1NCWL

Cationic cyclization antibody 4c6 in complex with benzoic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG2A
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncwL01
3LHPH 3RWIA 4G5ZL 3BJLA 5HVHB 1S9YB 2F15A 4Y4FA 1WAAF 4MDJA 3TJHC 1CDCA 5C0DB 1UXWA 5HGHB 4PRPA 3FL7A 1DVFB 3IFPA 4R0LB 2DQGL 1A4KA 3I6GA 4YHZL 3PP3H 1IGJA 2AGJH 1KCLA 2YPLE 1LMKA 3GI9H 2V9TA 4N8VB 1T1ZB 4OLWL 3QIBB 1M6OA 1X5KA 4K94H 4PJIA 4OI7A 3VFOA 1OSZA 1WWCA 1PQZA 5LG1A 1I3RA 4CJ0A 3O4LD 4PB9L 1FNSH 4OZHB 4W4OA 5E95B 4M02A 1ZXQA 4RBPK 5FGCE 2J6EH 4FP8L 4G9FE 1BX2A 3A67H 4P2RE 3ZKQD 2CR6A 1SJVA 4MD4A 4P2OB 3B9KC 5GJTL 1ZKAA 3PG2A 3A6BL 3B6SA 3CVIL 3QDME 3AREA 5J6HA 4KDTA 4CGTA 1MJJB 3DO3A 5AD0B 1ZLWH 2A73A 4Q9RL 3L1OH 3HRZB 3U0TA 4K8RC 5SX4I 1L7IL 4EDXB 2JJVA 5MENA 3WNPA 2EEBA 1JI2A 2VE6A 1KENH 4RFOH 3T1FB 4Y2DD 5I30L 2FX7L 1RIUL 4WV1B 2E5EA 2I60H 12E8L 1FFQA 3GJFH 5BS0B 5CBAB 4PJAA 2NY6B 1NFDA 3OAYH 4XCCH 5KN5B 5TFSL 3JWDC 3S6CA 4QY8B 5C8JA 1XIWB 4DFHA 4O02L 1BBJA 1G9ML 5TPWL 4IMLA 1OAYL 5HHXH 3IDYB 3TO2A 4LDEB 3QPXH 1ES0A 1UACL 5IJKC 1VFOA 3DHJA 3T3PF 1EJOH 3H9SE 3WD5L 4H1LG 1JZ3A 2X10A 4K2UH 1CD8A 4KMTL 2SEBA 2LFGA 3HUJE 3OB0H 5I2IB 3GKZA 2NY4C 4NWTL 5CEZL 5DQDH 3BRFA 4CKVX 5HYSA 5I8OL 4OV5B 2BRRL 1XGQA 1CG9B 2ZPKH 4G7YH 3UPRA 1BVLB 2NTFB 3QG7L 5GGSA 1HSBA 3NFSH 5J56B 2AABL 5H94A 3FQTB 3GSRA 4GBXC 2A1WH 4PJFE 3M8OH 2ZUYA 4QRTA 1A1MA 2JB6B 4DGIL 4EI5A 3SDDA 5T3XH 1HI6B 3WV0A 4OZIF 4YBLC 2IPTH 3KDMA 3DRQB 5JW4M 4HWBA 3ORJA 4R8WH 3K80A 3N1MC 4NQVA 3TA3D 4RWYL 1E4KA 4ISVB 3P4NB 4X4ME 4GKSB 4CVUA 4KTYA 1CE1L 2Z0BA 5JHDB 3KLAA 3MV8A 3V0WH 4KI5E 1RZIB 4NZJA 4PS4L 2Y25A 4EBQL 3EJYD 3SKMA 5DMKA 3MCKB 1AIFB 3O3DB 4DEPC 1ND0A 4ELME 5IFHH 3UTTE 1A2YA 1GYAA 5GGTH 1TJHL 4JY6B 3C5JA 5KANI 2EDQA 5DEGA 1NCUA 3BWAA 3SGDH 3BE1L 3QIWD 2D4DA 2DMCA 4WVRA 5IKCA 2NY6C 4JPVL 4KKNA 5I71B 3G5VA 1OWWA 4O2FA 3EO1B 4AH2B 1AQDA 3MRPB 5L0QC 4JFXA 3LRSA 1G1CA 3HI1A 4EVNB 4M62H 4U1SB 4PRHE 4EUPH 2VLME 1N0XH 3LKQA 1CZ8H 3O6FB 5EG6C 4W81A 4KRMB 4RFEA 1G9EA 5EA0L 4G6JH 5DRZB 5ADOH 3O0RL 3LKOB 5LCVH 3V95A 3QEUA 32C2B 1RD6A 5GRXG 2D31B 1KT2A 4WFGD 4OM1H 4LVNC 1BD2A 2DWDA 5ACZA 1CDIA 4ZNEE 4EVNA 3WFZA 4Y4HC 1C1EH 4IRJC 4NZTH 5GJSH 5CJXA 4YDKH 3DROB 1KN2L 4RBPH 2VXUH 3X12A 5F6HJ 2AEQH 4F2MB 5FKPB 1IGIH 4D3CH 5DRWB 1RMFH 2XWTA 1DQMH 4N8VG 1I3GL 4HUNB 2Z31D 1INDH 5CD3B 3NH7H 5HYJE 2VXVH 5HI4D 4G43A 4MNGE 4C57C 3MBEC 4HH9B 1WWWX 5D6DC 2AQ1A 1EO5A 3VJ6A 3MNWA 1PLGL 3R8QA 1VGEL 5L2JB 4MXQD 1KCSL 1BFTA 5D7IF 1IGTB 1I3UA 1PZ5B 3L3HA 4O4YL 2ZUQB 2DQFA 4QTHA 1ZV5A 5HD8D 3KPRA 5E8EA 1YEDB 1KJVA 1TZGL 2EICA 2G9HB 2J8OA 2NXZC 4R7NB 4UTAH 1JZ2A 1AR1C 4P3DB 1Y0LA 2DTSA 2UZIH 4KQ3L 3KPTA 2AK4B 1AFVL 1PW3A 1KULA 3HI5H 5IB3B 3BI9X 5KSUB 4L3CB 3QXAA 2HFGL 1XAUA 3JWNC 4NOFA 3BRDA 2D0GA 2EE2A 1T1WB 1KPUA 1YECH 4PJDB 1YDPA 1BZ9B 3QUZB 1M71B 3PXHA 3GK8L 1B4JL 1U8PA 5EU6B 3VXPA 4HF5H 3VWKD 2VZ3A 5L7XH 4KZEL 2X4UA 1JTPA 4XAWL 4LOUC 1N6QL 2LAGB 4BYHA 1QRNA 2BZDA 2YEZB 3NVQA 4U6YB 3D85A 2NY2B 3U7YL 2DAVA 3D69A 3AM8C 4HIJB 3U30C 2JCCE 2KH2B 5E8DL 2IEPA 3L3KB 5CZVL 5E6YA 1TETL 5DXWA 5F7EH 1F02I 4YHNB 5AYQA 1MJUL 3HMXA 5E2TH 5FA3A 4ZUWA 2D3VA 5L88H 1UWEH 2ENYA 1QA9B 2P5EB 5J4MA 3KHOA 2DYPD 4B5EA 2GJ6D 3C5JB 1TCRB 2V17L 2D4FA 4JVUA 4KJWD 2VXQL 4FFWC 2D7TL 1W8NA 4PJGE 2R9HD 5BW7C 1C12A 3U0WL 1QLEH 3NTCL 2NY2C 4TUKL 2PW2A 4PV9A 2FH6A 4XVTH 4FA8A 1JRHI 5IB1A 2EYSB 4YHYB 3WNMA 4WO4D 3GHEH 4LQFL 4PTTB 3PQYE 5JQ6H 3IFLL 3ULSA 3DTXA 1RIHH 3EYFA 3K8MA 1TVBB 4ZO7A 1JGEB 4Y4KC 3G04A 3KPOA 1B90A 5FUCE 4PJ9B 2XWBB 4MA1C 1EAPB 1PQZB 3WJJA 1WFOA 4KRLB 3FJTA 3TV3H 4MAUH 3UZVB 2VLRA 1IFHL 3HZKB 1NGXA 3QCUL 4PJCB 4RNRA 3BSZL 4XCFL 1RFDL 2AEPH 4OLVH 4AEFA 1CG9A 1UQSB 5CILL 3EZ8A 1A6VH 4OF7A 4XNZC 1DVFA 4RIRA 3NGBC 1MH5B 2OP4L 4MNHA 4UIKH 3BESR 3TIDA 5AWNH 4NBXB 1NC4A 5HJ3B 4U4BA 4RGOH 4QHUA 2D9CA 2NXYD 4Z7OE 2CK0L 1XGPA 3OF6A 4IHOB 5DD0L 3BO8A 3Q3GB 1F42A 1Q9LA 2ZOLA 5IGXH 3ETBF 5IG7B 3C6LD 1FYTB 5I1GH 1UZ8B 3PWNB 1A47A 4GW4A 5DR5L 3RGVA 1XR8B 3D0VA 3HE7A 2ZUXA 1TVHB 4Y5XC 3BP4A 3QIBC 1U3JA 2P48B 4F3FA 3ZO0A 1SQ2N 4HPYL 3VWJC 2PR4L 3QIBD 3QRGL 4YHMH 5EOQL 3OXRB 1CE6A 1FYTA 4KQ4H 1GOFA 2ZOLB 3H3BC 4H1LA 4I3RH 4P5KB 1JFQL 4PJGF 1YEGH 1DFBL 2VDOH 3QUYA 4XBPB 1IE5A 2EYTB 3HNSL 1BM3L 4MNQA 3SKNA 3DO7A 2H6PB 4M7ZC 5H8DA 1UWGL 3DX9B 1J5OL 4QXUH 5GGUA 3IU4H 4OFKA 4U31A 2P5WE 3MRBA 2AJZA 3OR6B 3SN6N 4BQ9A 3CCHB 1GIGL 1E4WH 1JHKH 3C60B 1FORL 2BVOB 1I1AB 2DJ4A 4DK6A 1T0NA 1JGLL 3IKCA 3KHQA 4KMQA 4U2YA 1JHTA 1PVHA 2ZZUT 1NKRA 4Y8AA 1KEMH 1JZ6A 1CU4L 5IMOB 3QRFM 1A5FL 3GMLB 4MNGA 5MEPA 3TIDB 1MCFA 5D2NC 3ZKMD 4OI9A 4JR9L 5KW9L 3CFDB 5IHUL 2CUHA 4X6DF 4L8DB 2Q8AL 1RVFL 4HHAA 1P4IL 2Y6SC 4PTUA 2XPGA 5AYUL 1FQ9C 4NNXA 3KWWA 3MGAA 1D9KD 1J1OL 4YGVA 3DTXB 3I3DA 2Q3AA 4JJ5A 3EO9H 1ETZB 2NW2B 1H3UA 4ZS7H 4MA3A 3HR6A 2EYSA 2WLYA 3NAAH 1R3JA 3NCJH 1EK3A 2V2TB 2Z4QB 3KS0J 1D5XA 5DMIL 1JGEA 1RZJL 1S7WA 1K6QL 3BN9D 3JVGA 3HR5A 5GGSY 1HWGB 2VDPH 4X9IA 4Z78B 2ORBH 4LGPB 1K4DB 3L7FB 4XGZA 4K3EL 5KSAA 3QNYB 