1ND0A

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0A01
2NY6B 4YX2L 1IAOB 2EC9U 4KKBD 2OL3B 5HYSB 5E2JA 4YWGL 4YXHH 3QUZC 1U8LA 3BVNA 3TIEB 5GGQH 1YEJL 5L6YL 3V5DB 2DI7A 1ZWIA 2ZOLB 1Z9SA 4OGXL 4G42A 1K8DB 2FIRT 5SWZA 4M61A 4F7PA 3U1SL 3VFNB 4FQ2H 4U3HA 5ID1A 1P4IH 5HYSG 3PDOA 1U91A 1I1FB 4BYHA 3OKDB 1KXTB 5LXGH 5D5MA 5C0AE 2P44B 5F7FA 4WUKH 1DE4B 4ZD3H 4J6RL 1RIUL 3BP7A 4FG6D 4DUVA 3DIFB 4XNMA 1WT5A 4A6YL 3V5HA 5EN2A 3TEUA 3MREA 1I7RB 1U8JB 4XWGH 3P2TA 3ZL4H 3RDTB 3PGFH 2VH5H 1J87A 4PV9A 5JO5A 3HPJB 3MV9B 5GQBA 4MJ5B 4S1QL 2CDFA 5HJ3B 3WFBL 5EUOE 4Z7WB 4IRSA 3QG7H 4EXPX 3HS0B 5I0ZA 4RGOL 5DJ8B 1MRCL 3O6FC 4PRPB 4NBXB 4NRZA 4OZFG 2JCCF 4DCQB 4XH2B 5FCSH 1T20A 1WBXB 1RVFL 2D0FA 2AXGB 4N9GB 3WO3B 4ELMB 3MUY1 5I6XB 1VFMA 4X6FB 3V5KB 1WIUA 4GLRH 5BZDB 4O4YL 1TZHB 4G8GB 4PJXB 4Y5VB 5TE4H 5KTEH 4JO4H 3UTSE 4OLZH 5HVFB 4X4YB 2OMNA 1IVLA 1YYLL 1JHKL 4R26L 2G2RA 3ZLQC 1UENA 5I9QC 4DZBB 3EFDL 4NC2B 4WWKB 4KUCD 4YR6A 1YEIH 2YXFA 1EFXB 3P9LA 4HLJA 4PLKD 3V52H 2DQGH 2BVQA 1CICB 3KVQA 3MGTB 2R2BB 3W0WD 1EFQA 1CE6A 4LLAA 3PP4H 2YBRB 1KJ3L 4GXVH 1OF2B 4LPTA 4G9FE 4XNZC 1T1WB 1KT2B 2VITA 2IBZX 3STZB 1MNUH 4MD4A 4NQEE 1E4KA 3WCYA 4WTXA 2ZUQB 3EBAA 3VJ6B 5T5NF 1WWCA 3VW3H 2XQBH 1ZLVH 5DUMH 2D31A 3BP4A 5IVXA 3CFDB 1AO7B 1MFBL 1T6WA 3U4BH 1GIGL 5DWUL 3ZYJA 3O11A 3T65B 4QEGA 3MV11 4WFGE 1EJOL 2H45A 5IOPB 4IOIB 1RUPH 1CD9B 1KIRA 3TFKD 3BFOA 1OVZA 1KIPB 1EEZA 2M26A 3EDDA 1MCPH 4POZC 4WU7A 2VN7A 2BDNH 3MLSH 3GMLA 3R0MA 4W6WB 2ZUSA 4A2MA 3ARPA 1CL7L 2A6KA 3MJ7A 2PO6B 2NXYB 1JYVA 4O51B 4C56D 3V4UH 1X5JA 4TQEH 3VE0A 3MJ9L 5IK3B 2YPLE 1QD0A 1OP5H 1PSKL 5JA9A 3QUXA 1CLZL 5B8CC 2R0LL 4HWBH 4ODVL 1ETZB 4HKZB 4JPKH 1H3WM 2HA1A 3ZTJH 3QXUA 5I18L 4I77H 1HDMB 2OBGA 1RJZA 1J8HE 3TJHD 3MX0A 1Y6KR 1GPOH 4U6VH 3IXTA 4LAQL 3WXVL 3T77A 1U8LB 4QHNA 5D7IB 2E9BA 2CKBL 5KSBA 1ZWIB 1T3FB 4G42B 3VFTA 3JBG7 2W9EH 1BECA 4JGUA 4M48L 1NGWB 3VWKA 5JW4Q 3S97C 5ID1B 4FFZL 3HC0B 3G9AB 3QXVA 4RMRA 3MV7E 3FFCD 1AQDB 2GJ6D 3DVFA 5GGTL 3QXAA 3DX6A 4QXUH 5CEZL 5B3JF 5D5MB 1RIHL 3FFDA 1LVEA 5J1TC 1RIVL 5BS0D 1RD6A 2ORBH 2R0ZH 4NN5B 1LP9A 1VFBB 3DYOA 3NFNB 3A6BH 4G7YL 5HI4D 3LEVL 1F4YL 1YJDC 5A43C 2DBLL 2E9JA 5CWSB 5C6TL 3V5HB 2BRQA 5EN2B 5GS0H 2LU7A 3WFEH 5IR1B 2E9WA 2NY0C 2X4RA 4U6YA 4HG4J 3DX9A 4LCIH 5E03A 2FX8H 5BRZD 2E7MA 1YEKH 4YBHA 3UTTD 4FA8A 1Z3GL 5KZCB 3WLWC 3ZHDA 2VXVH 4KJPC 1JZ6A 3QEQA 3QUYA 5TF1L 4OF0A 5F6IC 4CRPA 1EVUA 4JFED 4HZAA 4DAGH 5EO9A 3BX7C 5B4MD 2CD0A 4Q97A 1ZT4A 5HHOD 1HQ4A 2GSIA 2E9IA 4ZFOL 4M1DL 5D7LE 4G3YL 5FXCH 4F7EA 4WCYH 3L3KA 1KCSL 1R3KB 4Q9BA 1UWGL 3GSQA 3HRPA 1CLCA 4OIIL 3LHPH 1N8ZA 4MMXC 3ULVD 5EB9A 1Y0LA 3LN4A 4YDKL 1KCUH 4J3TA 5M95B 1EBPA 4GSDH 2OQJA 1CFVH 4W81A 4X7CC 5AG9A 3HI6L 3HR6A 1SY6H 3LS4L 3BKCL 2IAMD 3GIVB 4KI5F 1AXTL 4OFYA 2PTUA 1UADC 4IOFC 4U3CA 5T3ZH 3CX2A 3L3JB 3EYVB 3X14A 4MA1C 2PTVA 5FOBB 1CXFA 1SBBA 3UAJD 3SDAD 2A73B 2XN9D 2ADJB 3BD5A 1AD9B 3SGEH 3UMTA 3ULVF 1H3XA 1MJUL 4QRTA 1X4ZA 4NQSB 4YPGA 4Z7OE 4LLMA 1YNTB 3N0PB 2NY3D 3AY4A 4GW1B 3QSKB 4NJAL 5D7SH 5C08B 5GS1A 4J3OC 2H9GB 1JNNH 2BFVL 2WIIB 4FS0A 4Y19D 1FAIL 2HH0H 1ZKAA 1MWAH 3BQUB 5ICXB 3D2UD 1G7LA 3VRJA 2EDYA 3MA9L 1SVCP 2A38A 4EI5A 1PBYA 4XTRD 3FJTA 1FL5A 4LF3B 1MJJA 3BIAX 4G7VL 2ADIA 4UIKH 1UEYA 4WHYH 1QA9B 4NM8H 2VLRA 3NVQA 4XP9H 1A7OH 3VE0B 4Z7UE 5TQ2H 4D2NA 1UZ6F 4GW4B 2BOBA 2Z31C 1JWUB 4HCRA 5E2TL 4ALAL 3LKRA 1FNHA 1A7PL 1UJ3A 1LDSA 2B8OT 3IDGB 5EU3A 3IU3B 4ZPVB 3FQUA 5ANME 1A4KB 1YEJH 1XGUB 4ZSOA 1RJZB 4LCUA 2I60L 2M8XA 1CDIA 4UU9A 3U36B 1CG9B 2WUBL 4JR9H 3UZEA 5FV2A 4JDVA 3VRLE 1ZHBA 2G9HA 4XMKH 3U1SH 4KC3B 3RL1A 3VFPA 2FYYA 2R9HC 3WL9A 3TVMD 5DK0A 3W2DL 4JFFE 1L7IH 4FABH 4P2OC 5KSBF 3FN3A 4U1HA 4OI7A 3VWKB 3TYGH 4PGEB 1MY5A 4HPOL 4IMKC 2X10A 3ZT6A 3J7HA 1G7QB 5C07A 4BKLA 4LSQH 4V1DE 1MRFL 4ZTPL 5FA4A 4J6RH 3FFDB 4HH8A 5DS8B 3DARA 1Q72L 3NFSL 2HFGH 2X1XR 2X4NA 1KJ2L 5IB1B 1G6VK 1LP9F 2HWZL 3U2SA 4YH6A 1B4JL 4Y2OA 3NCJH 4FXKB 4OZ4B 3NACL 1QKZL 3MGOB 4S1QH 4M8VA 2Z92A 2WINA 1Z9OA 4HC1A 4QRPA 3MXWL 1PKQB 2D7OA 1PEZA 2A74A 1T1ZA 2CK2A 3AB0B 3V7AE 2XV6B 3BZDA 5I1DA 4MAYD 2HLFD 3WV0A 3S37L 5A2JH 3TCLA 5EO9B 2B4CC 3WHE0 3RVWC 5DGQA 4U6HA 3FN0L 1INEL 5ADOL 1ZT4B 1YMHA 4UB0H 1INDL 4NKMB 3S35H 4O2CB 1JHTB 1G9NC 4U1LA 4F7EB 2Z0BA 1XH3A 2YPKA 4YBQD 1YYLH 4X9GA 1YN6B 4PJ8B 4QRQA 2X4SA 4R26H 3VFSB 3VXMA 1UB5A 3B9VA 1RU9H 2AEIT 3GSQB 3QIWA 4KKCC 3S36L 1XF2B 3SHSA 5H2BA 4GG8B 4X6CE 3CSYA 5F1IB 3VDCA 3K2UL 5D2NC 2X4OA 4KI1A 1F4XL 2OQJB 3U6RB 3P11L 1URLA 4BSJA 2WBWB 4JVUA 1CWVA 2A6JA 1OGTB 1I1AC 1CDJA 3ARDA 4JY5H 3VXUA 3HZMB 1FZKA 3KPSB 5I1KH 3DURA 3RIFF 5KS9A 1FDLL 4X7TB 3ULSB 3LY6A 4LRIC 4X4MA 1NSNH 3GMQA 4UUJA 2X9XA 2M1KA 1SQ2N 1EEYA 4LVOC 1UEMA 1KLGA 2BHYA 4OF3A 1MFBH 4PJ5B 3VCLA 3TGXA 5E94B 5DWUH 4GRWB 3O3UN 4PRHE 1KBGL 2R0WH 4TYUA 5EZOH 1IGCH 5IHUL 1AE6L 4S1RL 3H9SE 2GTWA 4R0LB 1YPZF 4UDUA 1U8QA 4ETQA 3WIFB 4X9FA 1JPSL 1WEJL 2X5PA 3UTSD 4M1CC 5EOQL 1FH5H 5ETUA 2V5RA 2GT9A 2P46B 1W2KT 3A67L 2P7TB 3UO1L 1FL5B 1K2DA 