I48A 3ARBC 4NGHH 1MIEL 5EZIH 5E2WL 1D5XB 1EZVX 3P4NB 3TC9A 1NCDL 5HGHA 4U6VH 4NKOB 1T4KB 3WJJC 2DB8A 3OJ2C 4MMXC 3KNBB 4MNQD 1RZ8A 4ZS6C 3I02B 1DLHA 1R5IB 5J1TC 4TNVK 3UO1L 2C3GA 5KSAA 1J1XL 4NQCA 1X3DA 1RZJL 3W5NA 1A0QL 3GIZH 4K23L 1R6VA 1LO3H 3BZ4B 1FGVH 4FZEL 1PYWA 3UTTA 1WBXA 1KELL 3H6JA 5I1LB 1VPOL 2FO4A 3U4EA 5M95B 4I2XE 2NY5C 4FXLA 3BD5A 4KK9C 3MGTB 5CD5C 2R1XA 4NOFA 3KAAA 4G8IA 4JVPA 4O02H 1EGJA 2OMNA 3GRWA 1XGYH 1IGML 1PY9A 4JO1H 3RQ3A 3I6KB 4JLRB 1GOHA 1KG0B 4OCYL 4PRHA 2F54D 1R5VB 4AEIL 2ATKB 1IBGL 5DI8A 3SCMB 2XV6B 5DUML 4CVWA 3TIEB 1KCUH 4BYHA 3QEQB 4FTVE 4L8SC 4JKKA 2XI9A 1UJ3A 2XKUA 4LVOC 4L8DB 1A6UL 2EXWD 3TT3L 3TZVB 1MRCL 2YHGA 2IPUG 3K2UL 3GKWH 1TZGL 4FFYL 5DQJA 5B3JF 5KOVC 5IBLC 1VSCA 4ZXBA 2F58L 1N5AB 4OZIE 3GJFA 3RGVB 3WIIH 5JOFA 3TNMA 3DX7A 5GRXG 1XT5A 2DQIH 1GHFL 1S7QB 4HKZA 4P23A 5MEQA 4KKCC 5J6GB 1MAJA 4R8WL 3JBG7 4O00A 4NBXB 4UI2A 5F3HA 2BVQA 4XVJH 3PHQB 2CUIA 3U46A 2XICA 5A2KH 5AEAA 4PLNC 4MJID 5BV7H 5F1NA 5LBSL 1KIPA 4I3RL 4LCIH 1VGKA 1UZ6E 4LKXA 1NANH 5D8JL 4APQA 5D7SH 1F4YH 3PP3K 1REIA 2O26U 4YXHL 3WIFA 3STZA 2PYEE 4M4PA 1NUGA 2VIRB 1MCOH 5GJTH 1A7NH 1NGYA 4GJTB 2Y5TB 3OAYH 4OZGE 1A6AA 4IHOA 1MREL 1BEYH 1IT9H 2DLFH 2AXGA 3DPBA 3TO4A 4OB5L 3RWCB 1ZTXL 5C8JB 5D2LF 4EDWH 3LKOA 5HHMD 2J5LB 3LZFL 1QYGH 1AXIB 2BSRB 4GMSH 3P30H 5C7XL 1I3GL 4TPRH 3SQOH 2KQNA 4XMKL 4UBDD 2RQ8A 4YQXH 1K6QL 4HX1B 2EZ0D 1KPRA 2EIEA 4R7NB 1OHQA 1N5YH 3BVNA 5D71H 3MLSH 1I7ZA 4ORGA 1M7XA 5JQ6H 3IDJB 1N26A 1N8ZB 4KRLB 2J3SA 3MBEB 3P30L 3CU1A 1FO0B 3QWRD 4NHCH 3U30C 4YK4B 4WU7B 3RL1A 7CGTA 4YO0B 1NLDH 2ZUTA 5L2KE 2P43B 2A83B 1NMAH 2EC9U 4DFHA 2M26A 2BVEA 1MFAH 2CR3A 3ROLA 1A7NL 5HHOD 4HIHB 2Z31D 1ZHBA 4HXAL 3FFCE 3HZKA 4PLJC 2C1PB 2UZIH 3V0WH 3QXDB 5D1ZB 4M1GL 4FZ8L 3HE6C 4HZAA 5DJCA 3TBSB 3SY0B 5EO0B 4I13B 1TVBA 2R1WA 3EIFA 2B7DT 4IS6B 1QLRB 1VFBA 4R3SA 5A40E 2DIJA 4IM8A 5DD6A 3G6JB 3QISA 2Q87A 1UVQB 3JTSA 2C7UA 2PXYD 5GGRA 4NQCD 1CE6A 3ZTNH 1TFHA 3CSPA 3FB7A 3QO1B 5D7JC 4MQ7B 4HCRL 1A7BA 1A9EA 2M1KA 4OZHA 2C5DC 4HKJB 3UC0L 2GFBA 4YH6A 2AS5M 5FO8A 1S7WB 1PZ5A 1CN4A 2Q3ZA 2J88L 3DROA 2FYYA 2Q7YA 1RJZB 1I8LA 2IQ9H 4CMMB 5CD5D 2AEPL 5L88H 3M8OH 4HWBA 3ZYJA 3MXVH 3RWEB 3L95B 4JVWA 5IMOA 1IBGH 4Y2DD 1JHKH 1HYSC 5DJ2A 4WI3A 2AQ1A 1IGMH 1U93B 3MRMA 3QIUC 4JO1L 1J10A 4RMTA 2HTKC 2HT3C 2AQ2A 5E6ZA 2IFFH 4ZUWB 4GFTB 3EGSB 3AUVA 4M9PA 1V7ML 5D1XA 3UTTE 4D9QD 3RTQD 3A6CL 5EZLA 1BD2A 3ZDXE 3ZHLA 5E8EB 3EFDL 3BP6B 5J06A 4Q9BA 4NQED 3CPLA 3L6FA 4QHLB 3GO1H 1J0IA 3W0WB 5GGVL 3IDYB 1BGXL 2GITA 4G6MH 4NO3B 4OAWB 2DQFA 1CICC 2EYRB 3FRUB 