1NCWL

Cationic cyclization antibody 4c6 in complex with benzoic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL01
5GJTH 1PY4A 1ZWIA 3TWCL 2XQBL 1TTGA 3AREC 3FN9A 3CLFL 5DQ9A 2X1XR 2BOBB 2Y7QB 5DQJB 3I9GH 3PDOA 3MNWB 2E5EA 3C87A 4HWZA 1N59A 3OR6A 5FFLA 2J8UE 3OAZK 5H35A 4HS6B 3HG1A 4XXCA 1T7VA 4OAWB 4BH8A 2LVCA 5IB3A 1H8OA 1LHZA 1OB1B 1QBLL 3KPSB 1FVDA 1SVZA 2HRPL 2F53B 2R8SH 1F11A 4PJIE 4XPAL 3NFSH 2FSEA 3SE8L 4YIQB 1HDMB 5ADOH 2BVOA 3KPSD 4A6YA 2F53D 4HX1A 1YC8A 3AFLA 4G8FA 3D2UB 4PTTB 3K7UA 1KLGB 4NQCB 3OF6D 5CSZA 2XTJE 5I1GL 3CVHB 3KPMA 3QUKA 4MQXD 4NNYA 3GBNH 35C8L 4FQLH 1JYXA 4QXTA 2YWZA 1GC1L 3PV6B 2GAZB 3D2UD 3MQIA 1SHMA 2ORBL 1Z9LA 1ADQH 4FZEH 3UBXG 4NQCD 4TRPL 3VG0L 3GI8L 1HH9A 5DEZA 2X7LA 3QCVH 1U8IA 4OCRH 4M4RA 5FK9B 1IM9B 3S4SG 5BS0A 2DQHL 2HT4D 3T3PF 3TNMA 2UWEA 4W81A 4JANB 1XIWB 2KDGA 4MYWB 3NACL 5HHOD 5C08E 4K8RH 4RIRA 4LASL 1S5IL 3WLWC 4ERSH 3KWWB 1OAQH 3BGAA 4FTVD 3DV4B 2LAGB 3HPJA 3QXVA 5IK3A 3VXUE 5HGHA 4EOWL 4R7DA 3T2OA 2AJ3A 2YK1H 4AYFA 5D7LA 2AXGA 2QQLH 3MACL 3WYRA 3F58L 3LMJH 2R69H 2ATKB 1NAML 1SEBB 1K6QH 1YUHB 1WZ1L 3ZMRA 3BD4A 3C6SA 1FL3B 3F62A 1MEXH 3LKQA 3GMLB 3PWUA 1U41A 4Z77A 3MXVH 4X9FA 1J8HB 1U6AH 2Z35B 4KQ4L 4PJ5E 5FA4A 3MNVA 4POYA 5C6TL 1B4RA 3GI9H 3CFCL 1MRFH 1UEMA 3PGCB 1J8HD 4GS7C 4TUOA 4F7TB 4HUUB 1MCEA 1OW0A 1KC5H 4XVSL 1ERNA 5GGQL 3WFCL 5DUPL 5J8OA 5DK3A 5H94A 3LRSA 1AE6L 1Y6MR 4NO0A 5E8OA 3AGVA 1G7PB 1ZA6B 4P0DA 2NNAA 3V7AG 5I1DA 4WWKC 1ODAA 5JHLH 3KVQA 2BRRH 3HC3L 1AI1L 3N9GL 3O4OB 4NM4L 4QXUL 2J4WH 4MJIE 5HI4D 4X5LA 3P0VL 2F8VA 1ACZA 4RRPG 5E03A 2VLLA 3BZFB 4QLRA 3H9SE 4MJ4A 3DSFH 3SJVA 3DIFA 3R8QA 3QWRD 2CR6A 1LK3H 5E4IA 4JO2L 1JF1B 1ZEAH 1SEQH 2VABA 3FOMA 3LQZA 3RWGB 4P2QE 2DTMH 4DFHA 3IFNH 4LARH 1AHWC 1NCNA 4PBWD 1EUTA 4G9FA 4A6YH 4IM8A 1RK0B 1AXIB 3JWNC 3O2VH 3TIEB 3OGCA 4GSDL 1TQBB 1ZHKB 4C55A 4XPGH 1G7LB 1XGTB 2HLFC 1GXEA 2O93L 5TDPB 3C8HA 1JYNA 4JE4B 4LQFL 4CVWA 2AJXL 3V52L 4M62L 2VDML 1P69B 3R0NA 4HUKB 5I19L 5B8CB 1KIQB 2E27H 4PJAA 3KYMB 1UQSA 4FXKA 2RAMA 3MLTB 3K74B 4XNUH 3I2CL 1S7QA 1CFBA 1I3VA 4Y19D 1QR1B 1ZTXH 4JFFA 1T04A 4ZS7L 3WFZA 5B39G 4XRCA 2D03H 1KOAA 4KDWA 1ZLWK 2NY1D 1AP2B 4H88H 3Q6GH 2E7BA 4OLUL 2XA8H 3MLXH 1MHEA 3WS6C 4PJFB 5DQ9B 1DBAH 1KYOK 4Y5XC 1VKXB 2YBRB 5I1KH 3DPBA 3OR6B 5H35B 4K7PY 1YNTB 5D5MA 4ODSL 1AO7A 3W9EB 4XNXH 2X4NA 2Z93A 3G04A 2VXVL 3T0EE 3HG1D 5EUOF 2IANE 3U4AA 3MOAH 2IH1B 2VLJA 3RL1B 3VGGA 3RHWK 5LCVH 3BKYL 2EE6A 1G9NL 4O58L 5GGUB 3ZYIA 4OZGE 5T5NF 1U8JB 4GKZB 1NEZB 4R90L 3WIIL 3MLVH 3QEQA 4ZSOA 4Z7WB 4OFIA 2C4FT 2I5YL 2JJSA 3BKJL 1G9NC 3IRZA 3RUGB 4UT7L 2YMXL 5GS0L 2X7LB 3ZDYE 3MZTA 4Z5RA 2VL4A 1XF1A 1ORSB 3TCLA 2OR9L 5T3ZE 2UWEB 5L6YH 2O26U 4I0CC 4JVWA 2GJ6B 4RIRB 4U49A 3R8BB 1RURL 3P4NA 2D31A 5CZVH 3BVNB 4NUGL 1HXYB 5GS0C 4ZOAA 5JW3L 1VFBB 2AJ3B 1OWRM 2QQKL 5GISL 3BDYL 3GMPB 2YUZA 25C8H 3DMMC 2GJ6D 5E2UL 4Y5YC 5CGYC 2EE2A 4PJ8A 4ELKA 4JKPL 3PGDB 1A22B 4MS8C 4APQA 5FOJA 4J12A 4W6YB 5JLZA 3QPXH 4OZFB 3VXME 4Y4KC 1BM3H 1DEEB 1OAZL 3QJFA 4TVPE 2AI0L 4Z77B 2A9MH 5CEZL 3N1MC 1QQDB 4KHTH 4WHYH 4L4VE 1RZGA 4HXAL 5D7IE 1OQOA 5I2IA 2D0HA 3RIFK 2ZCHH 1IMHC 3QHFL 4ZUUB 1HSBB 1CLCA 2VITA 5I1JH 1CFSB 1J05B 1FFRA 2DQTL 4KROB 2AGJH 5L88L 2AEQH 3LRSB 3ROLB 2BSSB 2HFFA 4NO0B 2WBWB 1KB9K 3BFOA 4XAKE 2GK2A 4KUCD 3BWUC 1Z3GH 1EMTH 1D5IL 4NN5C 5I1DB 3EYVA 1ZHNB 3KNBB 4NO0D 3KLSA 5F6HI 4IOIB 5ESQB 2IQ9L 4Y89A 5IMKA 2P8PA 3C6LA 4PIRF 2NY0B 4EI6B 3U36A 3PWVA 3HRPA 3DV6B 2DS4A 1YEIH 4PGEB 5EU6B 2XN9E 3T0DA 1RUKH 3DIFB 4MJ5B 1H15A 1ZS8A 1VENA 2NY0D 3LN9A 2PETA 5EWIL 3BZ4B 1S7RA 1NEZG 4PTUA 3K80A 3OZ9L 5EU6D 3QA3B 4N0YL 4QRTA 1B9ZA 3FRPA 5IW6B 4XBGB 1NKRA 1UYWH 1MLCB 4R8WL 3V5KB 2QTEA 3FKUS 4OFPA 2F54B 5IB5B 5E70A 2P7TA 1ZANH 1JNLH 4Q97A 4XGZB 3NCMA 3H42L 4G9FD 1WT5C 1EXUA 2F54D 3DBXA 2X4PA 5MP6H 4YC2C 3ROOB 2D0FA 4ZNEE 1EHXA 5EZOH 3SE3A 3TZVC 1YY9C 3KJ6L 4L9LC 2DICA 2CJUH 1CLYH 4PJAB 3U0WH 1NC2A 1I1YA 4LRIA 2F15A 4EUPB 4IOSD 4XP5H 4F9PC 5ALCH 5C0AB 1HHGA 4MCZA 3W81A 1ED3B 3EDFA 5ACZA 2V2WB 1P53A 5DD1H 2GUOA 5C0AD 4OFYD 3TJEL 2BSTA 4U1KA 3RZCB 4JM4H 5JIKA 4KAQH 4UOW0 3X11A 3BT2H 4BUHA 1MFBL 3MODL 4ZFOB 2ZG2A 4XNQB 5DA4A 3O6ML 5D5MB 2FR4A 3BEWA 1SMAA 4AEEA 3RZCD 4UI2A 3IETA 4HHAA 2GK0A 1XT5A 2ZUSA 5D70H 3FO2A 3NN8B 1KTDB 2VLJB 3KJ4B 3TBTB 4GAJH 3VI3E 5CGTA 1CLZH 5FYLE 1G6RB 3QQNA 1T22B 4KI5E 1J0HA 4RGOL 4XNYH 3IXTA 2XTLA 2FDBP 4DVBA 2VLJD 1IGYA 3ULVD 2DDQH 1JZ5A 2IADA 1OM3L 4AMKL 2UYLA 3A67H 4Z7VB 4NN6B 3IFOA 3MLZH 4ZSOB 4AG4L 4LGSB 1G7QB 3JWDH 4PR5B 2IPUK 4GAGH 5CAYB 2IALA 1VADA 3QFJA 5EZIH 3KGRA 5INCA 3A6CH 2X4OB 1JI2A 1MNUH 3G9AB 1D3CA 2Z92A 5IBUG 1BFSA 4LSDA 5CP3A 5EU7E 3QQ3A 3TA3C 4RGNC 4QHNA 3QNZB 4H8WH 4U6VH 4Z0BH 3EYFA 2ZUVA 4MQ7A 1OHQA 2OJEB 2J8UA 4P46B 1OTUC 5FUZH 1KCUL 1RIHH 1UH3A 4P57A 4UAOB 2VWEC 3E0GA 5DJ8B 2FZ3A 4X0KB 4G8GB 1N3NA 4RA0C 4PJIA 2ZCKL 4WFEE 1A4JA 2HFTA 4RWHA 2BNUB 4PJ8D 4LRNH 1J0IA 2GSGA 1N8ZA 4G8GD 1QFWH 3KPQB 4APQD 5TQ2L 4EUPG 1F4WH 4WI4A 4JY6A 5I2IB 5DS8A 2DJSA 3EOYG 2YD4A 1MAML 