3HG1A 1MJJB 5F97E 3VXRD 5J1SC 2ADIB 4UTBL 3C5JB 4PJ7A 4XPGH 4MNHB 1MREH 2R0LH 2ED8A 3QUZD 5E9DB 3CH1B 1Q0YL 4HXBL 1VB9A 2BOBB 3AMKA 5GSRB 1LE5B 2K9UA 3LKRB 4ZYKA 5GGVH 5ACZA 4RMSA 3FQRA 1A7NL 3QQ3B 4NQED 1FL3B 3CVHA 4P4RB 3UYPA 1IGML 3QT2A 4LCWA 4YC2B 2CKBH 4ZSOB 2HAZA 3T2NH 4WO4D 3VFPB 1WC7B 1A8JH 5DK0B 1MLCB 5HGAA 3DSNA 3P4MA 3DMMC 1NAMA 4WFGD 3ULVL 4Z76A 4M62H 5D2NE 5FFLA 4GO6B 2P49B 5CEZH 3VDBA 3TZVC 2P45B 4YHYC 1WZMA 2VXUH 3RWCB 5F7KC 3UX9B 5HPMB 4KXZI 4M6AA 2DBLH 1ZGLM 1IGFL 2OYPA 1VFAB 2AERT 3L3GA 4QRRA 3MA7A 3U2SB 4E0RA 1GAFH 3D85D 4AIXA 7FABL 2D0GA 2VXQL 2DTML 3O6FD 5IMOA 3LKNB 1DR9A 3RJQB 1TXKA 2Z92B 3KPQB 3KPTA 4HWNA 3RTQC 3OXSA 1U8HB 4JDTH 4NUJA 1XIWC 2FCBA 4KAQH 1BQLH 4X5XB 2N56A 3I2CH 1YDPB 4IHOA 5INDA 1J8HD 2VERN 3U0TB 4JKMA 2J5LC 4R7NA 4P57B 1BIIB 2OL3H 3GSRA 4M1DH 2FLRT 1WUNT 3CMOL 1CZ8H 1PYWA 1LNUB 5AD0A 4OM1H 2WP3T 1YMHB 2Z4QB 4MSWA 3T0EB 1KCSH 4XNYH 4OZIA 2R56L 1VFUA 3MV7D 1UWGH 5I1CH 4JM2C 4M7ZB 4K8RC 4GRMB 1QBAA 3S3PA 3OAYK 1FLTX 3UZVB 1P4LA 2V7HA 4I0KA 4JO3L 3CFKA 2ZNWA 1UKTA 3CSYB 1KEMH 1AGCB 2HT4C 1IARB 5JOFA 4PJAA 2YD7A 4KDTC 4ZOEA 1FCGA 2IBGA 4CADA 3FOLB 2VZSA 3PWUA 4AJ0A 1MY7A 3H9HB 4IIQA 4AEHL 3O0RL 3DRTA 2R0KH 3EOBB 3V0WL 2P5WA 2A6JB 4HSQA 4MAUL 5DQDL 1JPGA 4MXVF 3ZE0F 1KN2L 5JPNB 1Y18B 4YHLL 2IPTL 1NC4D 3MRPA 4OFVA 1OGAE 1FE8H 1FGVL 3TNMA 2NR6C 1I8MA 3MRGA 4L4TD 4D0BB 4P2RE 3MMEB 3TH4T 4OZFH 2PETA 5DXWA 1AGFB 2AKRB 3WO4C 4HULB 5B39B 3BGMA 4JY6A 3ARGA 1BD2B 4POZD 2IF7A 4NNXB 2F54A 5AWNL 5CP3H 1RZ7L 1CF8H 5IMMB 3HZYB 5E70A 1VACA 1QBMH 2OP4L 4CU6A 1BPVA 3ZE1E 1R3HA 3DUSA 1F6AA 5HHQB 5IFAL 5B39G 2DQIH 5EOTA 5CIPA 1NLDH 1J1PH 4NGHH 3HKFA 2GT9B 1P6FA 3GJEB 1MCWW 1KJMB 1A6ZA 3HLAA 3BMVA 4LOUC 3SJVE 1HH9A 1KSRA 1K2DB 1J1XL 1X3DA 1HINH 5DYOA 3CLEH 5IEHB 3FONB 4Z0BL 5ICZA 1JN6B 1VCAA 1OT2A 3SBWA 2WWKO 1F3JA 1DBBL 2MKWA 3U7YL 4PJ7F 1LMKA 3FHQA 1EZVX 3RGVB 4OCNC 2YSSA 3C08L 4RFOL 5IFJB 3MLZH 2AP2A 3RRQA 4KVNH 1R6VA 4LGSB 4O58H 5A16B 1LK3L 5F9OL 5DRWB 3VGDA 3EYOB 1I75A 4FZ8L 2VABB 3T4YA 1OD7A 4LQ1A 4L5FL 1T0PB 1FAKT 1Q1JL 4OCWH 2FEDC 1EPFA 1FN4A 2ZJSL 5TE7L 4HPOH 4V2CB 4BH8B 5HGAB 2V2TB 3BISA 2JELL 1PQZA 1TJIH 3P4MB 4KJWC 2XZCH 2Q8AL 4FOMA 2P8LA 3DECA 1IAKA 1NLBH 1A5FL 3QCVH 2A9NL 4P4KA 4OCLC 1FVCB 1YQVL 5FKPA 2RQ8A 3MFFB 5C0CE 3BEVB 2HWZH 5JIHA 2HN7A 1RQ5A 1B4JH 3ZKQD 2ED9A 5C09B 4BSVA 4HK0A 4KJPD 4QRRB 1BFVH 1S9KC 4DGVH 2XA8L 3S3SA 1FNAA 4FQCL 1W72B 2CKNA 4K2UH 3QISA 3U7WL 3WS6A 4LPVA 5DVOA 2NY7L 2EIDA 4ZFFB 4JHBA 4CMMA 2HRLA 1JNLH 2JJTA 1KPVB 4MNGE 5CD5C 3BDYL 3DVGB 4IHOB 5INDB 2NZIA 3LQAL 2GJZB 2EYTB 2WV3A 1JZ5A 5CMAA 1J88A 3M8OH 2R8SL 4JFFD 3AVEA 1J0KA 2ZG2A 4YIQB 2FJFA 4OI9A 3CSPA 3C5SA 5I74B 4FQXA 2H32A 4X80L 4NKDB 3FQXA 2AXFA 5F7DA 4V1DD 3QHZH 5LQBH 1J18A 4HUXA 1T5WA 3CPLA 1ADQL 1UGNA 4IOFD 5KG9A 4P46D 3CFKB 1F4XH 2XACC 4PR5B 3RUGF 5IHLB 4KK8C 3T1FB 2XWTB 3LS5H 4PJBE 4PJAF 1PX4A 4Q0XL 4NRXB 1LGVA 3D3VE 1MAML 1T7XA 3MLTA 3H9YA 3PJSA 4Q6IB 1JTTA 4E41B 5SWSD 1HH6A 4OGZA 3EAKA 3O2WL 3KPMB 3MRPB 4YUEH 5EA0H 1WWBX 3TNMB 1I8MB 5DURB 1D5IL 3OKMA 3FQNA 1ZVYA 2EKJA 2JJWA 1YQ2A 1E27A 5CP7B 4MQSB 1D5BB 1AY1L 1X5IA 2EC9T 4JPWH 1RHFA 2EO1A 4W4OA 4LSSH 3OF6A 1EX0A 1QFPA 2J8UE 1R3HB 2VO5A 3DUSB 4JO2L 4OLWH 4DVBB 4L4VB 4JFPA 5D6DA 4HUVA 5EOTB 1NDGA 4UTBH 4X98A 4GW5A 3HMXA 4YDJB 1E4XI 2QHRH 1Q94B 5LBSH 3GUTB 2NQCA 5D7JC 6FABL 1Q0YH 4Y4KA 5KANI 2OSLA 3QJHA 4AIZB 1FYTE 1A7NH 4XBEH 5GRVL 2WWMC 1VGKB 3HI5L 2EDOA 3RZCA 3DO7B 2YRZA 4P2OD 1BVLA 1DSFL 5LGHL 4P23C 5HHVL 5GGRA 3HMWH 4ONFH 3PG2A 1AR1C 3VXSA 1S7XA 4PJFE 2F53D 5KN5A 3T4YB 4PRHD 3I6LE 2ERJC 2Y07H 4BFGA 1JI2A 1QSED 3VXPA 1CD0A 3H9SD 4GS7C 5HDBE 2ESVB 5EWIL 5TPWH 4UTAL 4KDWA 3BPNB 3IDXL 3V4PH 2ZCKL 4F15C 5DO2C 5CJXA 5IHBA 4XCCH 4JFOB 5JUEL 3BP5A 1IAKB 2DYPD 4HPYL 1JV5A 4OCXL 5IROC 3VXOA 3P73A 3C6LC 4POUB 2BHZA 4K94C 2AGJH 2HN7B 5MEQA 1NGYB 4LIQL 3GJFB 5F7EL 2XFXA 5ENWB 4JO1L 4QRUB 1U3HC 4ZNEE 3UYRL 1MI5A 3ZDZE 4HGWB 2NXZC 4XHQA 5F1NA 4YHPB 4XPHL 3RVWD 5HDOA 4G9DA 3RPIA 4Y2DC 3VXQA 5FO7B 5D96B 1LO4L 3CJJA 3PQYD 4D8PB 1UH3A 3DTXA 1G1YA 3QIBB 3HCVA 4OTXL 4N0UB 1A9EB 2GY5A 4P99A 5CUSL 1T4KB 3I84A 3GI9L 3W5NA 2AXJA 4G43A 1NC2A 5CMAB 4KKCD 3D0VB 1K6QH 3P30L 4U6XA 4L4JA 4PJHE 1LO5A 3NA9H 5KANG 2H32B 3FQXB 1XCQA 4J1UA 2AXFB 3V6FA 4K23H 1HSBB 2VLKA 4Y16B 1QYGH 3VI4E 2Y06H 3MRIA 3WKMH 5KW9L 1I1AD 1T5WB 3UROR 5FB8A 4QNPE 3MRBB 5KG9B 1NAML 2VQ1A 1QNZL 1T89A 5JOEA 4G5ZL 5TH2B 4OF5A 1UM6H 4WW2A 5D1QA 1RZKC 3PGCB 3SDXA 4MAUH 2FBJL 3ZE2E 5IGXL 1HZHH 3NPSC 4M9OA 3NGBB 4N1EA 1KN2H 2XNAA 3OQ3B 1SMAA 1YEDA 4M3JA 3VFMA 1W0WA 2JK5A 4DW2L 1N3NB 43CAA 2J7LA 4HF5H 5I1JH 2EICA 4WW1B 2FB4H 5IIEA 3QEGH 2A0LC 1KOAA 4PJ9C 1DVFA 1DBMH 1MFDH 3GSVA 4GMSH 3NIGE 4EDWL 1SHMA 2XZAH 1CU4H 5IB2A 5ELIA 5I8KL 3D0LB 1E27B 5C8JA 12E8H 1JF1A 4M1CD 2VIRA 4JB9H 2Q20A 1WZ1L 2DKMA 4XVSH 4P9ML 5L9DL 2YUZA 4YFDB 1W0VA 4I3RH 2NX5B 4XP6L 1MJ7L 1QRNE 1N6QH 1FNLA 4Q9QL 3MRDB 2AI0H 3K7UA 4JJHA 4ZDHA 3IDJA 4XB7A 3MYJA 2EZ0C 2IH1B 5K9QI 4YFLF 2R4SH 4HUVB 2BHUA 