2ICCA 4P2OC 5B3JE 1H5BC 1CS6A 4N9GB 3PGCA 3ZYOA 3NAAL 4D9LL 4M48L 1NFDF 4X4XB 4ONHB 1X4YA 3G6JF 2F74A 1MCQA 1CFBA 4LSTL 4QRSB 3HI6H 3QSKB 2ZNWA 3QDJA 2ZKHH 1NFDB 4LARH 4ISVB 3MV9D 4YK4C 1JN6A 5IB5A 5E2VH 5ALCH 1S7RB 4NQVB 2DQJH 1QSFA 4XNQB 1K8DB 1WZ1H 5T1KA 1XCTA 1OB1B 1UM5L 2Z8VC 4HWUA 4TULH 2X10A 1AGDA 1HSBA 2J4WL 4U2YA 5C0RL 4JAMB 3LKSB 1JF1A 4CNIA 3H9SB 4KZDL 4PJDE 5KANI 4JHBA 3U7AA 5C0BE 3SKJL 4YAQB 15C8H 1BWMA 4M1CD 4OZGF 5EBLA 1CL7H 2O5ZH 1WT5A 2YK1L 3RWDA 2IAND 2GI7A 4HWZA 3DX8B 1I3RB 4H5SB 4XP1H 2VXUL 3SOBH 5CSBA 2D7TH 2B2XH 1H3TA 4AMKH 1S9XA 3GGWB 4RGOL 4E42A 1I4FB 4PRIE 4OLEA 4HPYH 4N8CH 1HH6A 4TQEL 4YPGA 4MCZA 4NUGL 1WIUA 3PWLA 1JHLL 3QRFM 5TPWH 4GLRH 2DQFB 5F9JB 2WANA 3TV3L 5H2BB 4LGSB 5BS0E 1FLRH 4NQTA 1H8NA 4FXGB 4K3DH 4KDTA 3TNMB 1E27B 4PY7A 1ACZA 2AXHA 1XF1A 4RNRB 4X4MA 5AZEL 3F8UB 4L5FL 3OPZH 4YFEA 5HYSG 2FDBP 4KRPC 5ICYA 4FMKA 2QSQA 5IEKA 1T04A 4EEEA 3S9DB 4GKNB 1NKOA 2OZ4A 3VJ6A 4Y2DB 5DZLA 4LHUA 1OWRM 4NM8H 4NQDE 2QSVA 3HNVH 1C16B 3V4UH 3OAUH 5ICXA 1OSPL 3QDGD 2DWDB 4M6ML 3OKNB 3NCYP 2G60L 1OGAB 1RZ8B 4N5ED 1PX3A 1KIQB 1U8JB 3FCTA 3UDWA 3QJHA 1T66D 3B9VA 2H32A 1Y6NR 2BSRA 3BZ4A 1QRNA 4FQJL 1NKRA 5HHXH 2VR9A 5DK0A 1YN6A 1WBXB 5MEOA 2BOCA 4JFEA 5D5MB 1YJDC 1J7VR 4WWID 1S3KH 5IWLC 3U48A 1QACA 4J3VA 5F88A 1F4HA 4KMTH 1P2CB 1C5CL 3OG6B 4NQDB 3RTQA 4JFOA 2D7PA 3DO7A 3T4AA 1JI1A 4H0GA 4GS7B 4KXZI 4LPTA 3V0VB 2BFVH 1OLZA 2BNQE 1NDMB 3UTZB 5FKAA 1S7VB 4HIXL 5H2BA 2PNDA 4XBEL 4ZUUB 3QDME 4HUWA 1OTSC 3KPSE 4MAYB 3TYGH 5EO9B 1KF9B 3KYKH 4G6FD 4FFZL 5EPMA 2QQKL 5F89A 3BIKB 2O5YH 1EJOL 3GHBL 3ZKXB 1QVOB 4XMPH 2JIXB 3ZDXF 1DBMH 4XC1H 1NGZB 2YC1B 3BJLA 1IKFL 5AYUH 1DL7L 3ALPA 2IBZX 5K9QG 3PL6A 3TV3H 1MPAL 1YDPB 2PYED 4PB0H 4IBLT 1B6DA 1EV2E 2D0GA 4P5KB 1VKXB 3U79A 3PV7A 3QWQB 1JBJA 4BQ6A 4ENEC 4RIRA 2HT2C 3KPTA 4N8CL 1P53A 3N1PC 1UT9A 1XH3A 2C7UB 1KC5L 1T1YB 4NRYA 4JFEE 4WW2B 3NZ8A 4WTZG 5HVFB 2V5RA 4LSVH 2NW3B 3MRNA 1F2XK 5F1NB 3OKOA 1R5VA 3QUYD 5T3XD 5C1MB 4X6DA 4RA0C 4N0FA 3CFJB 2YK1H 4QTHA 1RHFA 3ILPA 1RZIB 3INUH 1CE1L 3D0LB 2IANA 1IVLA 5FM8A 5TJWK 5EOCL 1LK3H 3HFMH 3MFFB 1N64L 4RGMC 5TDNB 5E5RB 4JJHA 3VXNA 2HT4C 4ONGH 2WUBL 3PG2A 1OCWH 3EJZD 4GAFB 1MCWM 2B1HH 1SEBB 3D2UB 3GSVB 4XVSL 4LMQE 4Z7NE 1SMAA 1AGEA 4NQXB 4K9EC 4UIMA 2AAVA 4K3HA 3RL2B 5J3HD 2NZIA 3S3JA 2DQHL 1F13A 1DLFL 4HS6A 4P9MH 1K4DA 3E0GA 4KRPD 2ZSWB 1INDH 3MUJA 1CXFA 1OCWL 3PABB 4Y5XB 3F58L 5HDQH 5FXCH 2FX8L 1AJ7H 5TF1L 4U49A 4C57C 2G75B 5D6CA 3T77A 4QRRE 4BQCA 2XWJA 2EIZA 1HWHB 1QA9B 2EDOA 4K7PX 4AEFA 1EIBA 3PGCB 2R8SL 3V6ZB 4YDKH 1CE1H 1FZKA 