1ND0A

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
219
structure length
219
Chain Sequence
DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 219
sequence length 219
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0A01
4PJ8B 2W65B 1RUKL 1DQTA 4K9EL 4UNUA 4YK4C 5HHQA 2NYYD 1G9MC 3SDCC 3SJVB 4X80L 4U1HB 4ZDHB 3BXNB 5CEZL 1EVTC 3ARWA 2P8LB 4J7RA 4Y19B 3BKML 5T1LD 3MUJA 3CLFL 4HFWA 3G5VB 4HJJL 2OI9B 2JELH 3BJLA 2G75B 3L95B 4MA3A 3WHXB 4LAQH 2YD5A 2HWZH 4LU5L 1Q9LA 3BSZH 3VDCA 4PGCB 1NGWB 3TIEB 2IPKB 1I1CA 1DEEA 1BM3H 3I75A 1CE1L 2P47B 4LSVL 4MNGA 3QNZB 3GI8H 3UTTB 4Y88A 4YK4B 3SDCB 2E7LA 1DQLH 3V2AR 1U8PA 1W2KT 5KTEH 2R4SH 4R7NA 5D9SB 4I48B 3RPIA 3B9EA 3GSOA 3GHBL 1FFNA 4X8JB 1FGNL 4PGJA 3KYNA 3ARYA 3K1DA 1LO4H 3AREA 4KJWD 3UJJL 4ZFOB 4RNRA 3KPRE 4TUJA 3X14A 4RGNC 3U9PH 1FG9C 4AEIL 5IUSA 3NOIA 1NMAH 5IR1A 4G43A 5IW1B 4KTEH 5JUEL 2WP3T 3QQ9D 4LSQH 5C0DA 3TZVC 4WHTB 4PJFB 4Z9KB 1NFKA 1CD9B 3QIBA 4HIXH 4WEUD 5DJ0A 4UAOC 4XMPH 1U8QB 1MCOL 3QEUA 3FQNB 4JAMA 3AY4C 3IU3A 2GK0A 5TF0A 1MHCA 1ZLVH 4YNYB 2PCPB 1KN4H 1FFOB 1MWAL 3O8XD 1BQUA 1MCHA 4K94L 5AWNL 1MAML 5DUMH 3MLSH 4MD0A 4HIEA 4RGNB 3DUSB 3GBNL 3AU1B 3V0AC 1O7SA 1A0QH 2DQDL 4GRLD 3CU1A 3VH8B 4KK8D 3TZVB 4P4KC 4QEGA 5EH1A 5D1XD 1MCJA 2EDLA 5ETUB 1CDCA 4MD5B 4YWGL 4KKBC 4UAOB 4PLKC 5GZNC 3BRDA 1HH9B 2P8MA 1QEWA 2GTZA 4GAJH 3VXSB 4FZEL 1L7TH 3QDGB 2V2WA 5TE7H 2EIDA 4HMCA 1LNUA 4JFEA 3TJEH 4BQCA 4F7CB 4BH7A 4ALAH 5JDSB 2BVPA 3NIDF 5FCUL 4P4KB 5SX5K 4U1KB 4YHZL 2AJXH 5E99H 5T5NF 3VD9A 4KGLA 5T1DH 1RUPL 3FT2A 1I1AC 1U58B 2ZUTA 3G6JE 5CIPA 5DURB 1BM3L 3D69B 4IS6A 1NL0L 2EDNA 5TH2B 2IALB 5TJWK 4B7IA 1AKJA 4QCIA 4AH2A 3MNWB 5KTEL 4JRYD 2DM3A 4RCAA 4D0DB 4ONOA 5HYSB 4OQTH 2XPGB 1KJVA 1VGEH 3BWAA 3G6AB 5BRZD 3WS3B 1HZHL 1KUMA 4F3FB 1R5VB 5BZDB 2ZCLH 3BW9A 2F5BH 1LK3H 1IEBA 5CWSB 1UQSB 1I1AB 4I0PC 3ZTNH 3RGVC 1QSEB 4HPYL 2FDBP 1GGYA 3OXRB 2GT9A 4LPTA 4YH6A 4N0YH 2DKMA 4PY7A 4XMPL 5FUOL 4DTGH 2R9HD 3VGDA 1ZKAA 3D2UD 3SQOL 1KN4L 4TSCH 4OZIE 5FGSA 4MAUH 2R0WL 5IMMA 3QUXC 5EUKA 4DZBB 3MLSL 2FWOB 3WL9A 1I8LC 3EO0B 1JUFA 2HYMA 4I0PB 2Y07H 2I07B 4JG1H 3RGVB 1KTDA 2WQRA 3AVEA 3NGBC 3KJ4C 4NZTH 7FABH 5EZOL 1JGVL 2E9IA 2PXYC 5J8OA 4NUGH 1X5LA 2OR8A 3HR5B 1WC7A 3E3QC 1N8ZB 1I7ZA 5EZIL 2ED8A 4QT5A 1I9IL 1L7TL 3QUXB 3FQUA 4JDTL 2O5ZH 4F7MA 2OTUB 3T4YB 5BMFL 1IZKA 4PFEA 5AAMA 2W0FA 3IDGA 4X7TB 3OG6B 1MQ8A 4ALAL 3WXWH 2GCYA 4HXAL 1D5MA 4UU9A 5BQ7B 3PQYA 2P48B 1F3JB 3NGBB 3KJ4B 4HS8H 3H6JA 3VI4E 4BSWA 5C2BL 2HLAA 1UACL 3X13A 2YK1H 3KPQB 3QIUD 5TDNB 1S9WB 4G5ZH 3MLTA 1FNEA 2KKQA 2PXYB 3QXAB 1NFDF 2D3VA 1XZ0A 4OZHA 2LABA 4NM4H 1OGTB 2AKRB 4R4BB 5JORB 3PWNA 3GEWB 1R5IB 3OJDB 1SYVB 1A6VH 2XWBB 1HCVA 1ZVYA 3IDIA 5DUBB 1SEBA 3K7UA 5L88H 3O45A 4OQTL 3F12A 1TVHA 1FVEA 2IANA 3L3HB 2BP3A 1JZ7A 1RZFH 4O2FA 1GZQA 3TVMD 1T21B 4WHDA 4KJYA 4FABH 1NANI 2NX5B 2X44D 1PG7W 2AS5M 4JANA 3QWOB 3IFOA 5C0CB 1JN6B 2Q1EA 4GUPA 2YC1A 5E1AA 1DJSA 1BF8A 4TVPH 1MCWM 1UVQB 3P0YH 3CFKB 3S4SG 3D39A 4LCWE 5C6PB 5EOQH 3MV8E 5DHXB 4JY5L 5HDQH 3HUJF 4OLZL 4NHUB 4PS4H 4TSCL 1GGBH 4MAUL 2IADA 1ZT7A 1FO0B 2B1AL 32C2B 3HLAA 3DRTA 4DVBA 4FNLL 2F58H 2R23A 1B0WA 2YR3A 2Y07L 4G6FB 4JG1L 4OGAC 1NC4A 1HHGA 4D94A 3QDMA 4O2EA 5MEOA 3IKKA 2CLVB 4I3RH 1KN2L 1AD0B 4ZUVB 4ZUWA 5I1IH 3D48R 5F70A 4NZTL 5I76B 2DLGA 5CHNA 5J3HC 3S4SA 5KVFH 3ZYZA 4Z95H 1TCMA 4NUGL 5AZEH 1YPZE 5CEYA 2YBRA 4QNPF 4LDEB 1QACA 1G6RH 1R24A 2X10A 4K3HA 4PBWD 4ZO7A 1S8DB 3HI1B 2FHCA 3CDYA 4GW5A 5FB8B 3B8SA 1RK1A 4NC1C 3NCCB 1B90A 3M1BB 5T3XL 4JPIB 3SBWA 2ADFH 5SWSD 3REVB 1CK0L 3WXWL 1TDQA 1KOAA 3THMH 3P77A 3OKNB 4HS8L 1KTRL 1PQZB 3ROOB 2H2PC 3HR6A 1LK2B 4WTXA 3PDOB 5I8KL 4K7PY 1P84K 3FQWA 2Y7QA 3JWOH 1LO0H 4Q9CA 3L5WA 4QWWC 3QZWB 5BJTA 1X5FA 3T0EC 1A6VL 1GPOL 4R2GC 4LVNC 3MBED 2DN7A 2X1OA 1MELA 1YDPA 4U31A 5GRVL 3KGRA 2XZQL 4MSWB 2C3XA 3PWJA 1VENA 3RZCD 1WT5C 5SX4I 3TCLB 5ESAA 5J1AA 1TZHA 1MY7A 4MQ7A 3QG7L 3OJVC 4WJ5A 1MCLA 1T0MB 3T0EB 4IDJL 4X8XA 4R2GB 3O9WC 4RRPG 2YWYA 4ZPTB 4LVNB 3GB7B 2BRRL 4KKLD 1F4YL 3OKEA 3WDIA 1TZGH 4E41E 5E8EA 5ENWB 1WFUA 2IWGA 4NQDB 4JZOB 1B88A 3CMGA 4OLXH 4GFTB 1N59A 3DI3B 1JNJA 3LRGA 5C92A 4X5LA 5CBAB 3IFNH 4XCNB 4OV5B 3OB0H 1AO7B 5FYJL 4U6VH 1ACYH 2V7HB 1KT2A 1NGYB 4LHUD 5JIKA 3W39B 4RRPA 2HJKB 3O9WB 4HCRA 3X3FL 4IRJD 4RAVA 1A6TB 2AI0H 5DT1H 2MFNA 5FM5O 1CF8L 3O4LB 5BVJB 2ADIB 3X12B 3RUGA 2Z91B 5EO0B 1VADB 1PZ5A 5E08L 4EI5C 5IROC 3FOLB 4FQJH 1Z9SA 2ADFL 1RUML 2R2BB 3THML 1JI2A 5GS3A 3B9AA 1H0DB 1A14L 2BY2A 5EFIB 5HHOA 3V52L 3ZE1E 4OZFA 4S1RL 3LKQA 3RIFK 4P57B 4WI4A 3MRJB 3RKDC 1E4XL 3R8BB 5JA8B 2RAMA 3MRNB 4X6FA 1OF2B 2NY7H 1R3LB 3VDBA 4U6TA 4Z7VB 4EI5B 1OAKL 4NKQB 2UWEE 5L2KB 3B5HA 4PJGE 3NIFE 1F02I 5KW9L 3CXDH 4F7TA 2XTJD 5IB1B 4JPVL 3VFUB 4HFUH 3LN5B 3BZFA 1QSFB 5D5MB 4K3JH 5DHYA 1U8JB 4K7FB 1U8HA 2YD4A 3IS0X 1O5DT 3I50H 2XV6B 1DUZB 4BFIA 4ZOEA 5HHPA 3VGFA 5HI3D 5CLWA 5BZWB 1CLYH 1I4FA 1SJXA 1J1PH 1TZGL 3KPRA 3HG1B 1ZANH 3MRGB 4LRIC 5HDBE 3QAZC 4RA3A 5FHBH 5C07B 3QNXB 4TNWF 1H3TA 5T1KD 4Y4FD 3CGTA 