4XPAH 1PG7H 3S35X 3F7YB 4BQ8A 2Y7QA 3BH9A 5I1IL 2LQRA 3CC5A 3B6SB 5BZWA 5E8DH 2WBJD 4GMTH 5J56B 2R1WA 1OPGH 4OKDA 1XGTB 1QTYT 4W6YB 1A3RL 3NIFE 5F9WB 2DQTH 1CGXA 4TULH 1AQKL 2BNRD 3L5HA 2BERA 5IVZA 1JRHL 2X4UB 1EO8L 1T21B 5T3XH 3SKNB 5F9OH 5HHPA 2J8HA 1TPXB 4FZ8H 3DMMD 2CR6A 1NUFA 1RUQL 2W0KA 4FQ1H 3F7PC 1OWRM 3VGAB 2P8MA 3QHFH 4GKZB 5TE7H 2OI9B 4GKSA 2YUVA 3L7FA 1R3IH 2O5YL 4FTVE 3CXDL 2VLLA 5MP6L 4ELKA 3FAWA 3WMSA 1H3TA 3R06A 1A6AA 4RX4A 3L5WA 2M2DA 4GRWH 3U9PL 3RBGA 5C2UB 4WENB 2N7BA 4FQJL 4BZ2H 5DEGA 1G7HB 4NQCE 5CCKH 5T1KA 3BN9D 1S9YA 3P73B 3OKOB 5FM5M 3C8KA 5I8OL 1KC5H 4M7LL 5DJ6A 3X13B 3S6CA 4HXAH 4OBSA 4I2XB 3RA7H 1JZ8A 4G6MH 1A21A 1RZJL 2DQFB 4HS6B 2DM3A 2Z93A 3BDYH 1JF5A 1OQOA 4WI3A 3KPOB 2IG2L 1UXWB 4G9DB 3VXQB 4GAYB 3T0WA 3P0YH 3HCVB 4HCRH 4CMHB 2BY1A 3MV8D 4HG4K 4H1LA 4JM2D 1CICC 4OGAD 2CJUL 5K9QG 2AK4E 5C70A 5I66B 1FPTH 3RWFB 4X7EC 1OWWA 4Q2ZA 5F1KC 1G7MB 1GC1H 4OCRH 4X80H 2GIYA 2Q87A 4AQ1B 1R0AH 3ALWA 2KZWA 1MHHA 3VGHA 1H0DB 4U6XB 4D0CA 3RX8A 2HT4D 5GJSH 5GRXG 1TZGH 4FP8L 4UT7L 1RHHB 4HIXL 1P7QD 3D6GA 2DI8A 4J1UB 5JHLH 5F96H 2JB5L 2BVPA 3PGDA 5GGSY 2Q6WA 3W0WB 4P2QD 4RWYL 2VQ1B 1A7QH 4ODTL 1KJ2B 2FGWL 5GS3A 2FDBP 4RFEB 4P3CH 5C1MB 3MCKA 5A2KH 3GI8L 3FO9A 2XN9A 3SDXF 1CD8A 2EC8A 1AGEA 2I9LA 4GBXC 4EN3D 3QPQC 3VXNA 4Z7NF 2FX7H 3MBEA 4HW6A 2DM2A 43CAB 2O5XL 3MV9E 4TSCH 4KU1A 1RJYB 2PO6C 1WAAE 3MRLA 4KHTH 1J1OL 1QSFE 5E8NA 1B2WH 5B38A 1Z5LB 3MLRH 4Z7WE 1BJ1H 3K8MA 4JFHE 4YDIH 4HC1H 1K5NA 4H88H 4EVNB 2C3VA 2FSEA 1C5BH 3T2OA 5D9SA 1OCWL 5J6GA 3CFJB 3RVUC 2YS4A 1E6JH 3GMPB 5C8JB 3NAAL 5MERA 2NCMA 2VIRB 1I7TB 3U30B 1XR9A 2ZSWB 3BZEB 3NZHH 4LOUD 4RAHA 2W65B 4PJIF 4DGYL 2YA1A 3N9GL 5LCVH 1P9MC 1NGZB 3KDMB 4C56B 4ZDHB 3JTSB 4NFCA 4YK4B 4NWTL 1MEXL 4PJXE 4JFQA 4WEBH 3OKKA 2VZVA 4C83A 3DVIA 5K59E 1MCIA 1VADB 2B4CL 3DVNB 3PNWB 2QHLA 1S7TB 5BZWB 5D72L 2R4RH 3D3VD 3H3PH 1Z9MA 4MXWL 2PKDA 2R1WB 3TF7C 3QULA 4HS3B 5GS2D 1LEIA 1Q9LA 3R1GL 3B43A 3TLRA 3H2WA 4HJGB 2NLJA 4CVZB 4JG0L 2V7NA 4M8QA 4NN5C 5FYKE 2EXWC 3VH8A 2FO4B 2C3WA 2ZG3A 3GHEL 4KXZH 3WIIL 1QPPA 4DGIH 4KJWD 2KDGA 1R24B 5DJZA 3BJ91 4GT7A 3FFCB 4PJEB 1EUUA 4GKSB 1QQDA 2JIXD 2GJ6B 3D39A 4LRNL 1OSZB 1TTGA 4F58L 1RUML 1ZA3A 1CK0H 2A9MH 1R5IA 2O5ZH 3MCLH 4K3HA 5CSBA 1CGUA 1TVHA 1ZANH 4YDVA 4ELKB 5IJVB 5BO1H 5BS0B 3FT3B 3MROB 4L3CA 2Y36H 3REWB 1DBAL 5E2UL 4JFDA 3WDIA 1IMHC 3TN0A 1XF3B 3H7BA 4PRIA 2NTSP 2BCKB 2NY4C 5C3LD 1S3KH 5DEGB 3HE7C 3VD4A 4U1IA 4NNYB 4UV4H 5F3BB 3ZTNH 1YMME 1DTUA 2DWEB 2G75B 3M07A 3Q0HA 5BRZB 4NYLB 3UYRH 1JWSA 5CD5D 3UTTB 5FM5O 5IQ9B 5D70L 1TCMA 2XTJC 3C6SA 5DD6A 3QCUH 4HJJH 5FYKU 5GHWL 3V79C 3CUPB 1FYTD 1LO4H 3O3EA 1G7PB 1MHCA 3GBNH 3MJGX 4JFEB 4OT1L 5I19L 4ZMAT 1BZ9A 3ZDXE 4OZGB 1JTOA 2Z93B 3K1KC 3QDME 4M5YH 3MOAH 1I4FB 3RBSA 3NBNA 5HHOB 2VDLL 4U1NB 5DUPL 4LKXB 1V7ML 1MPAH 3CDCA 4KMLB 5DD3H 3LV3A 1OAZH 1G0YR 3QYCA 4H1LB 5FOJA 2FIKA 4L3EE 3I6LD 3CVHH 5J12B 3GMRB 1JHLH 5F89A 3JUZA 1MOEA 5DHYA 4E5XB 4X4XB 1PEWA 1UH2A 1RURL 5C0AA 3GO1L 5BOPA 3FB5B 1MHHB 1N4XH 3HAEA 1J9CT 4G8IB 4P5TA 4H1LG 5BW7C 1U0QA 4F7TB 2DM7A 4I5BB 1NAMH 1YC7A 3QNXA 1N5YH 1VGEL 5DJDA 4N5EC 2IAMB 3ARSA 3C8HA 4AZ8A 3OKNA 2WUCH 1UZ8A 5IHZB 4XGZA 2GITB 2VRAA 1P7KA 1QP1A 5EUOA 3O41A 5DQ9A 1IILE 2AJ3A 4LP4A 2PTTA 3HNVH 1BFTA 1FO0A 5HY9B 3SDAB 3FO9B 1QFWI 3S4SB 2XN9B 3BQUC 3ARFA 1AGEB 2I9LB 2DLFL 3VXNB 4N90D 4LPUA 3WN5A 1LDPL 3BAEH 2G5BA 1ZHNA 1LO2L 4M6OL 3OMZA 3SE9H 2FO1A 1P4BH 3G5VB 1Q38A 1U8OA 3O8XA 3IKCB 3S96A 4EDWH 1BF2A 1P53A 2LV4A 4MLSA 5TDNA 2H1PH 3S4SG 4LEOB 4G8EA 2NY3B 1K5NB 4WV1A 1F02I 4GQPH 1D5ZA 4Y19B 3P4OB 4G8FA 4IS6B 1FC2D 3DX8A 4LCCA 1MJ7H 1C1EH 3O3DA 3D2UB 1QR1A 2V6HA 4XNQA 1KGCE 1GRWA 1FLRL 1V7NH 3DWTA 2OXGA 1NGPH 3MODH 3O2DA 5EOCL 3NTCL 4RQQB 4MDJA 1YEHH 3GSUB 2XTJE 1YEGL 3BPLC 1DEEA 1NFIB 3QUZA 2XPGA 3NN8B 4JFQB 4NZRL 1N26A 2WWMD 4G9FA 3UJTH 2CUIA 3DPBA 5K9KA 1NMCC 3HB3C 3CMGA 4PG9A 3WS3A 2ATPB 1D6VL 1ZMYA 4RGND 1CT8A 1AQKH 1DBJL 4JFXB 1H3PH 4P23D 5BJTB 2LAGB 4N8VB 1AR1D 3LH2L 4UQ3B 4TVPH 2F8OA 1OTUC 3MLXH 1I3VA 5E95B 4PREB 5HD8C 1L4IA 2V7NB 1TETH 2J88H 4KKAC 4M8QB 5JR1L 3TVMB 1JGVH 5JW5B 2V9RA 4Q9RL 1MCRA 4OZHF 4NM4L 4N8VG 3D18B 3GSNL 5DO2D 2O5YH 5DJZB 3MLUL 1AXIB 1RZFH 3K3QA 3PWLA 4HKBA 2QL1A 4MA7H 4GG6A 2YPVL 3EDFA 1F3RB 1G1CA 4JZOB 5JW3H 4LPXA 4YDVB 5I16A 3SE4A 4O2FA 1QRND 3QEUA 3O45A 3HNTL 1A2YB 1WCBA 3Q1SL 2FL5A 3GDBA 2YPLA 3O6FA 5GZOC 5GJTL 3KLHC 5DZLA 5HGHB 3SY0B 2NXZD 5GRJH 2CLRA 3Q6GH 5CIPH 4LLYA 1U41A 1A3LH 2E3VA 2B5IB 3CFCH 1IGTA 3QCTH 4IJ3C 5DD6B 3TA3A 4NP4H 3X17A 3ARVA 4PJ8C 5CJBA 4Z7VE 3QIUD 3RWDA 4OKVB 4MAYB 3JUYA 1WFNA 4JGMA 3RL2A 4GJTB 3DX7A 3GEWB 4BK4A 4HIIB 3BP6A 4WUUD 3T0XA 3SGKC 3W9EB 5MEND 2LABA 1K4CB 4ZAKC 2BVOB 2NY5L 5DRNB 2A83A 2CO6B 1WGOA 3MV7A 1A1NA 3DROA 3FHAA 5B21A 2V2XA 2ENYA 2QQQA 1KCLA 2FIKB 3W82A 3TBVA 4FTVD 5F89B 2EH8H 4KVCL 5DHYB 4UT7H 4L29B 3INUL 1PJ9A 4KZDL 1JGLL 1JL8A 3VG9C 5E99H 4MB3A 2ZUVA 1QVOA 2ZZUT 1S9WA 1P69B 1QBLL 3KR3L 1C16A 1BOGB 5I1HL 4JQIH 3QNXB 4Y0GA 3O4LE 