2CDFA 3QUML 4LRNL 5FM8A 2LV4A 3RIFF 3AVEA 3CUPA 5I1CL 1OAKL 1S9WA 1A7OH 2BP3A 1C12B 5J3HC 4UNTA 2Y23A 4OGYH 3VD7A 3N85H 3VFSA 2P7TB 4NRZA 4TYUA 4QWWD 1CTOA 3O9WC 2L4OA 1UM5H 3S4SA 4CW1B 1I9RL 1K8DB 1QG3A 4X6DB 3ULUL 1CXFA 4JFQB 4KROB 3OX8A 3Q6FA 5T1LA 3O9WD 3FHAA 1OW0C 4APQA 2FB4H 3EKCA 2AS5M 2H32A 4EKXA 1FCGA 5T3ZH 3L3JB 3SGDI 3I75B 1VFBA 4PJGA 4PRAB 5C86A 4LEOB 2IQ9L 5IEKA 5K9KA 3B9KA 3G6JE 3FONA 2IQAA 2IH3A 1RJLA 1S7QA 4WTZG 4ODHH 2VERN 5FYJL 4G42B 3O8XC 3D87B 4PUBL 4NDMA 4E42A 2XZCH 3K4ZA 3U1SL 5SX5K 3CFBB 3I50H 1YEEH 5KTEL 1M4KA 4HUUA 3LEXA 4HGWB 4IJ3C 2J2ZA 3OXSB 4UTAL 4R4FL 1D5IH 4HUUB 4XP9L 5EIIA 3DUHA 3G6JA 3QQ3A 2Z93B 3QO0A 4KQ3H 2E7LC 4UQ3A 3CK0H 4JFEA 3WFEH 4NDMB 1T1WA 3RJQB 5CEZD 5LGHH 2PF6A 3OMZA 4JRXB 3VFGL 1CTNA 4AL8L 1NFDE 2BVEA 3VJ6B 4IBLT 1WZ1H 2GJ6A 2VXSH 3UXFA 4OF6A 1SYVB 2EDRA 2MNUA 3NIFE 5F96L 4LSUH 4HIXH 4JDZA 3H8NA 5IW1A 4N90E 3PABA 2GCYA 4XAWH 4GG6B 2G9HA 3S37H 1QSZA 3MJ9H 4OAWA 1RU9L 3FB5B 2YZ1A 2EEAA 4H8WH 2WP3O 4PJBE 1UA6L 3TIEB 4IIQA 2AVGA 2QQLL 2HT4D 3FCTA 4ZSOE 1OWRM 4PJ5E 4WUKH 5EZJB 3OBAA 4G6KH 3WLBA 2J8HA 5BZDB 2BNUB 4R9HA 2ZUQC 3VRJA 1I1YA 4OF0A 4M5ZH 1NBQA 4JN2A 1OTTC 1G7IA 2YD8A 4JJHA 2GTZA 4XC1L 5EN2B 1J1XL 2RCSL 1KPRA 1B4RA 4U0QB 1ZEAL 4Z95H 3LN4A 1YEFH 5JPNA 4LVHB 2R29H 1OP3H 5DVLA 2OTPA 5DUMH 2HFEB 4JHWL 3GHBL 5DQ9B 3JV0A 5T5NF 3D85D 1JGVH 4Z7NE 4YR6A 1KT2B 4BH7A 4PJIF 2VLRE 1MHPH 4GAGH 2NW2A 3RY5A 2WINA 3PP3K 5FYKU 5EO1A 2GTZB 4GW5B 1TITA 5EN2A 3QDAA 5GSVA 5KS9E 2VLKB 3DIFA 1IARB 3T0EC 2F54A 3L6FB 3N9GL 2HA1A 1DE4A 3WLBB 1DQLL 2NY1B 3B5HA 1OAXH 5DHYA 2AXFA 3CFCH 2HAZA 3VDAA 4I2XB 4G9FD 4WEUD 4JFPB 2GSIB 1A6WL 1JHTB 3TIEA 4KV5E 3A0OA 4WWKB 5E8NB 2FLBT 3QHFL 3CMOL 1CD0A 3O4OC 5F71A 4ZG1A 1JK8A 2NY7H 1K3IA 1SMAA 5C0IB 2CR3A 2RJMA 5IWLC 2VDQH 4HK0A 2R2BA 3IF1A 1JIBA 1KN4H 3VXSB 1JPTL 5EBMB 3JSSA 1A2YB 5EULV 4KFZC 1ND0B 2DD8H 3DRQA 5D5MF 4GRLC 1FG9C 1GVIA 4K8RH 2ICWI 3AFLA 2MQCA 1PGRB 3QDJE 1MCSA 5EBLA 1NAMB 3UZQA 5JHDA 1IGCH 3LKPA 5ENWA 3A6CL 3RKDC 1ZTXH 1MEXH 4NKIL 5HY9A 5DR5H 4P9ML 2DYPB 3BGFC 3S7GA 4KJQD 5D7LA 5A1AA 3OJVC 1A6UH 1R5WA 4HXBH 3HE7B 5HHQB 1ZLUK 4GW4B 3CDFA 1IC1A 4P23B 2AKRB 5EB9A 1MFBL 1E4XL 4S1SL 4KRPB 2NY5C 5H94B 1RQ5A 4H20H 1DQDL 2RR3A 3WUWB 1AO7D 3OHXA 3LEXB 4LDLB 4R97C 4PY7A 5TJWK 3FO1B 4OZFH 1NCTA 4JLRB 2DLFL 3S8WA 5C8JB 2DLIA 2HLAB 4FQQB 2EXYD 1YYLL 2A6JB 4P3WA 2VXTH 4KAQL 1JCKA 1C5BL 2EXWC 4P2RA 3C5ZB 4JAMB 3EW3B 2ZSWB 3QWOA 2FGWH 2Y4SA 2P8PA 4EQ3A 2R8SH 2I9TB 2DKSA 5DC9B 4WHYG 2BY1A 4GRMA 4BJLA 4EJ1C 5C2BL 3WJJC 2YBRB 4UDUA 4X6DE 3G04B 3KPOB 4JEGB 3MRGA 1TLKA 1OGTB 3ULUC 1GGYA 2GFBA 3KPMB 5F7YC 3KPNB 4JY5L 1K3ZA 1HXMB 5HDQH 3FMGH 3NN8A 5DGRA 5MI0B 2Y06H 4X6CB 5LGKA 5IB1B 5IBUG 3PP4L 2A73B 4I8DA 3H42L 5A2FA 1VACB 2AXHA 1Z2KA 5F7KC 1RHHB 2PYFB 3K1KC 2WZPD 4UNUA 4XMPL 4M93B 4POZD 3G6DH 3TA3A 1FN4B 3GSWA 3VFTA 2IGFL 3SGKC 3DMMA 1D5XB 3QI9B 5DI8B 4JO4H 1QBMH 3VXOA 2V2TA 5JIHA 1I7UB 1NPUA 4J1UA 2CKBH 1MIML 1S9XA 1XIWC 4MB3A 3BDYH 3LD8B 3QUXC 1ETZA 2YKLH 4FQXA 4XH2B 5I1IL 1N3NB 5BV7B 1IRAY 4JDTH 4TUOB 3WFDH 3N50A 1CL7H 1DQQA 1YJDL 1I9RH 4ZODA 2HJKA 4R2GB 1FZKB 4Y5YA 5TF1L 3SJVB 3AREC 2GITA 4GAYA 2H26B 3QHTC 5DFWH 5ESQA 4KU1A 3IS0X 4PP2A 5F7FA 3C60D 4YDIL 3T77B 2HT2C 5T3ZL 4KHTH 5KSBF 1LEIB 1N6VA 3U6RA 4GKOA 1LP9E 1T0NB 3IKCB 5GSRA 5CGMA 4HUVB 2VTFA 1NLDL 4KHXL 2YHGA 1RUQH 3TBTA 2AJZB 1XF1A 4JN1H 1WEJH 4NN7C 5GGUB 5FYJH 1CR9H 1TJGH 3X3GH 5KS9A 4MJIB 1TZIB 4J6RL 4PLOB 4OCRL 1HE7A 4PGEA 5I1AA 1A1NA 4Z7VB 5KTEH 3ZDZF 4XBGA 3UTQA 3RWEB 5C2UB 5AG8A 5IJKA 4H1LB 4MZ2A 4FFZH 4H0IA 4YHOH 3VXMA 5EBLB 1C08A 1U3HD 1QFUL 2VH5L 4MZ3A 3S97C 1N8ZA 1ODAA 5M94B 1A3LL 5E2UH 1EHAA 4M7JH 3H0TB 4IM8A 3GSNH 1UG9A 5I19H 2O5ZH 5TDPA 1FJ1A 3MRDB 1DUYB 5C0BB 1S3KH 4P2OD 4TSAH 5DJAB 2VR4A 3RGVB 2EDYA 2FHBA 3QXDB 1FBIH 1YMHB 1MCEA 4C56A 4YZFE 4HIXL 1ZLUH 4LVOB 1WIUA 4P2OC 3WHE0 4OBSA 3MOBH 4UT9L 5H2BB 1NMBL 2I07B 1HHGB 4OUUA 5I74C 1ZT7B 1X5FA 4WUUB 1UFUA 3BZDA 5FKPA 4HIIA 4QRRA 3X12B 4OM0H 4HJ0D 3HFML 4KMLB 4R90H 2VRAA 4PP2B 3QIUB 4CMHC 5BZWB 2QQKH 4WUKL 2X4SB 4XAKE 1LO5A 4G6KL 2A9NH 1A3RL 3G6AB 4PPTA 5CLTA 1BAFL 4LHUA 3K2UL 1EBPA 2ZJSH 3GUTB 2WBWB 3OKNA 3RUGF 3V6FB 2IG2L 3RUGB 2ADFH 5MEOB 1IKFL 5E1HB 1IEAA 1UM4L 3GSNB 3RVWD 2EO9A 3W5NA 1MCHA 4XCEA 4YEEA 5E08H 5DJYB 2OL3B 1NEUA 4JHWH 4WHTA 4JQIL 4U1SA 4EXKA 4L4VD 2Q86B 2X4QA 1G7QB 2BVQB 2FJHB 3PGDB 3WS3A 3DMMB 3KPNA 2DDQH 1U8MB 1MJ8L 2L0DA 2ICCA 3QFJE 3TNMB 4N0YL 4YHKH 5CHNB 3S98A 3QIUC 4Z6AT 2DQIL 5EUKA 3V4VH 1FGVL 3O2VL 1JN6B 1RZKC 1RZ8A 2X89D 4ORGA 4XMKL 4LMQI 1VACA 3B9VA 3PDDA 4ACPA 3MR9B 3HZVB 3QUYD 5MHSD 3HNTL 4JRYE 4LSTH 5GS2D 5GS3A 1JNHA 2F74B 3BPCA 2VLRD 1CICB 2ESVE 2PW1A 4WI2A 2ARJQ 4RZCA 1EO8L 1D5MA 3WFHA 2C3HA 3IJHB 3G5XB 4LLQB 3X14B 4PB0H 4U6YA 3I6LE 3V7MA 1RZIA 3B9EA 4WFGE 2R0KH 5EPMA 5CUSL 3ILQC 1T6VN 4JLRA 1MPAH 2GYSA 1UCBL 3W2DL 4GKSA 4OGAC 1VGKB 3F7VA 5F3HA 4FNLL 3QPQD 1EERB 1U95A 5CJXC 1KEGH 1EHLL 5C08E 3ARFD 2Q76B 1ZVYA 4KXZI 4PRPE 4X6EB 1N5YH 2DD8L 5D5ME 4MHHI 2M8XA 1NC4D 4B53A 3F7RA 