4QXUH 4YX2L 4OUUA 2KH2B 1IM3A 1NAMA 4NKOB 5D7IE 5DJXA 1JGUH 4LLYA 4QRPD 3P0GB 2X4RB 3DX8B 5HY9B 4A6YA 2EDQA 3QG6A 5IFJA 5JLZB 2C7UB 1BQHB 1AXTL 1RJLA 2VXSL 3P9LB 1NDGB 4WUUB 5JOPD 1J9CT 4XVSH 2EDDA 4HF5L 3D25B 3BEVA 1XGQB 3K74B 1ORQB 1MQKH 1OTSD 3QP3A 5ID1A 4GG6F 1SY6H 15C8H 2AJYH 3IJSA 2DWDB 4D2NA 5MENE 1CU4H 3QAZB 5F9JA 1JF5A 1UYWH 2FGZA 2AJ3A 2ZSWA 2ICWB 1K85A 1KIPB 4BKLB 5KSUB 1P4BH 3MRMA 3S3SA 4XNMA 3QO1A 1II4E 4NWTL 5MEPA 4L1HA 4LSPH 3SGDI 3ZHKA 1ZGLA 3T8XA 4F7EB 2VLJB 1MCNA 1PGRB 2EDHA 4P0DA 1X4ZA 4EVNB 4PV9B 3BZ4B 2R29L 1QKZH 4PYHA 5CKGA 3VD5A 2BSTB 3BDYH 1CFSA 4X99A 4G8EB 3CD4A 1D6EB 4KXZI 5ESQB 4HT1H 4K07A 4XB7A 5DK2A 1OGAD 1RURH 2D7TH 2IH1B 4JFPA 4J8RA 2CKBA 3G6JA 5ABDE 4QOKD 3MACH 4RWHA 1N2RA 3AM8C 5IBTL 4BQBA 3B2VH 4WHYH 1YEDA 1KJ3H 5IIEB 3MRQB 4PRPE 4UI2A 3DPBA 4S1QH 3HCVB 1YEJL 4OCXL 1DVFC 4Y5XA 3PV6B 1NFIA 2EXWC 4XCFH 1NBVH 3KPOB 4AM0A 1HHHB 1CDJA 1CICD 2DOCA 2VLMD 4C4KT 3BPCB 3MRDA 4QXUL 3J7HA 3EYFB 4KC3B 5D6CB 1JHTA 4UIKL 1JGUL 4HWUA 4QHNB 3RVVD 4N0CC 3BP5B 1E4KC 4YDVB 5F6HJ 1H3WM 4TRPL 2JJUA 1EJOL 3O6MH 3CFCH 3W81A 1DVFB 4OZIA 3MLRH 3KPSB 4LLMB 1UWXH 5KSAA 5KANI 1J18A 4D3CH 3KR3H 3ZT5A 4F33A 1KGCE 4JFOB 3WNLA 4PJIE 5CGYC 1YA5A 2ZG2A 3KPLB 1CU4L 1XR9A 1F3RB 1T03H 3WS6A 1PKQE 4B5EA 2B1HH 3DX9A 4YGAB 1SHMA 4LPUA 5D8JH 2MCG1 2OTPA 4GW4B 4LHJB 3BZEA 3BDXA 3DX7B 2HRPL 4Y89A 4KUCF 4ZQKB 5DI8A 4ESKA 4OF5A 4KDVA 2CLZB 4M5ZH 1CVRA 4NGHH 5C0BB 3PHQA 3KLAA 5E1HB 1AP2A 3HC0B 3K4AA 4LSPL 1MLCB 1A7BA 3QHFH 1QLEH 4LPCA 1UKSA 4S2SA 4JY6A 1A21A 2ZJSH 1KXTB 3BDYL 2VDMH 1M7IB 1JNLL 1YEIH 3C5SA 1GAFL 1GYAA 2D7TL 2ESVB 1WUNT 3LRSB 1YZZA 3NTCL 1FZJA 3BD5A 1YNLH 2K7QA 3ARXA 3B2VL 4H0IA 5FUZH 1KJ3L 4JFXA 2WIIB 3RQ3A 3DMMB 5DZOA 3PGDB 4EXKA 4YHNB 3BAEL 1KB5L 4UDUA 2ARJB 2UUDH 3X11A 3LN9A 3DSFH 2X42A 3FFCD 5BOPA 5FKPB 4PRIB 4DKFH 5FGCE 2CIKA 4LLUA 3VXNB 1MI5B 3TO4C 3WFCH 1WFTA 5KS9F 4XPTL 4PUBL 1K5NB 3QUYC 3KPMA 5JXAH 3P9MB 4EZMA 1IM9D 1E6JH 2DI7A 1AJ7L 5ICXA 4CMMB 1DQQB 1FZOA 3WFHA 3KYOA 4PRBA 3KDMB 4J3VA 5DZLA 3GRWH 1EHAA 4LCWA 4WU5B 4UTBL 2BY1A 5JPMB 1D5ZA 3MV8A 3SCMA 3CFCL 1CGVA 5F96L 1BVLB 3TO4B 1F97A 4Q2ZA 3GI9H 3OHXB 1YN6A 5FYKE 4GBXA 1EGJH 1A1NA 5IGXL 2VXVH 3KR3L 2PO6D 3BQUD 1DBKL 4U1LA 5DEFB 3RTQC 5MHSE 3QUYB 1P53A 2DQCH 2DQJH 3C5ZD 1N26A 5DJCA 1U9KA 4K2UH 1RU9L 4I13B 1T03L 1WZ1L 5DO2C 3EKCA 1B2WL 1YNKH 2XY1A 3IF1B 3TN0A 2RCSL 1R5WB 4C57C 1NGZA 3CCHB 1X5YA 1QR4A 2CR3A 1YPZA 1QSVA 4TSAL 4NO0B 3GKWH 5FCSH 2HMIC 4E41D 1T5WA 4FFZH 1MFBL 1NMBL 5F9WC 1RUQL 3ZTJH 1RULL 4HUNB 3CAFA 3RTQB 4X4ME 4GG8B 1TVBB 4WEMB 5EU5A 3UTSE 1Z5LB 3BYYA 4GKSB 5DGRA 3HA0A 2ZJSL 2VDML 1IZJA 1S7XA 4KQ4L 1HILB 1YEIL 3NA9L 3PNWA 1HSBB 3T2QA 1KCSH 4FFVC 1AY1H 3V0WH 5FO7A 4CVZA 1G7LB 5FUZL 5FM4A 8FABB 5F9WB 5INCA 4ODXB 1FJ1A 1VGKB 4NBYB 3CDFA 3VFMA 3S5LB 3VXTA 4YEFA 2VNCA 3ZYJA 1MRFL 2IAMC 1EXUA 3KYKL 5FM8A 1TCRA 3CLEL 3EDDA 3SE8L 4N0RA 3VD4A 2VR5A 3ZZ1A 2FEEI 3GHEL 1TZIA 3GZKA 4KVNL 4X4XA 3BEWA 1E6JL 4LPWA 1XH3A 4IM8A 2FJFA 4Q6IA 3MRBA 4ONFL 3NCFB 4ZAKC 4P5KA 2A77L 3BRGC 1A5FH 4M6AA 1UM6H 2A9NH 2LQRA 3GUTB 1FRGH 4JN2A 5IP4A 1C1EL 3RGHA 3WE6A 2IAMB 1GSMA 3GI9L 4POZC 4I3SH 4N1HB 2QSVA 3GMLB 3UYRH 1EGJL 5IHZA 1JMZA 4V1DB 3VWJA 5EU6B 4NPYB 3FB6A 2DI9A 2VUOA 3JSSA 3NZ8B 1HH6B 4UV4H 3VFWA 4MXQC 3IRPX 3O3DA 4K2UL 3MLWH 1GC1C 2A74B 5LXGH 3C6LD 4ZAKB 4WO4C 2W60A 4JO1L 3ZHDA 5A2JH 1RJZB 2H26A 5JOFA 1WCBB 4AENB 4EIGB 1X9QA 5KSVA 1L9MA 2EDYA 8CGTA 5HGHA 1DBMH 3X3GH 5IEHB 4I0CC 1T1XA 3HNTH 4AMKL 1UM4H 1UB6A 4XBEH 4JVPA 4AZ8A 3D3VE 3BE1H 3PWVA 3FQRA 4OT1L 2G60H 2ZUSA 4W68A 3ZE2F 4LL9A 1PYWA 2AAVA 3I6GA 3BH9A 3VFOB 5IKCB 4LASH 4KMLB 1Z0NA 1RZJH 4YXLH 4HS6A 4WO4B 4CVXA 4P9HL 3UYOD 2AQ1A 3NIGE 3BT2H 4KDTA 2Q8BH 1MIMH 1AY1L 3KNBA 3V0WL 1A9EA 2R15A 4K3DL 4A2MA 3RNQA 1A6WL 2NY0C 1MAKA 4X6BA 3QPXL 1A6AA 4GMTH 3VFGL 3ET9F 3U9UA 4PJGA 5GRWA 3B6SB 5E6ID 5E9DB 3SGEH 5CMAA 3SJVE 4I18C 3RKPA 3TJHC 4ZSOB 2HFGH 4WWKD 1XCQB 4Y19E 3IKCA 3MJ7A 3MYJB 3QJFA 4EJ1C 3W0WB 4S1DD 4H0HB 3QEGH 2L7UA 4NBXB 2MNUA 1F5WA 2NY0B 1UM6L 2A9NL 3O3EA 5IK3A 4ORGB 2Q7YB 4I3SL 3UTTE 3RVUC 3OPZL 4I18B 4ODVL 1EO8L 3TFKD 1G6RA 4UV4L 1JHLL 5DMIL 1OAQL 3OAUH 1V3JA 4PRPD 2E7BA 3B3IA 3RNKB 2APXA 3QUKB 2JIXD 4O58L 2I9LB 1JPST 5EUOB 5F44A 2FCBA 1YUHB 2FGWH 3S35H 4KDWA 3PHOA 5IMOB 2X5PA 4PJFE 4KJQD 4LLWA 1MNUH 2W9EL 4PJ9A 5IJVA 5MENA 2JJTC 3ZO0A 3BE1L 3ULUF 3HZYA 3D18A 5IW3A 3U46A 3R1GH 1G7MB 1T0NB 1M7DB 5KOMC 4OZHF 5JXED 4WWID 4LASL 5CZVH 4XPHL 1MF2L 4H88H 5DC9B 1VFUA 4GSDH 3E1F1 4PRHD 1EHLH 1MIML 3L1OL 4JFYB 4OD1H 4UZGA 3ZL4H 1WAAE 4DKEL 4Z8FL 4YIQA 1KENH 5T3ZE 3T0DA 3AROA 2FBOJ 1XIWD 2X6MA 4YBQD 4E9LA 4HG4J 1PG7L 4XNUH 4C83A 2VXQL 1K8IA 4HH9A 2AJUH 4HWZA 1RUAH 4Q9QL 2ZUQC 4H5SA 4PJAA 1CGWA 4JFFB 3HE7D 5EO9A 3VXSE 4R8WH 3BN3B 3WHE0 3QDGE 5C0IA 3MV7B 2A73A 2G2RB 3FB7B 3EOTH 1IKFH 2IPTH 4WFHE 5GJSL 5J1TC 3VRLE 4QYOA 3DETD 2PW2A 4U1JA 1BBJB 2NR6C 4O02L 1MH5A 1UEMA 1I8KA 5EIQA 3VI3E 3U0WH 4U7SA 3UJTH 4M62H 4MB4A 3UO1H 4B7LA 2ZUQB 3PG2A 1YY9D 1B0GA 3AFLA 2EXYD 3GSRB 5L0QC 1IGJB 