4NQCD 2FX9L 2Y6SD 1YPZB 3OKNB 2RIKA 2GK2A 3LD8C 43C9A 1IM3B 1P7KB 1NC4A 1PX3A 3HAEG 3M45A 4ZXBC 4R0LC 5EUOB 2CRMA 3VI3F 4R4BA 2A0LD 5JMOC 2H6PA 2XWBA 5IFHL 2CXKA 5F6HJ 1IGIL 1RZIB 3RVXC 3WEXA 2VDMH 5T1MA 5DRXA 1J1OH 1IKFL 1ZHNB 3G5YA 2ATKA 2DJ4A 5D7LA 1U8OB 2AEQL 4G6KL 2ZNXA 5D1XC 4EUPA 1N0LA 5FYLE 5TDNB 3OX8B 2AK4D 3NAAH 1TQBB 1REIA 1E4XH 4TUOA 2C1OA 5GXBB 3QRFM 2ARJA 2O26U 1EXUB 2HMIC 4LSTL 2EZ0D 5EU5A 2GSGA 2F5AH 1HKLH 1UM5H 4HKXB 4TNWK 5FV1L 3UTSB 3DX8B 3ESUF 4XXDB 1XFPA 1YUHA 2GK0B 4LSUL 3OHXA 5B8CA 1B6DA 2JTDA 3MO1B 4HMCA 5IEKB 5KVEH 3OG6B 4PIRF 3VXRB 2BSTB 3P0GB 1IBGL 1S7QB 2H32H 2BRRL 1NMBH 5IB3A 4HLZG 3KNBA 3QUZB 5D2LF 3K4ZA 5D72H 2QKIB 5FECA 1YA5A 2DN7A 4RZCA 2VDKL 4K3JL 1D5XB 5K9KB 1UCBL 3L6FB 2BK8A 3E6HB 4NQEB 3KXFE 1NBZA 5E00A 4Y1AE 2E27L 4DUWA 2V2WA 5C0DB 2F15A 4Y8DC 4D9QE 1P5VA 3WIIH 2PXYC 2W0FA 5TJWK 2EE9A 4D3CL 3KPSE 2IJ0C 5F6HI 1QSFD 4WO4B 2VZUA 3UDWC 3GHBH 4GQ9H 1T83C 2CLVB 4YE4L 2OMBA 1G9MH 5BXFB 2BC4A 5DVKA 1RUMH 3NCYS 4U1MA 4XAWH 1AKJD 4CDGC 4NZUL 5F70A 5D1ZD 1VPOL 1QSZA 5CGTA 2NTFA 1TLKA 3HPLA 4NZTL 1RAMA 4OD3L 4NN6C 2VDPL 1EK3A 4F9PA 3DSFH 5CZXD 1S9XB 4LU5L 4ZNCD 1BQUA 5C7XH 4GG6F 1LE9A 2L4OA 1DQML 4QTIL 1NBVL 4HQQL 4OF8A 4LHUA 3ZYOA 2QR0A 4RDQG 5FGCE 5M94B 3CLFL 4Z7UA 5C86A 3BKYL 3D85B 4I4WA 1A7RL 3WFDH 3O6FB 4L8CB 2GY7B 4XHJC 2ZUXA 3T1WA 1M6OB 3GRWA 3T0EC 4PY8I 1WFOA 3O6LH 4XRCA 5ANMA 4JZJC 5SX5H 2AJYL 4YXKL 1FVEA 2EDLA 3G5XA 1J8HB 3S98A 4Z18A 2BX5A 3OKLA 3RX7A 1U3YA 5FIEA 1BEYL 3HMXH 4HDIA 3TM6A 1OAYL 3KYOB 1CFBA 3QXDB 4XMLL 1CFQA 1H8OA 1SBSH 1F45A 4JZNA 5FYKD 4WHDA 5DHXB 2D7PA 3RL2B 5FKAA 4JFFA 1SYSA 2IANE 3BP6B 3GMMB 2JKXA 1TZIA 3WXWL 5HGBA 3U4EB 2BSRA 4I9WE 3PWVA 5I9QB 3MV7B 3DROB 2F74A 4V1DA 1HHKA 3GO1H 1UC6A 2VLME 3LSOA 4OQTL 3U83A 4Z5RA 4UAOC 2VDOL 1JTPA 5DJXA 1DQDH 4XNZB 3TBYB 1NEUA 5EPMA 4ODHL 5ACMA 1IL1A 1NAKH 4XPBL 2R2EA 3GJFK 3PP3K 1GZPB 3MNVA 2FHBA 4X6EB 4GBXD 4ODUA 4YAQB 1Z9LA 1U8KA 1YMMD 3RNKB 4QHMA 2HJFB 3G6JF 4F80A 1NC4B 2HTLC 4PRAA 4KDVA 4M1GL 5CKGA 1Y6NR 1EERB 3SQOL 1FORL 4ODXB 1K4DB 4L4TB 4M6OH 5E08H 3TNNA 1HWHB 3RKDC 3JWNC 1C08B 3QDMD 3BZ4B 1MIMH 3IVKA 2KZ1B 1T7VA 3KLAA 2EE2A 1WTLA 3W9DB 1OLZA 2DD8L 5FUOH 3OJDB 4HT1L 3GSOA 4K7PH 4EUPB 1T0MA 1A1OB 3F6IA 2HFEA 3MNWB 4L3ED 3U46A 1RFDL 2C4FU 1MFNA 5B22A 3Q5YA 4JGJA 5D71L 5EO1A 2C1OB 2ARJB 5H37H 3RGVC 1IQDA 2GSGB 4X6CA 4HH9A 4R8WH 2Z31A 3DUUB 1YUHB 3BT2L 5E6IA 1T6VN 4EUPG 2FATL 1A6WL 4QO1A 3T0EE 2YKLH 1GGIL 1VENA 1NJ9A 3BXNA 3IF1B 3QDGA 1HHIB 4HX1A 1AIFB 3BRFA 1TVDA 3V8OA 5IMKB 1D6VH 3OR6B 4PGDB 5FECB 2XRAL 5F44A 2VQUA 5DA4A 3S34L 2HFFB 1AXSB 5CLTA 1NBZB 3ROOA 4IMKA 5E00B 3VD7A 5A40E 2DJSA 1RK1A 4AH2B 3FOMB 3PE9A 2Q86B 2HKHL 5ESVA 1IC7L 5C0EA 2AK1L 5FF6A 4NM4H 1QOKA 4OV5A 3PWJB 2J12B 1RY7B 3IFNH 2LU4A 4OM0L 5I1GH 3H9SA 3ZO0A 4TPRL 2VZTA 4LBEB 2A6IB 5JHDE 1AR2A 2ZWLT 1YNKL 1L0YA 1RZKL 1YYMH 3IAPA 2NY4D 4NUGH 4UILH 4HIHA 1D7FA 3ZSSA 3HE7D 3HNTH 4WJ5A 5LGJA 4OAWB 2NY0B 1KGCD 1BD2E 1MF2H 3MRHB 4OQ1A 3VRIA 1G9EA 4GRLA 4ODWA 5HPOA 3IJSA 3OAZH 4L9LB 1V5JA 5EUKA 1QLRB 2ADGA 4MCZB 2XTJD 2AJSH 4WDIB 1NUGA 2EYSB 3CU1A 3QZWA 1RZGA 4U0RC 1N2RA 3QFJE 1ZT1A 4Z8FH 4ORGB 2DWDB 3PV6B 5I74C 2KQNA 4NHCH 3VFGH 4QYOB 3RY6C 5KBNC 4LHUG 4DVRH 4NDMB 1FVEB 5LWYL 5FA3B 3RUGB 3L9RA 5I1LB 1JPFB 3TJEH 1I1CA 3RU8H 4KK9C 1UB6A 5TDOB 2NY5H 2P8PB 3T0AA 4JFFB 3RFZC 5C0NC 4YHNA 4N1CA 1I3UA 1WBZA 5I1EH 4I13B 3GGWA 5IW6A 3EO0B 2J4WL 4CU7A 5JMRA 2F74B 4V1DB 4KZDH 4UOW1 5EU6D 1KB5L 4N5ED 1YEEH 2VE6A 2N4IA 3U0PB 3ES6B 4P46B 2AJVL 2R1YB 3SOBL 4JFYA 4MA1B 3S5LA 5EPMB 1P5UA 3SCMC 1MQKH 4I1NB 1IL1B 2R2EB 4PD4J 2P5EA 3K1DA 4ODUB 2QQLL 5SWSB 2BSSA 3QDAA 4HUKB 5IW1A 4AENB 1DQJA 1O5DT 1LK2B 2DLEA 4LARH 2ADFL 3KLDA 1AC0A 3MUZ1 3MJ8A 2H2SD 3C60C 1IAII 1KCRH 2DMCA 2IQ9H 3RWJB 1CIUA 3SDCC 1A64A 3KYMB 4X5WA 3BUTA 1UYWH 3IVKB 5BVPH 5AZ2L 3T3MF 1Q9KA 4APQA 4MJ6A 5IB4A 4I48B 3QHTC 1J8KA 5KSAC 4JAMA 3GSOB 3V7AG 1S5HB 5EIVA 4F7MB 3QA3A 3WBDA 4Y5XC 4KFZC 3MRJA 4PJCE 3KYAA 3N1QC 3OPZL 2VISB 5EO1B 2A77L 3JWOH 4IMLA 4H1LH 5IV2B 1HEZA 3L3HB 4L8DA 4WFED 4X6CB 3RWGB 4PRDA 8FABA 5JQ6L 4R3SB 3HB3D 4P9HL 2IPKB 4NKIH 5KVGL 3O4LD 5K9JL 1BHGA 3CCHA 3ARQA 3BXNB 4XVTL 1MRDL 1D9KD 4HX1B 2VDKH 4K3JH 1H5BB 5A2IH 3Q2CA 4JJ5B 4RFNB 4I18C 2D9QB 3BKMH 5CS7A 1EV2E 4RISL 5ESQA 4NWUH 5HD8D 1OGAA 2EXYC 3ZDYE 4KKAD 4MVBC 4ZG1A 3QRGL 1UQSA 5E1AA 3KGRA 3VFUA 5I1AA 4P2OB 4P2RA 1RULL 1MHPH 4OUUA 1DFBH 4JN2A 4M93C 8CGTA 3EYUH 1CD1A 5DDHA 2VXTL 1RK1B 2QTEA 3TZVA 2F53B 1KJVB 3GK8H 1RUKH 4PRHB 4M6NL 4XVJL 3UJIH 4JANB 2P1YA 1OSPL 1QSEB 1ONQA 3SO5A 4E42A 4FXLA 3MBXH 3H9SB 3IDNA 1QPXA 4K7FA 4NQVB 4OD3H 1IC4H 4GKNB 4J4PC 2UWEF 3FTGB 2DLHA 5AUMA 2QEJA 4NN7C 3ULUH 2DYPB 3AXLB 3L3IA 5ADPL 4HIHB 5GZOD 2ZCLL 1F3DH 2DQCL 2X1WL 3SJVA 4NZJA 3RTQA 4NO0D 3MPCA 1XIWA 4PTUA 2ADGB 4MJID 4QT5A 1FL6B 1TQCC 5ALCH 2X05A 3UC0H 1C5DA 1ZLSH 2RJMA 2B1HL 1VA9A 2P4AB 2AJYH 1FG2A 1EEUA 4QWWC 2HT2D 2GUOA 3P4NB 3EJZC 1BEYH 1FGNL 3Q48A 3PQYB 4ZAKD 4TSAL 4MCYB 4NNPH 1WFTA 4Y1AD 4Y16C 2WQRA 3QZWG 