3SE9H 1YN6B 4EI5B 3NGBB 3GJEB 4LLYA 3BRDA 2LE9A 2CKNA 3VXPB 2CXGA 3BIAX 1A1MA 4ZOEA 3ARGA 3R06B 4U6TA 4ZTOH 1YA5A 5HD8C 1P7QA 3R1GH 3QNXB 4WNQA 2E7LC 1YEGH 3P0YH 1NH6A 3DWTA 1M7DA 4OB5H 2K1MA 3EJYD 5C08A 4N5EC 1QBML 1NGWB 3F7YB 4KKAD 3S5LB 4OLYL 3VXUA 1UXSA 2XY1A 3OKEA 4X7DC 2ITDB 4NRZA 3W82A 4NBZB 2MFNA 4NSKA 4G43B 4LEOB 1BLNB 2P8LA 3D3VB 4KTYA 1GRWA 2IJ0C 3C6LD 4HPOL 3UAJD 1OAXL 3H7BA 3VRIB 1FDLH 5CEXA 3L95A 1VEPA 3D3VD 4X4ME 2GJZA 1ETZA 1BQUA 1MQKH 2XFXA 4N9OB 4PJ5A 4NKDB 3OHXB 5ABDE 2Z0BA 1T2QL 5IF0A 5F96L 4F2MA 2DWDB 1XGQA 3RWDB 1PBYA 5ID0B 4HPYH 4YAQA 5L8JB 1Q9KA 5FAAA 3MJ8A 5TF1H 2E8YA 4YHIA 5FHAL 4NO5B 3REVA 1FLTX 5HHNB 5DZOA 3JTSA 4YX2L 2FGWL 3MFGB 1TXKA 1RJZB 5KTEL 1U95A 2DWEA 1LO5A 4X9IA 4DKEH 4OLZL 4M02A 4F7PA 4LBEB 3UJTL 1RJYA 4NP4H 3MLYH 1GGTA 2ARJB 4PJCE 4PB0H 5HGGS 5CSGA 5EC1A 4MJIA 3CPLA 2UY7A 3NTCH 1NC2D 1UJTA 1JPGA 2Y07L 5TE4H 3SDXE 2YA2A 4MXQD 2XIDA 4YHZH 1XF2A 3H3KA 1E4WL 1FGVH 3H9SA 2N1KA 1NLBL 2HRLA 3HMXA 5C07E 4CKVX 5E00A 2NTFA 5GRJL 3MBXL 5JUEH 3BKML 2A83A 2V2XB 4XHJD 5KANG 3OG4B 5JMRA 3BMVA 3I75B 3ETBF 3MC0A 4OFVA 1IFHH 1JVKA 2FECL 4P2QA 1NFDE 1IC4L 3GSUA 4OGYL 4YDKL 4HHAB 4HIJB 1MLBB 4PV9A 4JM2C 2CSPA 5GS1A 2VLKB 1RPQA 4LCWB 1M6OA 3P73A 5DRZB 3VFUA 5IQ7L 3FJTA 2XWBA 1OQXA 2ZOLB 4LCCA 4QF1A 4EIGB 2ED9A 4PRPB 4DVBB 2VLKD 1CXEA 1DBKL 4LCWD 3G5ZB 2YD9A 3S5LG 2N7AA 3CNKA 4BQ6A 5I8KH 2ZJSH 2NXYC 1AGFA 5DWUH 1BZ7A 5ENWB 5IV2B 1T0MA 1UM5L 2EDTA 4L9DA 1VADB 4ZPVB 5D1ZA 1DUYA 3GRWL 3QFJB 5DR5H 1QEWA 3DTXA 3M8OL 4AEHL 1SM3L 3BGMA 1CL7I 3B2UC 2C3HA 2FIKB 4RQQA 5KS9B 3BDBA 4ZUTB 4ZUVA 4PP1C 3QFJD 2FL5A 3VGAC 1NCUA 3AXLB 4QHNB 5IMOA 4KRPB 2P48B 4LCYA 1CF8H 3MOQA 2P42B 3JWOL 5HSFA 1M7IA 4QGYA 4X8JA 4ENEC 4AIZA 3K3QA 5H2BA 3GNMH 3QIUC 4X6CF 4Y2OA 1GOFA 4KRPD 3PWNA 3VG9B 5EOTA 3WHXA 5CJOL 1R6VA 1B0WA 4KV5F 3T0EA 4JB9H 4LHJB 2IANA 4OV6F 4FQ1L 5FGRA 3JWOC 3UROR 3QUYC 5H37H 4OZGA 4Y7MA 4XWOC 5DJXA 3MRBB 3VFGH 5F6IB 5EO1B 1S9XA 4CVZB 2CLVA 1EBAA 3U1SH 1I7UB 3SDCC 3MV11 4DGVH 1L7IH 2V9TA 3V4VL 2GITB 1RUMH 4JY4A 3BPCA 4NM8H 4WV1A 4Z76B 2CK0L 1MCSA 3ES6A 2ZKHL 2IH3A 2PYFB 2W59A 1QSZA 1LEGA 3V6ZB 3QR2A 5C08B 3MRHA 3ARGD 1FH5H 4RNRB 4PLJC 2ICES 2P5EB 3G6JF 1II4E 4D0DB 3HMXH 5KSAA 1FIGL 1DCLA 5C08D 1MFAH 1KNOA 3ET9F 1MIMH 5HVGB 3RGVC 4ISVB 5IKCA 1I9IH 2P8LB 3O6FA 4M1CD 1MH5A 2A9NH 2NY4C 5DEGA 4M3KB 1NCCL 1YDPA 2DJUA 2H26B 2VZVA 3VXMA 1E6JH 1FNLA 4Y5VC 1OAKH 5HHVH 4OD3L 2BNQE 4L4VA 5GIRA 5D7IA 5EZJA 5L9DH 5IJVB 5IF0B 1R5VB 4MAUH 4ZFZB 4QRRB 4QCIB 3WSQH 3VFRB 1ES0A 1PD6A 3BPNC 5EOCL 3GSNA 3MX0A 7FABL 1DBML 1WISA 2R29H 1S7SB 1BQLH 4PLNC 3TBSA 5J4MA 4PRHB 4BFGA 4DZBB 4HDIB 1RHHA 2XG5A 1IQWL 1G7MB 2R9HC 3RDTC 3SN6N 2DWEB 3L3HB 2AJYH 5EDXA 2NMSA 1A6VL 3L3JA 3T04D 1D9KC 3CMGA 2DF3A 5LGKA 2VISA 5GGTA 1OAYL 1JWMB 1WEJL 3WS3B 3IU4L 1JPGB 1U8OB 4P99A 1EJOL 12E8H 4XI5C 4GBXC 4TSCL 3UTZB 3NCFB 2F19H 2XN9A 4MJID 3MREA 3UYRH 1I7RB 5E00B 1OP5K 2HG5B 2Y1VA 4YXLH 2XT1B 2A83B 4I0KA 5IGXL 1X6LA 4P2QB 5AZ2H 3VE0B 4E0RA 3LKPA 4WTZA 1KENL 5MHSE 4YR6A 1TZGH 4JFPB 3FRUA 2D7TL 4JHZA 1KFAL 1FJ1A 2FX9H 5GS1B 3NIGE 5IIEA 4PRIE 4P2QD 3U46A 4L5FL 2XZAL 4YWGH 3RVVC 4WUUB 4F58L 4HZAA 5DEFA 5GS2D 1INEH 3C5SA 2XWBB 6FABH 4ZNEA 1J1XL 5IVXF 2IQAA 4Q6IC 4YBQD 1ZSDA 2H3NB 4DJMA 5A40E 5A3IC 2VL5B 4WUUD 1RK1B 4K9EL 1HHKB 4L8BB 3QCUL 2DOCA 4LSSL 3UXFA 4K3DH 5DMIH 4O51B 2AABL 4R26L 5MEQA 4R0LA 1B4JH 1MQ8A 4K9EC 1XGRA 5FECB 3HMWH 2BXZA 4YHPB 3UPCA 4MXWH 1KEGL 1VGEL 4HKZB 1RD6A 1I8LC 1P4BH 2CR3A 2FGZA 1WJ3A 2RCSL 5IHUL 3MBEB 5IB4A 4XPTH 4HH9A 3HE6A 2W0PA 4G80A 4JN2A 1RUAL 1L7TL 4PJDB 4HS8L 3T0AA 4AIZB 3MBED 5H2BB 3SDYL 5DURB 3D39E 2IEPA 2OYPA 2Q76A 3MTRA 2GQHA 4TVPH 1UM4H 5F1IA 5ITBH 2IANB 1M05A 1X5HA 3ARBC 4M93B 1IZJA 5DURD 5DFWH 1JGDA 1LP9B 2ICCA 3VFTB 5DC9B 4P23A 1EUUA 3GSNH 1QLEL 1DL7L 2IAND 4LDEB 3W11D 4YPGB 1IC5L 4BH7B 2YUVA 4MMXC 5LAXA 2C7UB 3DYMA 3F5WA 3FZUC 5E5MA 3UYPA 4I0PC 1MHCB 5DVLA 4WI9A 3BPCB 5F89A 4ZG1A 5JW4N 5EOQH 4Q9BA 4WV1B 3MFFA 4ZO9A 3VW3L 3ES6B 1B2WL 2IH3B 1P1ZB 5IFJB 1LEGB 4U1JA 1H0DB 1S7XA 2R0LH 3MRHB 3VDCA 5BV7L 5FIEA 3Q3GA 4NT6A 4LHUB 1KJMB 4KRLB 3OPZH 2R4SH 4NQXB 1KNOB 4YE4H 4JLRB 5BZDB 4HFWA 1P4LB 4LHUD 1IGFH 5CEYB 1S5HA 4ODHL 1HKFA 4HWBL 1MH5B 2IAMB 4M6OH 2HKFH 2JB5H 3GSQA 1MUJB 3BIBX 2H2SC 2W38A 5CEZE 3WD5H 3WXWH 4D3CL 5E99H 3FB7B 5C0ND 5ECJE 3OXRA 3QUZA 5J13C 1JPFA 5D7IB 2QLVB 1LE9B 5DVMA 5DSCA 5IMLA 1CD8A 1WC7A 1HSAA 3ZDZE 2BFVH 2Y9RT 4ZO6A 2WANA 4K94H 4TVPD 4PY7A 1MCOL 4LQ1A 1I3GH 5CILH 4NHCH 4JGUA 5ACLA 4XCFL 5KAQG 2ZSWA 1RHHB 5HYQB 3MYZA 5L0QC 4GW4B 4J6RL 5LGHH 2EDWA 2W07A 3MLWH 4N90E 1YEKL 2O5XH 5FYKL 3NBNA 5EA0L 4PJXF 5E4EC 4UILL 2EDBA 2X5PA 2R1WB 3I6GA 4IRSB 1NGXB 5IEKA 3HE7C 3DUSB 4HGKC 2EH8L 3O45B 4WEBH 3OKNB 1BVKB 4X4MA 3TBYA 3B6SB 1N64H 5D72H 3S36X 15C8H 4E0RB 1VSCA 4BFBD 4YR6B 5FYLH 1AGCB 1ZHBB 3EYOA 3X3FH 3DYPA 1ZT7A 5DVNA 1G9MH 4KJQC 5IIEB 3U46B 2Z31C 1J11A 4P3WA 2IGFH 1A7QH 4K2UH 4U0QB 1N5YH 1T3FA 1WVZA 2KZWA 2XNAB 2QR0A 4U7KA 1A0QL 2AVGA 4U6HB 5DFVC 3G5VB 5D2LB 4NNXA 