4K71C 3CH1B 3SKMB 4CADA 1V5JA 5F88B 5GS0C 2OXHA 3GSQB 2O61A 1B6UA 1U3YA 5D96C 4I8DA 3VXMB 4CN6A 3RY5A 4P5TC 1T20A 3UPAA 2VAAB 1XGTA 2LTQC 3BN9D 5GRUH 5IMKB 5IOPB 1JVKA 2CKNA 2JB6A 1OW0C 3GSNH 4XAKE 1AIFA 2X05A 3U83A 2C4FT 4LLVB 3S35L 5L0QB 4PJIA 2GFBB 4LKCB 2WANA 4HK3J 4K71B 4DN4H 4UUJA 1FIGH 3BO8B 4W6WB 4OLVL 4PJCE 4FA8A 2VDLH 1PKQA 1S7UA 2F54A 4MHHG 3P30H 5D96B 2BNUA 5D2NC 3MLUL 4P5TB 3PGCB 3HPLA 2LTQB 1RVFL 3VFRB 1ZS8B 3RX5A 4EN3C 3NABL 5JA9A 1DN2A 4JG0H 3MLYL 1NCWL 3TPKA 2NTFA 3W5MA 1EHLL 3L6FA 4DGIH 5DDHA 4EUPH 5MHSD 4HZLA 1KENL 2YUXA 2NNAB 1OSZB 1VKXA 4KV5E 3MGTB 4RMQA 4HIHB 1RUAL 5CP3H 4UT7H 1R3JA 2IGFL 5D2NB 3QXDB 2JLLA 5I1KL 1WSST 1HOCB 2WUCL 4NKDB 4P2RB 4EN3B 5I66A 3RVWC 3QBTB 3B9KD 5I1GL 3B5GA 3VFNA 3HRZA 5E94A 4S10A 2IPTL 4Z7OF 2VE6A 2AJVL 4NZUL 1ZA3A 4D9QE 3GK8L 5ESVB 1MCRA 5AZ2H 3ZHLA 4BJLA 4P49A 5AD0A 4LF3B 2CKBL 1Z3GL 3UO1L 2FEDC 2QEJA 4R97C 5I75C 3BMVA 2R2CA 3MO1A 1GIGL 1X6NA 3C9NB 3BGAA 4BQ8A 3FT3B 4XHQA 5I17B 1ADQA 4HX1B 4QRQA 4PG9A 1NBZB 1QLRB 4WFGE 2QQLL 3LEXA 4MGXA 5E2JA 3RUGF 3CDCA 3WSQH 2AXHA 5EZJA 2ZCHL 2NX5E 4R97B 3UBXB 5I75B 3DIFB 4WI6A 4Y16A 4RFEB 1T0PB 5IBLC 5C0CE 1FC1A 1RIVL 4FXLA 2EIZB 4XTRC 5F8RC 5C08E 3LQAH 1CFVL 1FLRL 2QV2A 3P4NB 1OAUL 2VDLL 1FNGB 2M26A 4FQQA 3IGAA 4JHWL 5FA3A 2R8SL 5GRXG 1S7QB 1TFHA 5GSRA 4PRNA 5HYJB 4JG0L 3VXRB 3UJIL 5I1EH 4RQQB 1IC5H 1T7XA 2HVKA 4X4MA 3CFDB 3UTSA 4I4WB 2MPAL 2XZAH 2Z93B 1S5HB 3G04A 1WVZA 4ODUB 3JV6B 3ZYIA 5M95B 3GMPA 2ATPB 2GQHA 4PPTA 2Q8AH 2OL3H 3IYLW 4LQFH 4U1NA 1INQB 1SJEA 5EU3B 5BXFB 1LO2H 3A6CH 2RJMA 1AGBB 1BIIB 1IEAA 1F11B 2B20A 3J8F7 3V5DB 4Z0BH 4X0KB 3TA3D 1G1CA 5I2IA 1NCAH 5DD6B 2Y36H 5DK0B 3SQBA 3G9AB 4NC1E 3ARFD 3EFDH 5DQJB 1UH4A 43CAA 2DM7A 4R26L 3QH3B 1IKNA 3HNVH 1FZKA 1KC5L 5INDB 1RJYA 1BFOA 3DX6B 1TJGH 1KCUL 2FYYB 2OZ4H 4HKJB 1OP3H 4TULL 2ZUVA 4I1NB 4XVTH 1AI1H 2DLFH 2YEZA 2BSED 2C4FU 1IMHC 4LVHC 4OJFH 4JRXD 3ZDYE 5A40E 3T0EE 1BOGA 2D7OA 1KELH 4JY4A 4IHOB 2IFGA 2IEPA 5IF0B 2HKHH 2V5SA 4NQDE 4OCSL 3RA7L 4XXCA 2GJZB 3RWEA 5I1EL 1Z9LA 1A7OL 3MLPA 3BH8B 3T2NH 4JZNB 5DJ2B 2D9CA 4P2CG 3FB5A 1T22B 1AO7E 3D3VA 4MS8C 1A6UH 4LVHB 1MEXH 1BD2B 1E4XI 5K9JH 2ZOLB 2NZIA 4JQXC 3G6JF 4UBDD 4QTIL 5CKAA 1JPGA 5EDXA 2HRLA 2Q8AL 3VXPA 3O4LE 3V4PL 1HQ4A 4LKXB 3MC0A 1F6FB 1MUJB 4QF1A 3OGOE 1NGXB 5JIPA 3A6BH 3HE6D 5KG9A 1LO2L 4OCNC 3PIQB 3WLBB 5ILTL 1G7HB 1OQXA 4G8GD 3PHSA 1OTTC 1JCKA 3HMWH 1MRCL 3MUGA 3P73A 2HKFL 4NKMA 4RIRB 2J7LA 4PJ8A 2W65A 1KFAH 1B3JA 1IGYA 4OFYD 3SJVA 4RWYL 4KPHH 3BXNA 4ZDHA 5J6GB 2GY7B 2P8LA 4Y19A 4K7PX 4F37K 4XGZA 5K93A 5T3ZD 4P23C 2I5YH 3L95A 2G75A 4KFZC 3WHXA 4Z7VE 4OZIF 4JDZB 5L2KE 5H2BB 1NGWA 4Y8DC 3LMJL 3TIEA 2IPKA 4RFOH 5CP7A 1X6LA 2IQAB 3T3MF 3QNZA 2WW8A 3VXSD 3UTZB 3UTTA 3SDCA 4KHTL 4XVTL 1QSFE 4M9OA 1MFCL 5D5ME 4DUXA 1OARH 4MNQB 4UIMB 4M03A 4MXVE 4PTTB 2WP3O 4I48A 5D9SA 4S0TD 1GCFA 4U6HB 4X8JA 4P23B 4P4KD 1C7SA 1KCRH 4O4YL 5CCKH 4KKBD 4YHIB 3FQXB 1Y18A 3HG1E 2VYRE 5IW1A 5L6YH 5HBBA 1CR9L 3PWLA 3LS5H 4M7LL 5C07E 5CJ8A 5I6XB 4RMUA 4WHTA 3WDJA 4PJFA 2ZUWA 5GRJL 3VI4F 2WBKA 3KWWB 3Q2CA 3V0VA 4KKNA 4CGTA 2OR9H 4YQXL 1BJ8A 5K9JL 3FQNA 3Q48A 3RU8H 3EJYD 2OMBA 2NZ9C 4CJ0A 3NH7H 2PCPA 1FFOA 4WUUE 2HTKC 1P6FA 3RJQB 5I1LB 3PGFH 1FL3B 1C5DA 1OQOA 3AREC 3AU1A 3C60C 4PJ7B 1WAAA 1U8MA 3VH8A 4L4VB 3TZVA 1EMTH 4DKDC 2YPKB 1MJ8H 2KL6A 2QR0B 1VHPA 5ETUA 3WNOA 4MVBD 1TETH 1AXSB 1Q0YH 3OAZH 4MD5A 3TV3H 5GGUB 3HMWL 2R0ZH 2DL2A 3AY4A 3ARGA 2X89A 1HH9A 3QHZH 1A7NL 1XF4B 3DLQR 2ARJQ 4QHUB 3P0VH 1FFNB 5LGKA 3QJHA 5IT2H 3KYNB 3QDGA 4XC1H 3QI9D 2VLJE 4LSRL 3AREB 4LFHD 3C60B 4OI9A 5HYSG 4C56B 4HC1H 5JDSA 2D7NA 2I5YL 3ARQA 3O2VL 2ED9A 4ODTL 2KZWA 4WCYH 1IE5A 3VA2C 4ODSL 3RWJB 2R1WA 2F8VA 3D69A 3CX5J 3QEUB 5TH2A 1CT8B 2IALA 3FT4B 1FNFA 3DSNA 3DWTA 5F8QC 1IGTB 3FHQA 3MNWA 3WIHH 2ZWLT 4D0DA 4FQIL 2HLFC 5HYSA 3MUHL 4MD0B 4MJ2A 1YPZF 4HLJA 2XPGA 3G6AA 3WS3A 3TNMB 1CXFA 4D9QD 1HYSD 4F3FA 1R5VA 5BZDA 4PB9H 1KCRL 3STZB 3W9EB 3IU4L 2Y25A 1T7ZA 5CWSA 1F4WH 1UQSA 1I1AA 1QSEA 3LS5L 5BV7C 3F58H 4LFHG 2YD8A 3OXRA 2D4DA 4CU8A 2QQQA 3JTSB 5J13C 4PBXA 1A1OB 3H7BB 4LNRB 3ROLB 3BPOC 5I1CH 2HT3C 4QTHB 2GY5A 4APQC 3FO2B 2V2WB 4NQXB 2FR4A 2AEQH 4N9GA 5DWUH 2F53B 3KPSE 4WFGD 2NXYC 4Q58C 4DZBA 5E2TL 2FWOA 4H1LB 2XN9D 5JZ7D 4PLJD 4I0PA 4JB9H 2I07A 3RGVA 2NY2B 5BV7B 1MCDA 3MSPA 5J13B 5C08D 1EMTL 4PJHB 1CLCA 2HJFB 3SDAD 1TJIH 3FN0H 2VQUA 2FIRT 3BPOB 2VZ1A 1AKJB 1NGQH 4APQB 4AH2B 1ZGLM 2VAJA 2FLBT 5GGQH 2DD8L 4NOFA 1G0DA 4TPRL 2AEPH 1N8ZA 4W4OC 5C0BE 2NXYB 4DZ8B 1HN1A 1UEYA 3QUXA 2NXZC 5IT2L 2OTUA 1GGTA 3T4YA 2VUYA 3P4MB 1IAIM 1I8LA 4G6FD 3SKJH 1HHJB 3QCUH 4TUKH 4X7TA 1W72L 3SE9L 4HC1L 5BS0D 4HBCL 5BQ7A 1F3JA 4XCEA 3I2CH 5TDNA 3OKKB 1U93A 1S9WA 1U3HD 3QEHB 2DICA 2PXYA 3CXHJ 3QXAA 1OP5H 4PY7B 3WNPA 4KMQA 2AKRA 4R4BA 5JORA 3ARDC 3SKOA 1BVKB 4P48A 1R5IA 2O5YL 3OJDA 4FN0A 2EYTB 2XWBA 4NQCD 5DUBA 2FZ3B 2WIMA 1HHIB 1ZT4A 4FXKB 1NSNH 3STBA 4PRIE 3RX8A 3QB7C 3L3HA 1RZ7L 1JUFB 3AB0C 1MI5E 5H8DA 4PB9L 5LGHH 2YPLB 4XAWH 2VDKL 3T4AB 2ITDB 4GRMB 1D6VH 4IJ3C 