5GRYA 3E6FB 4LBEA 2P5WA 3EBAA 3RUGA 5E00B 3MXWH 5IJVA 2Q76A 1IAOB 3BHBB 3AAZA 2FSEA 1EBAA 5F6IB 1FFNB 5CMAA 1JRHH 3HPJA 5D96B 5IVXA 2RBLA 5ETUA 2VLLB 4UILH 1QSEA 4GBXD 5IFHH 3UROR 3LIZH 1ORSB 1SY6L 2OJZL 5A2IH 3KLAA 3EDKA 2H8PA 4OJFH 1T1ZB 4YIQB 5I1AA 2A74A 4X9IA 1I7TB 1P9MC 3HRPA 5ANME 3O4OC 2FJFA 2BRQA 4KJYA 4UT6L 5HTSA 1JGDB 3T0VA 1PG7L 5HGDA 1UG9A 4PB0L 2DAVA 5IFAH 4NNPH 3BE1L 4MHHI 1RPQA 4M7LL 1QNZL 3OJVC 5I19H 3QEGL 4WV1B 5J89A 2FR4B 5CGYC 1B9ZA 4PRPB 1IFHH 2X4QB 3NCFB 2O5YL 4RAHA 4X6DE 3V79C 2X1WL 5CGMA 4TUKH 2VLRA 1I3UA 3KYKL 1VADB 3TBYB 1C12A 4YWGL 3OKEB 2WWKT 2ARJQ 1Z0NA 1S8DA 4YHOL 2BFVL 3D18A 5I6XB 5I8EA 1FL6B 2MQ3A 2VQ1B 3QQ3A 2OZ4L 5JMOC 5LGJB 4YHIA 5D1QB 5DD3H 4PTUB 3LN4B 1WBYB 1NCWL 4PREB 1EHXA 4OFDA 3UJJL 5J1AB 4XCFL 1NMBH 3QXVA 3GEWB 2D9CA 2PCPA 1CL7I 2PO6B 5CP7B 5I2IB 1D9KA 2XWTA 3S3SA 1MWAA 2AV1A 3RWCA 1U6AH 2DTSA 3P4MB 2DJUA 1NMAL 1P4BL 4D9QE 1MI5E 4K94L 4FN0A 1I8KB 4MA3B 4NSKB 1RI8A 4X6CB 1OQOA 4P46A 2J6EL 3KPSA 4RMWA 1MFCL 2D4DA 1Z9OA 4F58L 1KACB 4OZGA 4HV8B 1IC5L 4X7SH 3MNZA 3QFDA 3MLSL 4M7ZB 1AKJD 1FGNL 1HDMA 4K8RL 4DN3L 4PJCF 2YN5A 5EUOE 3EDEA 3V6BR 1GGTA 5AYQA 4KK5C 2LABA 1N59A 3KHQA 3OB0H 5IOPA 4CVXB 4PJCB 1YMMD 3CNKA 5JNYB 1B2WH 4XCEA 1OB1A 3VFVA 4H88L 3ZE1F 5DK0B 2PTTB 3RVXC 4HZLB 1DTUA 1WZKA 2KBGA 3O3DB 2IPTH 4NZUH 2OR9L 2LV4A 3B9KB 3F7QA 2OS7A 5GJTL 4NJAL 3PJSA 5B8CC 1C5BH 2DWEA 5TPWL 3JV5A 4BH8A 5D8JH 3VI4F 2FL5B 4I3RH 4LCIL 1SJXA 3P9LB 4HBQA 2Q1EA 5K9JH 4ERSH 1DN0B 5TDPA 1QBLL 4RGOH 4Z76B 4XVJL 4G8IB 1MFBH 1NDGB 4PY8I 2B5IC 1UACH 1QLEL 5HGAA 3SOBL 5FECB 3L3GB 2WP3T 5DMYA 3MUZ1 3MJGX 3EDDA 4X4ME 1NPUA 5DA0B 3K2MC 3MGOA 3BGMB 4K7PL 1W0VA 3OGCB 4XPGH 3TT1H 4IRSB 3FQNA 3QDHA 2QQQA 4K3GA 3SKJH 5ADPH 4C4KO 3S88L 1RK0A 3BQUD 4KKCD 1C7TA 3JV0A 1BLNB 2JELH 3JVGC 5LKNA 3MODH 3AMLA 4ONOA 2N7BA 4M6OH 2V5MA 1EO7A 4L4VD 5F93C 1J0KA 2I07B 5DUMH 1UM5H 1MIMH 2FWOA 1K85A 1KLGA 1O7VA 4KROD 3LAFA 1IGJB 1A1NA 3B9KC 1WC7A 3F6IA 3S35X 2EXWC 1U8PB 4F2MB 1H3PH 4LKCA 5E2VL 3OKOB 5CWSB 5GIRB 4O02L 4XXDA 1QUNA 4LARL 4M1CC 1Q9KB 3HUJF 5LCVL 3GSQA 1I8MA 5C08A 2R9HD 2HN7A 3ZMRA 4P9HL 1W8OA 1H8SA 4APQC 4N0YL 4ONFH 3W0WE 3NAAH 4D9LH 4JANA 1T5WA 2X09A 5J1SC 1H8OA 4LRIA 3MV8E 1A64A 4KPHL 1FGVL 1BGXH 4FZEH 1T2QL 2OJEB 1EJ6A 3P9MB 3FRUA 2K9UA 3MFGB 4K2UH 1UM4L 1I1RA 2YUVA 3ZSTA 2VISB 4X83A 4WI7A 4EI6B 1RUKL 3NA4A 1V7MH 5GHWL 5DF0A 1LD9B 1QFPA 1GVIA 2WUCL 2A1WH 5GISL 1Q1JH 2MHAB 4PJ5D 1UVQA 3H9HA 4P59H 5EU6D 3C6SA 3VRLF 5H35B 1EAJA 2BOBA 4I48B 5SX4I 2R23B 3RIAF 3QQ9D 4NNXA 3N1MC 1KJVB 2AEPH 2HLFD 4H1LA 1OW0A 1KB9K 