2IQAB 1F3DH 1A6UL 3NCYP 4I2XA 4WO4A 3RWEA 4LHUG 4OBRA 1AKJA 4KDTC 4HLZG 3ZT7A 1I4FA 4FQXA 4RFNB 1VFAB 1EO8L 5A2JH 5C0EB 1KXTB 4PJCA 3VFOB 3QUMA 4O2FB 1M4KA 4GO6B 4LLVB 4HKXA 3VWKC 1ONQB 3SDXA 5EN2A 4RBPH 3VRLF 5EU3A 1MJJA 3MCKB 1N7ML 2W60A 3DARA 3ARDC 4LSQH 3V6OC 1NMCC 5C07A 3V6BR 5IQ9B 2NY3C 3HE6B 2XPGB 4JO3L 3CK0L 4O9HL 1XCQA 4HBCL 5DI8A 5EU4A 4NZJA 1A7OH 3CU7A 1OF2A 1NFDA 1RFDH 2Y36H 3HE6D 1HI6A 3RBGA 1T1WA 4JFYB 3DGGB 3LN5A 4KK5D 4QTIL 3SCMC 4NJAH 4DAGL 3LDBB 5F7EH 1WBYB 2A0LC 1KN4L 5DMKA 3E1F1 4DGIL 3SGKC 4MDIA 4Z95L 3O9WC 3SOBH 3Q6FA 1CL7L 2AV1B 4E5XB 3IJYA 3ZKXB 5FYLD 3NFPA 1DANU 4UTBL 4MCYB 3SQOH 5HPMB 4P23D 3HZVA 2ADIB 1D5XB 5J56B 4RGMB 2WZPD 3CFDA 1ZMYA 2VQTA 4LNVA 1FAIL 4R3SA 5F89B 2X89D 4R97B 2BVPB 3WDIA 1AGEA 2FJHB 1GPOL 3QDHA 1C7SA 2VWEE 4TOYH 3TEUA 2APBA 4JFHE 3FAWA 4FZ8H 1TJIH 5TH2A 4OIIL 1VPOL 4NWUL 3S9DB 1CN4A 1G0XA 3U7YL 1QRNE 1YPZF 2ZOKA 4PS4H 4U0RC 3MJGX 4GT7A 4OUOA 4V1DE 3LIZH 5I1LB 1FRGL 2VDRH 4HFWB 1YYML 2DL9A 1S5HB 3L3DB 4LKCB 2FYYB 3QNYA 3DO3A 2DAVA 1LO4L 4IIQC 3L1OH 3GMMA 4GKNA 3NA9H 1P7KA 3QDGE 3JSSA 4YHML 2I60H 1Z9MA 5AWNH 3STZA 1VHPA 2JK5B 5ESVB 2EIZA 1HSAB 4NO2B 1TJHH 2Y4SA 4LVNB 4JEGB 5CS7A 5KSVA 1YEDA 3S36L 4JDZA 3X12A 4HJ0C 3T2PA 1IARB 5D6CA 1RUPL 3C60B 2EC8A 3MLRH 5HHMB 3BZEA 2BJML 1NANI 5D7JA 1AQDB 3ILPB 4AY0A 1HXMB 2CUHA 1OLLA 1ZHLA 3WKML 1H8SA 2Z91B 4PJEE 4X5WB 3C60D 3BAEL 3CFBA 1ORQB 1C08A 4ZMAT 1SJEB 2BK8A 3T4AB 3AAZB 4Z0XA 2VZ3A 3UO1L 2HMID 3FO0H 5FHBH 2DKUA 1NAMA 2CQVA 5HDBE 1HIML 2AJZA 1FLRL 4O2CA 5MERA 4OZHF 5D71L 5IHBA 4F57L 1XEDA 3VU2A 2EDFA 4YEEA 5D1QC 5IEKB 5HI5C 4J7RA 3QPQC 3QIWB 5D7SL 1TZIB 3X3GL 3BUYA 2DBLL 1UWXH 4LNRA 1LK2A 4YXHL 2JB6A 3GFUA 5MEOA 4OBSA 4QTHA 2WBJC 3FT4A 5CD5C 3AMKA 2BNQA 4MWFA 5F7FA 3FQTA 2G5BA 1CLOH 3MV7E 4YHKH 3EYOB 1BEYH 1V8HA 4D8PB 3V4UH 1T4KA 1ZLUK 1FNSH 4P49A 3RKPA 3KDMB 1JWUA 1NMBH 3MCLL 2R23A 3M1BA 3WLBB 3MRJA 1QP1A 5GGSB 1KLUA 3HRZB 3QZWA 2ZNXA 4WO4B 2NYYD 4HWNA 5JPMB 1CK0H 3TWCH 2XQBH 5F21B 3CLFH 1T20A 4PRBB 1I4FB 2EDEA 1IGJA 1MHPL 4WO4D 5BXFA 1JYVA 4EN3C 1SYVB 2HH0L 3OJDA 1SY6L 4X7CC 1RMFL 2GSIA 4FG6C 2EIEA 3MUGB 1PZ5B 2HRPH 3ZTNL 4M7LT 5C07B 3LKRA 4XPAH 1TTUA 5EFIB 3JUYA 1JFQL 4KK9C 2CGRL 4J23A 7CGTA 5EU4B 3IF1B 3K1KC 4TPRH 1JNNL 1ZE3C 1CG9A 5C07D 4QYOA 3WO4C 1NFDB 4M48H 1CGWA 2DMBA 4OQTL 4AL8L 4P5TC 5I1GH 1Z9OA 2I9TB 2JCCB 1GZPA 1C16A 3CH1B 4PRIA 4HEPG 1IEAB 1IBGL 2ORBH 3K0WA 5D1XC 3VG0H 3GI8H 3CCHA 5IR1A 1NFKA 4YK4B 3L3IA 3WS6A 2FBJH 3AREB 1D5ZA 2DQHH 5EZLB 2X4TA 3NACH 2R39A 1S5IH 1T1ZB 3ARED 2BVYA 4CMHC 3BP6B 5CMAA 4BSWA 2DYPB 1D5MA 3P3YA 3MACH 3ZYJA 3F58H 4UDUA 4X5XA 1NGZB 3SGDI 2CKBL 1NBZB 1PFCA 1JE6A 3HZKB 1KB5L 1HQ4B 1I9RH 3OB8A 4HJJL 5K9KB 2WW8A 3DUUA 4IRJC 1I75A 2B2XL 3D6GA 3GMOA 1U8HA 5LG1A 2HYMA 2QV2A 3VXNA 3D39A 5E08L 4MNQE 1IGTB 1J9CT 5FM4A 5C6TH 2XXMB 1SBSL 4J3UA 3MMEA 3BSZH 3CFCH 1BMGA 5IM7B 1MJUH 1YC7A 1P7KB 2X70A 5E2WL 5T1KB 4BQ8A 4LPYA 5DC4B 4HGWA 5C0JA 1S7VA 4PY8J 4XVSH 5GGQH 4EKXA 1JZ2A 4RAUA 3V79C 1AE6H 4KKNA 3U83A 5T1KD 1TVBA 4FQJH 5KSVB 1YEDB 4AENB 3HFMH 3X12B 3VH8B 3CDFA 4UV4H 4QRPB 2ID5A 2ZUWA 4XC3L 3HC3H 2H8PB 3WLWD 1AI1H 3SKNB 4NM4H 4Q2ZA 1ZHLB 4PYGA 5HDQL 2FEDC 3P0VH 4QRPD 4XVUC 2VDKH 1NLDL 3CFBB 3B43A 2JIXA 4BSVB 4NKMA 4UBDD 3CLEL 1K2DA 4Y4KA 4Z0XB 4Y88A 2Z8VC 4X99A 1LO0L 2V17L 5BRZE 5I73C 1KSRA 4JO2H 1KBGL 3KYKH 3PQYE 4GXUM 3PL6C 1MI5E 5IUSA 2BVEA 4O2CB 1N26A 1HINH 4P2YA 2OSLB 2PTTA 1SYSA 4U1MA 5I66B 4PLKC 3EW3B 4S1RL 4GS7B 4QXWA 4G8EB 1CFVH 2DMKA 4GSDH 2FBOJ 3CFEB 3WFHA 4DOHB 4JHWL 1I3RA 4JHAH 1RJLB 4HMCA 5MEOB 1HQRB 1DLFL 1EEYB 5CJBA 2VDMH 1JF6A 3GSOB 4B7IA 1P6FA 3AB0B 3FCTB 2QQNL 4WWKB 3RWFA 5I19H 5TE7L 1FVCA 4LDOB 1T4KB 5C7XL 5IROA 1FO0B 2DKMA 5HYJB 3I2CH 1KPUB 1JWUB 1G7JB 1OTSC 2H6PB 2X10A 5E1AA 4ZS7H 4WWKD 4ZS6C 1KLUB 4KVNL 1DSFL 5HYJD 5TDNB 2HVJB 4XAWH 2OJZL 2V5TA 4I3RL 2OL3A 5I1CL 2HLAA 2BVQA 3BP7A 3A0OA 4UT6L 4WGVB 2D7MA 4L3EB 3BYYA 5L7XL 4LLQA 3OJDB 1DVFA 1MFCL 2B20A 3FO1A 4BKLA 1AHWB 2AERT 4JGJA 2AKRA 4ODSH 4L3ED 5FCUL 1H3VA 2XKNA 1A7NL 2C3VB 4OLXL 3LKRB 3M07A 3MV8B 1HH6A 3HAEB 4LL9A 4G6JL 3L3OB 4HWUA 3FQUA 3MV9B 3BKYH 2HLFD 1G9NH 1JN6A 3TZVA 4QYOB 2WQRA 3MV8D 3VH8G 4OD2A 4L9LA 1FFQA 3FQWA 2VDNL 3MGAA 3TO2B 3WNPA 4U1HA 3UTTB 4R90H 1FL6A 4F33A 1NGQL 3STLB 5D93C 3MV9D 1Q1JL 2NX5B 2F5AL 4JRXB 3S8WA 5FO7A 2X4SA 3UC0L 2PYEE 5MHSD 2I5YH 2VLRB 5KN5A 4NCDA 3UTTD 1GJIA 4DVRH 2DQJL 1I1AB 4UT7H 4NQSA 1CU4H 5GS0H 5HHPB 2NX5D 3QG6B 3WNKA 3KLHC 4BZ2L 3KHQA 5EBWA 2VLRD 3GIZL 3RWIA 4UDTB 2F9BT 3ZT5A 4Y5XB 5JDSA 3C5ZC 3PIQB 3EO0B 4XTRD 4K8RC 3IJHB 3QFDA 4NUGH 2AW2A 2PR4H 4OIBA 5CMAB 4GG6B 2QQKH 5GISH 3BDYH 3GJFK 4XCEA 5EO0A 5E2UH 4YPJA 1JTTA 5GRVL 5SWQA 4X5XB 1TCRB 3W5MA 2FJFA 3KYAA 4JKPH 5HY9A 3TBVA 4D0BB 3OQ3B 1U3HA 3TO4C 5ELIA 1F45A 4CJ0A 2MWCA 3OX8A 2Z8SA 5GGSY 2YA0A 3PABA 3KAAA 3HI6L 1KJ3L 1ZKAA 32C2A 4OSUL 4POZC 4HXAH 1WCBB 1AD0A 2D7NA 2AEPH 3U30C 1FNHA 5TQ0L 3QHFH 4LSUH 1I3UA 3VXSB 4R4NC 1KIUA 4G9DB 1HNFA 5EIQA 2DQTH 1AQKL 1S7VB 3N06B 5BZWA 1JHLL 1M7XA 2RB8A 4HGMA 