1XT5A 4M1GH 4JFDE 1B0GB 4PRHD 1ZAGA 5C08B 2YEZA 5KSUA 4MHHG 3VWJA 3MJ6A 2C3VB 1QVOA 4F33B 3HUJA 3O2DA 4R4BA 2DYPA 2X09A 5CSZA 5IBLC 2M2DA 1YEIL 3L3IB 3STZA 2YS4A 2R2EB 3MRHA 3DHMA 3Q1SH 4LLAA 5CMAA 4LPCA 1SVCP 2JIXD 2OR8A 1T2JA 5I2IA 1GGUA 4U1MB 1IGTA 2AJVH 2P8LA 4X5XA 1R5WB 1UVQA 2IQAB 2ADGA 1J87A 25C8L 3AAZA 4M4RA 2N7BA 3CVHL 4PG2A 1CGSL 1WWBX 2EYRA 4UQ2B 4HEPG 3F58H 4YFLI 5CEYA 4G8FA 1JPGA 4LAQL 4G8EA 2LQRA 2W91A 4RMUA 1KPVB 5ABDE 2P24B 1GH7A 3RVTC 3IDIB 2G5BA 3LVEA 1SJHB 3EJZD 3G5XA 5GIRB 3V52L 3VWKA 3LSOB 1U2HA 3PWPA 3L5IA 4I2XA 4D94A 1UM6H 3O6LL 5K9QG 3OPZH 3V6ZA 4U6XB 4QRRD 3GMQA 5INDA 3UC0H 3MFFB 4WWKD 5IMLB 2UWEA 2R8SL 2X1OA 5JIPA 5JHLH 4FQ1H 2E27L 4JPIA 4CL7A 5E6ZA 1RZ8B 1SEQH 1L6XA 4GW5A 1FP5A 1S7TA 3SDXB 1KLGA 5DRNA 1WCQA 4Z78A 5I0DA 3FO0H 3QI9C 4Z7VF 4NQDA 2BFVH 1BOGA 3WNOA 4ODVL 5I73C 2X4QB 3SQOL 5F1IB 4LKCB 3JVGC 2CDEB 4PYHA 2R39A 1EGJH 1QNZH 5F1IA 3RIAF 3NIDE 5D8JL 1TPXB 5B8CC 2B1HH 2UV3A 1BLNB 3H42H 4O9HL 2BC4A 2NW3B 3BAEH 5FDWB 5C3TA 1NGQL 5CJBA 4X7DC 2HYMA 4YHZH 3MQIA 1F13A 5GGQL 4U1KA 1IGFL 3KJ6H 5HI3D 3T3MF 1EGJA 4OZIE 1P6AB 4M43L 5HI5C 2F54E 2UWEE 4P23D 4E5XA 4JY6A 4UT7L 2KQMA 2NY3D 4CVZA 5L6YH 4WGWB 5MEPB 5C71A 3KNBB 2V5YA 2B4CH 1AO7B 5I8KH 4I0CC 1EXUA 1KELH 3IGAB 1F3RB 2FIKA 2BHUA 4PJBA 3UTSA 3C60A 5KSBA 4OAWB 3E6HB 3PGCA 4MA8H 3TBSA 5DO2D 5MERA 4WWID 3MRBB 4PIRF 3MRCB 4DFIA 3MUJA 1KJ3L 1UEMA 3VD9A 3NIFF 1ZK9A 3LH2H 5DJAA 4HG4J 5KJRH 4WTWA 1WISA 2OR9L 1NL0L 1VADA 1VKXA 1L7IH 3GZKA 3QISA 4OZ4A 2BNRD 4GKZA 1KENL 4RFOL 4HS6A 4LLYB 4YDLB 3G08B 4YHLL 1N8ZB 2BNQD 2F5BH 3BGFB 5B3NA 3VGEA 2GCYB 4K07A 3P9LB 2XY1A 1AGCA 5EC1A 2G60L 4V1DB 2UUDK 3MUZ1 4O02H 3ARBC 3UTTA 2GJ6B 5DJ2A 3MRIB 1OAYH 1CL7I 1CIUA 4QOKD 5KG9B 3FRPA 3GGWA 1X6NA 5FF6A 3S5LG 2D7QA 3RWFB 3C09C 3SBWC 2VKXA 3MJ8B 1KNOA 1F4WL 2WBKA 3IJYA 5GPRA 1XGTA 3ZE1E 5E8OB 5CEZH 4HZLA 4PJXB 3RZWA 3QHZL 4WO4B 4NC0B 4I9WE 1AGFA 2I26N 1OQOA 3IB4A 1H9VA 2HKFH 2IBGA 3PDGA 1P1ZB 1SJEB 5A2KH 2X44D 2IPKB 1ZS8A 4IRSB 4R6UA 5IQ9B 1NJ9B 4ZNCD 1KV3A 1M05B 2UWEF 1IAKA 4MJIE 1U92A 1MCDA 2SEBB 3ARUA 5BO1H 2VMFA 2IF7A 1DLFL 4P5TA 1JGDA 4YE4H 2KKQA 5F88B 4AZ8A 3DI2B 4YXKL 3BPNB 1NUDA 4WHCA 2F74A 4QGYA 4TQEL 5I75C 2X1WL 3PJSA 2A6DA 4NQDD 1R5IA 4OCSL 3RZCB 1EHXA 3WJLA 4ONFL 5B39A 3B2VL 2XWBA 1BZQK 2AJYH 5IMMA 4ZTPL 4PGZA 3BKYL 4XB7A 1WUNT 4YC2B 3EYFB 1MWAL 3FT2B 4LPWA 4G80A 5JORB 3SO5A 3TBVB 3HG1B 1RJCA 1FPTL 4AIXA 1Q8MA 1OAQL 3PWLB 3IJSB 1A7BA 3W5MA 2QKIA 3T65B 3KPSD 1ZSDA 1FV1A 1TPXC 4Y1AE 1DBKH 4P2YA 2DMKA 3MODH 5DVKA 5GGVH 4D9LH 4RGMB 1C5CL 3SE9H 5MEOA 3U7WH 4XPAH 4NJ9L 5GRUL 3MV9E 2NX5B 5F21B 2FH8A 4IDJL 4HGMA 4FFYL 4KTEL 1XF4B 4JKWA 4DUXA 1MCQA 1WAAA 3IFNH 1G7PB 8CGTA 1D5ZA 4X9GA 5ITFB 4HV8B 5D6DA 1B9ZA 3QAZC 1FH5H 2W0LA 4ELKB 5IEHB 1M6OB 3HNTH 4LSTL 5IBUB 3VFPA 4N8VA 2O93L 1U8QB 4WIQA 1MIEL 5IWLA 2FBJH 4P46D 5D5MA 3PV6B 2DKMA 5ADOL 5C0BD 4HWEH 1T7YA 3PL6B 5D6CA 3HG1E 4ALAH 4F57H 4JHBA 3RDTC 3MLZH 3QXUA 4QT5B 4PJHA 4OGZA 4FQCL 1H8SA 2FEEL 3OHXB 5IMOA 3NFPA 1HWHB 2HMIC 1A0QH 5GISL 3OJMB 1X4YA 1UCBH 4O5LH 3W2DH 1DQJB 2GI7A 2W65A 5JNYB 2AEWA 2BVOA 1FO0A 1NDGB 1YMME 2VZUA 1P53A 5BV7H 2AKRA 3BP6A 1HH6B 1I8LA 3RWEA 1IC4H 2QADD 5CGYC 1YY8B 4LPYA 1Y18B 3R4DA 3MCLH 4YXLH 4GS7B 5FECB 4MXWH 2OK0H 5HYFA 5LXGL 2AV7B 2PTTA 4PBVC 4PR5B 5I15L 4OZFG 1KCSH 1JGUL 3BO8B 3Q3GA 4DUVA 1JBJA 1WZLA 4LIQH 1WBXA 2V9QA 1C5DA 1QFHA 4MX7B 1HINL 4HBQA 3IAPA 3M1BA 1E6OL 3VGBA 1TFHA 3QEGL 4PRIB 2F9BT 2IMNA 4U1GB 1KCRH 3LS5H 4F3FB 3GI8H 4RISH 4OLUL 4IRZH 3T0EB 4YLQT 3O45A 2VISA 4NQSA 3EFDH 3NCYP 3P0GB 3ZSTA 5IB4A 4U3CA 5TPWH 4F7PA 4GG6F 1F6FB 4ZAKB 1DTUA 2XWTB 1U91A 3SE4C 4GS7C 1WSST 1PY4A 4XP4L 5J89A 1MFAH 1IEBB 3BZ4B 1ZGLM 4I77L 3CC5A 5IESL 4MNHB 3P11L 1S5HA 4MJ5A 4PLNC 4QXTA 3FFCA 3O9WB 4HJ0C 2R56L 4Z7UA 5D72H 2VLKA 2DN7A 3QEUB 3GMRB 4WTXA 3KXFE 4ERSH 2IALB 1EIBA 1AH1A 3OKMB 1FO0L 2NR6C 3CC5B 2ADJB 4MDIB 1BLNA 3UX9B 4YAQA 1BWWA 4O51A 3RWDB 3O6FA 4PV9B 5CZVH 4UINL 2BFVL 5T3XL 5FCSH 3RI5K 3B9DA 1FL5A 4GJTB 2EDLA 5D7JA 2B0SL 2FEDC 4MLSA 5DRNB 1JMZA 5FYKL 2PO6B 3I02B 4UBDC 4O9HH 3EGSB 4OCXH 1KYOJ 1PG7X 1DCLA 2JK5A 4LP5A 3QDGD 1T7VA 1SY6H 3RL1A 1I3VA 2VXQH 5HHVL 4OCWL 3E1F1 2X1PA 2HTKC 3S36X 1FL3A 4AIOA 3MXVH 1R3IH 2FECL 4FTVA 2KL6A 4JO2H 4XNMA 5FAAA 4NWUL 3N1FC 2I5YL 2Y7QB 3JV4A 2OZ4A 2JKXA 2PTVA 4V2CB 4BH8A 3D69B 4WNQA 2DL9A 5DMKB 4IIQB 1FE8L 2B4CL 4OV6F 4QXWA 5C09A 4ZTOL 3MRFB 1OGAE 1KTLA 1RIHL 1NMAL 1S5IL 1QLRA 4HFUH 5CBEB 1DANT 2QTEA 2CRMA 2CXKA 4ENED 1L7TL 1NDGA 5IOPA 4NQCB 4XT1C 1Q0YL 1FG2A 2YC1B 3UEZA 2MCPH 5E5UB 4MJ2A 4H8WC 1G1YA 3NMEA 3C6SB 5HHMB 1P4LA 3DUSB 4XBEL 1UEYA 4RMQA 1HSBB 3MV7D 4H25B 1OAUH 3L3IA 3MRMA 4OT1L 3VWKC 3DV4A 5JLZA 5EBGA 4D2NA 2WP3T 1ZHKA 1AHWC 4KUZL 4P4KA 1ZHBB 4OB5H 2YN5A 1B0RA 5IBLD 1IM9D 4PJDA 5EOCJ 1QO3A 4YDJB 5DD0H 4YEFA 4L9DA 4NNYB 3HC4H 3SCMC 1I8IB 4WEBH 1YN7B 3MTRA 4NOBA 1Z0MA 1G0XA 4NN5C 1C16A 5DQDL 3UROR 2AK4A 2P5EE 3LPFA 1QHOA 2ZG3A 1FZOA 1LO2L 1KLUB 1RZFH 1CLYH 2F19L 5TH2B 3TJEH 4WGVB 1X7QA 2HRPL 3JWDL 5HVGB 4EXPX 