5CSZB 4BK5A 4D9QD 1E4JA 4U7SA 3QI9C 2CMRL 4GUPA 1HHHB 3ZMRA 2YD9A 2ICEA 2AEWA 5TFSL 1BBJA 2I5YL 3C9NB 1B0RB 1I1RA 5EOCJ 4FQQA 1GOFA 1XCTA 3NGBC 4KDTA 1BM3H 4DK6A 5D2NB 5IW6B 1P7QA 1MHEB 1NFKA 4XWOD 3I02A 4JKPH 3MQIA 5JIPA 2C26A 5D4QA 1QFWH 2I9TB 1FRGL 3ET9F 1I1AB 1AD0A 1NH6A 1HKFA 4G80A 2VE6B 4JM4L 5C0CA 1I9IH 2VYRE 1S9VA 2E6QA 4ZXBD 1ZE3C 4LK4A 2X4QB 4N0CC 5HYQB 2BVYA 3QFDA 4OD1L 4ZOBA 1Q0XL 4X7SL 3QEHB 4I3SH 4AEEA 3HC4L 2DI9A 2PR4H 4JHWL 1CE1L 1CVSC 4ZOCA 1PY9A 3TO4D 1E4WL 5DQJA 1YY8B 5EZIL 3RAJL 4DEPC 3FO1B 4W68A 5BV7L 1MELA 3HE6D 2MCPL 3S5LG 3LKQA 5D1XD 1KNOA 3TV3H 4PRNB 4UV7H 3E2HB 4X6BB 4F57L 3RQ3A 1KYOJ 1UA6H 2PYFB 1J5OL 5EBMA 2HMID 2YD2A 4P5MA 2IAND 5I17A 4HT1H 4X5WB 2MWCA 3M1BB 4ZUWA 1WQVT 3K4AA 1Q9KB 1B90A 4I9WD 4NO3A 1HK6A 4NKOB 5D6CA 3UTZB 2X7LB 5ICYA 4N0UE 1NCTA 2P43B 2VLMD 2I25N 4AEIL 3L7EA 4ERSH 2G60L 3QG6A 4YHOL 4L8DB 5LGKA 5C2BH 4PRDB 5KOVC 4PJBA 4IRJC 5DD0H 2OI9C 2VC2H 4KRPC 4RCAA 5HSFA 2WBJB 4CVWA 3FB7B 2OK0H 5DJ2B 5HYJE 3HAEH 5CEXA 4MX7A 1UACL 4K9EL 2ZP0T 4JPIA 1SJXA 2DQHH 5GRUL 5CEZE 3S34H 1KCKA 2PXYD 5DRZB 2BNRB 4OI8A 3BZFA 2LVEA 4H5SB 3G04A 3MR9A 1NKOA 3QNZB 5JXED 5E1AB 5I1AB 3UTQA 1BFOB 5AZEL 3DMMB 2HKHH 4ODSH 4C54A 1BJ8A 2OTWB 2FEEL 4LCYB 4WRLA 2RCSL 1CD1B 2A6DA 5DDHB 3TZVB 4YHYB 3FN9A 3NIDF 1FO0H 4OM0H 2GW5A 2W60B 2NNAB 1JPTL 3BHBA 2ZSVB 1FJ1B 5HHME 4AG4H 4XC1H 1HI6A 3IJYB 1BMGA 4KPHL 4Q58C 4K3DL 5CILH 3L5XH 4L8SA 2R29H 2IQAB 3IU4H 4CJ1A 4FFYH 5C3TA 1AGBB 2DQJH 4ETYA 1DDHA 5KJRH 1GYAA 1G7IA 1J0ZA 3EYSL 4PJDA 2AV7A 1BQHB 2H26A 4CMHC 3SGJC 4CW1B 4X5LA 2NX5E 4HLZH 1T5XB 4R4NC 1DN0A 2IMNA 4HUUA 4ZUUB 1OAXL 1IGYB 4QT5B 4J3VA 4LNRB 3TT3H 4RBPH 4M43L 5JNYA 3O2DH 1CLOH 1EHXA 4M5ZH 1SVZA 2P24B 3G08A 3TC9A 3H42L 1ACYL 5E8PA 3JV5A 5CJOL 1HWGB 1MFEL 2QSQA 2IGFL 3MNZA 2SEBA 5L8KB 4PJFA 1JMXA 3MV8B 4PLKC 4JM2B 4MNQA 3BEWB 3KYNB 4MXQC 5GS0D 3QUMB 2HT3C 2CR3A 3C5ZC 2NW3B 4FQQB 1AI1H 3GSNB 1EGJA 1XCTB 5JHDD 1JUFA 1P7QB 2EIEA 2I07A 1JJUA 4N8CH 5ALBL 6CGTA 2MCG1 5HGDB 1Z0NA 2UZIL 1U93B 3SDDA 2B2XL 3QDJE 3BIKA 4OIAA 4P2QB 3UCRA 4PP2A 2HTLD 2JJUA 1WF5A 4JPVL 1NMAH 1ZA6B 4QGYA 1G7JB 2JCCE 2RHEA 5IT2L 3MRFB 1MJ8L 5FHAH 1F00I 3QFJD 4PJIB 2XQYK 4G6JL 4FZEH 4EN3B 2YD8A 1KPUB 5K93A 2E7CA 3WO4B 5J13B 1ZHLA 4MNGB 1B0WA 1ERNA 2YK1L 2BY3A 4HV8A 4KUZL 4QGTA 3LKQB 1KNOB 4NO2A 2E7LA 3MYZA 5SWQA 3RIFK 5AZ2H 2VDNL 4H26A 4QHLA 2Q8BH 3FO2A 4P5MB 5I17B 3DGGB 2DLGA 5C0RL 1MH5A 2AJZA 4HZLA 4XT1C 3OPZH 3D69B 3IXAB 4G6AD 5ICYB 2XTLA 3TJHC 3CGTA 5D7JA 5JDJA 3V0VA 5BQ7A 1ND0A 1DP0A 1TCRA 5HHNB 5IM7A 1OL0A 3QG6B 1UWXK 4EOWL 3SDYH 4P9HH 1MCCA 5GGSA 1MCDA 5LXGL 4NJ9H 1AHWA 2VUYA 1B6UA 4PTTA 3D3VB 2BNQA 4ISVA 1FFOB 5FUZH 2NY1D 4WUKL 2JLLA 4ZD3L 3ZT5A 4IRSC 3QRGH 3WUWA 5I75C 4JPIB 1C7SA 1OP9A 3IS0X 5F3HA 3W0WE 5IWLC 4CVXA 4TUKH 4XWGL 5HI4C 1QFOA 3PGFL 1FZOA 2VH5L 3VFVA 4AM0B 5H35A 3UTQB 3VMOA 3FQWB 3OTTA 5FGSA 3QG7L 3E6FB 1KXQE 5GIRA 3MUGA 2JIXB 1F5WA 3UJJH 3WLBB 3BIBX 5IROA 4KKLD 5FCUH 3C6LA 5IBTH 1CDCA 4P48A 1QRNA 1AJ7H 2FR4B 2VL4A 1A9BA 2J8UB 3VFWB 4DK3A 5INCA 4JG1H 4EUPH 1Q9OB 1U3HA 5B4MC 1WSST 2DIJA 2X40A 4PP1C 2BOCA 4KI5C 4R9HA 4Q7DA 5C0FB 4K7PX 1BAFH 2VSDA 3GM8A 3ROLA 1BIHA 2H26B 4Y2DA 4CL7A 4PJDF 5KTEL 3F12B 4JO4L 3R8BB 1U58B 2GCYB 4OLZL 3K80A 4KRLB 2B1HH 4K3EH 5CHNB 1MIEH 2UVFA 4MQTB 1FYTB 4U3XA 5SWZE 4KK9D 1BZQK 1YEIL 4CU8A 4TSAH 4YGAB 3ULVC 3G9VA 3NZ8B 4QXWA 4LKCB 3V52L 4QOKD 5C0ND 3PP4L 5DSCB 5E8PB 2MNUA 5BMFL 5B3JE 4GXVL 3OR7A 3MNZB 1X7QB 2GFBB 1CGYA 1PFCA 4YHKH 1ES0A 1LEKA 1MNUL 3GB7A 1FC1A 2EIZA 3F62A 5DVNA 4BQ6A 4U05A 4O5LH 3MRNA 4S11A 3VW3L 3PXJA 2XQBL 1CDHA 3OKEB 2EYRA 5F7LB 2HFTA 5DUML 1ZLWH 5ITFB 3UAJC 4KROC 4X6DA 3SCMD 3U4BL 4KJYB 3WNMA 4BUGA 1OTTD 1VSCA 3MRRB 3X11A 2JJSC 2I07B 2OJZH 2GJ6E 2C7UA 5ID0A 4TRPH 3IDMA 4OD1H 4ORZC 5I15H 1X4YA 4RAUA 1U8MA 3ZKND 3WHXA 1IKNA 4Y7MA 3MLSL 5IJKA 4PJ9A 3CXHJ 4PLJC 3C60D 5JOPD 5K9OB 4QCIA 1OD9A 4RMUA 5JIKA 4TQEL 5T1LD 3SDCD 3A6CH 3V4UL 5L7XL 5DR5L 1YN7A 5GRVK 3UTPE 1EHAA 1T04B 2PYEA 1DANU 3T4AA 4IEFB 1J5OH 5DF0A 4HMEA 2AAVA 5KSAD 1I3RB 1PGRB 3GRWH 2EEDA 2QQKH 4HUMB 5CJ8A 1DN2A 4HWBL 5HYSA 2AK4A 5L2JB 4KGJA 2HLAA 5EG6C 4JPKL 4LLQB 3TIEA 4H26B 2VLJD 4JFEE 4I77L 3V5DA 2ZOLA 4XCYA 3VU2A 4F2MA 1X5AA 2B1AH 3FB6B 4U6VL 1GPOL 1IQWH 1K8DA 3KPPB 4PJHB 4KI5E 3VFNA 4BH7B 4B53A 5HHOE 4XI5D 2XY2A 2W9EL 4YHOH 1L9NA 3PWPD 1I1FA 3V0VB 5HI3D 4HFUH 3GSXB 3OKDA 4PBXA 5IM7B 2YWZA 3ZZ1A 1P7HL 4N5UA 2V9QA 4FNLH 5CEYA 3TVMC 4JRXD 3GZKA 4QXUL 3I85A 3ULVE 4EJ1C 1DE4A 4XAKD 4K9EH 2KL6A 3DIFA 4RGNB 2ORBL 4NC0B 2CPCA 2R0ZL 3WIHA 4PJGF 4R97C 3KHQA 1K8IB 4P23B 3A6BL 1U8JA 3HPJA 3QUYC 3MV9A 4CVUA 2CIIB 1KEGH 1NUNB 5GS0L 1WAAA 2GYSA 3WFEL 2OTPA 1AH1A 3LKOB 3OJMB 5HJ3A 4FRWA 4Z7WA 4LCIL 4GS7B 5HDQH 3BYYA 2FX8L 2H8PB 3GBMH 3HS0A 1ORQB 4PRPA 5EORH 5CKAA 3I3DA 4P5KB 1RUAH 3RWEA 2X42A 4BFEA 3WJJA 4DCQA 4NPYB 1CIDA 4DAGL 4LLVA 4FFWC 1WBXA 1UZ6E 4LHJB 3O3BA 2AXGA 1QRNB 4N9GA 1R3LB 2D7QA 3K0WA 3WJLA 1HXMA 1CLYH 3DLQR 4X6FA 4LSPH 2HLFC 5BZDA 4HKJB 4G8GA 4PJXA 4Y19E 4WCYL 