1QSEE 3PG2A 1DQQA 2NZ9C 3VXSD 3S97C 4TSAH 1CWVA 3VCLB 1JK8A 3E6HA 4NC1E 1D5IH 3MJ9L 5I1HH 2OL3H 3DMMB 4UIKL 4H0GA 2EDRA 4GQ9L 4MD5A 1BBJB 1IAIH 2IQ9H 4Y5YB 3RI5F 1A1OA 4Q2ZB 5GS0D 4PJFF 5DD6A 3EO1A 3G5XA 3HAEG 3OKMB 2EIBA 3DMMD 4JFXB 1XGYL 4HIEB 4XXCC 1N5AA 5CGYD 4JRYE 4Z7QF 4QHLB 1S3KL 5E94B 4X99B 2BC4B 4MS8D 5BO1L 5B38A 5EWIH 3OAUH 3SQBA 1QRNA 1CR9H 3OZ9H 3EYQC 4ZOCA 4J8RA 4Y4KD 2WQ8A 3QXDA 4V1DA 1OTTD 1CFNB 2FWOB 5I1AA 3QQ9C 4R8WH 1KCSH 1S7UB 1EDQA 4YGAB 3EOAB 1FBIL 3X13B 5MI0B 4Z7UE 4J4PA 3QDGA 5LXGL 1KJ2H 4NDMB 2ESVE 4RMUA 4XNZB 5T1MB 1NGPH 3MUZ1 3QEHB 4OJFH 2E7LA 4Z7WF 5I17A 1OSZA 4NN5B 2OP4L 1UJ3A 3RWFB 4CU7A 3KJ6H 2AV7A 4QRUA 2ZUQC 1D6VL 2E7HA 2PW1B 5INDA 4GRMB 4ZDHB 1KT2B 5HGDA 3KXFB 1YY8A 5J1AB 5F71A 3RNKA 2P49B 4FFZL 4PJEA 1PDKA 2G60H 2OL3B 1T21B 2HLAB 2ADJA 3TJEH 2BVQB 1JPST 1X44A 5TDOA 4WW2B 5CZXC 5FYKE 4WU5B 4YQXL 5CBEB 5DJ6B 3MRFA 4FMKA 1AR2A 2BY1A 1T2XA 1OD7A 4HD9A 4N8CH 1T5XA 3PHOB 2DQFB 3IKKA 3O6MH 5CINL 3P4MB 1A3LL 1GGYA 3HNSL 5GRXG 2YPLE 2EO1A 4BK5A 2NW3A 2A6DB 4NFCA 3QH3B 5B3JF 1HILA 1FPTL 2XQYK 4YC2B 4J1UA 5DJZA 1CVSC 3TZVB 4RGOH 3U0PA 4MQTB 1NFIB 1RULL 2UZIL 3B3IA 3NIFE 3TPUB 5GJSH 4HWEL 1A6PA 3FQWB 1BHGA 4LPUA 4ZFGL 3O6KH 1OW0C 1KJ2B 3ZHLA 4XCNB 3L6FA 4I48A 4AMKH 4F8QA 3TZVD 1MHHB 1YY9D 5FO7B 3CSGA 4AG4H 3D69B 1AY1H 3GBML 5SWZE 2J5LC 2Q8BL 4PGBB 5E9DE 5FYKU 1JRHI 2QKIB 3EFDH 2FRGP 2P24A 1I1RA 3UYOD 3P2TA 1WBZA 4JFDE 1K3ZA 1A6WL 1M71B 2J3SA 2GCYA 3B9KA 1XR8A 1F8TH 2OZ4A 3TYFA 3V6OE 4XNMA 3WEXA 2BHYA 1Q0XL 4JKKA 1OSPL 3LQAL 3QFDB 4TSBL 1DFBL 3V0VA 2FO4A 2BSED 2HFGL 3OXSB 4NCC2 2BDNL 3D0VA 2Y72A 4HIIB 3NIDF 3VGFA 4X6FB 1KCUH 4JM2A 5I8CA 4MGXA 5JPNA 5CJ8A 1U8NA 3RWJB 2EKSA 3LQAC 1ULVA 3QIBB 5IBTH 2P45B 4MNHB 5T1DL 1JPSL 1EZVX 4HUWA 2WMPA 1A9BB 3QIBD 3VGHA 2P8MB 4QRSA 5TQ2H 32C2B 5E7FA 1HZHL 2CO6B 3WBDA 3OSKA 4UV7L 3FOLA 4HK0A 3T3PE 1QKZL 1KEML 3AU1B 2IBBA 1XCTA 1Y0LA 4GLRI 4FQCL 2YUXA 3DHJA 2X05A 3SBWC 1YQVH 3FT2B 1A9EB 3BOVA 3C2AL 1ITCA 1SJHA 1KTLB 2Q7NA 3TA3B 4RGNB 4LDLB 3TJHC 4MA7H 4RMTA 1JK8B 3BH9A 4M6NL 3RY4A 1QBMH 3GRWA 4JDVA 3D5OF 3TA3D 4RGND 5T1LB 4ALAL 3QIUA 4BFIB 2CUIA 2K3TA 3SGEI 4JJHA 1FZMB 1OTUD 2WP3O 3O8XC 4NQEB 2CDFA 5T1LD 3EOBB 2C9AA 3DROB 1MCBA 1WICA 3FQRA 4NWTL 3WNMA 5B38B 4NGHL 3RAJL 1N0XL 1U8KB 5M94B 4LLUA 4X6EB 2GI7A 4MNQA 1WBXB 5I1AB 3QI9B 4KPHH 4Y8AA 1T2QH 3ULVF 5F96H 4JPIA 1UB5A 3SO3C 3QULB 4V1DD 1Z0NA 2E3VA 5MEPA 4KGLA 3CC5B 3QI9D 4PJHB 2EE9A 3WFDL 4WU7B 3MYJB 1CD1B 5FHAH 4Z7VF 4XVJL 4JZOA 3MROB 2YC1A 1Z5LA 3QDGD 1I7ZA 5C9JA 4YX2H 1BECA 4JO1H 4RSVA 2I25N 2Q3AA 3EGSB 2X42A 5DJ0A 5KTEH 2BCKA 1WIOA 5HD8D 4OLZH 4UU9A 3O41B 3UJTH 2OZ4H 5HTSA 4RA3A 1E27B 5HGDB 5GRUH 4N5ED 3BEVB 4NYLA 1INQA 1YY8B 4X6DB 1P4IL 4DZ8B 3V95A 2Y07H 5BQ7B 3T77A 4L29A 2FCBA 4LSTH 1CBVL 2GY7B 1XGPB 4EVNA 3U9UA 1NLBH 4AM0A 3GHBL 1UXWA 4Y5VA 4MNGB 5DJCA 5CCKH 3MGOA 1JWSA 4ETYA 5BRZA 5GRJH 1QVOA 3MBXH 2OBGA 3VFWB 4KI1A 1AGBA 3BKMH 2R15A 3PQYA 1J1OH 1MI5A 5IEHB 3QO0A 1Y6NR 1IC4H 1K4CB 2V7NA 4G7VL 4OGYH 4XPHL 4YDKH 3E8UL 4Q74A 1NBVL 2WK2A 1X5FA 2WUCH 3BN9D 5FB8A 3TH3T 2AJVL 1YQ2A 5IVZA 4B53A 4UQ3A 2HJFB 3U0PB 3RDTA 3EFFA 5KVGH 3ULUC 2VDPH 5BVPL 1DBKH 3MV7B 1D9KA 1Q9WB 2R4RL 4DK3A 2QSQA 4OLVL 1NL0L 2YSSB 3AC0A 3JVGC 1BP3B 1FZJB 2CO7B 4FABL 3MV7D 1UM5H 4N9GA 4FXGA 4LPXA 3VD9A 1R3IH 3HS0A 4U1NB 2GCYB 4AEHH 3BN3B 3VD3A 5A2KH 3UBXI 5TGBB 5B38G 3VWJC 4WTXA 1GYAA 2XWTA 5EUOE 3L3GB 5CKAA 3V0VB 5J9PB 4PD4J 3JWOH 3RVXC 1LQSR 4NUJB 3G6DL 3QWOA 3QG7L 2P4AB 4M6MH 1C5BL 3SDAB 5M95B 2QBWA 2YXFA 4WVRA 1BFOA 5EBLB 2EKSB 4TNWK 5SX5K 4MA8L 4XH2A 5E8EA 1ZOXA 4JM2D 3SDAD 1MRCL 2OS7A 4YBLB 4FQ1H 5CJQL 4HUWB 1AJ7L 3P30L 3BGFC 4YHYC 3WL9B 2WIIA 1ZA3A 1FAKT 2QHRL 4D0CA 4YHNB 3WO3B 5JXAH 4XCYA 3KPOA 3SE3C 1V3KA 2VRAA 2FX8L 4ZAKC 3V4VH 2C3WA 4DW2L 2NXYD 4NQVB 3P9LB 5I71B 2HT2C 3DX8A 3IXAA 4F15C 5IFAL 4UUJB 2C3XA 2CK0H 4Z9KB 3BH8A 2VXUL 1F6AA 3VGAB 3B2UD 3ZO0A 3B2VL 1VFUA 4XP1L 4OCWH 2ED8A 3MRPA 4PP1D 3UTSE 1FIGH 3U0TA 4NO3A 5FF6B 5E2JA 3L9RA 4LSRH 3ARBA 4XMPH 3QUYB 3EHBC 3WUWA 3B5HA 4F37F 1NCCH 5AG8A 1WK0A 4N0UE 4P4RA 3VD5A 4WJ5A 3W0WE 2FD6L 3QUYD 4OD3H 2V5YA 1JNHA 3O11A 3FFCB 5EBMB 2R0KL 5H8DA 1K5NB 3HI1A 4QRQA 4XWOD 3SDCB 2CIIB 3JBG7 5EOCH 3OKYA 1T7WA 3GBLA 1X4YA 5MEPB 1DBMH 3RVWC 1BAFL 2PW2A 4D9QE 3SDCD 1NJ9B 2O61B 1QSEA 3DXAB 4WW1B 4NHUB 4PBXA 4U1SA 1A6VH 1IM3B 4TTDC 4KWUA 5ANME 5F1NA 3TYGH 5JOPE 3IGAA 3OKKA 3RWCB 3DXAD 4NZUL 4MLSA 3NMEA 3RGVB 4PLJD 3IU4H 4NC2B 5KS9F 2EDNA 4XWGL 3TFKD 1A3RH 1EJOH 2NY4B 3LH2L 3FHQA 3FN3A 4TSCH 1UACL 2DBJA 3RGVD 4JRYA 3U9UB 1UXWB 4IRZL 4Y5VB 5DJCB 3UCRA 4GQPH 2NY4D 1IEHA 5AZEL 1Y6KR 4HWBA 3MA9H 5IGXH 5J6GA 2GW5A 5IB2A 1OPGL 1JNJA 5BVJB 3GB7A 5C0IA 2Z4QA 4R7NB 1Z9SA 2D7TH 3P0GB 4ODXB 3SDDC 1KFAH 4U6YA 4XPFH 4Z7UA 4AEIL 2XTJC 4F58H 2ESVA 4TUJA 5A2FA 1KF9B 3QEGL 5F7DB 1TETH 1UZ6F 4FQQA 1YNLH 4K9EH 5LJYH 2C4FU 3KPPB 2R9HD 4NZRL 5FYJL 3D25A 3OKLA 1L6XA 2DQUH 2DM7A 1D9KD 3EO9L 1IZKA 4LVOC 5HYFA 4XBEL 2OM5A 3NZ8B 4R26H 5MENB 4HUXB 4P2RB 3GDBA 2XA3A 1I7TA 2X9WA 