4HSQA 2NX5A 2VN4A 1MIEH 1TXKA 3QWOA 2H9GB 5C0CA 2B4CL 3ARDB 1JN6A 3DXAB 3WXVH 5F21B 4X9FA 3CFKA 2AGJH 3BKCH 2G9HB 4M48H 5C09D 2D2OA 3U7YL 3QIWA 3AB0B 4NHUA 1P1ZB 1FO0A 2VDNL 32C2A 1WEJL 4WIQA 3MR9B 4IJ3B 2HLAB 4EBQH 1N5AB 4X6EB 2FIKA 2WUBL 1F4XL 3QHTC 4L5FL 2VMFA 4LOUD 1J0YA 5DQDH 1WWBX 3ARBD 4QWWD 2CLVA 4ZUVA 1AD0A 3K8KA 4PJGF 3T0ED 3NIFF 4R2GD 3SGJC 4MAYD 1YEFL 3F7QA 1U2CA 3PWNB 1QBAA 1FPTL 4N8CH 5EA0L 1S78D 1S9YB 1J8HB 4V2BA 3A67H 1TVHB 3SY0B 3HI1A 1UKTA 3QZWG 2QLVB 3O0RH 4XMKL 5FB8A 1SQ2N 3SKJL 4TUKL 1LP9B 4JPIA 1UH2A 5CAYB 1I3VA 1DR9A 4UINH 4R7DB 5AYUH 3IFOB 3ROOA 1J87A 5HDBF 5ID0B 4GUPB 1LK2A 2VDPH 5B39A 1OWWA 1TQBC 2HFEB 1YMHA 4QLRA 1J0ZA 3RIAF 3QUMH 3GSNA 4E42B 4UOJA 4XCCH 3QZWA 1SMOA 2Y06H 4KRPC 1UWEH 2IADB 1ZT7B 3HLAB 1EVUA 4HWBH 3FKUS 5TDOB 35C8H 1NUDA 5GRZA 2R23B 1XGPB 1GHFH 4MSWA 2KDGA 1HHGB 4JFQB 5FGRA 2EDBA 3T0XA 4OLWH 2V2TA 5I8CA 1JHKL 1OAYL 1IARB 4K8RC 4ZUWB 4PY8J 3TCLA 2PYEB 1TQBB 3EDEA 1OAZL 4HIJA 1ADQL 1KG0B 1QQDA 2XQBL 3MZTA 3HI6L 5AEAA 1T0MA 4KRPB 2E8ZA 1YJDC 5GGSA 2N7BA 4NO2B 2AGJL 1LILA 4ZPTA 5L2KD 3BKCL 3GB7A 4OAWB 5B8CA 5FYKL 5CP3A 3FONA 5DD0H 1RK1B 5HI4D 5I1DB 3V6FB 1LHZA 1ETZB 4NQDA 4JZOA 4V1DE 5C0AB 1YY8B 5EU6E 3CVHB 4MQXC 1JZ6A 1N0XL 3QUZD 1WT5A 1TITA 4XCNA 2ICEB 1CL7L 4WNQB 2RFXB 3MYZA 1AO7A 4RAUB 1EK3A 5DQDL 1FQ9C 1IGMH 4LEXH 3FQWB 4PJAF 4FQXC 1NGYA 2FB4L 3CNKA 4R4ND 4BZ2H 5DVLA 3W39A 2HJKA 3O9WA 1E28B 3MOBL 3WBDA 3WLWD 4N0UB 4RX4A 5ADOL 3HG1D 1IL1B 3O4LA 5BVJA 2ADIA 4PJ5B 4P9ML 2Z91A 4PREB 1VADA 1OHQA 5E2UH 3FOLA 4NM8L 1FAIL 5ESAB 4FQXB 2I27N 1F6AB 1H0DA 4MQ7B 2DQUL 2AW2A 4TQEL 2VLRD 2QQKL 3V5KB 4YPGA 3FB8B 3TBYA 1DBJL 4HBQA 3L3IB 3U36A 3ULVC 5JIHA 4EOWH 2ZPKH 4XCCL 4CNIB 3LPWA 4OFIA 3MRNA 2VDQL 4AEHH 4J3OC 1U8IB 5F72S 1R3LA 3ME0A 4HWBL 5IROA 4EI5A 4Z7VA 5ISZD 35C8L 3QXUA 4K7PL 1OY3B 1IFHH 5F3BB 3I3DA 4PJIF 5EU7E 4M6OH 5E9DE 5GQBA 1F2QA 1S9XB 1DCLA 2HT2D 3OJ2C 2H45A 5IB1A 3VFUA 2AERT 3LN5A 4ZSOE 1S3KH 1CI5A 1YMMD 1QSFA 5D5MA 2VLJD 3D87B 1U8JA 4K7FA 3W0WE 1YYLL 1QA9B 5D93C 1IVLA 1DUZA 1BQHG 1RAMA 3BZDA 1J0JA 1RSFA 4L1DA 4YE4L 5F89A 3CFIC 4NHCL 2EKJA 1PZ5B 3W2DH 2QQNH 4OB5H 4MA1C 1I9JH 4AL8H 3MRGA 3OKOA 4G6AC 3D0LA 1QHOA 2X9YA 4MLSA 5C07A 3QNXA 4JO2H 1C5CH 5I1HH 2MJWA 5HHMB 5KVDL 5HHOB 2FX9L 4YBLC 4NKOA 4JCLA 1CCZA 2X4RA 1J10A 2H8PB 3DX8A 1QFWL 5HY9A 5D93B 5F93C 1PX3A 1JPFA 5JLZA 1BQHA 2CDFA 2JJVA 1Q72L 4M4RA 2Z31C 3P9LA 1NDGA 4WUUA 3MLZL 5IFHL 4XMLH 3QRGL 1QRKA 4JM4H 5EUOE 3WEXB 3EDJA 5GGVH 3UC0H 1XGQA 1ORQA 5D1QA 3QWQB 4MA1B 4G6JH 4WFFD 1OB1A 3SGEI 2DWDA 3MXVH 3DVGB 5E2UL 3GMNB 1CD1B 4JFHD 4YBLB 4HK0A 1NC2D 2ICWA 2H6PA 1KIPA 5KSUA 4BKLA 1P7KB 5DHYB 1J0HA 1U3ZA 2V7NB 2CD0A 2Z31B 1G9NC 3KPSD 4JJ5A 1DE4B 1AFVL 1CXEA 1U8OB 1CXKA 4PP1D 4TNVF 4F7EA 2VLJA 2P8PB 1B6DA 4EVNA 4NNYB 2ZPKL 4PV9A 4EOWL 3D1MC 5E8NB 3LQMA 4OZ4B 4EXPX 2BSTA 3MOQA 4NJ9H 3K81A 4G8EA 3UDWC 1CVSC 1D6EA 2GTWA 3VRIB 3E2HC 4ZO9A 2IH1A 3O3AB 4OUUB 5E5RB 4JFFE 5F7EH 5FYJU 2FX8L 5HYFA 1ERNA 1WZMA 2DQIH 1D9KC 1XGYH 3MV7E 5FHAH 4H0GA 5A16B 5C0BD 4A6YB 5IFJB 5DMGC 5IIEA 1N4XH 3MRQA 1AR2A 3QXVA 5EBWB 3BIBX 3HCVA 5C70A 2ZNWA 2R2HB 3BEVB 1T2JA 1LO3H 4C4KO 4M02A 5HVGB 5C0JA 3KLHC 2FH6A 3EYVB 4KROC 5F9JB 1QBMH 3E2HB 1QTYT 2IF7A 1FORH 3VMOA 4MJIB 1I9JL 3HHRB 3KPOA 1HHHA 1FNSH 5EORH 4HD9A 2E27L 3MJ9L 5IESH 3AM8A 1D9KB 3BPCA 4XC3L 3EYFA 5I1HL 3I3BA 4XNMB 2J12B 3VXME 1NCDH 5D6CA 5MEPB 5ADPL 2LU3A 1P5VA 2X7LA 4QHNA 3TCXA 3BP5A 4ZFOL 4IOSD 3QCTH 5A3ID 1INDL 3BYTA 3HMXL 1DVFA 2Z8WC 3GJEB 5ITBH 1GVIA 4LARL 4KROB 4LLMA 1CZ8H 4NP4H 4NQVB 4ZXBD 1BGXH 4KAQH 4JFOA 3OG4B 2R56H 2CUMA 3MJGX 3KPLA 4DGVH 3MXVL 5F9OL 4K94C 5SWZD 1F8TL 4OD2B 2D0HA 4J3XA 3X17A 4KZEL 1OD7A 3QRFM 3CFBB 1C08B 1E4KA 3DX7A 1FL5B 5TQ0L 4ZQKA 4YC2C 12E8L 4PGZA 5DF0A 3MFFB 2IFFH 1RIUL 2CLZA 2LE9A 2YKLH 1WICA 3PL6C 3HC0A 3TH2T 1P7HL 1MLCA 4L3AA 1MJUL 1IC4H 4RA0C 5T3ZL 4BZ1L 1JE6A 1R3IH 4OF7A 1WLHA 3QXTA 4NCC2 4M43L 1FAKT 1HNGA 3DRQB 1EAPB 5TQ2H 2EH7H 5D2NE 1Y6KR 1RHFA 3SDXA 3N50A 2ESVA 3LRSA 4G3YH 4NO0D 4JKPL 4P2RE 2I60L 4RISL 1ZEAL 4HUUB 5C0NC 1MJ7H 3PL6B 1U95B 2FATH 2WIIA 3DMMA 2J1KA 3PGDA 1UA6H 2ARJA 5D1ZC 2CUHA 2IMNA 4F33B 2YUZA 4WHCA 5FKPA 4PRIA 1YYMH 3EOBB 4KK6C 3VXNA 1MI5A 2JTDA 3CMOL 3QFDB 1NUGA 3RWIB 1K5NA 3V7AE 2XRAL 3SKUD 3P9MA 5IQ7L 3BZEB 1BQLH 1NANH 4JPWH 4CMMA 1DQQA 3GO1L 1MHEB 1DL7L 3KDMA 5DRZB 3PHQB 5D1ZB 3BUYB 3FAXA 3NCYP 4MX7B 4WU5A 3RWHB 4BUGA 1BFVL 4XVJL 4B0MM 3NIGF 1BVLA 2Y1VA 1SEQL 2ZCKL 3LRHA 1NCNA 3L3DB 4OIIL 3TO4A 5J4MA 2DYPB 3OHXA 4HIIA 3CFJB 1UXSB 2XA8L 3K8LA 4JFZL 4P4RB 1BGXL 5KSBB 5DEFA 1NBYB 2YHGA 2MSPA 3QUYA 2UY6A 1LEKB 4P3CH 1X5XA 4FFVD 5DS8B 4ZS6C 3S88H 3BIKB 4DGVL 5JW3H 2XNAB 4AJ0A 5D7JD 1EZVY 5D6DC 3VXQB 2SEBB 3IF1A 3R0MA 4HUMB 4JM2C 1R5WA 3OZ9H 3LKSB 4TYUA 2H32H 1J12A 4YO0B 5K9QG 5HYJE 4UOW0 3VXRE 3X11B 2IAMD 1A1MA 1FSKC 4HPOL 5JR1H 4Z18A 3RTQA 3S5LG 1CGXA 1Z5LA 4GKSA 5T5NG 4ZODA 5H37H 2YOCA 4FQ2H 5SWQA 5DJZB 5DK3A 5LG1A 3WIHA 1G0YR 4JR9L 4Z0XB 1HILA 2EH7L 4O2CB 5HGAB 1BF2A 4JM2B 2D4FA 4HXBH 4MNHB 1QBLL 4KTDH 5F6HI 