4XNQB 2CK2A 4S10A 2GT9A 2X4OA 4GSDH 2AABH 3UZEA 2XKNB 4WU7A 5HGAA 1F4HA 3Q6FB 1BJ8A 4FTVD 4X6DA 3BP7B 3UJJL 3F62A 5FB8A 2EH7L 2ICWJ 3EJZC 4G9FB 5CJOL 5BO1L 4XXCA 3W39A 4X5WB 1MHEB 4NC1E 1EEUA 1R5VA 3FQRA 3SE8L 3FT2A 3UYRL 4FOMA 4BZ1L 3OSKA 5H37G 3ZE2E 1TZGH 2D7NA 3FB8B 4ONFH 3RUGE 5EO1B 1VSCA 4R26L 5MENE 4MAYD 5J12B 3PJSB 3UBXI 3GSOB 1KUMA 3U83A 5F1NA 3W39B 1G7QA 1A7PH 1T21A 2UYLA 1U8NA 3FO9A 4KPHL 3V5DA 4L8BA 4V1DE 3NFNB 4ESKA 5I8CB 2L7JA 2Q8AH 1ZGLP 5IHLB 2GT9B 2X4OB 4PJIB 1A4JA 1MVFA 3EO0A 5B39G 5IMKA 1FZJA 4XNUH 3RNQB 1UKTA 4JO3H 5CZXC 2YWZA 4JPVH 5DC4B 3QDMD 4I5BB 1J0IA 3C87A 4RFNC 2HVJB 4XCNB 5ICYB 1OAZL 4EN3D 3NCJL 2AJUL 4P59L 4RAVB 1UZ6E 3MJ8A 4Q58C 4RGNE 3GB7A 3P3YA 2AJ3A 1VPOH 4AMKL 4G5ZH 1AQDB 5SV3A 2OMBA 1UKSA 2CLRB 3VFMB 3JZ7A 3TPUA 3MRIA 5HYSG 1RUMH 1XF5B 1RULL 3C6LC 1LD9B 2OZ4L 2F8VA 1AGEA 5L88L 5DEGB 3LV3B 4Y0GA 2Z31C 2LU4A 4GRWE 1DUYA 1AKJD 3ARFC 3KYAA 4U6TA 1FLRL 3GI9L 4UMGA 4P5KA 3CNKA 4M1CD 1PYWB 1A0QL 5GISH 4EQ2A 1T1XA 4LSRL 1FVDB 3H9SB 3NOIA 4NRXA 3GHEL 1INDL 4X8XA 1W0VA 4FP8H 4TOYH 2FATL 5C0ND 1MCIA 4N5EC 3ZYOA 2R4RL 4OZIA 1KB5L 1T5WA 5INCA 5GJTH 4P2CG 5AZ2L 3MLRL 2XI9A 3V8OA 3RY6C 1HIMH 5I1DA 3DSFL 3RWJA 1VGEH 2VR5A 5H35B 3F7YA 4ZAKC 5EU6D 2WBJA 5IW3A 1IM3A 3TN0A 1PSKH 1I1RA 3VGDA 3QCUH 5ESVB 2VC2H 3BEVB 3DX8B 3RI5F 5HYSB 4U6HB 1D5IL 4YDVA 3O3EA 5TFSH 4RISL 3VH8G 1MQKH 4KZDH 5C0GB 4LGSB 4UIKL 5C09E 2MFNA 3FB6B 1KXTB 4CDGC 2JE8A 3QDJA 2X1XR 4M7LT 4XVSL 4O51B 1R24A 1UACH 3GK8H 5DK0B 4X6BB 1T1YB 4K2UL 2IALA 5EOTB 4JRYA 3TPKA 1ZT1B 3ALWA 3VFWB 2VZSA 2CDFB 4JKPL 4U49A 1T04B 5D72L 2E7MA 5BQ7A 4QXTB 4AQOA 1FN4A 4H8WL 3C2AL 1A9EA 4OLZL 3AY4A 4CUCA 5KVEH 3QG7H 1A9BA 4G9FA 4DZ8A 2V9RA 3QWRA 1QSFB 2PYEA 3OKOB 1TETH 3IXTB 5AD0A 5F7EL 4CN4A 2VAAA 4N0CD 1MJUH 4OJFH 5K59F 4NRYB 1PZUB 3RPKA 2BSRA 4MJ6A 1OGAD 4QHLB 4CAGA 2WM0A 5CEYB 1WZMA 1IGJB 3R0MA 4RWYH 4WO4C 3NA9H 2QQNH 5FOBB 3ZTJH 4POZC 3VXUA 1CD1A 43CAA 1OSZB 1H8OA 2P43B 4X7TA 3VXRA 5BOPA 3HE7C 4NQEB 4NSKB 4UUJB 4XVTL 1S9YA 2FX8L 3MO1B 4NZUH 2R2EA 1QSFE 5GGRB 1RAMA 3TGXA 4EDWL 4JO2L 1OARL 4C83A 4NWUH 3L7EB 5FECA 1GC1C 5C0CE 1L0QA 3K4DA 3MGTB 4ZTOH 3CU7A 1QRNB 1P7QB 3S34L 4OZFA 3QA3B 3FO1A 4LLUB 1DQLH 4Z76B 1T3FA 4GMTL 4JM4L 3SPVA 1VDGA 4KKAD 3MUHL 4XWOD 2C1OB 4ZFOL 3OG4B 4Z18A 1ZHLB 3UP1A 4HKZA 2W0KA 1DBML 4G8GE 3C6LB 4M62L 5DURD 3K4AA 1NMCC 1K4CA 4K7PY 5CILH 2A9MH 1E4XI 4I0PA 2IAND 4LASH 4ETQA 4G6JL 3TBYB 2VLJB 4GLRH 2DRUA 4ZQKA 1KIUA 1JPFB 1OAUL 4Y2DA 1DJSA 2NPLX 3NCFB 5K93A 2ENSA 1JVKA 4K8RL 4O2CB 1FNEA 1I1FA 5HDLA 4M7ZB 1U93B 3GMOB 1PZ5A 3L3HB 1XEDA 3HS0B 4QHUB 1CXKA 1IGMH 1IGCL 1KB9J 4I3SL 1CK0L 4U6VH 1HHHB 2AEQL 3KLSA 3P30H 5EBMA 1VENA 1G7LA 1G7HB 1MEXL 1I1AC 1XF4A 5DC0A 1IZKA 3LKNA 5TDNA 3ULUF 1OTUC 1LO2H 1RZFL 2R1XA 4M00A 5SWSA 4QLRA 3UTSD 1I1AD 3FQNA 2HRPH 1B6DA 4LSPH 5IFAL 4UZGA 1XCTB 1HHJB 4OLEA 1I7RA 4NFDA 5E8NA 1YEKH 3QNXA 3EYOA 2H2PD 4GSDL 4KI5F 4X6BA 4F2MA 1IEAB 2VLRB 1OP9A 1RUKL 4H20L 4POYA 3UTSE 2I24N 5KSBE 3WSQH 5ID1B 5HHOA 1JFQH 1QUNA 4A6YL 4ODHL 1UYWL 5I1JL 4UTBL 1OSPH 3CX5K 3TF7C 3FB6A 1G6VK 3MXWH 3BUTA 5C0GA 3TZVC 2EZ0C 1FVCB 3OGCB 4XP6H 1ITCA 1LHZA 3CZJA 3MLVL 4PJ7B 2WLZA 3CH8A 1YPZF 5CS7A 1ZLSH 1KIQA 1AHWA 4DVBA 1OCWH 4H88H 1GZQB 4LNRB 4HKBB 2ARJB 1JUFA 2XFXB 3QUMB 4NM8L 1J7VR 1CU4H 3MRKA 3TO4A 1OT1A 4ZXBC 2PUQT 4NQXA 4WY7L 3CIQA 3QO1A 4UIMB 3RVWC 1UZ6F 3RL2A 3VFGH 1Q0XL 2PKDA 2H8PB 5KSAD 4AL8H 3CD4A 1SYSB 3VMNA 4Y4KD 2XXMB 2APTA 2PN5A 5F96H 5EU4B 3NCBB 1A6ZB 4OLYH 2R2HA 2G75B 4D8PA 4WV1C 1SBBA 2GUOB 5EU3A 1DLHA 4XZUB 5HVHC 1C5DB 2VOTA 2F53E 4ZS7L 5TQ0H 1RU9H 4TTGA 4LPTA 5T3XD 4IIQC 2D0FA 8FABA 2O61B 1I9IH 4GXUN 4YHIB 4X4XA 4CVWA 4YO0B 3GRWA 4R0LC 5EUOF 4XBGB 2AV7A 3UTQB 2Z8VC 3FCTB 4MXQC 4YBLB 3T0EE 5JMRA 3MUY1 5AG9A 2XQYG 2CO6B 2VN7A 4MJIA 3KXFA 2CIIA 1ROWA 2IGFH 2VDNH 2WSKA 4K3EH 1AGCB 4JO4L 3SOBH 3CXDL 4BUHA 1Z5LA 3RKDD 1FVDA 2MHAB 5DEZA 3C6LA 1A7OL 3IAGC 3UBXG 5D2NB 1KJ2A 3N85L 1MI5A 1X5YA 1PKOA 2XZQH 2NY4B 3QCTL 1KGCD 3QPQC 4YBQC 1EEZB 1U9KA 4OZFB 1CL7L 4TUKH 15C8L 1YJDH 4QRTB 3RA7H 2UVFA 2P5WA 3LV3A 1S7SB 3G6JB 4YXHL 5JXED 2BOCB 3PQYB 3TBSB 1P7KA 1Q94A 4S0SD 3T3ME 4ZYKA 1I9JL 5I66A 5SX4H 3J8F7 4E42B 2ZG2A 2PXYC 4EIGB 5FO8B 1OTSC 1BECA 3MLSL 1RUPH 4GRWB 1H8NA 1OAXL 3TV3L 1QRNE 2XYCA 4ONGH 1WEJL 3HE6A 3OV6A 1CR9L 4KRNA 3I50L 3QQNA 3ABZA 4XCFH 4OCRH 3TA3B 3REVB 1WICA 3P9MA 2BSRB 3IDMA 4MJ6B 4KK6C 1N2RA 1WWAX 2DBLH 4KI5D 2BC4B 2NW3A 1IL1B 3D9AH 3ZKXB 4YJZL 3T8XA 2ZCKH 4PJAB 1YN6A 2DQTL 3V5DB 4YHOL 5IBTL 5HHME 2Y9RT 1OF2B 5AWNL 5C09D 3C5SA 2VDML 3ULUD 2DM3A 2IAMA 4MWFB 4U1LB 3GM0A 1BOGB 4YWGL 4JREB 1LO3H 3GBLA 5I1EL 3CSYB 1EPFA 1S7XA 4PGCA 5BQ7B 2FYYA 3HRZA 4XPGH 3GIVA 4Y16C 3OWEA 5DUPH 3FO2B 1ZTXL 4WFEE 2BNQE 2RBLA 2VDRL 5EU6E 2YPLB 2B2XL 5HVFB 1X7QB 4JKPH 3O6ML 3EJJX 3AS1A 5GS1B 2PTUA 2BJMH 4QRSA 1X5IA 1J12A 2MKWA 4LLVB 4KQ4L 4F9LA 3ILPB 3O8XA 4ORZC 4HFWA 4I3RL 3H9SD 3MUGB 3VFRA 1SBSH 3O6FD 3QQ9D 5L9DL 5DJ0A 4Z7QF 3SHSA 4LLMB 3U46A 4QOKB 4NNXB 3IU4L 3PQYA 5CD5D 5E8OA 4DN4H 1YN7A 5E0QA 1P4LB 