2KBGA 3D9AH 3NH7H 2CIKB 2NXZB 5I8CA 5HDLA 5J11B 3Q6FB 4HK3N 2VDQH 5E1HB 3EJZD 4DZBA 5J4MA 5IUSA 4WWKA 3LHPL 5HYJD 5J0BA 3S88H 4U1SB 1KCUL 4BSWB 2D9CA 1CICA 3MGTA 4HEPG 5CEZD 2R2BA 3QQNA 1DUZB 3QIUB 3QI9D 1JVKA 1SY6L 4WI9A 1M05A 2MHAB 4KHXH 1S8DB 2ICES 2IGFH 1MCJA 1EMTH 4WUUB 2DQEH 3G6AB 1KT2A 5T3ZL 5MENB 5T1DH 3STZA 3KPLB 1VERA 1OOAA 3QQ4B 1CDUA 3MLYH 4NQDE 2VWEC 3VJ6A 1PD6A 2HKFH 1CR9H 5JTWA 3CK0L 5HHMD 1LP9E 1MCHA 4FTVB 1HCFX 3CFDA 2NPLX 4ZUVB 4YHZH 3T65A 4N0CD 2NZ9C 4EIGB 2XA3A 4IOIA 2UZIH 2B2XH 1MVUB 4WI7A 4X6DF 4FQIH 2XZQH 1KIPA 5D7SL 4NQCB 4GOSA 3CH8A 4MB4A 1IAIH 1T1YB 3DHJA 4M7KH 2VKWA 4AMKH 5ID0B 1JNNL 2C4FT 4ZTOH 2HH0L 2PF6A 1MWAL 1U8MB 2VR4A 4BA8A 3RGHA 1DEDA 2PO6A 3WHXB 1UJ3C 1BVZA 1MFAH 3QWRD 4XX1E 2E7BA 1INQB 4UIKL 5IK3A 1FFRA 1GC1C 4NM8L 3QXTA 4XP9L 1J11A 4Q9CA 3IFOB 1A7OL 1H15B 1RK0B 1YN7B 4ONHA 5TQ2L 2IEPA 1ETZA 3T4AB 5CZVH 2Q1EA 4MQ7B 2APFA 1HDMA 4AL8H 2AK4B 5C0RH 1P9MA 2HLAB 2CO7B 5D7IA 1G9NH 1ZEAH 4XCYB 4F2MB 1T3FA 3ARWA 4XXCC 5IKCB 4JRYD 4JR9L 2WSKA 4XP5L 1NGWA 4XMKL 4HIJA 1C12B 3RHWF 3HC0A 4IRJD 1L7IL 3QUKB 4KRPD 4LEXL 4EOWH 4FABL 1U3JA 1AQDA 4ZS6C 1KB5B 3KJ4C 4QHKI 3TYGL 4FXGB 3OXRB 4WO4C 3QDJD 4UT9H 5CEYB 3QWQB 3LRHA 1N64L 3JWDL 4LSQL 1VFBA 3NFNA 1TNNA 1A3QA 1P2CB 5CWSA 3WNLA 2HFGL 2ITDB 5IR1A 1OQXA 2VWEE 1NANH 2EECA 1YPZE 2D3VA 4LVEA 1KXVC 2HP4A 1V3LA 3NCJL 3HUJF 4WHTA 2YHGA 1QSFB 2CRYA 2CDEA 1YZZA 3AU1B 3TPUA 2W07A 1XGPB 5T5FH 1L7TH 4Z7WF 4LLUB 3DUHA 3OGOE 1NCDH 4PBWD 4KZEH 1AKJB 5D1ZB 5ISZD 2F5BH 4WEMB 3HE7A 3RWEB 4M7JH 3BESR 3FKUS 2X6MA 1KPRB 2OLDA 4LLVB 5IMLA 3QIWC 4U1GC 2H2PC 4Z95L 3O3BB 3DYMA 4R4ND 1JE6A 1HXMB 4ELMF 4UB0L 3S35L 2D7TL 1R3KA 4KMQA 3F58L 3QH3B 1DQTA 5I8CB 1XR8B 3RVTC 2CUHA 1RU9L 4YZFF 3RIAF 4WNQB 5CJQH 1QSVA 3I3EA 1DQLH 4QTHB 4PFEA 3OSKA 5FYJH 4D0DB 5KAQG 2AQ1A 4K3GA 4PGBA 3UBXA 3VXRE 1UKSA 3IYLW 1MCFA 5CGYC 3GIVA 5DI8B 4B7IA 4I0PD 4MXQD 3ILQC 3TBSB 1KG0B 5BMFH 1M05B 3L3JA 4KQ4L 3CFEA 2HT3D 3VFRB 5IQ7H 5JXAH 3EYVA 3C5ZD 4Y4HD 4JY5L 5FOBA 5C07E 5I1KL 2A73A 1NBYB 3BE1H 2ADJA 3G6JB 1AD9A 2NYYC 5HYEA 1X6NA 4N0FA 5BW7A 1NSNL 1FYHB 4NQSA 3QWOB 2VZ3A 1MCOH 3NCEB 3EJYD 3DETC 5IP4A 2F19H 3HHRB 1YNTA 4GW1A 2R0WL 5C08A 5EZOL 1IGCL 1P1ZB 3L95B 2H9GA 2WIIA 2E6JA 3UPAA 2UZYB 2ITCA 4DZ8B 3BQUA 4HAFA 5ICXA 5ILTH 4GBXB 4J12A 4P2YA 1YMMB 5IB5B 1A6TA 3OJVC 3CDFA 2L0DA 4LF3A 1FH5L 1R5VB 1VFOA 1I9JH 3ALPA 3M17B 1A6PA 4O02H 4XBPB 1FFQA 2Y5TA 1QA9A 4NRYA 5L7XH 5DR5H 5SWZD 2C3HA 2W1NA 4GW4A 2IALB 1KN4H 1JWUA 3QDMB 4XPGL 3T09A 1XGRA 1MREL 3IDGA 4ONHB 4WFHE 3IU3A 4PD4K 4ZPVA 1UH4A 1A4KA 5DC4B 4LLDA 1UFUA 3GSWB 1XGUA 4NOBA 5GGVL 4Z77B 2PCPB 4L3EB 4PG2C 1AFVH 3U36A 1CG9A 2C9AA 1IAMA 2WLYA 3DRQB 1X6LA 1BP3B 3JTTA 4K8RH 1AC6A 5D7IF 4PS4H 3T2NL 5HVHC 4HIJB 4PGEA 2EH7H 4MXVE 3ZE0E 3DBXB 1GCFA 3VXUE 4IRZH 4MDIB 1G7QA 3REVB 5MEOB 3UBXI 1IRAY 1FFPB 4M62L 1NGQH 2MMXA 1IFHH 4IRSD 4TOYH 4CN1A 2FZ3B 4X4ME 1HYSD 1MCQA 3QO0B 2VXUL 5DS8A 9CGTA 5D5MF 4C59B 1NEZB 5IB1A 1IEBB 2P47B 2DQUH 2XWJA 4OZ4A 4FXKA 3MGOA 4S1DD 1I8KA 5H94B 3UTPD 4UIMB 1GAFL 1VDGA 2VNCA 4H20H 4GAGL 1NEZG 4WHTB 4L9LC 1QFWM 1PKQA 4LIQE 2CDEB 3TPUB 3EFFB 5L88H 2DMBA 4JDTL 1LEGA 2R2HA 4L4TE 4KAQL 1KCVL 1BQLL 3VGEA 3I2CL 2GJJA 2HJLA 2NY4B 5SX4I 2VL5B 4Y4FC 3AM8A 3HNSH 3HE7B 5C6PB 4PP1D 4KI5D 5FO8B 4HHAB 2OL3L 4NKMA 5IMLB 2HYMA 5JA8B 3FB8B 4XCEA 3R8QA 2F58H 4O2CA 5MI0B 1JHTA 1CZ8L 4WFFD 4N1HB 4OM1L 1FIGH 2XTJB 4Z0XB 4XNYL 1YN6A 3ETBF 4PJ8A 3VFSA 5I1CL 1CGSH 1XF2A 1T2QL 4GG8A 4IIQC 5F1IA 2OJEB 5HHXL 4BZ1L 4X0KB 5F9DC 4R96B 3U6RA 2Z91B 3KXFA 5HVWA 1KEML 4PGBB 3UBXB 4HUWB 4LNVA 1OGTA 2FRGP 1U3ZA 1I9RH 2YD3A 2YMXH 1A6VH 3HZMA 4P46C 1QLEH 3KPSA 1NGXA 2R0KL 3ZHLA 3CFEB 5MHSD 4R4FH 3KG5A 4X7TA 3ULSA 4KY1H 2FECL 1RJLB 3UBXG 3CK0H 4KROD 4J3XA 3K8LA 5I76B 2DQDH 1FE8L 4N0FB 4PJ5A 2UYLB 5E94A 2W59A 1MCLA 5EU6B 4HFWB 3WYRA 32C2B 2YC1B 2X89A 4KTEH 5IVXF 4ZXBA 4HD9A 3V6OC 4R0LA 3QUXD 3BUYB 3WIFA 1RZJC 1CF8L 3RI5K 4PLJD 1QBML 2ITCB 5DD5L 3EYQD 2P7TA 4N8PA 3SBWC 3HI1B 1OAKH 2DQIL 1A6TB 3ABZA 1NLDL 1WTGT 4F7CA 5KVFH 1J1PL 1FFNB 4NGHL 3U9UA 2Y5TB 3ARRA 3C5JA 5D1XA 4NRYB 2D0HA 3X12B 1PAMA 3OAUH 5F7HA 4MNHA 1R3JB 4Z7VB 1BBDH 1ODAA 4IOSD 5E9DA 1NDMB 3CH1A 5DEFB 4OLXH 1HINL 3OWEA 3CLEL 1QR4A 2D7NA 3MZGB 5GSRA 4MA8H 1A47A 1LE5A 4DFIA 1XGRB 2AVGA 2YD5A 3A0OA 1FBIL 3QQ3A 3KS0J 3T8XA 1FL3A 4YPJA 3MRMB 4LLDB 4NQDD 4P4RA 5GISH 4TTDC 3MLZL 1LQSR 1H5BC 1EBAA 4RFNC 3RUGE 3L3OB 4KVNL 3FMGH 4O58L 4RA0C 4XP5H 3UEZA 1UM4H 1DLFH 3BPLB 3JTTB 4RAVA 1WC7A 1MLCA 3KYKH 4LEXH 1CQKA 1KYOK 2VR9A 4OCWL 4IDLA 1G84A 1QHOA 1QG3A 3MV01 1GGCH 1F6FB 1NMCB 1VEMA 2Z8RA 3MACL 4HAGA 1TJIL 3O4LB 1N64H 1EGJH 3JWDH 3PL6C 1H8NA 1D9KB 2XZCL 1UXSB 3RWCA 5HPMA 3S9DB 1I7ZB 2UWEB 5DUBA 3QEQD 3QUYD 1NLBL 3QCVL 1VFAA 4CGTA 1F8TH 2QADC 3UDWA 1T83A 3RNQB 1OHQA 1ITCA 1T1XB 2XWJB 4E9LA 2F54E 3LKNA 3UP1A 1I8KB 1UWEH 1BFVL 4Z7QF 3KPQA 4NC1C 4DGVL 2Q76B 5SWSE 1U8HA 4P2CG 4K2UL 3T3PF 5DJYA 3OKYA 4X5XA 5AYUL 1YDPA 4FFWD 3PUCA 4TNVF 1JNLL 4JN1H 1LEGB 4D9RD 3U0TA 2R2HB 