4M62H 1EEUA 5DFVD 4BZ2H 4I5BB 3E6FA 5HDLA 2AERT 2IBBA 5FO8B 1YPZA 4IRJB 5EFIA 4U6HA 1T5XB 2OTWB 4J6RH 1LNUA 3UC0H 3RUGF 1ZHBB 1LILA 2DD8H 4LNRB 3C5ZA 3WO4B 2C3HA 4NN6B 2QR0A 3CFKA 4NRXA 3HR5A 1HYSD 4B5EA 1YEEL 4XZUA 2PN5A 3HZMB 4NKMA 3VXRD 1EFXB 1Y6KR 3HE7D 1MLCB 3MUHL 4DKEL 3PNWA 4MWFB 1FNGA 1CLCA 2YN3A 3WFBL 1P7QB 3G5XA 3GM8A 4OLVL 4QRUB 1CK0L 4XTRC 1AXSB 3QEHB 43CAA 4NCC2 5EUOF 3Q1SL 4PGEB 4N0FB 1IL1B 4MJIA 1AO7D 5GZOD 4AENB 3VXQA 3REWA 1U8QB 1EGJH 3BPCA 4YPJA 2DICA 4C56B 1O7SA 2ZOKA 3RWJB 3EO1B 5E2JA 1MFAL 1KT2B 2X2YA 1J11A 5GS1C 5DJYA 2X5PA 4L9LB 1IQWL 3HE7B 4K9EL 4OF0A 1K5NA 5C2BH 2IAMA 4JQXC 4NHUB 1ZAGA 3TJHD 3H3PH 2YD9A 5I71C 4LHUB 3CX2A 5BVPH 1CR9H 1YEDB 1N5YL 1L0QA 5F96L 3JV4A 2VLRD 1ZEAL 4YXKL 1ZLSH 4ZO8A 4AIZB 4O51B 1JN6B 4PJXF 2DM4A 1TCRB 3EGSA 4ZTOH 1YZZA 3NCYS 5E08H 4QF1B 4FQIL 3LEXA 5C0AD 3BUYA 3MLYL 3V4VL 1NAMA 5DI8B 4JPVL 5FB8B 1T1WB 5FHAH 1GGYA 3CFEA 2NXYD 3E8UL 1GGBL 2AV7B 4HJGA 5IK3A 5C09A 5I73B 4JY6B 1A6VH 2AKRB 3H9SA 4PP1D 3MYJA 1U0QA 2FEDD 4MJ5A 3MC0A 3P0VH 4OIBA 3NH7H 1I9IH 1U36A 3MPCA 4JN2A 3W0WA 1KBGH 3ARYA 2MFNA 5LG1A 2BNQB 3RWIB 3D3VB 4Q9RL 1FFNA 5HYIA 1OY3B 2V7HB 3DX9A 5C3LD 1OARL 1SQ2N 4WFGD 4KI1A 1EHLH 4PJCA 1NMCC 1G7QA 3I3EA 1ZT7B 5KVEH 4OQTL 4NFBA 2X89A 4YR6A 5GRZA 1OT2A 2DM3A 4X7EC 3ARFD 5BOZG 2EE9A 2NY6B 5KSVB 2VXTL 1Y0LB 1KXQE 5EIQA 1YUHB 3WIIL 4PRDA 4R4FL 1E6OH 2F58H 2Y25A 5EH1A 3D3VE 4GRWH 2OX5A 2NY7H 1TZGH 2A0LD 3NTCH 3SGEI 1DBAL 1D3CA 1FPTH 5JR1L 2W0KA 1B88A 3T0DA 1JPGB 4XP5L 5IT2H 1A6PA 4ZS7L 1A6TA 3S96B 2X4QA 3O4LB 4KK8C 1XR9A 1JTOA 4JVUA 1DLHB 5EIIB 1T03L 2ERJB 4D0BA 1S7SB 3IVKB 4MA1B 5EU6A 3EYOB 4OCYH 3G08A 1MHPL 5EU5A 4J1UA 4XNZC 2NYYD 3BD4A 1NLBL 1AHWB 3ARFC 3QXWA 3LS5L 3MRIA 3WHXB 2VQ1A 3RZCB 3VFTA 3SDYH 3V4PH 3SKOB 4F7MA 2BRRH 3I6GB 5D2NB 3OKYA 3MRMB 1KPRB 4P5MB 5IB1B 4WI6A 3GBLA 5E6IC 1JNNH 4QRQB 2E7HA 3HMWH 5HPMA 4M9OA 1OP3K 4JFDB 4KMLB 2HP4A 5ESVB 2F19L 2HJLA 4MHHG 5HD8D 4DVRH 5IMLA 3W81A 5IEHB 1KIQA 2V2WB 3D39B 2CSPA 4MNGE 4WV1A 3LSOA 1J8HA 4P99A 2CRMA 4NQEA 2EE2A 3KJ4C 4MLIA 4NCC1 3QUKB 3IETA 5BCAA 1FZJA 4HK3N 1NCDH 1VESA 3RUGE 2A6IA 4HK0A 3QXDA 3EKCA 3TBWB 3RNQA 4R9HA 3N9GH 2CDFB 5HYJB 1IC4H 4DGVL 2EDDA 3OXRA 4PRDB 3G6AA 3HZYA 3ZSSA 4OD2B 4QRRB 1QLRA 3O9WC 4OQTA 5E1HB 1LP9B 1DP0A 4PJHA 1FJ1B 1CGVA 1C16A 3VFOA 3V7AE 1JGEB 1Q72H 1OD9A 3BIKA 3GJEB 1PDKA 4JZJC 5EZJA 3GMPB 5I8KL 3ZT5A 3E2HC 4POZC 2Z91B 4LBEB 3RUGB 5IJVB 3S37H 4XHQA 1AP2B 4EKXA 1UWGL 4IJ3B 2YA2A 3HNSH 5KOMC 3WFEL 4FQHB 1NGPL 3BWUC 1YEGL 3WS6C 5HI4D 2PYEB 5EO1B 4D9RE 4S1DC 1NGYB 3FONA 1HK6A 2VDQL 2QADC 