5F6HI 3QFJB 4P9HL 5IHBA 2NY5L 2APWA 4O00A 5HI5D 3IVKB 5HHQA 4GXVH 1JHLH 1KEML 3UO1H 3MYJA 1T5WB 5FA4B 2FX8H 5JIIA 1MJ7L 1YNLH 3DV4B 2DM4A 4I48A 4IRSD 2C7UA 4LSQH 1MF2H 3OJDB 4AG4H 1BOYA 1RZ7H 1T1XB 3MRLA 5DO2C 3MLPA 3RBSA 3NBNA 3S34H 1T20B 5TDOB 5JOFB 4GBXA 5J1SC 5JR1H 4GKZB 3PWVB 2ADIB 4Y8DC 1WC7A 4FFVD 3NAAL 2DQGH 4RX4D 1NSNH 3QHFH 2GJZA 2C7UB 5MERB 1HILB 1MRDH 2NY7L 5J13B 2EE6A 1KTLB 2XICA 1P4BL 2ZOKA 4I0PD 4M93C 3PDOB 1B6UA 2E8YA 4ZSOA 4XNXH 4LASL 1J0HA 1T4KB 3BN3B 3DURA 1AXIB 3ARDB 3RZCC 3HI6L 2EIZA 1FNSL 1FL5B 1QPXA 3KPSB 4JHAH 3UYPA 5IVOA 2W60A 1J0KA 1IAIM 2YKLL 3O41B 4UOW1 1GAFH 4DW2L 5B22A 2X4PA 2FR4B 3NCCB 1RJZB 4I18C 5FDWA 4P9MH 4W4OC 2FB4L 3E8UL 3SDAA 4DZBA 1TDQA 4LFHD 5BS0A 1FLTX 4LCCB 2UYLB 4F15B 4FTVE 4NQXB 4IJ3B 4LKCA 3MRKB 4QRSB 4WWKC 1OLZA 2ARJA 1JYVA 1CDJA 2I60L 4S1DD 4EI6A 5D96C 4PJEB 4QF1A 4RMSA 1MUJB 3T2NL 5J1AB 3EYOB 3WSQL 2F53A 2ATPB 2P5ED 1UYWH 4L8SA 2X7LA 5DJZA 5EO0A 1JWMA 4CDHA 1TJGL 3LAFA 5GHWH 1S7XB 4DCQA 3K46A 3KPQB 2W0FA 4KK9D 1UADC 3AXLA 5HHOB 3KPLA 3WIHL 3I6KA 3F6IA 2H41A 1NBZA 2CRYA 4PGDA 3KJ4C 5CSGA 5FCUL 1JWSA 4OCLC 1I3RB 4MJ4A 3HMWH 4LKXA 4HT1L 1IAIL 4P5MA 5DURB 4YX2L 3PXJA 2UZYB 3VD4A 1LNUB 3BX7C 1EHNA 5D7LE 4BZ2H 3PABB 2ZPKL 4G7YL 4GAJL 5GS1C 5K9QI 4PV8B 3ARYA 4DKEH 1TQCC 2ADGB 4ETQB 3M8OL 4JY5H 4PRPB 3M1BB 1IAOA 2VLLB 4L1DA 2IPTL 1B3JA 4NNYA 4ODXA 2F53D 1EGJL 5C0FA 1UA6H 3PP4H 2VZ1A 2YPKB 4EI5D 1XGUA 3MRHB 2W65B 3HFMH 5D1ZD 2O5YH 4M1DH 1UENA 43C9A 4EI5C 4YPGA 3G6DL 4WI7A 4F33A 3U9UA 5DRXB 1RJYA 4LK4A 5D93B 5EWIH 1Y18A 1AXSA 3RFZC 1GC1L 4GRLA 2DQHL 4P3CL 3BP6B 4I18B 1QBML 1MY5A 2ZJSL 5D2LF 1OP5K 3LOWA 2IG2H 4OZGB 1R0AL 1MIMH 1R3HB 2FJFB 2NY0D 3ECBB 4KK5C 1NEZG 1IKFH 2R29L 1UM4H 5IOPB 3K74B 1T03H 1I7ZB 1XGUB 5GGVY 2CUIA 1TNNA 3JTSB 1W8OA 1JGVL 4C58B 3TCLA 5D96B 3N1PC 3I85A 4JM2C 4J3UA 4QRUA 4M6NL 1RJYB 4NGHL 1H0DB 5LAXA 3BDXA 5EOCL 1Y0LB 1QLFB 1EMTH 4YXHH 2HLFC 2IBBA 1CBVL 5DDHA 3S35X 1KYOK 1N0XL 5BMFH 1YEDA 2NX5E 1TIUA 3JWOL 2E3VA 1T2QH 1EEQA 3IXTA 4PREB 2BNQA 4GAFB 4HUMB 4X5LA 1G6RH 3CFKA 1ED3B 3SEPA 4HAFA 4HGKC 2VDLH 5KSAB 1A6AA 3L7FA 4UT6L 1CS6A 3KYOA 2VQUA 3BT2H 5B8CA 1KBGL 2ESVB 1BQLH 4S1QH 3ZDXE 4ZXBA 4L8SB 3FN0H 1P9MA 5T1DL 3TESA 5T33H 1F4XH 2CKBB 2DBLL 3JV6A 3QNZB 3UDWA 4LF3B 1KN4L 4FNLH 5A40E 3WHE1 3BGMA 1T1YA 5K9OA 1JUFB 2M1KA 2XFXA 3QUXA 2FL5B 4OD1H 4MDIA 3UTZB 3KPLB 1J8HA 2C5DC 4M7JL 3OKMA 4PJEE 3GSNL 3QDJB 5I19L 4GQPH 4A6YA 3I9GL 3BFOA 1PBYA 4RGND 4JFYA 4HUWB 1ADQL 4AEEA 5IMMB 3ZHKA 4JZOA 2R1WB 4HHAB 5T3ZD 1U8OA 4G8GD 4QF1B 4UT9H 4K71B 1HDMA 4JFOA 2FO4B 3GMLA 2VDRH 4MNGB 4YE4L 4O4YH 3SDXF 3C9NA 1F45A 4RSVA 4XXCC 1QP1A 3BD5A 1HQ4B 2EDHA 4HQQL 4JPWL 1KNOB 1LP9F 4Z8FL 4ELMF 2R69H 4ELMB 2VISB 4MAYA 4JZJB 3TP4A 3OAZH 2OM5A 2NCMA 2W1NA 2VITA 5DHVA 2D03H 3K2UH 2PCPB 3HNVL 1VERA 3HRPA 1KIRA 3TC9A 1AGFB 5ALCH 3INUL 1CICC 1GGBH 5EC1B 4XPFL 1MWAB 5HYQA 3LS4H 4HC1A 3O3AA 3UPAA 1C5BH 2WQRA 4H26B 3C8DA 3TT3H 3MV11 3O8XD 1CFTA 5LGJA 3DWTA 1WC7B 3MODL 3GSUB 1C5CH 3SE9L 2D2OA 4P9HH 4Y2DB 1GHFL 1X5AA 3UTPD 4PGEB 2AK1H 2F8XC 2DI8A 1MJ8H 1GOHA 2Z92A 4PJFB 4N0YH 4YHKL 3ZT5A 2KDGA 1XR8A 1HH6A 2HMID 4QCIA 1ZE3C 4AEIH 1LO4H 3O3BB 2EECA 3MACH 1TNMA 5ANMB 4JCLA 4LBEB 2X5PA 1K2DA 2P8MA 5TQ2H 3G08A 5B38B 4L4JA 2ADIA 2Q7YB 5ISZA 3GMMA 3S4SG 5JW3L 1CI5A 2Y1VA 4WW1B 2GIYA 4BQ6A 4ZUVB 4M8QA 1SEBA 4K55A 5CINL 3MYZA 4U0RB 5D8JH 3ULUE 3FFDB 4GW1A 1M7XA 4P4KD 3HAEH 3TWCH 5DSCB 1B0WA 4OZHF 2R15A 2V17H 4JQXA 4PJBB 2FRGP 3QBTB 4TUOA 4BQ8A 5ETUB 3BPOC 5FHAL 3HZKA 4ODSL 1KG0B 1QLEL 3NTCH 4K3DL 4M43H 4ZD3L 3H9YA 1Q9OB 3NFNA 4Y4HA 4PJIE 3SO3C 4PYGA 1WBYA 1OB1B 2IAMD 1IAMA 4UI2A 5D71H 4X4YA 2WUBH 5IVZB 5HDOA 3WFDL 3L3DA 3BIKA 2ZNWA 4BKLB 4K7PX 2YPLA 1W0WA 3SDXA 2FWOB 3QUKB 4MA8L 1BGXH 3TVMA 2QHRL 1ZA3B 3PWJA 2A6IA 4P2QB 3SDXE 3WIIL 2UUDH 5FYJU 4S11A 2IPUK 3Q1SL 4KI5C 2W38A 1GZPA 3CZFB 5IMLA 5I30H 3CSYA 3VRLE 3N0PB 4IEFB 4ODBD 1E6OH 3DARA 1F2XK 5F1NB 5K33A 4N0UE 2XIDA 3NACH 1IQDB 3LKSA 2EC8A 4GQ9H 4LARH 4X98B 2ICEA 3MFGB 3FO2A 3RVVC 1GCFA 5CP7B 2G60H 4NN6B 5SWZD 3HC3L 4PJDE 2VITB 3QDGE 2XQYK 4KGLA 2DKUA 3V0VB 2FJGA 3UAJC 4N68A 3P77B 3HLAB 3ZHLA 1C16B 4K7PH 4KMTH 4OZHA 3LSOA 4CU7A 2DBJA 1DZBA 4JG0L 3TO4D 3REWB 1RPQA 4MS8C 5ITBH 1A3LH 5E2UL 2HLAA 4FQQA 1KG0A 4QXGL 4XNQA 4GG6A 3P73B 3D3VA 4G8EB 1E0OB 3V9FA 2VLKD 2IH1A 4KKBC 1WFUA 1V3LA 1VEPA 3ZE0E 2CIKB 1FBIL 3IDYC 1YMMA 3R1GH 4TSCH 5CZXD 3DUSA 2P8LB 1H3VA 5I6XC 5IIEA 4U1MA 2VQTA 3PWPE 4UINH 3STBA 3HUJF 3GBNL 1BBDL 4YDJA 4JFDB 1WGOA 2X42A 4Y4FB 4EN3C 1HNGA 3WXWH 3DX6B 3SKOA 4PG2C 1G7JA 1VEMA 4BFEA 3QYCA 1BJ1H 4POUB 1NGZA 3BH8A 1S8DB 3M17A 4HUXB 4PJHF 5EORL 3W0WD 5J57B 4J2XA 2BXYA 3VXSD 2FDBP 3C6SA 4EBQH 5D70H 1JGLH 2IJ0C 3FAWA 3KJ6L 1YEJH 4XMLL 3AUVA 4K23H 1K8IA 5KS9F 4I4WA 4BH8B 2BNQB 1TJHH 5DMYA 3F7VB 5F3HB 4OD3H 1KELL 1KJMA 1T03L 4G43B 2GEEA 4H1LH 5C0IA 3VXMD 1LD9A 5DQJB 3P0VH 1LE5B 5JOPE 3EYUL 1KJ3H 5F6IC 5DJXB 2P49B 1EXUB 3IGAA 3MLWH 4XTRC 3IFNL 3TNMA 4PJ5D 2GSIA 3BQUA 4LLDA 1JMXA 3O2VH 4CW1A 1EUUA 5J11C 2HG5B 4O58L 