3EGSA 4PRBB 3TN0C 3WNNA 1KB9J 3NPZB 4ELMB 3IXTB 1SVCP 1FSKB 3T65A 1W0WB 4POZD 2XWTA 1D5ZB 1G7LA 8FABA 4ODXA 2XT1B 1EV2E 1VGKA 5C7XL 3WKMH 4Q2ZB 4HAFA 1RK0A 3S5LA 1BVZA 4MXQD 4IMKA 3B2UC 3EFFB 2FLRT 3TESA 5DJ8B 3TNNB 9CGTA 1JWMA 3RZWA 3G6DH 3UPRB 4OLEA 4PJFF 3VWKD 4KHXL 2P5WA 4PD4J 3ALPA 1EFXB 1D5IH 2UVFA 5E5MB 4GRWB 3DVFA 1UB5B 3TN0B 5CBEA 3LOWA 1SM3H 4JO3L 1BQLL 5E95B 2GHWB 2YMXH 2E7HA 5FYLE 2UV3A 5GGTA 1LGVA 4Q0XH 5C0EB 5MI0C 2KZ1B 5EU5B 3IDJB 2IAMA 1WAAF 4N5ED 3GMLA 4ZO6A 1J0KA 4X4ZA 4V1DA 4XHJC 1S7XB 3H42L 5EU6A 4NPYA 3HPJA 3H3BC 3NZ8A 1HH6A 1T1WA 4P3CL 5E2VH 3FMGH 1AQKH 1X44A 2Z8RA 1KPVB 4Z77B 1JWSB 2VZOA 1ED3B 1WTLA 2VDRL 3LQZA 1DUYB 3C6SB 4ZAKA 5FO7B 1FO0L 3VXUB 2NY0D 1D5XB 5INCB 1RJZA 1WCBA 4WDIB 4AENA 5A1AA 1MFDH 2PN5A 5CILL 3ETBF 2C3VB 1JFQH 1X3DA 5IEHA 3VRLF 3BMWA 4MZ2A 4HDIB 1DBAL 1FH5L 3OAYK 1I9RL 3LS4H 4YHKL 5FA4B 3WIFB 3VI3F 1EXUB 5T5FL 3TJHD 1BD2E 3VWJC 4HLZH 1JWUB 5HD8C 4G42A 4XX1E 3MXWH 3ELAT 4Q7DA 1ZHBB 3VFOA 5IKCA 3EHBC 3BX7C 4G9FB 3S36H 5GHWH 3RIFF 1B9ZA 4P2QE 1OM3H 4G7VH 5FXCH 4WO4A 3I02B 4GQ9H 4PIRF 3JXAA 1AC6A 5HYQB 4OF8A 3INUH 5CUSH 3LD8C 3WKML 1H3PH 1YEKH 4Z7UB 3VWJB 3BGFC 3WHE1 3MFGB 4KH2A 3QA3B 3P11L 5AAWA 3O3DB 3Q1SH 3B6SA 2NY4C 4XPGH 2B0SH 3K2UH 5E9DA 1H15B 4GXUN 5CGTA 4XPFH 2WBJC 3JTTB 3MRKB 4OGXH 4J4PD 4QRRE 4ZSOA 3RJDA 3S34L 1XCQA 1I8IB 1OT1A 4N1CA 3EYSH 3MYJA 5JOFB 1S7RB 3W0WA 2DF3A 5DEGB 4IRSD 2YMXL 3LD8B 5LQBL 1T1XB 1WJ3A 5TFSH 3BGFB 3ZKNC 2DMCA 3HZKB 3PWPD 4JFFD 4ORGA 2Q7YA 4X7EC 5L8KB 5DQ9B 2NY4B 1PYWB 4XNQB 4I18A 2WBJB 2BX5A 4KV5F 3T1FB 4XI5C 2HN7B 4MA8H 4MNQE 2BRQA 3Q5OA 2M2DA 2VLKB 5E2VL 3MRCA 5D7KD 5C6WH 3OXSB 3IDXH 3RNKA 1QFWM 1QVOB 2JCCA 1VA9A 2MHAB 1LMKA 1NQBA 3HS0B 3LAFA 3KPNB 2I9LA 4Y1AE 4XP5L 5EUOA 2GKIA 1JPSH 3RNQB 1YUHA 2EEBA 4G7YL 4LIQH 4X6BB 5IMOA 2ZSVB 2CO6B 4U0RC 1P4IL 3WFEH 1VERA 2UVEA 5JO5B 3U9UB 5IQ9B 2BY3A 4XZUB 1IGCL 5FO9B 1G7MA 4W70A 1M7DA 4LRNL 2NR6D 5D71H 3P2TA 1MHPL 3FL7A 4OI8A 3PDGA 5I1AB 1UWGH 4Z7NF 1BLNB 2EZ0C 4GQ9L 3QXWA 4JGUA 3B9VA 4JFYA 4PJ7E 4LGSB 3FO1B 1BBDL 4L4VE 3CSPA 3VFTB 4U0RB 5GSVB 1MCPL 1MLBA 4J6RH 3RDTD 2JJTA 4N0FB 4R4FH 4M8QB 4NOBA 3JWOC 4PJ9C 2JJWA 1G6RB 4OV6F 4Y2DC 1A7QL 4KXZH 1D7FA 4XPGL 4YHLH 5LBSH 4TOYL 2DQTL 3K2UL 2HJLB 4U6XB 4XPFL 2YD6A 4QRUB 4OGXL 3MV7A 1EJ6A 2G2RA 3FB7A 1DQDL 2O5XH 2EYRB 2YRPA 3C8KB 2Y23A 1MAJA 1QYGH 1ZLUH 4Y5VC 4MMXC 1BBJA 4C55A 4X6DB 2FX7H 3FJTA 3IFPB 1CE6A 4PJ9B 3MRRB 3L5JA 3VW3L 3JVGC 2WZPD 4TUOB 4Y2DB 1AXIB 3GSRA 3HZYB 4XWGL 1RZKH 3MV9A 2H2SC 3CH1A 1L4IA 3T77B 5F88A 1A9BB 3GSQA 5IHUL 3U7AA 1FNLA 3MCLH 4L3ED 3VXMA 3CSYA 1AH1A 1PJ9A 5L8LB 4Y5VB 4BQ6A 4M1GH 2VAAA 5IMKA 5IOPA 4ZTPL 1P69B 4M6MH 3S37X 2AV7B 3RL2B 1YECL 4C83B 1E6OL 4FQCL 3WIIH 4LLVA 4LIQL 3WUZA 4F58L 2GFBA 4LKCA 2KQMA 4HGMA 3BHBB 1NDMB 3BO8A 3WFEL 1ZK9A 1ZLVK 4I77H 5ELIA 3VFPB 5IFAL 3TH3T 4IOIB 1WBXB 4QXGH 4P5TA 4UV7H 3SDDC 3PGCA 2F53E 3VFRA 4R90H 1ZS8A 1UWGL 1UCBH 2PW2B 3VRJB 2FO4B 5B3JE 2FEDD 1OW0A 1RQ5A 2MQ3A 2V9RA 1PY4A 1PSKH 2E6JA 3I6LE 4NFBA 4KKCC 4P46A 5GJTH 4M7JL 4PJHE 3JV0A 2NNAA 1OSZA 5I15H 1B0GB 4J6RL 3MGTA 3BESR 4M1CC 4HIHA 1YEGL 5D2NA 5LAXB 2W92A 3QXDA 3SDDB 1Q1JL 1MCFA 1HOCA 4CN1A 3V7AG 4NKDA 4P2RA 5HYJD 4EN3A 1JGDB 4H8WH 3U7WL 3ZDYF 4GXVH 3RVTC 5ICYB 3GSVB 5KVMC 4BK5A 4OUOA 4DQOH 3TT1H 1NAKL 4WI3A 5IV2B 4OGZA 1DSFL 5E8OB 5ESVA 3VCLA 5DMYA 1OVZA 1CLZH 1PBYA 3ALXA 2FX7L 3SKNB 4LF3A 2BK8A 4CU7A 1YN7B 1NUFA 2VISB 4UQ3B 5EBGA 3UBXG 5F7DB 2K1MA 4NKIH 4U0QB 3C9NA 2Q7NA 5EZLB 1N6QH 2V9TA 5L2JB 4NRXB 4PGBB 3FT3A 3O2DL 5DR5L 5I17A 4Y4KD 1ROWA 3QNYA 1UADC 3V6BR 3L6FB 4M1GL 1QLRA 2CJUL 2WV3A 1NEUA 2YPLE 4RMWA 2CDGB 4HZLB 2P49B 4S1SH 1P7QD 3V4VL 2F19L 4RFEA 5HHNA 1MHHB 5IW6B 1QNZL 5FYJD 2EIZA 2BNQB 4ZS7L 1R3JB 3V6OC 1VACA 3DXAE 4XBPA 4DGYL 1FNGA 3WDHA 4MHHI 2PKDA 2XWJB 5FYLD 4KZDH 3CIQA 4UILH 4PLOB 4FFWD 1S7QA 2VE6B 5HYJA 3O81A 3VXRA 2DJ4A 4FQ1L 3TEUA 2VH5H 3VU2A 4OCWH 2BCKB 4NNPL 2NYYC 4Z7VF 5F71A 1WWCA 4DW2H 3CFDA 3D9AL 5GJTL 4MXWH 4I4WA 2Z93A 5I15L 5ANMB 1S5HA 3MROB 4ODUA 1IAMA 4XNYL 3WFBH 2ATPA 3QEQB 1JNNH 5E00B 5D5MF 5FK9B 3WO3B 3O6FB 3DYPA 3UROR 2IANE 4MXVF 4H8WL 4XVUD 2M1KA 1INQA 4GXVL 1IGFH 5EU3A 5BXFA 2K9UA 1TQCC 4OQ1A 1BEYH 2P5EA 1LP9E 2PW1B 3TT1L 1AGBA 1PEWA 1BD2D 1F11A 4D9RE 4YHPB 3QPQC 3V5DA 4HHAA 4L4TA 5T1LB 4DK6A 4P2QD 2V17H 3EYUH 4X0KA 4KJWC 1E27B 3D39E 3IGAB 2CXKA 2V5RA 1TIUA 1HXMB 3QQ9C 2NTSP 5DD6A 1A02N 4PRNB 1TQCB 3HKFA 5DQJA 3V9FA 3JV4B 4YDJA 3WNMA 4MS8D 4NJAH 2LV4A 5I8OL 1MCKA 3QH3A 1WK0A 2HVKB 4NZRL 3L9RB 2Z0BA 3F7RA 3MA9H 1LEIB 4K3EH 5JHLL 3QDME 1T4KB 4AYFA 1I1RA 5INDA 4S1SL 4OM1H 3O8XC 4IOFD 1KB5B 1DFBL 2PYEE 4KK9D 4HKJA 1B4RA 4ERSH 4QRRD 2WWKT 4WTWA 1XGUA 1J1OL 3L3KB 2GJ6D 4XX1G 1HWHB 3CSGA 4U1NB 5D1XC 3FRUA 4ZUSA 4M5YL 1X5JA 3WO4C 1Q0XH 1OTTD 2H1PL 4KRNA 4ONGL 3MA7B 4IHOA 5IF0A 1T66C 1JK8B 5IB5B 1C12B 2GJZA 1LDPL 5C0AE 2VH5L 4AG4L 3T2PA 1QRND 5DD1H 3O8XB 3BH8A 1YQVL 4JZNA 5DJ2A 2RHEA 4DW2L 1T22A 1RUKH 4MNQD 4K9EH 4HQQL 2AXFB 2ZOLA 1VESA 3VXOB 4X80H 1X5GA 4P23D 4GRLB 4HMDA 5CEZH 3BD3A 