3BPNB 3GMNB 3ARDD 4P5MA 1WIPA 3V95A 4YUEH 2YPKB 4CU7A 4CVZB 4EZMA 2KL6A 1E4XI 3TLRA 3KLDA 1VGEL 3OX8A 1A3RH 5TE4L 2VLRE 1U8NB 3L3HA 4HT1H 1CD0A 4IDJL 5C0FB 5IMLB 4MSWB 3QEQE 1JNLH 5E8DL 4LEXL 1AD9B 4XCCL 5IW1A 5AZ2H 4Y16B 1NBYB 3DURB 2XN9A 3DMMB 4GQ9L 5J56B 5EZLB 1HHHA 3V52H 5LAXB 1UENA 3G5VB 2NY5H 1RK0B 3VA6A 3K74B 1F3DJ 1PG7W 2VXQL 3H42L 2YPLE 4L4JA 4Z7WF 5I8CA 3HC0A 4XX1G 5E24E 2ZSVA 2GITB 3BZFA 3PE9A 1JF5A 3B4NA 2CLRB 1KN4H 2VN4A 1II4E 4M5ZH 1FJ1A 4R96B 3QUML 1DN0A 5TDPB 1DVFC 3DMMD 4UIMB 3QFJA 2MSPA 3ZZ1A 2AXFB 4XVUC 2YUWA 2NQCA 5GQBA 3JVGA 3MRNB 4DGIL 4P2QD 4RGNC 3RY6C 3GMMA 3IFOA 4QTIH 5BRZE 1QR1A 5E5UB 4BQ9A 2QSCH 4PJBF 4HH9B 5EOCJ 3IS0X 1QFWI 1YEKH 3OGCA 4W68A 4KHXL 4NSKA 4HGMA 3QDMB 3IF1A 2HT2D 1FVCA 5LXGL 2PW2B 4NN5C 1ZHLB 4ELKA 3HCVA 4O2FB 1F6LL 3O6KL 5C0JB 2DTMH 3GSUA 1QRNB 4MNGA 4QHNA 3G6DH 1PZ5B 1YNKH 4ODSH 5I1HH 2P47B 1N59B 3LQAL 1I9JH 3VMPA 4XRCA 4X0KA 3ZKQD 1QO3A 4P2CG 5JHDD 4XGZA 4D8PB 1F3DH 1WWCA 2F5BL 1PEZA 3MTRA 5MEND 1SBBA 2NY3B 4JPWL 3BZEA 4OUUA 3AY4A 5EG6C 3MOAH 1BX2A 1R3HA 2KZ1B 5B39B 1ORQB 1WWBX 4WWKC 3BW9B 4QXGH 4HZLA 1Q9OA 1N8ZA 4NWTL 4ZFFB 4L3EE 1AXTH 3BEWB 4K94C 1JP5A 2DYPD 4P4KD 4XNMB 4G8GA 1OAQH 4ODUA 4BSVA 4JFXA 1HOCA 2VL5B 4ETYA 3NIDF 1ERNA 3NIGF 3GZKA 2VXVH 2DI7A 4NKOA 2BC4B 3JSSA 4UT9L 5JXED 3F7YB 5HJ3A 4P2YA 3VXTA 4QOKB 2VLJD 5ID0B 4U0RB 3MRHB 1FN4B 3RA7H 5IWLA 5AD0A 3HG1D 4XWGH 4LSQH 2DYPB 4S1QH 2W07A 4MA8H 3FOLB 1CDUA 2ADGA 3T0EC 5KSAC 5BW7A 4JZNA 3RWFB 3HS0B 3EJZC 2DWDA 3DVGA 2AQ3A 1EAPB 1JPGA 5F7YC 1BQSA 1TPXC 5IF0B 4GW5B 4NKDA 2R56H 2DQTH 2FIRT 3R0MA 5KS9E 4YJZL 4IEFB 3EDJA 3LPGA 1ZT4A 1BOYA 3D0LA 2ORBH 2VDKH 4XGZB 4NRZB 1FNAA 3IFNH 4RMVA 3WFDH 4D8PA 5J13B 2D03H 4XXDB 3MRIB 1E4WL 3I2CH 4DAGH 4GKZA 4JFYA 1XIWC 1ZV5A 3PWPA 1ORQA 2VDPH 2JJSC 2BSED 1CD1A 1Z6JT 4ZNEE 4MXWH 5HYFA 2DQUL 1BBDH 3KPRA 1Q8MA 4O51A 2VDNH 4JANB 4JRXE 2MWCA 1CLOL 2WBJC 3MRPA 3RU8H 1J0HA 3MOQA 2F54A 3VD5A 5DHVB 3LHPH 3KYNB 2W92A 5J6GA 4LRNL 4M4RA 2QHRH 3VGAC 1G9ML 1T1XA 1H15B 2HA1A 3FTGA 5L6YH 4AH2B 4NJ9H 4GG6B 4Q2ZA 2LTQB 3MCKA 3MYJB 1AKJA 1VFAB 2BXYA 4LCCC 2EKJA 12E8L 4J3WA 3NN8A 2DN7A 1JYWA 1QFUL 2YD2A 5CIPA 2HJFA 4RSVA 1ZWIB 2W60B 2JCCA 4U1LB 5FGBA 4QRTA 5F9DC 4QHUA 3IAQA 4IHOB 4XHJD 3UYRH 4G7VH 4X6CF 5DJZB 3GBNL 2YD1A 3KPMA 5CKGA 1XH3B 4AIZA 4GBXC 4R2GD 4NQXA 1NDGA 2NLJA 5DEGA 2R4RH 5AWNL 1N4XL 5HGAB 3QXAA 4OZIB 1FG9C 3WSQH 4LF3B 5KSBA 3KR3L 2XNAB 3FT2A 3H9SE 3IFPA 4TTDD 2EH7L 1SBSH 2IGFL 3KPOA 3O3BA 2DDQL 1NAML 1PKQB 3DVIA 5JOEA 1ADQA 5EBGA 3K3QA 1ZS8B 4W6XB 1RFDH 1TQBB 1WWAX 5T33L 3BPLC 2PUQT 3QXUA 