5LVEA 3SCMD 3PGDA 3WS3B 1RV6X 3D39E 5BRZA 5ACZB 4FQPA 1RZJH 1QBLH 2X40A 5I17B 3MOAL 3JWOH 2NXZB 3QUZD 3CUPB 3WL9A 2ORBL 1R3HA 2FJFA 3ECBA 5DFVD 4YAQB 5HYJB 1J8HE 1YC7A 4ORGB 1OGAB 2FIRT 2R2HB 3KYNA 3AS0A 2CO7B 1PKQE 4JE4B 2DLHA 1AP2B 1LEKB 2WMPA 2Y07L 3ZDZE 1H3TA 5BCAA 3GSQB 4KUZH 1A4JB 7CGTA 5IW6A 2LAAA 4OB5L 2R1WA 3BGAA 1JYXA 5DRXA 5I8CA 2EDKA 3S35H 3WN5B 3MRJB 1A7QL 2NY2D 1J88A 5BXFB 5ACMA 1UM5L 3FN0L 1JYNA 2IC2A 1P9MC 3ULUH 4RDQF 3GSOA 1CT8A 4Q2ZA 1G0YR 1GZQA 5C0FB 1NCCL 5F1OB 3V6FA 1CD9B 5F9WC 1S7TB 4QTIH 3PV7A 1PKQA 5A43C 5MI0C 2EC9U 3JV6B 3WS6A 5IKCB 5CJQL 5DVNA 1S78D 5IQ7H 5IB4B 1LK2B 1ITBB 4QHKJ 1Y6MR 1ADQH 2IADB 1QRND 5TDNB 3MFFA 3FT4B 5HGBA 1HXYA 3QUXD 3AMLA 3OJ2C 4F8QA 3RPIA 4NPYA 2I07A 1SJHA 2BK8A 4AY0A 3HZYA 1NCWL 1EA9C 3CCHA 4E41A 5HDBE 3BEWA 4W6YB 1JTTA 3MJ7A 4Y1AD 2YR3A 1NC2A 4PR5A 1XZ0B 4C56B 3EHBC 4HQQH 4JPWH 5J6GA 1MQ8A 1MCKA 1YNKL 4Z7UE 1FDLL 1GGTA 3F58L 1Z6JT 2XA8H 1BVZA 3KR3H 1H0DA 2DLTA 1NEZA 1FZMA 1WK0A 4X5XB 1BZ7A 3GJEB 4YHPA 3RRQA 2A77L 1DR9A 1K4CB 3INUH 2JLLA 1I8LC 4QRPB 1B4JH 2IMMA 4UQ3B 3V6BR 4L9LA 3BHBB 4PY8J 4HKZB 3WYRA 4FMKA 4KZEH 5IESH 4NIKB 4NWTH 4L3ED 4IRSC 1N64H 3P11H 3DVGA 4R2GD 4YZFF 2APFA 4H25A 4OD2B 1N59A 2AK1L 4R2GC 5TE4L 1CYGA 2ESVD 3ARGB 4LQ1A 3SJVA 1AP2A 4FXKA 3T1WA 4XP1H 2PNDA 3HMXL 3WE6A 3GMPB 1FG2B 1WAAE 1FO0H 4FABL 5E8DH 1X5ZA 1VFAA 2R1YA 2J6EA 4MMZC 1CFQA 5JW4N 2NXYB 3SDCB 4KK5D 1JYWA 2HWZL 4QT5A 4UB0H 1F4AA 3IFOA 1BJ1J 4R4ND 1T66C 4ZUSA 3VXOB 3MGTA 5L8LB 3VXUB 4Y5YB 1HH9A 3QXWA 1D5MB 4Z95L 1NGQH 2HFFA 3V5HA 5D5MB 1AQKL 1HILA 4LLWA 1NC2D 1NGXB 1N3NA 2AERT 4J3WA 1MCWM 3FTGB 1IGFH 5FK9B 2ERJC 1U3HB 3MLTB 2XQBL 1FC1A 5F8RC 3RTQA 4APQC 1ZSDB 2PYEB 3EAKA 1LVEA 2HT4C 1S7UA 3QSKB 4XX1E 3SJVE 4EOWH 1G7PA 4MQSB 4WI8A 5DD6B 3I02A 1DBAH 4KVCL 3MCLL 3HG1A 3SDCC 3BE1H 1BFOB 3MLXH 2WUBL 2X2YA 2DQDL 1BF2A 1FL6A 2JJSC 2Q86A 2YBRA 3QIWC 2QSCL 1U58B 3QEHA 5FA4A 1L7TH 2HVKB 2OR9H 2QSQA 1MUJA 1WLHA 1QSFA 4MAYC 4JRWA 3DV6B 3WJLC 5F7NC 1JF5A 2OI9B 1HINH 3IKKA 2UY7A 2NNAB 4M9OA 2MCPL 3VXUE 2W9DH 1TCRA 4Y89A 1JI1A 4Q6IA 5ID0B 4G80B 5JORA 2ERJB 4NKOA 3QIUD 4KTDH 2P5EA 1KFAH 3NACL 2EH8H 3MNVB 1GGIL 2F54D 3IETB 5FGBC 5FGCB 4UV7H 4NM4H 3K3QA 4J8RB 4JZNB 1W2KT 2I9TA 5DJDB 3L3GA 4OM1L 1R24B 4NKDB 2FD6H 1MFAL 3EOBB 3WUWA 3RP1A 1C1EL 4NZTL 5GJSL 3Q5OA 4I77H 4L4TB 1FGNL 1JZ5A 2A0LC 2ID5A 3SCMA 3HC4L 3ILQD 4IRSA 2VL5B 4JG0H 1TTGA 4YQXH 3NH7L 1F3DH 2VKWA 3CH1A 1PG7L 3BVNB 4PLJC 4OLZH 5KVEL 1E4XH 4NO0D 1U8JB 4MA7H 1WF5A 4JGUA 4P49A 1DQDH 1CICD 5H35A 3THMH 3ESUF 1BFVH 1LO0H 1HHKA 3P2TA 3HNSH 5KVGL 1LK3H 1D6VH 1NEZB 5TDOA 5D7IE 5GS2H 1IC7H 3SE8H 4PJ5A 3H9HB 1YYLH 3NA9L 3LEVH 4HX1B 3TBWA 3IF1B 1IMHC 3QUKA 1V7NH 3BIKB 4BKLA 3BEWB 3PGCB 3KPRB 4EUPA 5CLWA 1Q9LB 5E70A 4OCWH 3I3BA 2V7NB 1BREA 4NQCD 3UJIL 1JV5B 1MREH 3TPUB 5CCKH 2VQ1B 3U6RB 1SHMA 1J18A 1R3IL 3HPJA 1CGTA 4JFPA 1YECL 4J3VA 4JR9H 4QO1A 5KW9H 1KCVL 5EIVA 1OARH 1MH5A 1OY3B 1DE4B 2R2BB 2YA1A 4JREC 2APBA 2OMNA 5EUOE 2IFGA 3PL6A 2LABA 5SWZB 3LN5A 1QSEA 3DGGB 3E6HA 4M03A 3PV6A 4NQDE 1Q94B 4XI5C 5HDQL 3FMGL 3VFMA 3RNQA 3K7UA 4XH2A 3RU8H 1K85A 2R0ZH 5IMKB 4MMXC 5JHDE 2Z8RA 3F12A 5GGTA 4QYOB 4QGTA 2RGSA 2QL1A 4P59H 2XT1B 4HCRL 2Q7YA 2ILLA 4I5BA 2WIIA 4F7TB 2ZUVA 3VGAB 1W72L 4EUPB 2NY6D 5ICXA 1BHGA 1G7MB 2XTLA 4IS6B 2WINB 5AZEL 2DOCA 4OIIL 2CSPA 4LEXH 1ZANH 3VCLA 1D7FA 5DLML 4TVSa 5HYJA 5JPMB 3NIGF 4Q6YA 2PW2B 3WUZA 4N1EA 3S35L 3FKUS 4FQCH 3DMMC 4MA1B 4N0RA 3PNWB 4JFXB 4UAOC 1S7RA 2O61A 4U6VL 3EZJB 7FABL 1MWAA 5HYQB 1HSAB 4HG4K 1CLYL 3ZYIA 4UDUB 1TZHA 1GJIA 3ULVC 5DK3A 4G6AC 5JXEA 1IL1A 2W92A 5EU4A 1XR9B 5FYLH 4MXWL 4L5FL 5TH2A 3GSXA 2X6MA 1NLDH 1RUKH 4IOSD 4X6FA 3VG0H 2BVPB 1T7WA 5C9JB 4LAJH 5CMAB 5DJDA 3ULVH 4ODTL 1UXSA 4JM2F 4JZNA 4N8CH 5I8EB 3STZB 1ZHBA 4MS8D 4J8RA 4X7SH 3ZKXC 1ZLSL 1KCKA 4FFZL 3ROLB 1PD6A 4Z7UF 3ZT7A 4UNVA 2BOCA 1KXVC 4EN3B 1XGTB 3SKOB 1YDPB 2NY3B 4OQTH 3IJYB 3P0YL 1MLCB 4XAKD 4Z0BL 4KKLC 3UTZA 1EEZA 4KPHH 4JG1H 4GFTB 3VE0A 5KG9A 1YMMB 2FLRT 5GGSB 2HVKA 4FQXC 4LSUL 2NTFA 4KKLD 3ROLA 5K9KB 3BZFB 2LU7A 3ES6B 3BD4A 1YQVH 2VAJA 1JPST 1MELA 4Y4KA 2ICWA 3ZE2F 1J0ZA 2FNBA 3P73A 4OQTA 2OTUA 2DQFB 3WKMH 1VFMA 3T3PE 3MRFA 4J3TA 3IDNA 1R3KB 4YHML 4F7MA 2BX5A 4Z7WB 3ARGC 5DJ8B 5L2JA 5D2LE 4DOHB 2OBGA 1I4FA 3GMOA 3QEQB 4X7CC 3QH3B 4NFBA 3TO2B 4NRZB 5FGSA 3GSXB 1U3HC 4LHJB 2WQ8A 1MHCA 4BM7A 1DFBH 3L3JA 3TT1H 3MRCA 1FFOB 1NANI 4XZUA 3HZVA 5CD3A 2YD2A 1JPFA 1QLRB 2OZ4H 5CP7A 3V5HB 4V1DD 3U9PL 3ZL4H 5JA9A 1HSAA 5FYKH 3WDIA 1CVRA 1YEFL 5JW5B 2PO6A 1F3DJ 2VR9A 4HXAH 4ZUSB 1OOAA 1Q9WA 4LRIC 1J10A 1SM3L 2V2XA 4JQIH 5HHVH 1H3WM 1I7ZA 1BQSA 2DIBA 1A5FH 3CPLB 4S1RL 2CH8A 3SY0A 4NKMB 4NZUL 4U1KB 3ZYJA 5GRJL 4TSBL 4Z5RB 4R7DB 3TVMB 3EGSA 3VXQA 5KZCB 4TOYL 3DETC 5TGBA 3GO1H 5C07E 2I27N 2R4RH 3N06B 2HJLB 5GQBA 4M7LL 1CF8L 4PD4J 1KJ2H 3L9RB 3S5LA 2WIIB 2MJWA 4F7TA 2B1AL 3CGTA 2EEDA 3IDGA 5DQ9A 4JM4H 3QIUA 1DSFL 3VD5A 2QSCH 3QR2A 1U6AL 1FHGA 3GSNA 4J3XA 1YPZB 4NQDB 2DQCH 5MP6H 5E9DE 4O2FB 1Q0YH 4ODXB 1Z0NA 4L3EB 3V7AE 4JJ5B 4ZXBD 