3V6OE 4FQXC 1FP5A 4P57A 1BIIA 4XVUD 2HJLB 3EGSB 4Z95H 1LNUA 4OLUH 5I2IB 4FQLH 5T3XD 1W8NA 2Z4QA 3T0EA 2D7TH 3M8OL 4OFYD 4XCEB 4NO0B 5BVJB 4GRMA 4WIQA 4HBQA 3F58H 4MJIB 3MLVH 4IJ3B 2YN5A 3STLB 2ID5A 2WBKA 3QHZL 5LQBL 5EC2B 1BLNB 3LN5B 5I8EB 1AGCA 1U42A 1KFAH 1G9MC 3FOLA 4ZAKB 2EIBA 3KXFB 2P48B 4LPCA 3H9HA 4G6FD 4L8BB 3BKJH 4Y1AB 5J3HC 3EOBA 3OAYH 4KQ4H 1KLFA 3LS5L 1X4XA 2D4DA 5JPNA 4F37K 1M7IB 1Y18A 2BXYA 1NGXB 4KKNA 1HHJB 3VG9B 1KACB 4D0BA 3MMEA 2QSTA 2NZ9D 4YUEL 1AGFA 5EA0L 4LL9A 4EI5D 1G6RA 2AKRA 4W4OC 1HN1A 5B39A 1J10A 2F53E 1H3GA 4J3WA 1HQRB 4N0YH 1CFNB 1BD2A 3BDXA 2VLRD 4NNXA 4GRWF 5IBLD 3LD8B 5IMMA 1QSEE 3HZYA 1ROWA 3VWJC 3E2HC 4FQHB 4XNUH 4ZXBB 1FZJB 1D5MA 4JPWL 4XPFH 3I6KB 1NCWH 2VB5A 5HHQA 1XAUA 1EDQA 5FGCB 4LSSL 2D7MA 4K94H 2AXHA 4KTDH 1SM3L 3TO4B 1GZQB 4OLWL 3GJEA 1KJMA 4Y4KC 1WLHA 4J8RB 4F8TA 2H3NB 2QBWA 4NC1E 4Q6YA 3RKPA 4F7CB 3U9UB 3HE6B 5IEHA 3FONA 5D1XB 1JN6A 3RZCC 3BJLA 3PWNB 2QHRL 5LBSL 2W91A 1FV1B 4PPTA 4OUOA 3RGVA 2IANB 1CVRA 5E56A 5C07D 5IFJA 5ERWB 3LVEA 1ACZA 5A2LH 4XBEL 2WBJC 3T8XB 5A16A 3PQYE 5DRWA 4XCNB 3EYOA 1OW0A 2VABA 4ZS6D 1A02N 3HMWL 4ONFL 1QZ1A 4RAVB 1OAUL 2BJMH 4BH8A 4JKKA 3NABH 5JZ7C 4L3AA 2V2TA 4DN4L 5C0GB 1PLGH 2Y07L 5D7KE 2DF3A 4HK3J 5FO9B 3HZVA 3WFHB 4PYGA 2MPAH 5TPWL 4QRPD 1D6EB 3B83A 2OR7A 3V4PL 4WTWA 2LTQC 2Q7YB 4XCCL 1CXEA 1FVCA 1XZ0B 1YEFH 5DUBB 2DDQH 2CDGA 3MFFA 2PXYB 3BEVA 5FUCC 3PIQB 5C09A 2F8XC 1G0DA 5IVOA 2Y25A 5CD3B 2UY7A 5F7YC 2AGJL 2QQNH 1W72A 3CFBB 4GAGH 3W39B 2NW2B 4JQVC 3P0VH 2AEPL 3BN9C 4CN6A 1PDKA 2PUQT 4UQ2A 1VEOA 4WFHD 4ZFFA 4NN6B 1LO3H 1FVDB 1H3UA 3U79A 5DJYB 1KPVA 3VXMD 1KCVH 2FWOB 3DVGA 3QIWD 4LSRH 3FZUC 2H2PD 4PJCA 1BQSA 2YWYA 2E5EA 2GJZA 2EYTA 4XC3H 1V3MA 2GHWB 2VN4A 1CFTB 4QY8A 5EFIA 1ZSDA 2FH8A 1A0QH 4YIQA 4HJ0C 3AAZB 3RVTD 4JKWA 3ARDD 3LMJH 1OM3H 4NKDA 3VXUD 1K6QL 3RY6A 4OGAC 1T2QH 4JZJB 3NA9L 5D1QC 2UVEA 4KV5F 5CGYD 5HHXH 4ZUTB 4BZ1H 1X5FA 4K23L 3LCYA 1B88A 3ILQD 1I8LA 4MQXC 4PR5A 1QYGL 4EQ3A 3W81A 2DICA 2Y06L 1X5YA 2LFGA 3RY5A 3WKML 4BQCA 4M02A 3T1FA 1XF4A 4P3WA 3VXSE 2XWTA 4DKFH 4A6YA 1DLHB 2AABH 4NRXA 2R15A 4OFKA 1UM6L 1I8IB 2NYYD 2YUWA 4Q6IA 4E41A 1S7SB 4XP4L 5J6HB 2L7JA 1HZHL 3WIHH 3SGEI 3SEPA 2LVCA 2BNRE 3KPMA 3LEXB 1SEBB 4UAOB 1DL7H 3DETD 5KS9F 1DUYB 1N5AB 3VA6A 4HF5L 4HUNB 3CX5K 5JHDB 5I1JL 5EBWA 4J7RA 1VKXB 2FB4L 2O93L 1IEHA 2HVKA 1G6RB 3QEGL 4PRBA 4EN3C 2C4XA 3UPRB 1DANT 2C1PB 5J13C 3HG1D 5CP7A 1D5BA 1XGYH 1DBML 1MFDL 3T0BA 3KAAA 4GMSL 2FGZA 3ZT7A 3IETA 2XZAL 1CU4L 2X4TB 3IJHA 12E8L 4MD0B 3BO8B 4JB9L 5FUCE 4XVSL 5DD5H 1D5MB 4DVBA 4QLRA 4L4VA 4XCFH 5DK2B 4I3RL 5CZKA 3QFJB 1N6QL 2AI0L 2NY5C 1U2CA 3VXTB 5E0QA 5T1LA 4LCWD 3HR5B 4YDJA 2R4SL 4F33B 4CKVX 4DUXA 1GHFH 1Q94A 3GUTA 4XPAL 1PG7L 5HGGS 3ISWA 2CRZA 4C4KT 4BQ9A 1JPST 5E8DL 4AIZA 1FBIH 3GM0A 2ILLA 4GMTL 1OPGL 3L3DB 1VGKA 1T2JA 2DQTL 3TT1H 4TULL 1YNLH 3CXHK 3DO7A 1F4WH 4BELD 4MHHI 4NCDA 5FYKH 4LDOB 5T3XL 2X09A 1S7RB 1JGUL 3BD4A 1AP2B 3MV8E 3F6LA 1LD9B 4FQ1L 3QHFL 4WEUD 3P40A 3MACH 2ESVA 4RNRB 4Z7NE 1FNFA 4PBVC 1MCEA 1R3IL 1EHLH 4HBCH 3HZVB 4KQ3H 4JFOA 3VGBA 2NY1B 4JCMA 2A1WH 3BH8B 4BZ2L 3WNKA 4B50A 2CDGB 2YA2A 1FNSH 4P2QE 4BFBD 4DKAA 5CCKL 25C8L 1NGYA 3GJFA 2CQVA 5ENWA 3SKOB 4QRUA 1KC5L 3MJ9A 4J4PA 3BGFC 5F8RC 4PJIE 2AW2A 4HXAL 4HGWA 5AYUH 1U95A 4YHPA 1KIUA 4Y4FD 4UQ2B 1ZS8B 5FO7A 1QACA 1S7WB 3RA7L 4D8PA 4G6ML 4DTGH 1IAIM 3QIBA 5E5UB 3H3KA 4LMQE 4N0UA 4WI4A 2N1KA 1A9EA 3B8YA 4PJCB 1RZ8B 1ZTXH 1T4KA 2PW2A 3P0YL 4PUBL 4HCRL 5EBGA 1JWMB 3EOYG 1JCKA 4OD2B 4U0RB 2DTSA 3D0VA 4QY8B 4LSVH 1FPTL 5EFIB 1ZSDB 3G6DH 2ZPKH 1GC1L 2P5WD 2QSCH 3LQZB 1EH9A 4OCRL 1R0AL 1AGDA 2VAAB 1JGDB 1HSBA 5GGTA 5HYJA 4OZIF 2D03H 5GJSL 3O4OC 4Y16A 1TZGL 2ZUYA 4TNWF 1KLUB 4UT6H 5DTFA 4U1KB 3MRBA 4EI6B 4ONGH 3D5OF 4MHHG 4RMVA 4XNXH 5TH2A 5JHLL 1BZ7A 4HWUA 5F96L 2YD4A 4HEME 1XF4B 3LPGA 3PGCA 4QOKB 3MBEC 4A6YB 3ARBC 3ARGD 5SV3A 1A7QL 2BXZA 3IFPA 1R5WA 2ARWA 2F54D 2PW1B 3EOTH 4P3CL 1BF8A 4P0DA 1N3NA 5HVGB 3WDHA 1HOCB 1T0NB 1JK8A 4LHQB 3AREC 4WW1A 3GMNA 4OGYL 5EU4B 2FX7L 2VZ1A 5DJ0A 4L1DA 5DLMH 4TSCL 1J05A 4KHTL 5EBWB 4XZUB 1B2WL 1DQQB 3SCMB 2HVKB 4PRBB 4JRWA 3MLRL 4LVHC 4DWHA 3D0LA 1CFSB 4YDIL 4HC1L 2J6EA 3TWCH 1C5CH 4H88L 1C5BL 3X3FH 3IETB 4ZFOA 3IJHB 1WVZA 1E6JL 2RBLA 3SKJH 5A3ID 2NX5A 1CL7I 2DKSA 1SM3H 3MRDA 1SJVA 35C8H 3NZHL 2JB6B 5EO0B 4DQOH 3QWRA 2IH1A 4PB0L 5LCVL 1F6LL 3C60B 3F65A 1TENA 3F7YA 5T1LB 3SDCB 5EZJB 3N1MC 3B6SA 3LEYH 4WEBL 3QQ9D 1TNMA 5I30H 5KSAB 1XGTA 5JPMA 4TTDD 1E6OL 4H8WL 4EBQL 3KLSA 1VEPA 4Y5XB 2R4RL 3H3PL 1X44A 3QBTB 2RFXB 3WFZA 2X4UA 1T21A 2VLJB 4PJGB 3SKNA 4ZOAA 3ELAT 3VD3A 3FQTB 4P4KD 4RGNC 2L7UA 3OB8A 1P84J 3CZFB 3O2VH 4GKZA 3AS3A 1NL0H 1OAUH 5J1AB 3LB6D 2MQ0A 4DGIL 3PWPB 2LE9A 3PL6D 4DN4H 4NO5B 3EZ8A 4YO0A 2GAZB 3W5MA 4I18B 4J3SA 3TN0C 4JRXB 3NFPA 2EEAA 1CK0L 2A9ML 2QADD 2AJUH 2O5ZL 3DXAE 3MCLL 3SE3C 1TJGL 1YECH 1ZANL 2B0SH 2XOTA 2XI9A 5BO1L 5HYFA 2ZCHH 3TYFB 5A2FA 3N85H 2Y36L 1G7HA 4M93B 1J86A 1U8IB 3OKOA 2DB8A 2V5TA 1S3KL 5EIQA 3EYFB 5E8EB 4GAJH 