5JW4Q 4GBXB 2YWYA 3HE7A 4LLDA 3GSWB 5HVFB 1KEGH 3QXAB 1VGEH 5MEND 5IHUH 4XI5D 4GBXD 2MCG1 4Z8FL 5FO8A 1R3JA 4ZXBB 3BPLC 1UB6B 3TBWA 5DD0L 2QJDA 4LP4A 2WINB 1RUAH 1ZVYA 1F2XK 2XKUA 1L7TH 4HS8H 1OCWL 3SDYH 1ND0B 3VJ6A 4ZXBD 3RI5K 1B6UA 2YPLA 4NFDA 3V6FA 1GIGL 4NIKB 1DQJA 1N4XL 1NMAL 1JRHL 3SO5A 3UJIL 1TPXC 3UTOA 1ZXQA 4Q6IB 5E6IB 4E41E 4LAQL 3RVVD 1QLEH 4KDTA 1T0PB 1BF8A 1MCFA 1IC5H 1K8DB 3L7EA 5A3ID 3VXTA 2G2RA 2DM3A 4ELMB 1HHHA 2PYEB 3L5WB 5SWZA 2FH6A 3IJSA 3PNWA 5E9DA 3BQUC 3EDEA 2CH8A 4LLWB 1JZ3A 1X5GA 3IXAB 4JFDA 1OT2A 3CUPB 3RVUC 2ITCB 1NGYA 2PYED 4IMKC 5I8OL 3BH8B 3ARDA 3RBSA 3V6OA 4GW1A 4JGMA 4G7YL 4CU8A 3VXRA 3ELAT 3V5HA 3GMRA 1HK6A 1FSKC 3U0TB 5C09E 5DDHB 1VCAA 2M26A 2C1OA 4HT1L 4TNVF 3FB8A 3GM8A 1Q9LA 4FP8L 4LCUB 2OI9C 3U4BL 4ODHH 3ARBB 4HWBH 2X4UB 2YKLL 4XXDB 2DI7A 5I75B 1LEIA 4P4KC 3SGKA 3EOTL 1U8LB 3ARVA 1AFVL 2WIMA 4N0FB 3O9WA 5J7CC 3ARBD 4F80A 1E4XL 1YEHL 3HHRB 1FCGA 1V3JA 2HJKB 1HHJB 5E8DL 2VO5A 5ETUA 1IGIL 3MJ7A 3TESA 2ENSA 5FUOL 4LCCC 2VDQL 4CW1B 3O2WL 2W1NA 3K8LA 4I0PB 3TIDA 1OGTB 1FNFA 1VACA 4PY8I 3QRFM 2RGSA 4LVHC 5L2JB 1W72L 4XCFH 4CN4A 2VKWA 1I85C 3GO1L 4I0PD 4KY1H 2G75A 5ERWB 1F3DJ 3H3PH 1RVFL 1WAAF 1XF3A 5JNYB 1BQHA 3U48A 5D1ZC 1A6AA 2MJWA 3IGAB 1YMHB 4G6AC 3RTQA 5I30L 1EFXA 4M5YH 2HFEA 1U58A 43CAA 4P9MH 2I9LB 5IWLA 1OT1A 4NN7C 4FFWC 5D2NC 3F7VB 3DECA 4ZQKB 3I3EA 5KAQF 3BW9B 1TCMA 1TIUA 1FIEA 3OJ2C 4ZO7A 4IIQA 1C5DA 4PJDF 2EH8H 1PX3A 2YRLA 3B9EA 4UOJA 3GSRA 5J13B 1DQLH 3GSVB 5C0DA 2H2SD 5D8JL 3TP4A 5FGSA 4IHOB 3IDNA 4GRWB 4RAVA 1IL1B 1LP9F 2B7DT 1PQZB 2Q8AL 2D0GA 1HYSC 4F3FA 1UFUA 1A0QH 2ZNWA 4OQ1A 1O5DT 3HC4H 2P5WB 4OI8A 4TULH 2NY7L 5L0QB 3FN0H 1A6UH 4M43L 1CE6A 2ESVD 4G6FB 5DZNA 3CU1A 5EORH 4HFUH 4JFOA 2NY6C 2P5WD 3UMTA 2XZZA 4HS3B 1EO8H 2VAAB 4UIMB 3RX5A 4CBPA 5E4EB 3V0WH 3OTTA 4G6FD 4ZUWA 1ZK9A 1Y18A 4KJPC 2DB8A 4LLDB 5FOBA 5KSAC 1N7MH 4BSJA 5DK2A 5DUML 4R96A 3S35L 3T4YA 3T65A 5CUSL 3HE7D 1DR9A 4UQ2B 4JO3H 3CK0H 4O9HH 4G42A 4HBCH 4R2GC 2LTQC 3PWJA 1X3DA 4K7PL 4LU5L 1KG0A 3VJ6B 2DD8L 1XF5A 1LGVA 2Z31B 3ARZA 3I6LE 4JAMA 4QTIH 5B4MC 2W0KA 2YPLD 1A14L 4KJQD 3JUZA 3BO8A 2Z31D 2ICEA 4OCYL 5CBAB 3JV4A 3WJJC 1FFPA 1CL7H 4Z78A 5DFVD 3PGFL 3DVGB 1G7IA 4UTBH 3L7EB 3VFSA 4L1HA 2X9YA 5FGCB 5AAMA 1HHHB 5DUBB 4AIOA 4EN3A 5IHLB 5I6XC 3OKDA 2A73A 5E9DB 3DO7B 2CLZB 3MNZA 3RHWF 3VWKB 1YZZA 1QLRA 1FAIH 2YD2A 1NUFA 2NY2C 3UJJL 3MRQA 5F88A 4I3GA 3DX9B 5E9DD 4LLAA 4X6CE 1NMCB 2CIKA 3GHEL 3VWKD 4FFVC 2CD0A 4KV5E 5JIHA 1MRDL 4JFDD 5EUOA 4OIIH 3CMOL 1SY6A 1VPOH 2CDGB 4N5UA 4NWUH 3ARDD 2QL1A 2NY3D 3VD4A 4HIHB 4P5TA 4LSPL 4P9HL 4M1GL 3MRIA 3SCMB 4X9HA 1YYMH 2D7OA 2ZP0T 1XR9B 1LEIB 5F7LB 4I13B 1UM6L 5D1XA 1BX2B 4YDVA 1U8MB 1JHKL 1LO4H 2EO9A 3DVNB 4X4XB 2NY5C 3SCMD 4YHMH 4OQTA 5GSRB 2FHBA 2VUYA 4LCIL 3KPLB 3NABL 1ZLSH 5ICYB 5ETUB 2XWJB 3U79A 4M61B 1BOGB 2A6IA 4NKIL 4E42A 4Q9QL 5BMFL 1RUQL 3RL2A 5ITFA 1FNGB 2AK4E 3S36H 4A2LA 4XMKL 5GGRB 5D2LF 4I4WB 5ID1A 3G6JE 1RUPH 3L5XL 4H5SB 2BJMH 1B0RB 1MVUB 3I3DA 2G75B 1U8PA 3WKMH 2VC2L 1MWAB 1R3LA 4R0LC 4URTB 3RIFF 1A6AB 4S1QL 4IRJA 3B9AA 4WI5A 3UO1H 4QT5B 2R1YB 1Q0YH 1MJ8L 3QCTL 3UTSA 4YDJA 3SKOB 1BFVH 2CKBA 2YHGA 3PDGA 3LKNA 2E7CA 1KB5A 1EFXD 3AM8C 4LEXL 3QUXB 1QA9A 4GAYB 2JLLA 1QO3A 4JN1L 4NRXB 5D71H 1JHTA 3CVHL 4IIQB 4D2NA 4F57H 3LAFA 5DQDL 4RWYL 3CFJA 3HB3C 3FL7A 4PV8B 4XP9H 5EPMA 1KLFA 4JQIL 4N0UA 1AR1C 5K9QG 5CIPH 3ZSTA 2DBLH 1CFTA 1T7ZA 2HJLB 4G6ML 5FUCC 4ZYKA 3N0PB 1AGDB 3ARRA 1VFOA 1FZKB 1A7RL 1I1FA 4LHQB 1NUNB 2AJSL 4KI5C 2YPKB 3L5JA 4LOUC 2DJ4A 1EAPA 5KANI 5K9JH 1CE1L 1IAOA 1I8IA 5K59F 4FXLA 4HJ0D 1ZLVH 3MCLH 4X7SH 1A6TB 1KCRL 4FS0A 2Y06L 1U9KA 4M7ZC 2BOCA 3I9GL 1XIWC 1U36A 4HIXL 5F9OH 5ANMA 5HGBA 4JFOB 3LS4L 1J0JA 3W39B 5HHQB 5DK0A 4DQOL 3HC0B 1H3XA 3CX2A 4JREC 3DOSA 4ZTPH 5EU7C 5ICXB 1SY6H 3FB6B 1RZKL 2IPKA 4OCXL 2GT9B 3C5JB 3QHZH 5D1QB 5FDWA 3Q0HA 2DLFH 3DYOA 1CD0A 4RX4A 5ILTL 2CRMA 3T4YB 1MCHA 3PJSB 2APFA 2AK1L 5D1QD 3IAGC 2WBJB 3QPQD 4YJZL 2RFXA 2CGRH 1MREL 1RZKC 1JNNH 5IVXE 3PWJB 4QY8B 3PF2A 3UTQA 1DQTA 4S0TD 3P4OB 4PRAA 5CD5D 1EK3A 2WBJD 1XH3A 4AL8H 5CIPB 4PGDB 3QUZC 3LV3B 1RZ7H 1MJ7L 4XC1H 3MRKB 1K4DB 4OCRL 4Y16A 5DRNA 1QFWI 3MGTB 4EXPX 2L4OA 3W2DH 3JV4B 5IT2L 3FTGA 3MLSL 1JYWA 1FFPB 3CZFA 1C12A 2M8XA 3C09B 3DVIA 4O5LH 1G7IB 1EV2E 5HI4C 1F4YL 4RZCA 5KSBB 2YK1L 5HJ3B 1IQDA 2WUBH 2QQLL 2A73B 3LMJL 3RA7H 3O4OC 1K6QL 4ZUSA 4EN3D 5F8RC 5I1EH 1MEXL 4X7TA 2H1PL 5IJKC 3T2NH 2CKBH 2X1WL 5E2VL 1XGUA 1KB5H 4NQDB 1K9TA 4FQHA 2FNBA 4O2EA 3GK8H 4PJGF 3IDJB 2B2XH 5JW4R 2Q86B 4KQ3L 3RWHA 4KK9D 4MJ6B 4NQDD 2DQEL 2OR7A 2X41A 1MRFL 4IDLA 4KKLC 4UT9L 3C8KB 5E08H 4H26A 4MA3A 4JKWA 3G08A 1TQBC 1SBSH 1QFOA 1LEKA 2PXYB 1KC5L 2KZ1B 4P5TD 4PREA 3S88L 3UEZA 4U1IA 5E2WH 3ZT6A 2OR8A 3KS0H 5FKAA 4E41A 3NFNB 3C5ZA 4XP4L 1FV1B 2J7LA 4PG9A 5IB1B 3IKCB 4N8PA 1CICA 3S4SB 4OF7A 1PJ9A 4XC3H 3HI5L 1EERB 4ODVL 4P3DA 1SJVA 1BBDH 4FQXC 2BSRB 4JJ5B 3DSFL 5SWSE 5GPRA 5IHZA 4LIQE 1MPAL 1NLDH 3TNNA 3TO4A 4IRJB 3CLEH 4DCQA 1Q9OA 3KYOB 4LARL 3ZE2F 1LO0H 2V17H 