1G7IB 4BSWB 1JTOA 4DN3H 4K3JL 3VFNA 1N7ML 4ZFGH 1F6LL 3U0PA 1NMCB 3I2CL 4PV8A 1JPTH 3BP5B 5JTWA 2DMBA 3FQWB 2EH8L 4AJ0A 2ITDB 4OT1H 5CEXB 1XCQB 3HPLA 1QSVA 3QUMH 1MFEH 4LRNH 3BKCL 1OM3L 5C0BA 4M8QB 4UV7L 3EYSH 3HG1D 1FJ1B 5ANME 3P9WB 1J05A 1IEBA 4P4RA 2CMRL 4X4MA 2BY3A 2OR7A 1IQWH 2EDEA 4RGMC 3LIZH 4HDIB 4NO2A 3EUUA 1I1AA 4P4RB 2JB5L 4XPGL 4PJXE 1FNEB 1BIIA 3PHQB 1FVEB 4NUGH 1A9EB 4Y19D 5KVDL 2PTTB 4HX1A 3ZE0F 4CRPA 1UJ3B 3RNKA 3JTTB 5TDPB 3ME0A 2KZ1B 1LK2A 3SKUD 1UJTA 3RY6A 4Z7WF 3C2AH 4LGRB 4OBRA 1ZT1A 4OKVA 3PL6C 5MHSE 1FAKT 4XHQA 1EBAA 1YY9D 3E6FA 4HS3B 4KC3B 3WUWG 1C08B 1X4XA 5IB5A 1S7VB 2X70B 4ZFOB 3UCRA 5IV2B 4WW2F 1T5XA 4PUBH 4HGWA 5F72S 5CZKA 4P5TD 2IANA 2J8UB 2CKNA 4NQUA 1ONQA 1TZIA 4FQLH 5IW6B 1YEEL 4XP6L 5E5RB 3O81A 2QQNL 1B2WL 1RJZA 1UZ8A 3PWNA 2X4PB 2FR4A 2QHLA 3GMNA 2CUMA 1CFBA 1PY9A 1S7QB 3HB3C 4AM0A 5FUZH 1PJ9A 3OPZL 1U8QA 3S96A 3FOMB 4NM8H 1JHLL 1A7PL 3ARWA 4JFZH 5E5MB 4ELKA 3T77A 3GEWB 3I75A 5I1HL 3ARDA 3QG6A 5C2BH 2HG5A 1XIWA 1KCVH 5BS0D 2MKLC 1FNFA 3MNVA 5D7IB 1NBVL 5FOBA 5D1QB 2Z8SA 1KC5H 4MCZA 2ED8A 4OZHE 3SGEI 5FYKD 4G7VL 4F9PC 3T0VA 1A7RL 3VFSB 3QUZC 5CJ5A 2VAAB 3RU8L 2B1HL 4I9WD 4J1UB 4JKMA 1PYWA 4HJJL 2EE9A 3V4PH 1WITA 3VW3H 4HKXA 2HN7B 3IDNB 4LHUG 3Q5TA 3QCVH 3OZ9H 3OB0K 4KJPD 4WENB 3BIBX 4PJCE 4M8VA 2W9EL 5DD3H 1J8KA 4N0UA 4L8SC 3RBGA 1QA9A 4WI4A 4FQ2H 1UCTA 1ORSB 4NO0B 2RHEA 2OSLB 4JRYB 1CGVA 2C1PA 1BEYL 3GB7B 4FQHB 3L3KA 1H15A 3QCTH 1CK0H 4I3SH 4X9BA 4KRPC 5HHPB 1Z3GL 1HYSC 1Z9LA 2DQUH 4P2RB 2XPGB 5KJRL 2H1PH 5E99L 4PJAE 4LLMA 1PAMA 1NUGA 1LDPH 2BSTA 4R97B 3SKJL 4PLKD 3QG6B 4LSPL 3UBXA 2AJXL 3SDCA 1CFNB 1RIVH 4RX4A 3LEYL 1ZWIB 4AT6B 2ZSWA 1CXLA 1JNNL 5H2BA 3G5YB 4JN1L 3QJFA 3T04D 3CSBA 1A02N 3NCEB 2LVEA 3CMOH 1XR9A 3H7BA 4M61B 1YZZA 5IVXF 3ULVL 1NAML 5HYIA 3QDGB 2J8UA 4N8CL 4F58H 2VZTA 4XPBH 5EU6A 3VXPB 3D9AL 4Z7OF 3H9SA 3VD3A 3QWQB 3FQRB 3HMWL 5LBSH 4X7FC 3VFUA 2IAMB 4MWFA 4WY7H 4XVSH 3P0YH 3QXAB 1QEWA 2Y36L 1OF2A 4Q9BA 4HZAA 4OKDA 1RZKH 3WFBH 5D7LB 1ERNA 1UJ3A 4NCC1 3UMTA 2IWGA 4OLYL 2HH0H 2EE3A 4DKEL 4P57A 2FO1A 5CIPB 4NFCA 5ICXB 5E9DD 3DVFA 2K9UA 4ZDHB 1BIIB 2P1YA 2Q7NA 2B2XH 5HHOE 5JXAL 5ILTH 5GSRB 3QJHB 5DYOB 4YXKH 1A6TA 5HVWA 2R4SL 4U7MA 3VMOA 4R90L 1MFBH 3FZUD 4OCSH 1Q72L 4S1SH 4GOSA 4PJ8D 3ZHDA 4S0TD 5GZOC 3VXSA 1QO3B 4DCQB 4QRQB 3PQYD 4NO3A 4Z0XB 2IADA 1SBSL 3RVTD 2X9WA 5TE6L 5L9DH 4MSWA 3L5HA 2X7LB 5EO0B 2DQHH 3BPOB 1DQQB 1FNLA 1J9CT 1OAQH 4ODWA 4ZO9A 4JANA 1FIGL 4RFEB 1ZLVH 1CT8B 1CGWA 1YA5A 1QFWL 3HE6D 1DBKL 4CADB 1AR2A 4TVPH 1NQBA 4HK3N 3WLWD 3WN5C 5ICZA 5KAQF 1BFSA 2VQ1A 5D2NA 5C6TH 3LY6A 2YRLA 3FOLB 1EV2E 3LRSB 4IDJH 3S5LB 4CNIA 2BY0A 2G5RA 3O3BA 1XGYL 1MNUH 2XN9D 1FGVH 4NHUA 2B8OT 1TQBB 1WT5C 5CBEA 1U8KB 3R0NA 2H3NB 3MC0A 1UGNA 4MVBC 4NKMA 1RURH 3VRJB 4M7LH 1Z9SA 2UWEB 5C0AA 3CXHJ 4X83A 2Y7QA 5F7HA 2YK1L 4OLXH 4WI5A 5BRZB 4JFDD 3V6ZB 2EIBA 1XGRA 5DT1H 1G6RL 1L0YA 1DSFH 1KGCE 4G3YL 4J7RA 3ZKNC 5ALBH 1KLGB 3VWKB 2DQCL 5MP6L 5DJXA 3BVNA 1XF3A 2VYRE 1QZ1A 4DQOH 5FA3B 2PCPA 5J12C 1MRDL 4UILH 5J1TC 3AB0C 1GOGA 3FQUB 4RAUA 1JPGB 4G8FB 1KJMB 1MRCL 2VL5A 4IRJD 5J13C 2OL3H 4H5SB 4NQVB 2H8PA 5I1KL 4MB5A 2Q87A 4PRHA 5F97E 3BKCH 2CKBL 4Z7WE 1OM3H 1TTUA 5DJ8A 3QEQD 3MNZB 1I8IA 3SGJA 5GIRA 3C5ZA 4JRXD 1JZ4A 2BXZA 4WFHD 5I74B 5BOZG 4NKDA 2JB6A 1QYGL 2G5BB 1ULVA 4HKBA 3LIZL 1HQRA 4X99A 4YXLL 2OJZL 3GMRA 3BH8B 3EOYG 4ZOBA 2EYRB 2QV2A 4UQ2A 1MLBB 3IETA 3KXFD 4LHUD 4EEEA 1G7JB 1NAKH 3QDMB 5KOVC 3D1MC 5DUBA 2VWEE 5JDSB 5CD5C 1A1MB 3EDEA 2YD3A 4P9HC 3GSRB 2NXZD 4LNVA 4NQCA 3BPLB 5DD5H 4R3SB 3FONB 2F8OA 5HYJD 1TCMA 1AGBA 2AEIT 1U95B 3B9KB 3Q5YA 4N5ED 2JF1A 5KZCD 1YYMH 4KK8D 2DB8A 3QIWB 3X3GL 4OV5A 4LCIL 3LKNB 4WFHE 3DXAD 4NC2B 2WAHA 5CP3A 3JUYA 5GHWL 2P5WD 4DN4L 1RHFA 1TQBC 5CBAA 1HHHA 1BIHA 3TT3L 4WNQB 4C4KT 2BSSB 1NFDF 4RQQA 5GS1A 5JA8B 2R56H 4ZDHA 5ADPH 5CAYB 3U0TB 4HBCH 4U3HA 1YNLL 4PJXF 3RL1B 1Q0XH 1INQA 2JK5B 2JJTC 5I1LB 2YD9A 4LSQL 5I6XB 3FO0L 4EUPG 1ZVSA 2QEJA 3WNLA 3QZWB 3QB7C 4M7KH 4NKQB 1KC5L 3IDXL 3P40A 1NMBH 1TQCB 5DMGC 4JY4B 1JNHB 1P84J 3BKJL 1CFQB 2B0SH 3VG9B 1WFTA 1T80A 2XNAB 3U4EB 3DGCR 2E7BA 5B21A 3LKOA 3OKNB 4MD4B 1UH3A 3MJGX 1P4BH 4L29B 5E9DA 5SWSD 1DBJL 1BAFH 1HNFA 3DUUB 3OZ9L 4NO5A 2A83B 1S7WB 3HR5B 1WCBA 2Z35A 3CDCA 1LO5B 2UY6A 5ICZB 3ARSA 1AXTH 1WBYB 1VCAA 4U1IB 3P4OB 1R3JB 4L9LB 1I75A 3HI1B 4QRPD 3B83A 3JWOC 4QYOA 3SGEH 3GJFA 5SWQA 3F12B 4ZUTA 2J8UE 2YPKA 5ECJE 5JPNB 4B7IA 5E08L 3QIBA 2XZQL 1TJIL 3WIFB 1I85A 1BEYH 1PX3A 2BSTB 5GGRY 1AD9B 4LMQE 1FZMB 4JN2B 3V5KB 1T83A 1VESA 5EU7C 1I1YB 5BZDA 4KDTC 5HGHA 3ZKSD 4QHLA 4ZOEA 5FYLD 2ED9A 5FUOL 3SKJH 1LNUA 3D6GA 4HIIB 1MI5B 5BMFL 4NUJB 1ZT7A 1SY6A 1DDHA 1ZMYA 5L2KD 1QSFD 1S9VA 1M7DB 3PIQB 5FGRA 3TNNB 4YNYA 3VI3F 4M5YL 3MRRB 3IU3A 1OVZA 3QDHA 5CIPA 1RUAL 3IDJB 4MQTB 1U8HB 3MJ9A 4XCYB 1QACA 2RB8A 3MBEB 2HT2D 2R0KL 2ZUSA 2EYTA 1BQLL 1QEWB 4S1QL 3OKDA 2F53B 3RZCA 5EOTA 4RAHA 3GSUA 1F4XL 4IDLA 3D48R 4EI5B 1RK0A 2WNGA 4MQXD 5F9WB 2YXMA 1IAIH 4E9LA 3QQ3B 1HHIA 3TJEL 2E7LA 1CXHA 3CDGB 2VUOA 