4UV4L 3X13A 4NQUA 4BFIA 3ZTNL 1HHGB 2CK0H 2O61B 1OT1A 1SJHB 2AEPH 3OGCA 3LKPB 4I2XA 2HJKB 1IC5H 4FQXD 4PGCA 4XB8A 2DQFA 3QCUL 4HJJL 1OAQH 2I27N 4HS6A 1U95B 1FHGA 2APBA 4NN7B 5CINH 4F3FA 3KPOA 4N90E 1UXWA 4GAYA 3GBNL 1F58H 5HXMA 4UINH 4V2BA 1WITA 4M5YL 3MOAL 1DBKH 3SO3C 5I66A 3QIUC 3RWFA 2PW2B 5DJAB 1G7MA 3LZFH 4P5TC 1MPAL 1TQCB 5DD3L 2CKBB 1OAZL 3KJ6L 1IE5A 3CVHL 4X8JB 1H0DA 5F72S 5D7KD 2DLTA 1JHLL 1JFQH 1RHHA 4KRMB 3R4DA 1AGDB 1NFDB 1T7ZA 1N4XL 5HYJB 3PHQB 4PYHA 5J3HD 4OZHE 5DTFB 3MUJA 3W0WA 5L8LB 4NFBA 3QI9B 4D94A 1N5YL 4M00A 1U8PB 1BZ7B 1KJ2A 3ARFC 4ZFZA 3TBWB 2DBJA 4YBLB 3WHE1 2WUCL 1GSMA 3C5ZA 3WN5C 2B39A 4RFEA 4O9HH 1JNJA 4ZS7H 4XP4H 1PZ5B 3ARZA 3D39E 4RGNE 1ORSB 3IFPB 1R5WB 3O8XC 2R69H 1I1YB 2Y6SC 2JJVA 5J89A 5IBUB 3HNVL 3OF6D 5HHMB 5JLZB 1F90H 1JK8B 4NFDA 1RJYA 2XKNB 4OLVH 4ZQKB 3GMNB 3P9MA 1Z5LA 3BAEL 4PRIE 4ZFGH 4RIRB 3VWJD 5DJ0B 1LO0H 3SE9L 1W72L 1A1MB 1P4BL 3P77B 4EVNA 1J05B 5FYLH 5IBUG 3SGDI 4C58B 3CFJA 2COQA 3DV4B 2H1PL 2ENSA 3GMPA 1UG9A 2CGRH 5CBAA 2VDRH 4U1JB 1CDYA 3X3GH 4M6MH 3TPKA 1I7TA 4WU5B 4Y4KD 3TBTB 4LQFH 2ZSWA 4ZFOB 2QLVB 3RWIB 5L0QC 3BZEA 1NCAH 4DEPB 2W65A 2A2QT 3U48A 2D4FA 1C1EL 1NGZA 3KDMA 3Q3GB 4C56A 3JTSA 1NCCL 3RZCD 1V7NL 1FG9C 2YD6A 1EO5A 1NGPL 3GKWH 3MODL 1IT9H 5TGBB 4MWFA 1U8NB 3FO0H 1YEHL 2OTUB 1IZKA 1VADA 1N59A 3VXSD 3DVNA 3PNWA 1S7TA 4URTB 3THMH 4JREC 3E0GA 3QNYB 3UJTL 5JPMB 3U0WH 4HS3A 3O3AB 3B9KC 4HJGA 3AFLA 1H3PL 4CVZA 1XGQA 2FO4A 4TVPL 1QFUH 5JZ7D 1OARH 5KSVB 1JGUH 4JRYB 4WUUE 3MLXL 4WTZA 5MENE 1WICA 4YGVB 3ECBB 1TETL 1CTNA 2J88L 4QHUA 1FSKC 1XMWA 3HUJB 4R2GC 4JY4B 1R24A 4IRJB 1JGVL 3SE4C 3AC0A 3MCG1 4KRPB 3FFCA 4PJEA 3VI3E 3DJ9A 4Z78B 4BJLA 2GJ6A 2LAAA 2DIAA 4OZFB 1OSZA 5E4EC 1KTLB 4YO0B 4LLWB 3VG0H 1RZFL 3QDJB 5IJVA 4R90H 2VQTA 5IWLA 5F1OB 1MI5D 3FT3A 4MA7L 5T33H 5BS0A 3MROA 1FZMB 3NFPB 3REWA 4YNYA 5JW3L 2JCCB 3B2UC 5D1ZC 1XF3A 2BCKA 3F8UB 3MZTA 1NKRA 4NIKB 3WSQH 4NNYA 1TJHH 3KS0H 5CZXC 5F3BA 2NY2C 25C8H 3TA3C 2DWEA 2G75A 5BRZA 2DOCA 4TSBH 4NYLA 4F8QA 1NC2D 3UTTA 5IQ9A 4BFIB 5GRJL 4P3DB 3AUVA 3FZUD 3OGCB 3CUPA 3Q6GL 3I75B 4CNIA 1A3LL 2XYCA 3F5WA 3CFCL 1G7PA 4PGCB 3QCTL 4JFEA 4QXTB 4OZGA 4NP4L 5ISZB 1ZT7B 4F3FB 4P9HC 4DKEH 2VLKD 2WMPA 1I4FA 2YOCA 2B7DT 1CGWA 4WVRA 5HHOA 4PUBH 5FDWB 4HJ0D 4U1NA 5D2LE 4LKXA 1T22B 5MEPA 4DN3H 5F7WC 5D1QD 3GMRA 4E5XA 4X4XA 1KTDB 2YA0A 1T7YA 3LRSB 5F1SA 4L1HA 3FB5A 4MQXD 5EIIA 2EH8L 1PKOA 4G8IA 3LKSB 2W9LA 3CDGB 2V9TA 4F7TA 5E99L 2VSCA 4I5BA 3C2SA 2IAMA 4KUCF 1X5GA 3CVIH 1DVFD 5T5NG 3EO9H 4JQIL 1RMFH 5IHZA 4I0PB 3DOSA 2GITA 1U92B 3QPXL 4ZFZB 1S7VB 2HRPH 3C5ZB 2ICCA 4Y4HB 4PB9H 4WW2F 3VFOA 5HY9A 3SDAA 3BW9B 4GG6E 5DEZA 1IGJB 3S4SA 2ZKHH 4NT6B 3D25B 4OGYH 1ZK9A 4H0HB 5C0IA 2JJSA 1Q9WB 2VAJA 4WY7H 1M71B 2VDML 3G5VA 3T2QA 3KPNB 2HVJB 3IKCA 2VTFA 3P9MB 4HS8H 4LEOA 4X7DC 1OLLA 3H6JA 5F9JB 4Y19A 3MOBH 3P4OA 4IS6A 4GH7B 5CBAB 3BDBA 3I6GB 1E4XL 3O81A 3WD5H 3D2UA 1B0GA 3MOQA 1NCBH 1CGTA 1HKLL 1UM5L 2F5AL 2VMFA 3BVNB 4PB0H 3C2AH 4RQQA 3GSUA 1NFIA 5SWZB 5KVEL 4M61B 3V0AC 4F7PB 3NN8A 4MWFB 3MUHL 3PDOB 5F21B 1NMBL 1N59B 2OR8A 3EOAA 1U91B 2ATPA 1E6OH 4H8WH 4EBQH 3SE8H 5E6YA 4JFXA 1NCNA 4QXGH 5BJTA 1EA9C 4NQDA 3GNMH 4N8VA 2IBZY 4UQ3A 4RX4D 3F7RA 4PREA 3ZKXB 3FRUA 3V95A 1FNEA 1XGQB 2YXMA 1KULA 3BP7B 1EIBA 1XEDA 4XNMB 3TVMA 5JW5A 4F9PC 2IPUK 3MREB 5T1KD 4RMWA 3D18A 4QHUB 3C09C 5DVLA 3GHBL 4GQ9L 3D48R 4HGMA 4PV9B 3G6JE 2BVUA 5JO5B 4OSUH 1G9ML 4TVSa 2CDFB 5BV7C 4PJEF 4PY7A 4XAWL 1HCVA 1G6RH 2KUTA 4IRSB 5I75B 4AT6A 1TJGH 4C55A 4JZOA 4NHUA 4WTZG 4RGMC 5HI5C 3DSFL 3NCCB 3HC3H 4YQXH 4F9LA 4YNYB 5C7XL 4OCYH 1A2YA 2J6EL 4NRZB 2W0PA 4S1SH 5HGHA 1T20B 3SY0A 4OB5H 3MXVL 5MI0C 3WFDL 3MRKA 4RA3A 4U2YA 2Z8VC 2X9YA 2W9DH 3TIDA 4OLEA 3O6LL 4CNIB 3F5WB 4OKVA 4MAYA 2G2RB 1RSFA 3GMOA 3WE6A 4HIIA 5C6WH 3HMXL 3L5JA 4JQXC 4OZGF 4YR6B 3KHOA 4M7LT 3W9EA 1SBSL 1K4CA 2BVOA 5DRNA 4S2SA 3P9LB 2VXSL 2BVQB 1ZLVK 3EW3B 1HNFA 4K9EC 1CE6B 3KJ6H 1BGXH 5KVDH 5MEPB 4X99A 1MCSA 4ESKA 1RV6X 4L29A 2VITB 1I3GH 1KB9J 3B2VH 4MD4B 1A6UH 1EAJA 2UUDH 3DXAD 4HWEH 5EIIB 3MBED 3ARBD 1BOGA 2D31B 3BP4B 3ALXA 1HIMH 5IVXB 1EAPA 1DQDL 5FGBC 1YPZA 4IDJH 3ULUD 1NAKL 3O11B 1IM3A 3N06B 1K85A 3ARED 3BGAA 1KIRB 2IFFH 1CBVH 3CNKA 1OP5K 3VFOB 1EEZB 2DS4A 2Y4SA 1WCQA 1RZIA 4WU7B 4KROB 4OJFH 3GMLB 4LPWA 2DRUA 5E2WH 5C0IB 2A6KB 3U4AA 3MJ7B 5E08L 1W72H 2Y72A 3BOVA 3B5TA 5DMIH 2EKSA 1MCNA 1ZXQA 5E5MA 1MIML 3OX8A 3GBLA 1A14H 2VJXA 3V7MA 2H2SC 5E6IC 5FUOL 4YX2H 3ULUF 3QUXB 1CCZA 2OS7A 1EXUA 4K7PL 1F11A 3ZKMC 4YWGH 4HKXA 3UTSA 4LFHD 2WQ8A 4XXDA 5L6YH 2GK0A 1B0GB 4OGXH 1NCCH 2C5DC 3MO1A 5IEKA 3IXTB 3T77B 3KWWA 4R8WL 3VXRA 2BSTA 4QHNB 4GXUM 5KSBB 5DFVC 1S7QA 2GTZA 3VFTB 1ADQA 3GIZL 3CSBA 2YKLL 3T2PA 2VR5A 2QKIA 1D5XA 4XXCA 3EOAB 3D39D 3L6FA 3QXAB 3E6HA 4NQEA 1WZLA 3DX6B 4NQDB 3DV6A 1D9KC 1RIUH 4AIOA 5C0DA 4A6YH 1LP9B 2CUMA 1JMZA 3FRUB 1FNEB 4JFDD 4WO4A 3TN0D 4PRID 2CLVA 5BXFA 2X4RB 4U6YB 3WFBH 1ZGLP 3DX9B 5E4IA 3IFNL 1JNHA 5I1GL 4GRLC 1E0OB 3RJDA 4RGOH 4R97B 1MRCH 1S9XA 4PY7B 5EU6E