5JR1H 1KIRB 3ALWA 5C09A 3O2VL 3MRDB 4IRJD 1KB5B 4GKSB 4ONHA 2DLHA 1GOGA 1HWGB 2Q3ZA 4LPWA 1DN0A 1JHTB 4HBQA 2L7UA 3UTSD 3IDMB 4Y1AE 3CFKB 4S1RH 2EDLA 3GIVA 2V7HB 3RX8A 3RZWA 5F1OB 2BY0A 4CVXB 5CLTA 2MMXA 4N0UB 4GUPA 4JHWH 4X83A 5K93A 4P5KB 2P43B 2UUDK 3W0WB 2EDHA 4AZ8A 4ZYKB 3UP1A 5IMMA 2Y6SC 2JCCF 1DLFH 4ZPTB 4GAFB 1I1FB 4MA1B 3BUTA 1ZTXL 2QQNH 3FMGH 3GMNA 5TE7H 3W0WD 1EAPB 1A2YA 2FX7L 1CDJA 3HZMA 3PHSA 3Q6GL 2CDEA 2BVTA 5AUMA 3WE6B 2XA8L 1S9YA 3LEXB 2V2TB 1LO3L 3HA0A 2DL2A 4PJXE 4KVNH 1NKOA 2SEBB 3MJ9A 1JGLH 1U92A 2OJZH 1D5BA 5I1KL 5I1CH 3GKZA 3HZYB 2FEDD 5E8NA 5HGBB 4Z7OF 3WN5A 8FABB 1CGSL 1CXFA 4IS6A 4UT6H 4XVUD 5T5NG 4KMQA 2LV4A 4X9GA 5L7XH 3PL6B 1B0GA 4K7FB 4XNXL 4PRDA 1MFCH 1P9MA 3BISA 2BERA 4MZ3A 1ITBB 3M17B 2EYTB 4D9RE 3MRCA 2E6JA 5FCUH 3PL6D 2PCPA 2VR5A 2ERJB 1A7NH 3BXNA 4Z18A 1JCKA 4JKLA 1U0QA 1T0NA 5GGRY 1JJUA 1R24A 4L4TA 4PJ7B 4PLKD 3UPAA 4HCRH 4F7CB 4G6JH 1FN4B 3MLVL 2K9UA 2DKSA 2GFBB 4OT1H 5HHOB 2PO6B 1WUNT 4FTVB 2EDDA 4CDGC 4PD4K 1NGQH 4TNVK 3RPIA 4PP2A 2F5AH 3DX6A 3UTPE 1GC1C 5DRNB 1BJ1H 5DLML 3DURA 2ICWA 2PO6D 5F3HA 4KROC 2I26N 5F9JB 5J11B 5GGVL 5JORB 5L6YL 1GZQB 1OTSD 3VXQA 1BGXH 4ZS6D 5E8PB 3V7MA 3VRLE 4M5ZH 3GIZH 1LE5A 5D7JC 1QZ1A 5A43C 4RZCB 1KCLA 5B39B 3LOWA 4C56E 5E0QA 3G5YA 3IFPA 1YN7A 5E1HB 4CDHA 1MIEL 1IT9L 3GUTB 1CT8A 1U93B 2Q20A 3LY6A 4ODWB 1KIPA 2DTSA 4XZUA 4WUKH 4KTDL 5GS3A 4CMMB 1BM3L 5BOZG 2CUMA 2GTZB 1MFDH 5EC2A 5I16A 1K8IA 1HOCA 4ZFFB 1KJ3H 3ZKMC 5D93B 4OSUH 4BM7A 4X7EC 5I1JL 1AD9B 5FYJU 5AEAA 5TQ0H 1KGCE 4IMLA 5I74C 4U1IB 4HJGB 4OZ4B 3H2WA 5FKAB 1JV5A 1FNEA 2MOVA 1AQKH 1NDMB 3SPVA 1JHLH 1F58L 3MRLB 1E4KC 3SHSA 1EMTL 3C5ZB 2VE6A 2GYSA 3D0LA 3ZTJH 3BRFA 3QDME 4N1CA 5AD0A 2LAAA 1UG9A 2NR6C 1X7QB 3ILQD 3C5ZD 1J0ZA 3I85A 4OM0H 1KJVB 1RZ8A 2XG4A 4K8RD 3P9WB 2P46B 1YEIL 1YPZE 4GQ9H 4ZFOL 5I1IH 4UINL 1DQMH 5IHZB 4X6CA 1IEBA 1PG7W 3TNNB 2MPAL 1BIHA 4L3CB 1XGYH 4MD0A 5HXMA 3LN4A 5C0CE 3RZCC 4PJBB 4X6BA 2W9DH 5C8JB 3ULVL 3BE1L 4OF0A 5BO1H 1UYWL 1NCAL 1G6RL 1PG7H 4ESKA 5CJ5A 1JNLL 2OTWA 3U30B 1S8DA 2H2PC 4B5EA 1PYWA 4JPKL 5ISZE 5JOEA 5EU5A 4Y19B 2R2HB 1FBIH 3ULSB 3ULVC 3TN0C 4PGJA 1FG9C 3SBWA 2NY1B 5TE6L 4DN3L 5B3NA 4HUVA 4R4ND 4YGVB 2R0WL 4XP5L 3O3EB 4N1HB 2I07A 3ARQA 5C0BE 3GMNB 3QO1B 2ZUTA 1ZWIB 3IDGA 2AK4A 1D6VH 3ARSA 5D2NE 3G6JA 1KPRA 3PDOB 3MRMA 4HWZB 4U3CA 1N59B 1FL5A 3O8XA 2VXQL 1QLFA 3HG1B 1U92B 4HXBL 4OZHE 2GTWA 4BH8B 4KAQL 2LVEA 4KZEH 5IB3B 1FVDB 4GG6F 1KN2L 1F11B 4P2CG 2FSEB 5CSBA 4YQXH 4P46C 4W4OC 5E95B 2BVOB 4A6YB 4UAOC 3C08L 5D70L 1R3HA 2ZG3A 4HX1B 4NRYA 3BP5A 4G8FB 1U42A 1A3LH 3EYQD 3HNSH 2VIRA 5CSZB 4MAYC 3KPMB 3J8F7 3QUKB 4NNYB 1G0DA 3QQ9D 3K4AA 4XNYL 1CFQA 3OAYH 4QXTB 5DD5H 5DJAA 5T3XE 1JTPA 4KFZC 3A67L 4LK4A 3VRJA 3MO1A 4EDXA 3RY6C 1HH9B 1RULH 2UZIH 1U8IB 3HTLX 2W0FA 2ZUQB 3JWDL 3QXUA 4ZFGH 3U4EA 3P9MA 4GAGL 5BS0B 4Q58C 3BI9X 3TNMB 1TZHA 4EI5C 1JUFA 3GBMH 3DURB 5EZIL 2Q8BH 5F3HB 3A6CL 5BS0D 3HPJB 1MNUL 5IK3B 1R5IA 5HGHB 1NAKL 4R7DB 2KBGA 5D7LB 1A6WH 2AXGB 1YMME 4I8DA 3OJVC 3DX7A 5DJDA 4BQBA 4U6VL 4GG8A 3B9DA 1Q0XH 2C1PA 2FHFA 1OSPH 5FUZL 3FQNA 3LQAH 1RIHL 3F12A 5D7LD 3C6SB 5CZXD 2G5RA 4TSBH 1DFBH 1CT8B 2ZPKH 4Z6AT 5I76A 3LKQB 1TTFA 3FAXA 2HFGH 3PWUB 1RV6X 1EO7A 2MNUA 3ZDXF 2ADFL 3SY0A 1S7TA 2A6JA 5FA4B 3MNVB 3BX7C 4DKAA 5JQ6H 1D6EA 1QFWL 3QEUA 3ARFC 5EC2B 5I16B 3LB6C 1Q72L 1KELL 4YO0A 4TUOB 3LKSA 1HOCB 1JPSH 5IVXA 5I8EA 2DM2A 2YD7A 1DANT 2A38A 5H94B 1HZHH 3IRPX 2UVFA 4Y4HA 5E8OB 3JVGA 2H9GA 1UH2A 2HT3C 3FB5A 5KVFH 1J0YA 2NNAB 3ISWA 5CZKA 5LKNA 1AIFA 4FQCH 1UKQA 3R1GL 1LNUA 1YEGL 3I6LD 3P0YL 5JA8B 5IROC 4OB5L 3E6FA 1A6ZA 2F8XC 3VWJA 3BWAA 1EHLL 3C2AH 3DETC 4KK8C 2OLDA 1WITA 3D85A 2VLLB 4M6NH 4M7JH 4GXUN 5HI3C 3SJVB 5FM8A 1CIDA 2EXYC 5JW4M 3Q2CA 4ALAH 2X9XA 5IBUB 4WW2F 3ZE0F 2VABB 3FOMB 3LQZB 4X6CB 3SJVD 1DVFC 5C0GA 3PWPE 4G9FB 3FQXA 4QHUA 1NPUA 1G7HA 4OKVA 5DRWA 2VQUA 3OGCB 1MQKL 4PJ9C 3GSXA 3KPNA 1PKQE 2DQGL 3CSPA 4NGHH 2E6PA 4HPYL 4F7MA 4YDIL 5TF1L 1H5BA 1PSKH 5JIIA 4ZAKA 1UQSB 4FXKB 1YEFH 1S7QB 1AXTL 2HTLC 3WFDH 3CJJA 4JFFB 1T04B 4V2CB 5JO5A 1XZ0A 4XRCB 5KSUA 2QEJA 2M2DA 1UVQA 2ENYA 2CRYA 3BIKA 5C2UB 1MHEB 3IDGB 4HC1L 4PB0L 4K3GA 4JFFD 5HPOA 2RQ8A 1KACB 1NCDH 3NTCL 1KCVL 5E5UB 3V7AE 3VMPA 3TJHD 2X1PA 1KPRB 4HF5L 3MRMB 5SX4I 1FGVL 1ACYL 3KPSE 1P4IH 3STBA 4P2OA 1RZFL 5C86A 1QLFB 5SWSA 1KTRL 3H3BC 2GTWB 1AO7B 4X7FC 2X4NB 1JL8A 2Z93B 4B41A 3G04B 5FKPA 2N4IA 1OL0A 1IFHL 1X4ZA 1AO7D 5FUCE 4CADA 5J1SC 4OGZA 4NQCE 1QSVA 4XB8A 4DWHA 1U3HC 2UZYB 5DVOA 4HH8A 4NRYB 3SO3B 4YEFA 4G7VH 3ULUH 4XPHH 3E8UH 4Y1AA 1PAMA 1FG2A 4ONGL 4I5BA 3QEQB 3FT3A 4HEME 1BREA 3GJFA 3KYNA 5KVEH 4MD4A 5EULV 5J3HC 2ZJSL 3H9HA 3QEQD 2W0FB 4RMVA 4YNYA 4Z5RB 3P9MB 3CDYA 4RFEA 1H3PL 3TCLB 4KJYA 4KXZH 3ECBA 4DKFL 5EIIA 1NL0H 2RR3A 2DLGA 4FABH 3P4NB 2D31B 4Q9RH 1WTLA 5BJTA 1VGKA 4X4ZA 4PJXA 3FFDA 3W9DA 4WHYG 4GG8B 4PJ8B 3WXVH 4ELKB 1YNKH 3Q5YA 3Q5TA 3FQNB 2B1AL 4APQB 4XHQA 3F12B 4POUB 1J8HE 5LWYL 3UPRA 1YECH 4U31A 5JLZB 1EVTC 3RY5A 3KPRE 1J0KA 2VLMD 3QJFB 3G6DH 4JB9L 