4ODVL 5GZOC 4ZAKD 3L1OH 2WNGA 4HKBB 3LKPA 3GRWH 2DQDH 5MP6H 3ES6A 4HC1H 4HUNB 2VN7A 1CDYA 3VFRA 1T22A 5HHQB 3WXWH 3CVIH 3QI9A 1IMHC 2P8LA 4HWBL 1A6WL 1OAYH 4LAJH 4O58L 4WHTA 4PB9H 1R3IH 1AXSA 2NY2C 4KDVA 1F02I 1TJIH 3K80A 4CDGC 4C56E 4H8WL 4WEBH 2GY5A 1JPSH 1JK8B 4R7DB 3TA3D 3W11D 1MCCA 4BM7A 5EULV 1EXUA 2VLME 3P3YA 4NKIH 4JFZL 1KT2A 3GSNL 2ZOLA 1VFBB 4L9LA 1OAZL 2VUYA 1A7OH 3D39A 2P5EE 4NP4H 5KTEL 2P45B 4L4VB 5LGHL 3X3GL 1MJJA 3X3GH 1FO0H 4MAUL 2R2EB 3S36L 1LWRA 1OAZH 1BPVA 1OAXH 1TZIB 3GDBA 1LE5A 1V3JA 3TJEL 1YEIH 5DYOA 3JV4B 2Y6SC 3H3KA 3G08B 1EZVY 3BAEH 1ACYL 2XNAA 3IFPB 2YBRB 5K9OB 2FYYB 4OTXL 4FOMA 4P4KB 3LCYA 1F58L 2V9QA 3UEZA 5L2KA 2EYTA 1YY9D 1TJIL 2AJYL 5C08B 3HLAA 4JCMA 3CFEB 4I8DA 4JM4H 4PB9L 3QNXB 5CJOH 5D7KE 4U1SB 5EZJB 3WFCL 4G9DB 5MENB 3ZL4H 3VFRB 4JG0L 3FN3A 4ELKB 4U1IB 1FAKT 5HI5C 3WN5B 1CDBA 4OSUH 3HAEB 2NY6C 3F6LA 4KFZC 5DMGD 1G9NL 4G8FB 4UIKH 3P2TA 5IMMA 2NX5A 5DHXB 1EMTL 2V17H 3T0ED 3RVUC 1MY5A 2Z92A 1ZT7A 2XZCL 3KYMB 5CSGA 3WE6A 3TBWA 1UXSA 2BNRD 2YD4A 4JZJA 4LGRB 2C9AA 3WLBB 2Z35B 2XTJC 3WKML 2R0LL 4HWEL 4DZ8B 1R3HB 3LS4H 1JV5A 5AWNH 2FJHA 3QNYB 2R4RL 5DK3A 5FK9A 3CVHH 1S8DB 2ZUVA 4LDEB 2P42B 5EBWA 4E9LA 3BKMH 3MBED 2VLJB 4LIQE 2AW2A 3GBNH 2F74B 4M6AA 3WS6A 5JHDA 2X6MA 4UV7H 3BXNB 1BD2D 5CAYB 2GK0A 4OZFG 1WBYA 1QFOA 5T3ZD 5ENWB 3KYOB 3BZDA 3ROLB 1OOAA 1A7PH 1EUUA 4LEOA 5DEFB 4Z7OE 5M94B 4NCDA 1EEYA 3OHXA 2JB5H 3MX0A 4X7TB 3JUZA 3HAEG 5EN2B 3WNKA 1FVDB 4B7LA 4DZBB 1XIWD 5CLTA 3RVWC 1K2DA 3FQRB 2FO1A 3CXHK 1CLZL 3K8MA 2LU3A 2YD6A 1JYNA 3UBXA 4YHLL 4PBXA 3BWAB 3RVUD 4XPFL 3AXLA 4H25B 1P4LB 1YPZF 2OYPA 4WO4C 2A2QT 3KPQA 3WXVL 3RU8L 3FAXA 3B9AA 1TIUA 2VERN 1FVEA 2QJDA 1QLFB 3GI9L 4YGVB 2DIBA 3DVFA 1VEOA 5C08D 2VDPL 1FRGL 35C8H 4GG8B 1C1EH 1YECH 3GMRB 4KJQC 3GSOB 3ROOB 1NGWB 4JQVA 4QTHB 2ORBL 5ISZD 3RWJA 5T3XL 4IRSA 1FZJB 1F45A 5SX4H 3VXSD 4GRLC 1BBJB 2PTTA 3P77B 4MMZC 4WGWB 2R56L 2YD8A 1OAKL 4JY4A 5ITFB 1X9QA 4QGTA 2CO6B 1ETZA 4PTTB 1ZVHA 3PWJB 3REVA 3ZKMC 3Q2CA 3HE6A 2VWEE 3DX9B 4NM4H 4OIIH 5I1EH 5F3BA 4AYFA 4AEHH 1A1NB 3JWOC 3I3DA 3QFJB 5DZNA 1DVFD 5C0BB 4MA8L 2R29L 3LH2H 5CKAA 3SE4A 4R97B 4WW2F 2XY1A 1DZBA 3OKEA 3IXAA 3MRKA 1FVDA 4M93C 2XZCH 4Y2DA 3QO0B 1RMFH 4LIQL 3QT2A 3NIFE 4JFXB 4DOHE 2VXVL 4PRIB 3T3MF 5GSRB 1I1FA 2PO6A 1LP9F 4E0RA 5HVGB 5GZNC 4PJIF 5DMKB 3HN3A 1YPZB 4IRJA 5EFIB 5A2FA 1J0ZA 3VMNA 2BHUA 4QXUL 3IS1X 3U1SL 5C0FA 4NO5B 5HDOA 3DETD 1KG0A 4XPHL 5AD0B 2QR0B 3CFKB 4MD0A 1HNGA 5CLWA 3EOAB 4FP8H 5I74B 3TJHC 4UV4L 4Y4HD 3WUWG 1PKQA 4F7MB 3VWJC 5IHUL 1BAFH 5FF6A 2I5YL 4N0UA 4UTAL 