1NDCA

X-ray structure of nucleoside diphosphate kinase complexed with dtdp and mg2+ at 2 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray structure of nucleoside diphosphate kinase complexed with thymidine diphosphate and Mg2+ at 2-A resolution.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndcA00
5C7PA 1NPKA 3VGTA 3VGVA 1B4SA 3EVOA 3FBEA 1WKJA 4S0MA 4ANEA 3ZTRA 4UOFA 1NDCA 2HURA 4DZ6A 3EICA 1S5ZA 1S59A 3FBFA 3EE3A 1U8WA 3VGUA 1NSPA 1ZS6A 3B6BA 3ZTSA 4C6AA 3G2XA 1PKUA 5CAAA 4WBFA 4KPCA 3FBCA 1NCLA 1F3FA 3Q8VA 2VU5A 3ZTPA 1NDPA 2ZUAA 3EVMA 5BXIA 1W7WA 1B99A 3FKBA 3VVTA 5CABA 1MN7A 1NDKA 1VYAA 1BUXA 1WKLA 4W98A 4F36A 2CWKA 1HIYA 3DKDA 1EHWA 3ETMA 2B8PA 4CP5A 1MN9A 1NSQA 3EM1A 1LWXA 1NB2A 3GP9A 3Q86A 3GPAA 1WKKA 3DDIA 1NDLA 3Q89A 4FKYA 3ENAA 4ANCA 1F6TA 1LEOA 3PJ9A 3WX8A 2NCKL 1PAEX 4ANDA 3BBFA 1K44A 3BBCA 1BE4A 4ENOA 3B54A 4UOGA 3PRVA 1UCNA 3BH6B 3EVWA 3JS9A 4UOHA 3NGSA 3Q8YA 4DI6A 4DUTA 1KDNA 2BX6A 3ZTOA 2DXFA 2HVDA 1NHKL 3NGTA 1XIQA 2BEFA 3FCVA 3Q8UA 3MPDA 3VGSA 2B8QA 2AZ1A 4FKXA 4O0NA 1BHNA 3FC9A 1XQIA 1HLWA 4HR2A 5IOLA 3ZTQA 3BH7B 3EMTA 3R9LA 2DY9A 1NSKL 3BBBA 4EK2A 3NGUA 2HVEA 3L7UA 4F4AA 3EJMA 3ELHA 3FCWA 2AZ3A 1JXVA 3FBBA 2DXEA 3NGRA 3VVUA 3Q83A 1NLKL 2DXDA 1S57A 1NUEA 1HHQA 2DYAA
chains in the Genus database with same CATH superfamily
5ETKA 2C3MA 3R8YA 5KT6A 3EWGA 3ZO7A 3WZ0A 4JI8J 1D9DA 4KHMA 2BE9B 5BR8J 1H3DA 3BF4A 1S49A 2WVEA 4OZ2A 5E3PA 4K2XA 4WE1B 2YWGA 4C2MA 3D5MA 4NLXA 3D0IE 1J2VA 2X1FA 3HFKA 3HFZB 5HMWA 2Q6CA 5KFPA 3OFEA 1FHTA 1LWFA 3OUYA 2NXUA 2HLUA 1XTZA 2FPHX 3CCUS 1Y3KA 3DDIA 4CLPA 3IP0A 1EB0A 3PIPQ 1QVFR 1D8ZA 3E01B 4DLEA 3W5XA 3NWRA 5KFHA 1RLCL 4C9DA 1C4CA 1GX5A 3KHGA 2VB6A 