1WZKA 3BKMH 3OX8B 4JZJC 3CLFH 4N0UE 5D1XB 1JNNL 5TDPA 4PRAB 4U1GC 1H8OA 1I3GL 4HJJH 3WO4B 2R4RL 4Y1AD 3UP1A 3OQ3B 4LKXA 1FYTD 4PJ5E 1MUJA 4LU5H 4NYLB 1NGXA 3LV3B 1IGFL 1CE1H 4LSVH 5DRXB 3PIQA 3WLBA 1BJ1J 1ZHKB 1G7HA 3FZUD 4J23A 3TIDA 4FFYL 1DN0A 3TWCH 1V7NL 4JQXA 4RIRA 4J3SA 2ICES 3F6IA 2VSDA 4JZJB 4U1GB 3PP3H 1FGNH 1RHHB 3K4DA 4X4YB 4X98A 1BFTA 5BOZG 5J6GA 4U1MB 1VDGA 4XPBL 4Y5YC 4Z7OE 5KVGL 1I3UA 1E0OB 3N1PC 2EDWA 3ZMRA 4AEIH 4M7LT 4PJEB 5CD3B 2BJML 4AT6B 3CK0L 5DLML 3RHWK 4JRYB 2R9HC 3FB5B 1QFWI 4P99A 4RGOL 2FH8A 4Z7WB 2IQAA 1MCOH 2C26A 2H32A 2HTKD 5BRZB 4X5WB 2I9TB 3UTZA 5H94B 2P1YA 4WFEE 5BCAA 2CO7B 5K9OB 1MWAH 3W82A 3ARED 3ULVE 4Y5YB 1MVFA 3N85L 4PTTA 4UIMA 5AWNH 2EH8L 5GGTL 2X70A 3C60D 3VXPB 4TTDD 1Q9WB 3VGBA 1G7PA 3CJJA 4U6HA 5FDWA 2UZYB 2G5RA 3H8NA 4QF1B 1DBBL 2IBGA 2H3NB 3IAQA 1YC7A 4YHIA 3FQXA 4UTAL 3QIBD 3GBLA 4M61B 4YWGH 3OB0K 4O00A 4NKMB 5ERWA 5HHME 4X6CA 5HHOE 4NN5C 1XMWA 3KWWA 3SDXF 4FZEH 1IGYB 4OZGA 2A1WH 5D2LB 2QADD 5DJYA 2NY1D 1QSZA 5HGDB 4PJBA 1XGRB 4NQEA 4XGZB 5I1LA 3QIUC 5TPWL 3I9GL 5FCUH 4L8CB 1FL3A 4F9PA 2XZCL 4YHZH 1CDYA 4NRYA 2V6HA 1UZ8A 1BHGA 2APFA 4PJ7A 5DFVD 1RUPH 3WCYA 4L4VA 2X09A 2YPKA 5CP7B 2VZVA 1GC1L 2CK0H 4XP6L 2QR0A 2VRAA 4QXTB 1NL0H 3L3GB 1WWWX 4NN5B 4ZYKB 5CEXB 1AXSA 1HEZB 4EDXA 4G6KL 5GGUA 3TWCL 1QLFB 4FQHB 4JFED 5I30L 2F53D 1XF4A 4NFCA 2XKSA 4QHUA 3QIUB 3TVMC 1HZHH 2CMRL 1I8MB 3EJZC 3R0NA 4XP1H 2YWZA 3CZFA 3C60A 4Z78A 1Y18B 4C56A 2M8XA 1T04B 2EDEA 4HPYH 3PWLB 5CZXC 2AJSH 4YLQT 3P40A 4MB3A 2XG5A 4PV8B 1AKJD 3RWJA 2HT3D 2VXUL 5F7LB 4LCIL 3V0VB 5IB3A 5FUOH 1G84A 3MZGB 1YNTB 2NXYD 3ARGC 1CT8A 3FT4A 3AMLA 1VCAA 3SQOH 3TVMB 1IGTA 2R0WH 3GNML 3FCTB 4YHOL 1C5DB 4JVUA 4FTVB 3TNMA 1TPXC 3FO0L 3N1MC 5C9JB 2MWCA 1REIA 2DTSA 1DQML 1U8MB 3STZA 4DFHA 3W9EA 3HAEH 4MJIE 4H1LG 4QY8B 5K9KA 3L7EB 5EZOH 1JGVH 3JTSA 3ARGB 1A1OA 4MCYB 5D7LA 3QDJA 2NXZD 3S37L 3CC5B 3H7BA 4OKDA 3F7PC 4LNRA 3ROLA 4POUB 5DJAB 5EZIH 3VFVB 3QJHB 1I9IH 4HV8A 4JDTH 2A1WL 4QTHA 4YZFE 5BMFH 4OIBA 3FO2A 4NQXA 2F53A 1TPXB 5CJQH 5E7FA 5BVPL 4XNXH 4TNVK 5C86A 4HXAH 5FKAB 4GRWH 5C2BH 4H1LA 3O41A 1UACH 2YRLA 3BKJH 2OMNA 1RZJC 2R1WB 4DOHE 4PJHA 4NQUA 2CK0L 1H3VA 5HYIA 2HJFA 4C58B 1K6QL 3MBEC 5F3HA 1OCWH 4APQA 5LKNA 4KRLB 4MDIA 4QRTB 4DZ8A 3PQYD 3O6KL 3P4MA 3RZCC 4U6YB 4XP1L 1HHJA 3DECA 4OD3L 3ULUD 4K23L 4YHML 5JQHC 4X9BA 2AJSL 1JZ3A 3OKKA 1XCTA 1HQRB 1CFNA 3QEHA 1I3RB 3MBEB 3RRQA 3TC9A 4KKLC 3JZ7A 5CJXA 1BVKA 4W4OA 2IAND 4JY5H 5EN2B 2FR4B 4N9GB 1MREL 4OLZH 2EYTA 3RZCB 2B1AH 3LCYA 3EO9H 1FCCA 4FNLH 5JPNA 2FZ3A 1HHIA 4UB0L 3ZLQC 4FXKA 1FG2B 2E8YA 3IETB 4TSBL 2YPLA 3T3ME 1M71B 2Y5EA 3PE9A 1S7TB 3T4AA 2H41A 2ITDA 4GRMA 2WQ8A 3KAAA 2HFFB 3FQTB 5KZCD 3KYMB 1KN2H 4IRJC 3PP4L 5HGGS 2H9GA 3D39D 3MGAA 2C3GA 2BMKB 2EDXA 3S36X 1KEML 3ARDA 5CSZB 3DXAA 1AC0A 4UNVA 4KK5D 1JTPA 4MYWB 1A3LH 3KYAA 3S96A 1UWXK 3ARUA 2NLJB 4H20L 2G9HA 1T3FB 2LVCA 5JW4Q 1NC4D 5CJQL 3HB3D 1P1ZA 1U41A 2R1YB 5T3XH 1BPVA 4XNXL 1T2QH 3QDMD 1CK0H 1OWRM 4LHUB 2N4IA 3MR9A 5C71A 2BFVH 5KSBE 1UJ3A 4XCEB 4JO4L 2DS4A 4IRJB 4F8QA 1N5AA 1U93B 4X6EA 3BKJL 5I8KH 1W0VA 1EEZB 3V6ZB 3MODL 4OCYL 3L5HA 1KCLA 1FGVL 3SKOB 3MCG1 5DJDB 4MQTB 1OCWL 1GPOH 3R06B 2F5AL 1S9YA 1J8HA 3P9WB 1ZT4B 4KUZH 5DGQA 3SY0A 3DV4B 3QIWC 3IB4A 3KJ6L 2MMXA 3UPCA 2XZQH 4K8RD 2XTJC 5KANG 1QO3B 1HI6B 1K3IA 1LP9A 1M4KA 1MRDL 4F80A 1FDLL 4MMZC 3T3PE 4LMQE 2WBWB 1A3RH 4P59L 4R7DA 4EIZC 5MEQB 3SGJA 3GJFH 3QG7H 5ID0A 1WBZB 3HC4L 4AIZB 4IDJH 5HI3C 1K4DB 2HFEA 4ELME 3V4UL 2UUDK 3JWDH 4E42A 1WZLA 4PJ5D 2BRRH 1F4YH 3QIWB 1DTUA 3SDYH 2XTJB 3EO9L 5DTFB 1AR1C 4D0BB 5TDOA 1HYRC 4IMLA 4NNXB 5EUOF 1XGPA 4ODHL 2EDKA 2FIKB 4JFQA 3NBNA 5FYJH 2W91A 5EWIH 2BSSA 1ZTXL 3NFNB 4OF0A 2MKWA 2PYEA 4YXKL 3X3FH 3LEVL 2D7MA 3LN4B 1OTSC 1KG0A 1GOHA 4LCYB 1CF8H 5I19L 2CLRB 1A3LL 1T5XB 5IG7B 1A64A 4NO2A 5T1KB 3KS0J 2EC8A 4OAWA 5CD5D 3LIZL 3V8OA 1XF5A 3HFML 2CGRL 2YD7A 5E08H 4QRPB 4JN1L 4CBPA 5GIRB 5I1DA 3V6FA 1T2QL 1ETZA 1RUMH 5C0AA 1CGSH 1YY8A 2J5LC 3CVHA 2BFVL 2X41A 4P2YA 1HKFA 4WFED 2V9QA 1A14H 4X5XB 2ICEA 4WNQA 4F2MB 2RFXA 3V52H 2VB5A 2J6EA 3QCVL 4RAUA 4S1RH 5B39B 3BFOA 1PFCA 1JGLH 1YMHB 4IBLT 2IQ9H 3GSNB 1VB9A 1E4XH 1E28A 3M07A 5DVMA 4N0UA 1EZVX 1IL1A 5LGJB 3UTOA 1OAKH 4KUZL 5B8CC 4PJ5A 2XY2A 4OFDA 4JE4B 1V8HA 2P4AB 2J5LB 4PREA 3WKNA 1KCKA 2CRIA 2JJSC 5KW9H 4GKNB 2V2TB 5HHOD 5I8CB 3IRZA 1C5BL 4JPVH 3KLDA 2E9JA 1A3RL 1ND0B 2VO5A 2BHUA 4FQXA 4HIJB 1F6AA 1QQDB 2JF1A 4X7SL 4EUPB 3V5KA 4F37F 5GGSB 4RZCB 3FB8A 1YEEL 1QOKA 1OGAB 2VSCA 3L3IA 3JWDL 4G6AD 3UAJC 5B8CB 4JEGB 4CNIA 3JUZA 3FAWA 1CICC 3H2WA 3FONB 1WV7T 4QOKB 3SDYL 4YFLF 2YA1A 1U8IA 4Z7UE 3MGOB 3U0TB 2F8OA 2X1QA 2NY6D 4UDTB 4H26B 5ITFB 1U92B 2AEWA 1CXLA 1GOFA 4YX2H 5F3BA 3RVVC 4N9OB 4ZG1A 1MVUB 4ZPVB 1S9XA 5MP6H 5EWIL 3N1GC 2DBJA 4G8IB 1AXTH 5HYEA 2VXSH 2E9BA 1NKOA 1ZWIB 4OZFG 5FYLL 4HF5H 1QA9A 3KPRD 1CICB 2XG4A 3MNVB 4RMRA 4MCZB 3LQAC 3R8QA 4OLYL 3TP4A 3T0VA 4GXUM 4RSVA 3RWCB 1CGSL 1U91B 4LSSL 5C6TL 2DQGH 1MFEL 4JRWA 4R6UA 5E2WL 3TO2B 1OPGH 2J8HA 1QPXA 2WWMD 