5C0RH 2GJJA 3H9ZA 4YWGH 5EFIA 1XGQB 4M1GL 5EUOB 3CFBA 1MY7A 1MFDL 1Y6NR 3LMJH 5EBWA 3SDAC 4DKDC 2IPKA 2H26A 1SYSA 2APXA 4JZJA 5A16A 1T7ZA 3QAZB 5EDXA 4JRYD 1KCUL 3FOMA 4IHOA 2XTJD 3GBNH 3WHXB 4E41E 4HZLB 4PJXA 3QUMA 3C9NB 4MB4A 5D1ZA 4PJBF 3WXWL 4HC1H 2C9AA 4J4PC 4M3KB 3QWRD 3T0XA 3VXNB 1P69B 4CMMA 1KIQB 1YEHL 4WCYH 4FRWA 3CVHH 4P2RD 5FHBL 3A6OA 5HGGS 1DL7L 1FZKA 2X9XA 1F6AB 3E2HC 2Q6WB 2IANB 1ORQA 5ERWB 3VDCA 4P3CH 2CJUL 4QOKE 4PJ9D 5ALCL 3KAAA 4YIQB 3RTQD 4ZFFA 1JE6A 3GBMH 2V5TA 4Y19A 3EYVA 2YA0A 3LS4L 4M6OL 1QFWH 4HS6B 3U7WL 1HHJA 4OCYH 2NY5H 3DETD 5EZIL 1ORSA 3F7PC 1T20A 2HRLA 1VADB 1VKXB 1T7XA 3JTTA 2ESVA 1GHFH 1UH2A 4FFYH 2E6QA 3UO1L 2VL4A 3KPMA 4M6NH 4NGHH 5C6TL 2DQJL 5D4QA 4FQ1L 3MBXL 2NQCA 2NR6D 1DN0B 4N8PA 5CGTA 1IEHA 1S8DA 3M17B 5LWYH 1RHHA 2PYFA 1FH5L 1XF5A 1IBGH 4Q97A 4HDIA 5B39B 1CLZL 4E41D 3HS0A 2XTJE 3BWUC 3SE3C 4ODVH 3F8UB 5DGQA 4LVNB 5FYKE 3SQOH 3IVKA 3GJFB 3QDJD 5D1XC 5SWQB 4AEHH 1QNZL 2GFBB 4RGNB 4HWEL 3BP5A 2Y07H 1OPGH 4BFGA 5DT1L 3TBYA 3R06B 4HUKB 4RRPG 4NO5B 3MLZL 3QUYC 5F9OL 2E6PA 3WIFA 4MD0B 3G9AB 4A2LA 1A7NL 2VIRB 5HGDA 3Q6GH 3QWOB 5E94B 3UYOD 2D9QB 4K3DH 1VFAB 2R1YB 4CU6A 2YN3A 2CDEA 4QTIL 1FRGH 5CJQH 5IQ7L 1I8KA 4GRLB 2ARWA 3DBXA 3D0LB 3V0VA 1DANU 4DW2H 2EO1A 3BKML 1W72A 2OTWB 4FG6D 1EZVX 3DVGB 2E6JA 3SY0B 1CFSA 3E8UH 4N9GA 3WIIH 3BISA 3NZ8B 3QUZA 3LKSB 3PF2A 1J1PL 4QRPA 5FYLE 2RAMA 3VXRB 3V7AG 4P23A 3RAJL 3OXRA 3CLFL 4U1LA 1PSKL 1NCWH 3UTOA 3TYGH 2GSGA 3QEGH 1Q9WB 3CZFA 2Y5TA 3UTTD 4M1CC 1LGVA 1MCOL 3MNWB 4GQ9L 1A3QA 1AC0A 4P3DA 1T2XA 1X5HA 5JUEL 5HY9B 1MQKL 5IVNA 3OAUL 2GAZA 2CD0A 4NHCL 4YUEH 2OXGA 3HC3H 2NY1C 2K1MA 4XPFH 2A77H 3E3QE 3HZYB 5B4MD 5IVXE 3SE4A 1P2CB 1DUZB 3GRWH 2FIKB 1AGBB 2FEEI 4XP4H 3TH3T 3C08L 2BSSA 4LSSL 5E6IA 3LQAL 5IUSA 1F4WH 3KNBA 4K7PL 3FB7B 4JM2A 2GJ6E 1IVLA 1WT5A 3IRPX 4UV4H 2WWKO 3FT4A 5SWSE 1XMWA 4N9GB 5DJZB 4NBYB 1CVSC 3DVNA 1WBZB 4BZ2L 5I9QC 2YOCA 3E0GA 5CSZB 5CIPH 1I85C 3MACL 3D25B 2CPCA 4S2SB 4JPKL 4PJAF 2QJDA 3D39D 3RJDA 5HHNA 3PHOB 3TJHD 3LHPL 2HTLC 1INEH 5JW3H 4M6ML 4X6EA 2HWZH 1IZJA 4EN3A 3OAYK 1GGCL 4D9QE 1NGYB 1BF8A 3L9RA 5CEZE 1OTTD 2DIJA 4F80A 5C7XL 1OTUD 2LE9A 3MLYL 2MHAA 3X17A 5EZOH 3ULSB 1KTRL 2XXCB 1KPRB 4XP5L 3LDBC 3VXQB 4YK4C 2R23A 3P4MB 4FQIH 3QQ4A 2XG4A 5GRWA 2X05A 4Y16B 4LRIA 4OLWH 5E2VL 4ODSH 2BVPA 4JFFD 3VXTA 3MV7E 3I6LD 3LKQB 3MXVL 1N4XH 2XQBH 3B5TA 3L5WB 4MQ7B 2QSTA 1X44A 4HAGA 4D9RD 4AH2A 3DXAE 3O3DA 4EOWL 4PBWD 5F1SA 4D9LL 1NUNB 4RAUB 4ZNEA 3B9KD 4BSVA 5I73B 4LFHG 3QQ4B 1W0YT 3MRQA 3P0VL 4HIHB 3EIFA 5DF0A 3KLHC 4PRDA 1IJ9A 5DS8A 5CHNA 2QHRH 4RDQG 4ZPVB 1JPSL 4M48H 4Y5VB 3QFDA 1EMTL 1SYVA 3PWPD 4ELMA 1DBMH 3TH4T 4O58H 3RWGA 1NGWB 2ITCA 3LKRB 2YD5A 4I4WB 2OL3A 3TO4B 2QR0A 4XCEB 4KROC 4X80H 2E7CA 5HHNB 3ULVF 4F7EA 3VRIA 1AHWB 5FO7B 1I8MB 4FN0A 3D3VD 3X3FL 4PJ7A 3WBDA 4K7FB 1N6UA 1J11A 1F6AA 1NGYA 3W11C 4JFYB 5GXBB 5C9KA 3O9WA 4YPJA 3VWJB 2FD6L 5HI4C 3PGFH 1Q9KA 4G42A 4Y4FD 1NH6A 1MLCA 3WD5H 2CLVB 3WS6C 4JFEB 2EDBA 5I76A 5C3LD 5ITBL 1ES0B 2CIKA 2F19H 1I7RB 3TVMD 3EFFB 3UPRB 2MPAL 5IEKB 4JFFA 1WBZA 5I8OH 3C5ZC 4OTXH 4OCNC 4RMTA 2BRRH 5A16B 3D2UA 4QNPE 4QRQA 3UJTL 1F8TH 5KN5A 4KK8C 4NCDA 2VLMD 1UB5B 3R1GL 4HWZB 4TSCL 3CX5J 4YBQD 1ED3A 2Y5TB 4LLVA 1JGUH 3NIDF 4A6YH 4E0RB 5C0AD 1KCUH 2LVCA 4TTDD 3MA7A 3ZDYF 4JGJA 2YSSA 1FC2D 3VXMB 3MLVH 5EIQA 2XN9E 2YRZA 2R69L 3MR9A 5DTFB 4URTB 4R26H 5I1AB 3GI8L 5IROA 2VDKH 2E7HA 4NJAL 3L95A 3V0WL 5FHBH 4JFQA 5T1LB 3GIVB 5GRZA 3O3UN 4BQCA 4QRUB 4XCYA 1YY8A 2D03L 2XKUA 3KR3L 4PRBA 3EFDL 1IT9L 2BCKA 2WANA 4K23L 2VE6B 4L9LC 3T1FA 1WZKA 5SV4A 3TBTB 3SGJC 2QLVB 2EXWD 1FO0B 2VNCA 1HEZB 1CFSB 4GXUM 4NUJA 4PFEA 2XKNA 2C1OA 4XVJL 5HPOA 1FYTD 2A6IB 4P2QA 5A3ID 1T3FB 4G8GA 4JO3L 3QA3A 2R0WH 3HC0B 5LJYH 2GKIA 3D0LA 1PG7W 1T0MA 1AXSB 2O5XL 4DKFL 2R0LH 1BX2B 4OCMC 1ZLVK 4X4YB 2E9IA 2OXHA 4AEIL 4YHYC 1URLA 1VPOL 2ZUWA 3F65A 5E94A 5TQ2L 4PP1D 3MRPA 1TVDA 4NQEA 4N90D 3CXHK 1BVKA 4YK4B 1W72H 1QQDB 5I66B 4W6WB 4WFFE 1RULH 4YGVB 5EA0H 2MSPA 3I6GB 3BWAB 5LCVL 4QHMB 1RI8A 2YD7A 3BYYA 5KSAC 5H37H 4OCXL 3V4UL 2EDOA 1AQKH 2LTQC 3HE7D 4ZUVA 2VABB 3WXVH 1UT9A 4DTGL 5I16B 4HW6A 5FHAH 2WWKT 4Y7MA 3MCKA 4LSVH 5DJ6A 1EVTC 5FO9B 3MV9A 1KN2H 1FNAA 1JV5A 4ZD3H 5E6ID 1JWSB 2HTKD 4C56D 3RKPA 1VFUA 4KDWA 3PWLA 1FL6B 3F5WA 1QFWI 2ED7A 5JW4R 1I9JH 3F7QA 4XXDA 3DX9A 1CWVA 4R96A 4KVCH 2Q6WA 3MLRH 2AXGA 3B9AA 3O6KL 4KKAC 4PJHE 4G6FB 3MLSH 1T0PB 5K9JH 5C07D 5IT2H 3JV5A 3EYVB 3WMSA 2YUXA 3L1OL 4C4KO 5D1ZB 2BERA 3ZTNH 1J1PH 1LQSR 1BVLA 5TE7H 4MCZB 2YD1A 5HJ3A 2W9DL 2FX7H 3KLDA 1RIUH 1U92B 5I71C 1A6ZA 1UB5A 4HWZA 2CDGA 2O26U 1GGIH 2DQTH 3D2UB 4P4KC 4L8CB 3VXNA 3RL2B 2A74B 2VDMH 5EUOA 2BRQA 1J0JA 1HQ4A 4NHCH 3T4AA 1G9NL 3ESVF 4WO4A 4D0DB 4U1JA 3B3IA 5I76B 4D0DA 1CCZA 3QPXL 1IC5L 1GPOL 5L7XL 1QBBA 5C0AE 1O7SA 1I7UA 2J8UF 3CFJA 3ZT6A 4NQTA 2CDGB 2P47B 5DJ2B 5ESAA 1CLCA 3QXVA 5E24E 1NBYA 2OQJB 4N5UA 4WV1A 4XP1L 4CN1A 3W9EA 2B20A 1EH9A 3PHQA 1WIPA 3WEXA 1HQRB 4NP4L 4YNYB 3TN0C 4WUUE 5DFVC 3UJJH 3ARFB 4KI1A 2P4AB 1U91B 2OCFD