4TUKL 3QG7H 1BVLA 5L2KE 1C5BH 1JZ7A 3SDDA 4R4BA 4OZIF 1RZGB 2FLRT 2NPLX 4FMFA 3IVKA 5DZLA 5JXEC 2E7MA 3SKMA 5J6HA 2BMKA 2MKLC 1MRCH 5D7KD 2AXJA 5F72S 5CJQH 1TENA 2VITB 1IAKA 1AJ7H 1C1EL 4J4PC 3P30H 4N8VA 1L7IL 1XF4A 4XBPA 3ULUD 2HFFB 5KVDL 4PJHF 1WZMA 4LPTA 4K23H 3T2QA 4JFZH 4KDVA 4NM8L 5EOCJ 3EJJX 1R5WA 3FO9A 2FX8H 2J88L 1UJ3C 1MFEL 1LNUB 3EYVB 3VI4F 3L3KA 4BQ9A 2B1HL 3E6FB 3O2DA 1A6ZB 5IFAH 5IMKB 2P8PB 3C6LB 3BWAB 1YEJH 1P2CA 3KLAA 1DBBH 3NZHH 1UWXK 5DC0A 3MRNA 3U36B 3PWVB 1KCKA 1NDGA 4LLMA 4L8DA 1P5UA 3CD4A 2NLJA 1TJGL 2B4CL 1R0AL 4G6KH 4X6DF 4YUEL 4C56A 2O5ZL 2EDKA 1VA9A 5KG9A 1H15B 2D7PA 1ZS8B 4LIQH 4U6XA 1HNGA 4NNPH 1I9IL 4XP1H 1F90L 2F74A 1X5JA 1S7RB 3FONA 2H32A 4PTUB 3WFEL 2BRQA 4KTEH 4M1DH 4QRTB 3WCYA 1S9WA 2IFFL 3GGWA 3R4DA 2B4CC 1E6JL 4PGCA 3FQXB 3O3BA 2HN7A 5JOFA 2XRAL 2P7TB 5DRXA 5HDBF 4AH2A 3GSXB 4JR9L 4XT1C 4MAUL 1J12A 4R9HA 3WSQL 1EXUB 5FO9A 2FD6H 3DBXB 2X4PB 3PWLA 2F8OA 3MA7A 1ZGLP 3HNTH 2R29L 5EO9A 1QACA 4I2XE 1VEOA 4ZAKB 3BQUA 3NH7H 1DDHA 4PFEA 3U6RA 4YFDB 3T08A 1N0LA 4DGYH 1I1YB 1NC2B 3LSOA 1HHGB 4MCZB 4IMKA 1DQDH 1BAFH 2IF7A 2FATL 4ZAKD 4N0RA 5ACZB 4H25A 2EKJA 2AQ2A 2DLTA 5CP3H 2GUOB 2HT2D 3QDMA 4HKJA 4Q0XL 5D96C 2D7QA 4WY7L 4Z7QE 2BSTB 3HCVA 1LO2L 3MRGA 4W68A 3B9KC 4U1KB 5DYOA 3VFMA 1DUZA 1W0WA 3X11B 1YPZA 2F19L 5IW1A 4XWGH 5SWSB 4EIZC 2FR4B 3BEWB 4YXLL 2GIYA 4YBHA 4P4KA 4S2SA 3IETB 3DLQR 2GK0B 3HNVH 5C0CA 3GMQA 1U91A 3FO2B 5AZ2L 4IRZH 5SWSD 4FQ2L 5FM5O 1TZGL 1RZIA 3EHBD 2VDLL 5AZEH 5C71A 2FX9L 3OR7A 4FQPA 4KHXL 1CQKA 5FGBC 4Z7WE 3IXTB 4YWGL 5ISZA 5C0RL 1IGYB 1INEL 1S7WA 1GGIH 2IADB 2IPTH 4M9OA 6FABL 2UYLB 3W11C 3IFOB 2JTDA 1TVHA 4AEIH 4FA8A 1HEZA 4YFEA 2X44D 2HVKA 1I85A 1N2RA 3OWEA 3C8DA 1EFQA 3BMWA 3QEGH 3RVWD 2IALB 4L8SA 2G9HA 2GJ6E 4B7LA 5DMIL 4CGTA 5C0BA 3O2DH 5INCB 3NCEB 1W72A 4NZRH 2Z92B 1B4JL 1EHNA 3O3UN 4TTDD 5D2NA 3QQ3B 3EO9H 3FRPG 3QJHA 1VGKB 1LDPH 3EYFB 1GAFH 4MXWL 5F93C 4MQ7B 2J8UB 1DP0A 3PP4H 4ODTH 4OZHA 4P57B 5B3JE 2H32H 2FZ3B 2QADC 1N3NB 4PJIB 5A16A 4Z8FH 1A4JB 5DD0H 5DJYA 1C7TA 4XP6H 2GSGB 4JPVH 5ITBL 1N8ZB 4P59L 4EDWH 1OCWH 3Q5OA 3PP3K 4JY6B 2IAMC 3T0WA 5DS8B 2X2YA 2XTJB 4G8IA 3C9NA 1F4XH 1JRHH 3INUL 3SDDD 4D9RD 4NKOA 3UX9B 5DMYA 5JZ7C 5EBGA 4LLYB 1UEYA 2ED7A 3IDYC 2XTJD 4XX1E 1A1MB 1URLA 1EEUA 3K8MA 5C6PB 3ARGB 5IP4A 4ZOBA 1RIUH 1P7QB 4WNQB 3VFNA 1M7DB 4LVOB 1T1YA 3RNQA 3SKUD 3MJ6A 1F3JA 5GZNC 1P7QD 3L3KB 1EPFA 3VXUB 4M8QA 2HA1A 1UXSB 4ONFL 1QHPA 3UTPD 1GL4B 3NIDE 5EU6E 3OKEB 1YMMA 4NRZB 2JJTC 5I8OH 4NSKB 1S78C 5K33A 1NDGB 3OPZL 4HMDA 3VXUD 1VDGA 2R4SL 4L3AA 3H7BB 5DTFA 4U4BA 1IGFL 1S9VA 5CEXB 4TQEL 2W9EH 2H32B 3L95B 2F54E 4M6OL 2HKFL 2GJZB 3Q48A 1ETZB 4HT1H 3WD5L 4IRSC 2XFXB 4FP8H 5E99L 4PJ5B 3U4BH 4M03A 4GW5A 5I18L 1TPXB 1UWGH 4F2MB 5JOFB 3JTTA 1XGQB 1T03L 3EOTH 4YAQB 1U3JA 1Q9KB 2BFVL 4PJ5D 3MJ8B 4ETQA 3WJJA 2EEBA 4X4YA 1JGEA 1E4XH 5FO9B 4YHIB 4OGAC 3CSYA 3REVB 5EB9A 5E8DH 1CI5A 1IGIH 4U1GB 3JTSB 5C0AE 5FUOH 3RU8H 2K7QA 4NHCL 2VDQH 1U95B 4WI6A 1LO5B 2EH7L 3U6RB 4X98A 1F42A 5ALBL 2ZUUA 3WDJA 4F7PB 3LSOB 3UBXA 1BQSA 3ZHDA 1RJYB 3MR9A 3U82B 1EJ6A 2A74A 1ZGLA 3LEYH 3BQUD 1KGCD 4S1SL 1QBBA 3GO1H 5EC1B 4MJIB 2EECA 3CPLB 2X4QA 1W8NA 1RVFH 2ZCLL 3RVUD 1XF2B 3BPOC 3HCVB 3H9SB 2L0DA 2DM4A 3V2AR 5JDJA 4XMLL 2NTFB 4HAFA 3MRRA 2EYRA 2OI9B 3H9SD 4WEBL 3GSUB 4M9PA 3ULVE 3PWPA 2VDOL 5C0CB 4PV9B 1IKFL 1X5ZA 3BP4A 1NBYA 4MX7A 5LGJA 4WHCA 1M6OB 3P73B 1PKQA 4XCCL 1CDIA 3HLAA 3VFUB 3X3FL 4Z7VE 5C0CD 1IILE 4LCCB 4MZ2A 4QF1B 5T3XH 2YN3A 2Y23A 3JV6A 4PRNA 5FM5M 4UZGA 3LDBC 3P4LA 2VMFA 3OB0H 3ABZA 1MAJA 43C9A 2YD8A 2Q8AH 1AGFB 1CD9B 4MDJA 4MSWA 3NAAL 3T1WA 3K4ZA 1QRKA 1EEQA 2VTFA 5T3ZH 1BZ7B 1T0MB 3N1QC 2G9HB 2NY7H 1DUYB 3EYSL 5D1ZB 4ELMF 2MHAA 1QEWB 2Y7QA 3DTXB 4M43H 5DQJA 5LBSL 3MNWA 3BGMB 4JFQA 4RQQB 5ESAA 4ZUVB 4HS6A 1ZVSA 5D1ZD 3EJZC 2FL5B 4OAWA 1DBJH 4YHLL 5E6ZA 1WFOA 5IMOB 3AM8A 1OB1A 4LCYB 3KPSA 2F53A 4G8GE 1M7IB 4X8JB 5H37G 4FFWD 4YIQA 1J1PH 1HDMA 1X6NA 1QFUH 3PWNB 1BPVA 5EOTB 3WHXB 3S35H 3T0EB 3D2UA 2BP3A 2CMRL 4PTTA 3V8CA 1KLGA 2Y36L 4NQCA 1UCTA 2HKHL 5DO2C 3CVHA 4DUVA 2ZG1A 4NJAL 4K7PH 4OZGB 3T0ED 4LU5H 3PV6A 2DD8H 2GAZA 5DJXB 2WLZA 1QD0A 2Y25A 4KU1A 1S9XB 2CLVB 4WEMB 5I9QB 3S37H 2WNGA 1G0YR 1WCQA 4QOKE 5FK9A 1IM9A 3VA6A 5F7YC 3IAPA 4FQIH 1FGNH 4JY4B 1XIWA 1HYSD 2XOTA 4ORGA 3EDJA 4LVNC 3PGFH 3KWWA 5T3XD 1QPPA 4U3XA 5GGTH 3DV4A 2DLIA 1F3RB 1L9MA 4D94A 3RIAK 4TOYL 4JHBA 4NQUA 1F3JB 2NY6D 1GH7A 2ATKA 4NC1C 1SEBA 5T3ZD 3UJJH 1YUHA 2EZ0D 1TJIL 2YZ8A 5KSAB 4M8VA 1FL3A 1SVCP 3D18A 1U2CA 4KKCC 4KJPD 5IKCB 3O6FB 5F97E 3GMLA 2EICA 1A7BA 4O02L 5BV7C 5KSAD 1IAII 5DEGB 4R2GB 1NCBH 2LTQB 1J8HA 1WF5A 1YDPB 4EQ3A 2EXWD 1S9VB 2Z35A 3VXMB 3KPRA 2NY5H 3O6FD 3QSKB 3LZFL 5L2KA 4LSPH 3IDXL 3PGCA 4L4VB 4R2GD 4LPCA 5GIRB 5EZJB 4F7TA 3VXMD 4HUUA 3QIWC 5AYUL 4RISL 1ES0B 2A1WL 1JHKH 3GSNB 2VZUA 4L4VD 3UZEA 1TJHL 4X4YB 5DGQA 1QNZL 3P77A 4U2YA 4GRWF 4LCIH 3CSYB 3MOBL 5B4MD 1G7PA 1ZA6A 3TBSB 4GJTB 4HK3J 4NKIH 5BMFH 1FCCA 1RUQH 1PEZA 2VKXA 2YZ1A 3L3JB 4XMKH 2NY2B 5SX5H 3QWRA 