4U3XA 4NWTH 3G5ZB 3DBXB 5DRWA 1Y0LB 4YPGB 2APBA 3QYCA 4JLRA 1JGLL 3TBYB 2H8PA 4FG6D 2IQ9L 3GMRB 3U36B 4KI5C 2R29H 2OYPA 3FFDB 3WEXA 1AGEB 3RAJH 4TVPE 3H3KA 2MTPA 4N8VB 5HVHC 4PY8I 1FVDB 3DVGA 1AE6L 1BJ1H 1Y6MR 2BNRB 4YR6B 3GMNA 1UM5L 1CD1A 2DBLL 4HS3A 5IBTH 6CGTA 3Q6GH 3T08A 3FO9A 1P7KA 2V7NA 5JMRA 4OBRA 2Z31A 1DE4A 1U8OA 4KROD 3GMMB 1A6ZB 4Z76B 1YEJH 3SGKC 1VEMA 4OCXH 3NFPB 3TYGL 2P8PA 5F89B 1BAFL 5FYKU 4NNYA 2WLZA 5E8NA 5DD3L 4OZ4A 5HVHB 5D1QC 3U30C 3OKOB 1NCCL 3D0LB 2OL3B 3VRIA 5LVEA 1IEHA 3O3AA 2V2XB 2P7TB 1HNFA 1K4CB 3FFCB 4UIKH 5MP6L 2DM4A 2A6DA 5A16A 3D0VB 1JPFB 4TRPH 1EJOH 1ES0B 3DJ9A 4KY1L 2CDFB 3S98A 4DWHA 2PO6C 3BQUC 3OJMB 1LD9A 5EULV 3OKMB 4KWUA 5EBWA 2D7PA 4U3CA 4KMTH 3C5ZC 2LVEA 1D5BB 2R2HA 4PG2C 3U6RB 5D1QB 1XF2A 1OB1B 3U30B 1FV1B 3UDWA 3EYVA 2X4QB 3CVIL 4MJIA 2NY3D 3NCYS 4HK0B 4F7PB 3BP6B 2H6PB 4GOSA 1D9KA 2HRPH 2DQGL 1CIDA 3AMKA 5HPOA 1OPGL 3C5JB 4JJ5B 2NW2B 2YA2A 2PO6B 3BQUB 5KSAD 5ALBL 3IAPA 4KJPC 3C5ZB 3NVQA 2ICWI 4BSJA 3M8OL 3C08L 5CJOL 3GJEA 4JHAL 1KJ2L 4DVRH 1QFPA 1CG9B 5EPMB 4NQVA 3RAJL 1DQJB 1JNLH 2GTWB 1GAFH 5D72L 4PJAE 4E41B 4OD2A 2VITB 3NTCH 4OFKA 4UOW1 2C1OB 3CFBA 3MRLA 3Q6GL 1C08A 4WGVB 1FL5A 3RI5K 3BAEH 1KB5H 4KK6D 4JHBA 3AGVA 3MFFA 4JKMA 2FRGP 2GSGB 5C0JB 1A7PH 2W9DL 3DRQA 3Q5YA 2OTWB 2W07A 4GLRH 4XPTH 4PUBH 5I9QC 1EAPA 2OJEB 4XP9L 2X4NB 4NSKB 4UT9H 2AXGB 1GGUA 1AJ7H 2J8UB 4YXHH 1J5OL 2VL4A 3CFEA 3DURB 2X7LB 4LQ1A 4ZFGL 4UTBH 1DLFL 4HUUA 3PL6A 1U95A 1CLOL 5F96H 4F15C 4FMFA 3NCJL 3Q0HA 4EQ3A 4ZS6D 5IGXH 4ZUTB 4KMTL 1AGFB 1DBKH 5I9QB 4MQSB 3EOBA 1KULA 3H0TB 5F9AC 1RU9H 3QFDA 2F54E 1WZ1H 3RWIA 5IWLC 1B2WH 2UWEB 1NGPH 5B4MD 2RCSH 1X5HA 4LCWD 1P2CB 3MV8D 3SCMD 1KV3A 4TSAH 3TH4T 3H9HB 4HJ0D 1MHEA 4RBPK 4F15B 2BDNH 4GBXD 5DRZA 1MFBH 1NMBH 5D1ZA 1ZOXA 3BUYA 4MX7A 1RUQH 3RWHA 4H25B 3DMMC 1RULH 5FGBA 5F6IC 3L3DA 4DVRL 2DYPA 4HAGA 3BI9X 3CFJA 1FE8L 1UXSA 4KQ4H 4P4RA 1SBBA 5KSBA 1NBYA 2BNQE 3NA9H 1LEKA 3TN0D 5DS8A 2JB5L 3SDXB 3BIKA 2XNAA 3OR7B 4LPYA 2CPCA 3EO1B 3DVIA 25C8L 3VXQA 2SEBA 5F7YC 1JF1B 3LKSA 4BK4A 1KLGB 4JCMA 4YO0A 4RFNC 5D7IB 5F6IB 3U4BL 2X4PB 3ULUH 2FECL 3STLB 5BV7L 2L7JA 5E6IC 4JQVA 1VPOL 3S97C 1MRFH 5FF6B 1A7PL 3KYKH 3CLEH 1T7YA 4XBGA 3V6OE 3AS0A 3SE8H 5ANME 1B0RB 2XQYK 5DJZA 4M6NL 3GHEH 2AP2A 4KVNH 4UT9L 4Z0XA 2QHLA 2VDOL 3MMEB 5D6DA 4O2CA 1NBQA 4S1DC 5HGAA 4JM2A 4MNHA 2AK4A 1M05A 3ARPA 4YXHL 4ONFH 1INEL 2JE8A 2X4SB 1EO5A 4RFNB 3HN3A 4ELMA 3C8HA 3IXTA 2A77H 1W0WA 3UTPE 4XHJD 5E6IB 1C1EH 1WITA 4HIIB 3MV11 2OCFD 3IDUA 3GSXB 3EFFA 5DJ8A 3TNNA 3R4DA 1OD9A 2ZG1A 2QHRL 4D0CB 4FQPA 2D0GA 3UPRA 3LEYL 3D6GA 1HWGB 1W72B 2DLEA 1CBVL 3U2SB 1EFXA 1NGPL 5E5MA 1UB5A 3ILQD 5DD5L 4OZGF 1R3KA 4JO1H 3RVXD 1QD0A 1HIML 4PJBF 5LWYL 1A1MB 2BDNL 1CGYA 4AMKH 3VWJD 1L7IL 4X9GA 4PRPB 5C0EA 3T2OA 3IXAB 2CRMA 3IDJA 4PJ7F 4OT1H 5JXEC 4IMKC 5L7XH 4I3GA 5BW7C 2MKLC 5SWQB 5A2LH 2JIXB 1FN4B 1J1XH 4OQTA 5IVNA 5EBLB 3UMTA 3D85A 2I25N 2QSQA 1KPVA 3EOAB 3EGSB 4Z77A 4P9HH 1JWSA 1HXYB 2ZNXA 1ED3A 2HFTA 4LAJH 1DUYA 3NFSL 4YBQC 2Q86B 3C6SA 3T65B 1A8JH 2XWTB 3VXUA 5EU4A 3TF7C 1D5XA 1T7WA 4K3DH 4WDIA 3VD3A 2DQFB 1A6WH 3BVNA 1RK0B 2GUOB 2C3VA 3EYOB 3ULUL 3QPXH 4R96B 1J05B 3HE7C 4HDIA 3OKLB 3VFGH 3G08A 5FA4A 3WIFA 1JWMB 1UJTA 4ORZC 1N5YL 4OM0H 1V3LA 4PRHB 1JWUA 3ZDZF 2P5WB 4ETQB 1ZHBA 3O3BB 3NAAL 3AS1A 4G9FA 5CBEB 4CMHC 1IBGH 3I02A 1J7VR 3G5YA 1N7ML 5GGSY 5HYQA 4JFDA 1YY9C 1FZMA 3TYFB 1KACB 2EXYC 4N68A 4TVPD 4YDLC 2UZIL 1JBJA 1YQ2A 3DYOA 3HE7B 3L5XL 5J57B 1U42A 1CGUA 1MJJA 3BKYL 4ODWB 4Z7UA 2BHZA 3OPZH 4ODVH 1EO8H 3HPJB 3QA3A 1JHLH 1T1WB 5DMIH 1OAQH 1KIQB 2OK0L 3BN9C 4N5UA 4CMHB 1H15A 3LKRB 3S9DB 2BC4A 2YRZA 3JTTA 1ZLWH 3MRKA 3LQZB 1WBYA 2XFXB 3C8DA 3DGCR 1I8IA 4DAGL 4O58H 3B43A 4YDLB 1S7RA 5DEGA 5MERA 4XCYB 2PR4L 3KS0H 2YPVH 1H3XA 4JRYE 2W9EH 5CINH 5DC4B 5B3JF 3HZKA 2E5EA 1OP3K 4P3DA 5AG9A 4Z7WE 4KVCH 4G42B 4HCRH 5JW4N 5DQ9A 5L7XL 4XNQA 4PJHF 5FGCB 2WBJA 4XPHH 1J1XL 1MF2H 2DIAA 1MPAH 2HN7A 4QHKI 3T1FA 1A7RL 2VLKA 1ZT1A 3CX2A 4URTB 3O11B 3OXSA 1XF3B 1QVOA 1U8LB 3L1OH 2MHAA 4WW2C 2QL1A 4NCDA 5KJRL 4DKEH 4Z8FH 5C0RL 2X1XR 3HS0A 3KPNA 4ZTOH 2DWEB 4PJ9D 2BVTA 5MEND 1PG7H 3CVHL 4K8RL 2VXQH 2F74B 4Q9QH 3BUTA 2ZSVA 3VGGA 5AG8A 2OP4L 4MD4B 3ZSTA 3LZFH 5JO5A 1EEYB 3B9KC 2C5DC 5IQ9A 4XZUA 4OM0L 5DJ6B 1ZVSB 5FO9A 4NWUL 2VTFA 5GJSH 4WW2B 5I1AA 1BLNA 1IBGL 4O02H 4U1IB 5DVKA 3S3JA 3LB6C 3TGXA 3KVQA 4L9DA 2OR7A 4G9DB 1NJ9A 3FO1A 2IG2H 2FSEA 3VFTA 1OLLA 5GSVA 1CXHA 3VGHA 1LEGB 3B9KB 2CR6A 2Y5TB 4N0FA 1IILE 3L7FB 4M8QA 1J88A 2YD2A 1BZ9A 3MUY1 3REWB 3MRCB 2A6JB 5GZOC 2HJLA 4U6XA 4QRUA 1RZIB 2JCCB 3GGWB 3RY6C 2EYRA 3C8KA 1AHWC 2FBJL 5A2IH 3GDBA 3QFJA 4YDKL 2DQEL 2YPVL 4X6DA 1NAMH 3OGCA 2XYCA 3IFPA 5CINL 3MRRA 3QUMB 4OLVH 3V8CA 4KVCL 4TUOA 4I0KA 1CQKA 4Y2DA 2DQHH 4HCRL 4MZ3A 4PR5B 3MLUH 3ULVL 3T77A 1SYSB 1RVFH 1MPAL 1A9BA 2ORBL 3EOYG 3F7VB 3NABH 1JZ8A 3MLYH 5E8DL 1NCWH 4KKCD 1FNAA 4RGNE 1ITBB 1HCFX 1AHWB 4Y5VA 4FTVE 1KGCD 4R3SB 2DRUA 1X5AA 4KQ3L 4D8PB 4ZTOL 5FUCC 3LPGA 5HTSA 1MLBB 2AV7A 3RL2A 3JVGA 2F54D 3KHQA 4NC0B 