3MD1A 1CPZA 4A8WA 5KFIA 1NH8A 2ZC4A 4ZPAA 3JSMB 1RTHB 1S1WB 4EO8A 4KJIA 2HHTA 3SBMA 3V6JA 1VOMA 2XNQA 3PJXA 1R8BA 4DZ6A 3MMBB 1BY9A 2CPEA 2YNFB 2AYEA 1XR5A 3V4IA 4RW4B 3UDLA 3NCPA 2NXEA 2JLFA 2HK3A 2ZBQA 2E1RA 1FERA 3OHAA 4O4RA 2A10A 2H5EA 4NXNF 2G1HA 3OHBA 2WOMA 3PZPA 5CABA 3Q8SB 2MSSA 2R4FA 1VRUB 3C2PA 2AGOA 3X3UA 3CJKA 3HJFA 2N3LA 3AHPA 2GIRA 3A1YG 2DNGA 2M88A 2PO4A 4Q7AA 3QJLA 1IUJA 4NA2A 3A8JA 4X62J 1XMQF 1BWVA 3CXCR 4WFXA 4MIBA 3LP2A 1IBMJ 4J7CA 2XMMA 3EDRB 3RRHA 1WG4A 1QD1A 3BSNA 2CNNB 1AXQA 4KGVB 2OPPB 3D6TB 4OJGA 2IAJB 1VRTB 1Y5IB 2I1RA 3GZ7A 3KWMA 2QFJA 2BYCA 4O3NA 3LW5C 5GAHU 2QYGA 2Y1LB 4AUKA 2P9CA 3A3OB 2EXUA 2LQJA 3NY0A 2OAUA 2RF2B 1W2IA 4ECTA 2DNNA 2IIHA 1SH0A 4M5NA 4M1KA 2JC0A 1VQPS 2FJVA 4LF9F 2J7KA 1UZHA 1V3RA 4TLRA 2QMWA 3MM9B 1I94F 4NLPA 1B70B 4DFKA 4YEAA 1RP5A 1H7WA 1S48A 4GKJF 4YFUA 4U8YA 4LJMA 5EUHA 3CD6S 2W9BB 4JV1A 4LF5F 3QPIA 1D1UA 4KQZA 2PN6A 2CVIA 3KLFB 5D0HA 3IM8A 2BACA 4LF4F 2KFNA 4PQAA 2WAQD 2HRTA 3ZZYA 1VC5A 2E5GA 1FKAF 2DY1A 1PJ6A 2E9ZA 1U0HB 1RU1A 4RPFA 3DI6A 3W3SA 4ZVQB 4FXDA 1JLBA 3A3NB 2R2SA 2HVEA 2I38A 1L3KA 1RT5A 1D3WA 4ZVGA 2DO0A 4EMDA 2XLJA 2YNHA 4NEYA 3VWSA 4ZMMA 1P1TA 1G2EA 2NSCA 4EBEA 1HMVA 4EYIB 5D8HB 1S79A 4J9OA 2XSFA 3PW7A 3H5UA 5B0AA 2GQQA 2ADBA 4IOCQ 3H0PA 1M90T 3KLGA 1VLYA 1Z4UA 3Q8VA 4IFVA 5A6PA 3HHLD 2KFYA 4C98A 4WIIA 4Y2KA 1Q79A 4CLKA 1AT1B 2C2KB 1JJ2R 3OQ2A 3UVJA 2P6TA 3UFCX 1T95A 3G6ES 1X5OA 1NJYA 5CYMA 3CNQP 3R5AA 1TMMA 2GO9A 2MKKA 2BEFA 1LWCB 2AZ1A 1FE4A 1Y7PA 3J81j 1AFIA 4DF4A 3OL8A 3DOLA 3IG1B 4TN2A 2C2DA 2XMWA 4O3RA 3ZFVA 3PW4A 5CA5A 1DTTB 1S97A 5C2CA 1HW8A 2APOA 4KPYA 3HSZA 2ASDA 1QTMA 1FKPA 3MM5B 2VJVA 1NK0A 4CI0B 1OQ6A 5AE3A 9ATCB 2O1PA 2PI4A 