3LQAH 1ITBB 2H41A 1NC2D 4WRLA 1I1YA 1ITCA 3DVGB 1YEIL 1SJEA 4PTTA 3BP4A 1OAXL 4KHTL 4G8GB 2B1AH 4LP5A 5I8CB 3MBXH 1UYWH 2VTFA 1FLTX 4XCEB 1VDGA 1WIOA 1YC8A 1MVUB 1MHCB 2I9TA 3F62A 4OCXL 3NVQA 4JO3H 4F15B 4KHXH 1H5BA 3T0AA 4U7KA 3IGAB 4EI5A 4D0BB 1TETL 3GSNH 5GRVK 4EI5C 4NKIL 5C0IB 3E1F1 3QP3A 1S9WA 4J3OC 1A2YB 1YMHA 5INCB 4M5YL 3IDGA 4AQ1B 1JGLL 4PLKD 4DQOH 4NPYB 4WEBL 4BZYA 1RIUH 3ULVD 2CIIA 1CDGA 5D5ME 1KV3A 4BFIA 1ES0B 2CK0L 4HSQA 4YHKL 2WZPD 4MNHA 4HWBH 2DQCH 2H45A 3CVIL 1LO5A 2R23A 3RPKA 1KFAL 1WBZB 3UPRA 2E27H 4I3SH 4W70A 3SDXB 3AREA 5C0EB 3V5DA 1J05A 4BH7A 5ICYB 5C09D 4ZNEA 1WEJL 1FSKB 1W0WB 5FDWA 2VXQH 1HKLH 2WBJA 3L1OL 2AV7A 3MJ9L 3RHWK 3FRPG 4PJEF 5K33A 5T33H 1RZIA 4XRCB 5F1SA 3V52L 2IANB 5JORB 4BUHA 4NQSB 4HX1A 1OTUD 4H26B 4FHBD 3Q5OA 5E5MB 5I1DA 1DEEB 2BK8A 5TDNA 3JWDL 3SE9H 1N4XH 4Y7MA 1IZJA 1OTSD 4HT1L 4P5TC 2H1PH 1BZ7A 1VGEH 2HT3D 1SEBA 1G7QB 3U0WL 3ZE2F 2L7UA 4EJ1C 2DLTA 3L3JB 3DVNA 4PJ9B 1RJYB 2YD3A 3MCKB 5KSAD 3SDAD 2HWZH 4FXKB 4K3EH 4U1GC 1S5IL 1YA5A 5FHBL 1NEZB 2BVOB 4GXVL 1F42A 3WFEH 5E9DA 5DJDB 3WS3A 3GSRA 1X5IA 3HNSL 1NGQH 2AEIT 3LKPB 3LVEA 1AP2A 3JV6B 1PBYA 4OUOA 3S37L 3OXSA 4EIGB 1Y18A 1VACA 4RA3A 3DJ9A 4R0LA 4RMUA 1A14L 4OM0H 3LRSA 5EO1A 3QI9B 3O6LL 5D7LA 3LQZA 4Q58C 4XNXH 5L6YL 2XZAH 4NHUA 4PRAA 5CINH 3SJVB 4X9HA 4GG6F 2O5XL 3KPMB 4U1MB 5I1KL 2FB4L 2CGRL 1NFKA 2I25N 2D7MA 1CLOH 4GQPH 43C9A 4KVNH 1FL3B 4OCRH 5EU4A 1GZQB 5GRJH 4X6EA 1F4XH 1FV1A 1EDQA 4F9LA 2YOCA 4ZUSA 3UX9B 4MXWL 5IF0A 4LU5L 1PD6A 1YY8A 3MREB 4JKPH 1OF2A 1OTTC 2I60L 3WHE1 1CDHA 1R5WB 4PJ8A 3VH8A 3KLAB 4NO0B 4JPIA 3MLUH 4CMMA 4LCWB 4FQQB 3QA3A 5IB2B 3RP1A 3RI5K 5DUPH 2HLAB 5IG7B 5I16A 1EFQA 4ZUTA 3D3VD 3PF2A 2YRPA 1I7RB 1PVHA 4LPYA 3JTTA 1S7TA 5EB9A 3MV7B 4P2RD 3IB4A 3B9DA 4KU1A 1MY7A 3AM8C 4D94A 2IQAA 4C55A 1AGCA 4YE4H 3TM6A 2EYTB 1F3JB 4JR9H 3EHBC 5E95B 3D0VB 1MCSA 4WFFD 1I1AC 3LN5A 3RA7L 5GS2H 5CINL 4Z9KB 1XGRB 3MRFA 4QNPE 3BP5A 1S7XA 4ZPVA 3O6LH 3TCLA 5DSCB 1HI6A 1T7VA 2H2SC 4G6AC 3VFOB 1VENA 5FA4B 4OD1L 3SDCC 4JGUA 3PQYE 2ICWI 1NGQL 2XKSA 4HAGA 3MV7E 5JTWA 3U0TA 1S5IH 5CJBA 4BZ1L 1TVHB 4IRSD 1NBZB 2EDYA 3RWGA 3CDCA 4XP4H 5C0BA 3U0PB 3QIBB 3MGAA 1RZKC 2XYCA 4X5XB 3CD4A 4ZPTB 4U4BA 2VDOH 4P4KA 3AB0C 2XTLA 2H1PL 2EDKA 4G9FB 2APWA 3FOMB 1FCCA 3QWRA 2CJUH 2XQBH 1DQDH 3GBMH 5TGBB 5D5MF 3U9PL 3CLFH 5BRZB 3IJSA 2Y07H 4ODUB 4F7CA 5BVJA 3AAZB 1CGWA 3P0VL 3WFZA 4GRWE 4Y19B 4OCMC 4J3XA 5FO7B 3ESVF 3RGHA 5FM5M 3AGVA 2LVCA 3E8UH 3HA0A 3KPPA 3F5WB 5GGTH 3ZDYF 5IHZA 2PKDA 5DFWH 3DHJA 4POZD 2PW1B 2ESVA 2LQRA 1XF4B 4P3WA 2CK0H 2A6JA 4RDQG 