2VISB 4D9LL 1T7XA 3L5XH 1OAUL 4XAKD 3BZFA 5IJKA 2NXZC 2NY2D 1UKTA 3FO0L 5FHBL 5KOVC 3BYTA 4MHHI 4WI7A 1JF1A 1BOYA 2XN9B 2IC2A 4BA8A 3MREB 4OUUA 3RWGA 4Z7NF 4FFVD 1O7SA 4KMTL 1MJ8H 2EYRB 1RK0A 2XN9D 4KVCH 1ZHKA 4HV8A 1G7LA 1XGTA 2VLKE 3LKPB 3TVMC 1MCRA 4LCWE 3TPKA 4L8CA 3CVHH 5TDPA 3FRUB 5LGJB 4MX7B 4BJLA 1CGTA 1FJ1B 1INDL 4XPBL 1FYTE 4EJ1C 4PRPE 1CLOL 2I27N 2VN4A 3PWPD 5DEFB 3C5SB 4KRMB 4G6MH 1KIQA 2WAHA 3QRGL 1JPTL 5AAWA 1FNSL 1ZSDB 3MLTA 4PRNB 1DLHA 2PKDA 1QR1A 5IFHH 1QPXA 5DHVA 4K71C 3PE9A 1CE1H 1AP2A 4YHOL 2YS4A 2DQCL 1CK0L 4H0HB 4YK4C 5MEQB 3DJ9A 1SBBA 4PJFA 1A5FL 4R0LB 5KS9E 2OK0H 1KCRH 4TVSa 2MHAB 2Y06H 2BXYA 1XGRB 1VKXA 2YBRA 4JFQB 4ZNCD 4HIXH 1N6VA 5ESAB 1B6DA 3BESR 3LS4H 1A21A 1YNTA 1ZVSB 2MQ3A 2E9WA 5IB4B 4HH9B 4QEGA 3W9EA 4DQOH 4OM1H 4G80B 3LEVH 4JN2B 3WNLA 3ORJA 1RZKH 4OCXH 2IH1A 3RL1A 2Q76B 4TPRL 5F1IB 5J12C 1V7ML 1YJDL 1TQCB 5ILTH 5GGUA 2IG2L 1OVZA 1DN2A 3A6BH 4M48L 2AK1H 2ILLA 1M05B 3IU3A 3HB3D 1U8JA 4GKZA 1JGDB 1NEZA 1MREH 1AR1D 2VH5L 4P23B 4H20L 4Z7WA 1UZ6E 1MCPL 4C4KT 1JP5A 1YJDC 1FC2D 3RUGA 5LAXB 2Y5EA 1MJ7H 3F5WB 4KI5D 2FBJL 5E5MB 5GRZA 4LOUD 3KS0J 1ORSA 4M7ZB 4KK6C 3LD8B 4FHBD 1MY7A 5IT2H 3I50H 3MLSH 4ORGB 2GJ6A 3MFFB 2GY5A 4JPWH 1X5LA 1IM9D 2NTSP 3BVNA 2P5EE 4JZNA 1HXYA 4C57C 1RI8A 3D9AL 2JJVA 1F4YH 2EDJA 1VFBA 4U1JB 1S7XB 1XIWD 3GMPA 4S10A 4A2MA 4JREB 4WTWA 3Q3GB 3NPSB 4UBDC 4WTZG 4NT6B 4RFOH 3RTQC 1UA6L 4OTXH 3PGDA 1I9RL 2WV3A 3N85H 5IWLC 3D18B 2H1PH 4OZFA 5E2VH 1DEEA 4UB0H 4W6XB 3GSQB 1QQDA 3WFBL 1A02N 3L7FA 4RMQA 3KPRB 2E9BA 4QRRE 4KQ3H 3BSZL 3OXRB 2DQEH 3QUZB 4WFED 1MCIA 5L2KB 1MJUL 4UT9H 4ZUUA 1JPFB 1HSBA 5DSCB 5IMLB 3FHAA 1WC7B 3KPRD 1CFSA 4J3WA 1J05A 1FO0L 4PRHE 3S88H 5L2KD 3QUZD 4PY7B 3ROLA 2BSSA 3P77B 5HDOA 4MB5A 4FQJL 5DHVH 2V5SA 5C2BH 3HFML 5C1MB 1N6QL 2ZSWB 3AB0C 4UV4L 4XP4H 2YN5A 1ZHNA 4R4FL 3KNBA 2XKSA 4IOIA 3QUMH 5ESQA 1YYLH 1CXHA 5J0BA 4EI6A 2Z8RA 2VDKL 3HI5H 4ODVH 3DV6A 4PGEA 3RGHA 4K3EH 5EU6A 5A2IH 4MJ5A 5E5RB 1RU9L 1L0XA 5HVHC 3S6CA 3T1FA 3VFPA 1CXLA 1MPAH 3BKCL 3BZ4A 3QT2A 3I6GB 3KYKL 1E4JA 3QA3A 4OUUB 4U05A 3VMOA 3CVIL 1QUNA 3ZE1F 5IW6A 4XBGA 1HINL 1T6VN 1MLCA 3V5KA 1FORH 1ZVHA 2F54A 5IB5A 3TBYB 2VZ1A 1CFVL 2XACC 4DTGH 2CXKA 1B3JA 3OMZA 4HV8B 4XGZA 5ADPH 3DGCR 4LSVH 4L8CB 4JHAL 4WUUE 4KKLD 2XY2A 4YZFF 1ZT7B 3UZVB 3ROOA 3S34L 1J88A 2EDXA 4HZLA 3O0RL 1E4KA 2FECI 5J57B 2XYCA 1T3FB 3LS5H 2QR0B 4NJ9L 2QSVA 4WHDA 4NNXB 4EUPA 1WAAE 5C0AA 4OFYA 1DLHB 4G3YL 4I2XB 3RWEB 1S9KC 4LKXA 5DHVB 1AKJB 1ED3A 2APVA 3MPCA 3S7GA 1ROWA 2FX7H 2V2WA 1BJ1J 1I1AC 4FQXB 4XAWL 5JTWA 2V5MA 3LHPL 2FB4L 4XTRC 5SV4A 4KUZL 1LO3H 4KJWC 4PJCB 3QUMB 3AMLA 1AKJD 5KSBF 3JZ7A 2ADGA 4LAJH 4HKXB 4QNPF 3SDXB 3RZCA 4FQXD 2E9IA 5EN2B 5EU3B 1MJJB 4GMSL 1E0OB 1QBLH 2W60B 1CGSH 4ZFOA 2FJGA 4PJDE 4XNQA 3N1FC 3T8XA 5F3BA 3SE8H 4OZFH 1BWWA 1XCQB 2J6EL 5DI8B 1MAKA 3SGJA 3NN8A 1KTDA 4RMWA 3ZZ1A 1OF2B 1T2JA 3TN0A 4IEFB 1LP9E 1SJXA 1HI6B 3TBTA 1G6RA 1T1WB 1T22A 3LN5B 35C8H 1BD2E 3IU3B 1GC1H 3JV0A 2BZDA 3ARTA 5DMKB 4TRPH 4Z7VA 1WIUA 4MDIB 3Q6FB 1G7QA 3SE4C 2Y6SD 4PR5A 3IJYB 4DVRL 3NFPB 1CU4L 3HZVB 5DLMH 4FN0A 5J06A 4LASH 4LPVA 4JO4L 1VB9A 3CFDB 5GGVH 2X4OA 4R3SB 4EOWH 5HHXL 1AGEB 4X80L 5IESL 4JZNB 3QNZA 2PR4L 3Q1SL 4OLEA 1NAMH 2OJEA 4P46A 4W4OA 5TH2B 1WZ1H 3L5IA 3HUJF 1T89C 1ZV5A 1MIEH 1IT9H 1HYRC 2VR4A 5DJ8A 3EDKA 2D9CA 4X0KA 4G8GA 2ZOKB 3PXJA 3CX5J 2W91A 4KTDH 4MAYA 4KKBC 2BNUA 2BY3A 4KQ4H 5D4QA 1OTTC 1PGRB 3QNYB 5JW5A 3KPQA 4WFGE 3L7FB 3RY6A 3GMMB 4GKNB 1EX0A 4IJ3C 1A7PL 5GRWA 2AEPL 3STZB 1FHGA 1QOKA 4OIAA 3WFCH 4LSUL 5DUPH 2LU4A 4UNTA 1YN6A 4EI5A 2EIZB 3GJEA 3RKDC 1CDHA 3U9PL 5MI0C 3VXPA 4EUPH 4JDZB 3DI2B 3R06A 3G6AA 4XNZC 4QOKA 1T83C 5D6CB 2VUOA 3QNXA 4TSAL 4LGPB 3BZEB 1OP3H 3CZJA 4PB9L 1F58H 3N9GH 4KROD 4LP5A 5D7JB 1Z0MA 4QXUH 5I1HL 2ICWJ 1NGWA 4CU6A 1MCWW 2OL3L 3F7YA 3S5LA 3UDWA 4TNWF 1IAIL 4CN1A 4Q9CA 1C08B 2APXA 4V2BA 2ITDA 5D7JD 1W2KT 5D9SA 3DRTA 4G43A 4LEOA 1BLNA 3D3VA 2QSCL 4UINH 1PEWA 1NAMB 2OXGA 5A1AA 2AJZB 3T1FB 3VFPB 2KUTA 5DXWA 4WW2C 5MERB 3VRIA 4J3SA 4TN9A 2MPAH 3OAUL 3ARFA 3BD5A 1CR9L 3TV3L 1IRAY 1KXQE 3ULVH 3LQMA 3BE1H 3WJLA 4NKDA 3OHXA 1NCAH 1KCSL 1G6RH 4MXVF 3BUYB 5KW9L 4LNRB 2DWDA 1LK2B 4JRWA 2JB6B 4LQFH 4QTHB 3RWDA 3FT4B 2BNQB 4MWFB 5ID0A 4PJ7F 1H3WM 2AJXH 3FQTB 4JPKH 2G5BB 2R2CA 3V52H 4M62H 1KJ2L 3QDAA 5I74B 3WIHL 2YPVL 3ZKMD 3VMNA 1NGPL 4NO5A 2IBZY 4OJFL 5D2LE 5HHNA 2BNQD 5TE6H 4HZLB 4OF8A 4DN3H 1RJZA 3S98A 2R23B 3M1BB 4Y16C 1GGBL 3MRJB 4LBEA 5K9OA 2R0WH 3QZWB 2XZCL 2D2OA 1G6VK 4OLUH 4LKXB 2ARJA 1H8NA 3PUCA 2YD6A 3TT1L 1T20B 2NR6D 1IGJB 2G60L 4OZFG 5BXFB 2A77L 4I9WE 5DMGC 2ADGB 3OGOE 2VXQH 5BW7C 4HXBH 2GSIB 4W70A 4N8CL 4PJ9A 2V2XA 2FJGB 3MSPA 1KN2H 3T8XB 3TGXA 2VXVH 3I75A 5F3BB 1GHFL 2HWZL 3NCJL 4ACPA 2VXSL 4HIJA 1MLBA 3C08H 4J3XA 3QDJE 4O58H 1CG9B 2VLKA 4LCWA 2WM0A 5DRZA 3TN0B 3QIBC 2DQDL 2H2PD 5TFSL 3WIIH 1V05A 2ZOLA 2ARJQ 1GZPB 5IOPA 4XX1G 1C16B 4PRIB 1FYTA 2COQA 4PRPA 5GJSL 5K59E 3TN0D 3O6KL 3G5ZA 4JCMA 3BKJH 3CCHB 1FP5A 5IR1B 3GKWL 2YMXH 3E2HC 4XVTL