1LP9F 6FABH 2J88L 2IGFH 1I85A 3BHBA 1NDMA 1T7VA 3LZFL 5I1KH 4FZ8L 2MQ0A 2WUCH 3TT3L 2EKSB 5LCVH 3VFPA 5L9DL 4JHZA 3UTQB 4IOIA 1WBXA 5I1GH 2EIBA 3DYMA 2J4WH 1EPFA 4OCRH 5E6YA 5FECB 1IAIH 3DI2B 1YEHL 1J86A 5L8JB 3VRJA 2AJVH 2FO4A 4NZUH 3GK8H 2CKBH 1RZ8B 3TA3C 4FS0A 1ONQA 4OKVB 1Z3GH 3OAZK 1CE6B 3OF6A 4LHQB 2IG2L 4ZFZB 3ZKQD 4NUJB 2EDOA 3MV9B 1GIGH 2XOTA 4GMSL 3TBVB 5EO1B 2A83B 5LAXA 1H5BC 1CN4A 3SDDA 4AEFA 1SBSL 2IPUG 3CSYB 4P2OA 2ENYA 1JGDA 4MDJB 5ICYA 4G80B 3GSVA 2Q20A 1IT9H 2QQLH 3TA3B 5IV2A 2ZCHH 4GW1A 2HAZA 4XNZC 1JPTH 5E8OA 1QSEE 1KEGL 1RIVH 5F1NB 4P46C 3SKNA 2MOVA 1NAML 5EIIB 1CFVH 1FLRH 1ORSB 1G9NL 1YN7A 2VISA 2QSCL 2BOCB 4UQ3A 5A2FA 2VABB 1H5BB 1TJHL 1OAUH 4A6YL 4F9LC 5F7DA 5FV1L 3ARVA 4QGYA 2DQHL 1RI8A 4JHWH 4L9LC 5EZLA 3GBML 1NCBL 5L2JA 5IM7A 4ACPA 3UTPD 1JNHB 2R8SH 4HJGA 4NRXA 4PGBA 2UYLB 2GW5A 2WM0A 2CQVA 3UJIH 2HT4D 5FYKD 2YD9A 4E0RB 4XNZB 2NW3B 5IHLB 4Y16D 3EDFA 4JRXB 1IGIL 2CDGA 4P46B 4UBDC 4DN3L 2MPAH 1DANT 1MHHA 5IW6A 6FABL 2BNQA 2DLTA 4L9LB 1WCQA 4WI2A 1VFBB 3HE6C 4D9LL 1SJHB 5LCVL 1F4AA 2XWJA 2J4WL 4OCRL 4WY7L 5FAAA 5IB4B 1IAIL 1CFTB 1T89C 1R3HA 3QPQD 3SN6N 2NY5H 3UTSD 2BSRB 2OM5A 5JQ6H 2K7PA 1X7QA 3VGEA 4HG4K 2DAVA 3VCLB 3WD5H 2BCKA 3JBG7 5TE6L 3ABZA 4HGWB 3V6OA 1CDBA 5ANMA 2VL5B 4NT6B 1EIBA 3MROA 3E3QE 3HE6B 1A2YB 2VR4A 1GGIL 4Z7NE 3UEZA 2FJHB 5E8PB 1EEQA 3QEQA 1SY6A 1AGCB 1ZE3C 4I5BB 1WQVT 4YUEH 5E00A 4G8GB 1JGEB 5FK9A 4JREC 3O6FA 3ULVF 3QNYB 4R26H 5DYOB 4XXDB 1U8KB 4B41A 5AYQA 3SO3C 1K2DB 1IT9L 1JJUA 2PW1A 1KC5H 4DUWA 1KCUH 1JPTL 4TULH 2YA0A 4YHPA 5HHNB 5HI5D 1OP5K 5IEKA 5FDYA 5T1LA 4WHYG 1VACB 5D4QA 4XBPB 3W11D 4CUCA 3EYQD 1E27A 3UBXI 4X9IA 5HXMA 1KPRB 4JREB 3TBSB 1T66D 1F3DJ 1HXMA 5DVOA 4ZNEA 3I6KB 1IAOB 3SO3B 2EDRA 2XTJE 5E24E 4OCSH 3RA7H 3EAKA 3JV4A 1A7OH 1UZ6E 1RY7B 2WWKO 3L9RA 1LEIA 3EJYC 1T4KA 2JELL 4B53A 4LAQL 1KB5A 3EZJB 2HWZL 1Z9OA 3BSZL 1P4LB 4QTIH 1S7WA 2ZOKA 4LGRB 4PJDA 2C3HA 3L3KA 3AAZB 3V5HB 5JDJA 4L8BB 3V4PH 1AD9B 3GI8L 4BH8B 1P6AB 4X9HA 2LFGA 1DQLL 5HHXH 1SJVA 4MVBC 4BFBD 3OWEA 2R4SL 2P5EB 3MA7A 4QRPE 3BP4B 3D3VD 1JK8A 5ILTH 2NY5L 5IB5A 1C12A 1BECA 5JQ6L 2CIIA 5K59E 1MRCH 5JOPE 3NN8B 2HKFH 3WD5L 4Y0GA 3O8XA 4HHAB 1LO4L 4L4TB 4FOMA 3QI9C 4EI6B 3U9PL 5DHVH 1NMAL 2AXFA 4KTEL 1F90H 3SE3C 4RWYH 4KRMB 3VXOA 4LSQL 2A38A 4GRLA 3CUPB 3OX8A 1RZGB 5KN5B 5D1XA 4PRAA 4HIXL 4PJCB 4YUEL 4NBZB 3HZVB 4YDJB 2BZDA 4NYLA 4PJXB 3BISA 3LMJH 3LV3A 3ZT6A 1QZ1A 4PJ8D 4Q74A 5DRXA 1NEZB 1ZHKA 5DUML 3MOAH 3QI9B 1T1ZB 2HVJB 3SJVD 4JPKH 3O2WH 4KHTH 3IDMB 1MFCH 1A0QL 4JJHA 2R1XB 1I75A 4Y19D 1XGUB 1HYSC 4N90E 3B4NA 1O7VA 4JZJA 4P3WA 1RHHA 4BUHA 4X4YA 1OGAE 4ZUSB 3FRUB 4O4YH 1MCEA 4U1MA 1GGCH 1P84J 4YZFF 4QOKE 4WGWB 4LLQB 4GAJL 4PJEA 1CR9H 5CD3A 3K1KC 4M7LH 2A9MH 4AT6A 2Q76A 3UTTD 5TE7L 5GRJH 3SDCD 4JRYA 3TJEL 4Z7WA 4WI8A 4YQXH 2BHYA 5BRZA 4X5WA 2AJZB 2I9TA 2BVQB 5H94A 4OBSA 2AJXL 5E99L 1ZVHA 4XWOC 5K9OA 5ICZA 1DANU 5T1DL 4Q9BA 2MQCA 4J3TA 5JZ7C 4Y5YA 3E0GA 5TDPB 4PLJC 1Q9WA 2L0DA 2YUVA 2VLME 3DHMA 3EJJX 3DHJA 1CXIA 2H3NA 3SDAC 5HHXL 3ARSA 2APVA 3MRFA 1CFBA 2XI9A 5KOVC 5IMLB 4IRZH 4NC2B 4M61A 3TIDB 1DN0B 1VGEL 3D2UA 2ZCLL 3GRWA 2F5BL 1K8DA 1A7NH 1LK3L 4QHMB 3EJZD 2XN9B 3ZTNL 2OBGA 5TF1H 1F90L 3CU7A 4HKXA 5D2LA 4RGND 4X98B 1EGJA 1F2XK 4LSRH 4FTVD 3FTGB 5HGDA 5C08B 1XGRA 3E6FB 5CZXD 4LEOB 3ZTJG 2YXFA 2BOBA 3B8YA 1NPUA 3TZVD 4X7DC 3SDAB 4N0YL 4L8CA 5JW5B 1U3HC 4DTGL 1X4YA 3O2VH 4ODTH 4ODSH 3SEPA 3VE0B 3RWGB 4JQIH 3ARGD 2X89D 2BNRE 2O93L 4QXTA 2H32B 4FQLH 3L3GA 5CEXA 4ZYKA 5I6XC 1XAUA 3MOAL 1HEZA 1G9EA 4JPKL 1FVCB 4W6XB 3O2WL 3QDGD 1QLFA 3PF2A 4FQHA 3SPVB 1S5IH 5BS0B 1U3JA 2XA3A 4WFHD 4KI5E 4FQIH 2X70B 4ZFFB 2V5YA 1ZLSH 1G7PB 7FABL 5FDWB 3QIUA 4LCUB 4HKBB 5F1IB 1I8MA 2C4XA 1U3HB 3GKZA 1GGCL 5DA0B 3IU4H 4PLKD 3K8MA 2OQJB 4F9PC 1KCVH 1UGNA 5GZND 1T04A 2O26U 5DURD 2O5ZL 3RY4A 2A9ML 3VH8G 5ERWB 2NQCA 4NQCB 4PV8A 4S11A 5KSBF 5HDLA 4X6CB 5EB9A 3FFCE 3HRPA 3FOMB 1S9KC 2VIRB 3U82B 3C87A 1YNTA 4OZGB 3GMOA 1P9MA 1W0YT 5DJYB 2YK1L 3U4EB 4BZYA 3TVMA 4G5ZL 2GSIB 2VQ1B 4PJBB 5DXWA 4NQEB 3NPSC 1LO5B 3FCTA 2VWEC 4NM4L 5E2TH 2Q87A 1I1AD 4LOUC 4XAKD 4FTVA 4NRYB 1QSED 3ARBC 5TE4H 2RR3A 5C9JA 1UZ8B 1F45A 3WUWB 2ADJB 3KXFB 2DKSA 3ZKXC 4MAYC 5DMKA 2B39A 1LE9B 4QY8A 5L88L 3L7EA 4IRZL 5C09B 3VJ6B 4EDXB 2DLHA 1S78C 1RZFL 3DTXB 2ILLA 3T3PF 4MCYA 2UY7A 1PY9A 1QR1B 3CC5A 2DD8H 4TPRH 1PDKA 3ESUF 4JM2F 4M00A 5DJAA 3NPSB 4FABL 1BREA 5TF1L 3VFVA 2P24B 4I0PD 4J2XA 3RGVD 4ELMF 3ARBB 1W72H 3CZFB 3SE9H 4Z78B 4PP2B 2JK5B 4TVPL 43C9B 3P0YL 5FKAA 3ZKXB 4HBCH 4MAYB 4WVRA 5CSBA 1VFMA 1FFRA 5I0DA 5IVXB 5EOQL 3Q5TA 4MJ4A 5HDQL 1WIOA 4PS4L 1GGBL 4JQIL 4IIQC 5CJ5A 5IB3B 5E7BA 3WFDH 3IJYB 3M45A 2Y9RT 1R0AH 1PKOA 4FQLL 2F58L 5B21A 2O5YH 3QUXD 5E56A 4GRWF 1S5IL 5SWSA 4I3RL 4ONHA 5I1IL 1ZLSL 3CH8A 4QRTA 2EO1A 1RZ7H 5KVFL 3PXJA 4Z95L 4W4NA 5AZEL 1PVHA 2VDKH 4U6YA 1JIBA 3WN5C 2PXYD 2XKNB 1KCVL 4XPAH 2EECA 5K9KB 1G6RL 4IIQB 2NY2C 5FEBA 2B4CH 1HQRA 3HC3H 5D7LB 2J8UE 3QDJB 1I3RA 3MBEA 4NO5A 4HV8B 2OX5A 5HI4C 4DK3A 1JMXA 4GS7C 3U7YH