3TGXA 3D5OF 4ZDHA 1LQSR 5EOQL 1SYSA 1WITA 2Y23A 3QWOB 1UWEH 5BVPL 4P23D 3PP4H 4J4PC 1HKFA 1LP9A 2ZUQC 5DZOA 1MCRA 2P5WE 4PJXB 3FB8B 4HQQH 1X5LA 3C60D 1NGWA 3DXAA 4OLUL 5FAAA 1XGQB 5TDOA 4JO3L 4HIHA 1IQWH 1A1MA 4N1HB 4WO4A 2DKMA 1SJVA 3DIFA 4AEEA 1MLBB 1I85C 2BDNH 3T1FB 1UZ6F 5E1AA 3SKMB 5L8JB 4QY8A 1CXLA 2LFGA 1JPTH 2ZSVB 3BZFB 3D85A 2Y06L 4POUB 5BXFA 1S7QA 4P23B 2WAHA 3AS1A 2IH1A 1T7ZA 3QJFB 4OGYL 2NXZC 4XCCH 5IHUH 1ZLWH 4FQLL 3VI3F 3AS3A 3KPRB 4C59B 2XOTA 1KENL 4OF8A 4UV4H 4I0PB 3ARGB 4KGJA 5JPMA 3V6OC 4ZXBC 1AGBA 1YEEH 4W4NA 4UQ3A 4IOFD 5E6ID 1CXKA 4TYUA 3VFTB 4MVBC 4WDIA 4G8FA 3NFNA 3MNWB 1PSKH 1YEGH 5DQDL 3EHBD 5IJKA 3ULVC 2X4OA 4KROB 1UZ8A 1KOAA 3QZWG 2OMBA 5E8NB 4LIQH 4Z7QE 3LKQB 3IAPA 4DKDC 1H9VA 1JV5B 1QBBA 3MO1A 2O93L 1BZ7B 3WEXA 5ITBH 2CMRH 4N0CC 5KVGH 4TRPH 4I0KA 2VLJA 1TTGA 2P24A 2YPLD 3KPNB 1BF2A 4U05A 1J1PL 1MUJA 5F3HB 4XP6L 5F7MC 4WCYL 5KAQF 1A1MB 4J3TA 1CTNA 3UPAA 1NGZA 3N9GL 5JW5B 1QG3A 1KJ3H 4S1RH 3AY4C 1LO4L 3ULVE 1ZLVK 3O3EB 4TVPL 4QCIA 1DE4A 4QLRA 2F53B 2VZUA 3EYFB 2EYSB 4ZOAA 3GJEA 2VC2L 4MD5B 4GG6E 1T2QH 2Z91A 4U1JB 2E7CA 5FA3A 2FGWL 2EDRA 3F7PC 2YPVL 5LJYH 1J12A 1MCPL 2WM0A 3TFKD 2XQYG 2WP3O 1INEL 3CMOH 3SQBA 1IM9A 4N0YH 4YDLC 5EU6B 4KRPB 3A67H 4TN9A 3MRQB 3QIWD 3IDXL 5EIVA 3ULUD 1WWWX 5TFSL 4TSCH 4DGYL 3KXFD 5T5NG 1MHPH 2CLZA 3WJJA 3OBAA 3O8XD 3SDDB 4CL7A 1T03H 1MEXH 3ULUC 3BP4B 5DD0L 5CFHA 3QEHA 5CILL 2QQLH 3DUUA 5IT2L 5GS0C 2A83A 1BFOA 5EUKA 5DJAA 1FAIH 4KI5F 3VXOB 4M7KH 3RVXD 5ESQA 1U3YA 4FQCL 4Y16D 2K7PA 4YZFF 5DXWA 3RZWA 3PUCA 5DJYB 1JL8A 4HS6B 4OI9A 2O61B 4MQTB 3T2PA 3SCMD 3VFUB 1X5KA 2H9GB 4X5LA 1HH6B 1UA6H 4P2RA 2CLRA 1QSZA 5FGCB 2Z8RA 3CK0H 1VFUA 4JHZA 4R96A 1EHLL 3T77B 3IKCB 4WU5B 2XZQH 5FA4A 5K9JL 2AEWA 1RSFA 4JQVC 2NLJB 2R0ZH 3GK8H 4MYWB 3RJQB 4J12A 4L8SA 1IE5A 4JFFD 1OAUL 4WI5A 4Q9RH 3RBGA 5DJDA 1JGUH 2R0WL 5JXAH 1IGIL 4KUCF 1I9IL 3D85D 3NH7L 4NZUL 2J7LA 2RCSL 4CVUA 3BQUB 3E6HA 3PP3H 4P3CL 1A6VL 1BQHA 3UXFA 2V5TA 4Y88A 2FJGB 3O2DA 4H88H 4C83B 4NWUL 5BJTA 1G7PA 1S78C 5E2UL 3MLYH 4YC2C 2F8OA 4FQIH 2GSGB 4ONHA 5E08L 5KVFL 5I9QB 5BV7B 1IZKA 2ARWA 4GRWB 3KPQB 4JJ5A 4Y19E 3HZVA 2GQHA 4CW1B 4K8RH 4DN3H 5EBWB 1ZEAH 4KDTC 2PXYC 1MRDL 3ARTA 3MRRA 3ORJA 4CN4A 4PD4K 5DK2A 3MR9A 4L8BA 4N1CA 3OR6A 4R7DA 5ACZB 2DQEH 4K7FA 3O3BB 4KKLC 5BO1H 1KTDB 3KPPB 4K9EH 4DEPC 2HFTA 1Z3GL 4L8DA 2MCG1 3PL6B 4PJ5A 1R5IA 1VFAA 3MLZH 4LNVA 1CXHA 2COQA 1YNTB 1WF5A 3TWCH 3T8XA 1EGJL 1T20A 3DHMA 1IC7H 4WHDA 3UJJH 4QRTB 1NCWH 4HKZB 5MEQB 1FDLL 2DJ4A 3UDWC 3MRJB 3QUYA 5JDSA 4PLKC 3I3BA 1XGUB 1BOGB 2SEBB 3VGEA 3NACL