4LR8A 1S4EA 4C8NA 2JVOA 4BLGA 3QWPA 3DRRB 5KFCA 1X9SA 2A2DA 5J2QA 4ZDNA 2UP1A 1TVRA 4DCPB 3KG1A 2MY7A 4F0HA 1DLOA 2NXJA 4ANCA 3MECB 1MWYA 1R0AA 4IH7A 3DLBA 2HRYA 4CLLA 2GHVC 1IKVB 1FCAA 2WSEC 4QW9A 1NKEA 2J8AA 1HWLA 1BGXT 2P9EA 3J80Y 2KFZA 4USTA 4FYXB 4P72A 2R7SA 4DXLA 5CD4H 3OLBA 4OLOA 1S9EB 3M2RB 3K59A 3C66A 3HHLB 1RTZA 4KO0A 1RQ0A 2AX1A 1VBKA 1HWUA 1T03A 3PR5B 2XZWA 3CCLS 2YKMB 2CQ0A 5K8MA 2DTJA 2CPXA 3R6GB 1RWUA 2VBZA 1S0NA 2QYCA 2DHXA 3QT6A 4JI2F 4G1QA 4MFBB 4OZ1A 5CYQA 2ZUGA 2QJ3A 3M32B 2WBMA 1MN9A 4DV4J 2AX0A 2XYPB 3V6HA 3GPAA 3R1HA 4M5HA 1SJQA 2Y1IA 1UZDA 4H54A 2HHXA 1S1TA 4B3TJ 1G4CA 4JYAF 5EWEA 3NP5A 4EUVA 1X4HA 2DJWA 5LT5A 2PA3A 4ILMA 1E6VA 1XQIA 1RGVA 5KT5A 2CQPA 4P7TA 1C0TA 2EW9A 1VQ7S 2MKJA 4USUA 4F4WA 3RR8A 4XTTA 2MKIA 1SB6A 3CJ5A 3OR2A 3MCMA 1XNQJ 2R7VA 2V67A 1X5TA 2RJZA 5L9XA 3UNGC 3TX0A 4DV0J 5A8WA 4DG1B 4YMEA 1ROFA 1S12A 5K20B 4DQPA 1RKJA 4F0MA 3V81A 4DR2F 2HLTA 3BKTA 1X60A 1WC4A 5MLCV 5FJ4A 3LPYA 4IG0A 4D3GA 1WKLA 2NXCA 4EZ9A 1O51A 2FY1A 1EJ7L 2E5LJ 1NH7A 2ZD1B 4E8UA 5T14A 2HZCA 5CZXA 3UN3A 1RBLA 2D3O1 3QZ7A 2Q79A 2E7XA 4K4XA 4IFYA 5KG6A 4X4TA 2VV5A 1UWBA 1VFJA 2V50A 3O1LA 2FTRA 1LWFB 3CDBA 1TAUA 3BQ2A 2B9WA 2ZE2A 1T9UA 3EMTA 1JLEA 1EKSA 1W2BR 4ES3A 2U2FA 3HULA 4J9KA 4RW9A 4LRDA 1PC5A 2G0JA 3MR2A 1B4SA 3JAMU 2RE1A 2O5DA 1AA1B 2H5IB 1U1NA 2IVFB 1YJWS 4DSJA 4KPCA 5IC4B 3GE9A 5HVGA 3QAUA 4JBCA 4XPEA 4GO5X 2UVUA 3BJYA 1D09B 1NRKA 1SQGA 2AYMA 2Z57B 2XGPA 4M5MA 2DCLA 1VHFA 3KG4A 4ZK7M 1QAYA 1UVJA 3MEEA 1GXUA 1VK3A 4IH6A 5GAEU 3NMAA 4ZLPA 1BQNA 3P96A 3IMQJ 3WBZA 2WOMB 5KT4A 2EEYA 2HVDA 5CCLA 3A13A 4LF2A 2MPUA 2H65B 3K2YA 4AFFA 1S6OA 4ZKAA 4A8OA 2DIUA 3CJKB 3M6VA 5DETA 1FNMA 4FDFA 3MR5A 1FI4A 4W4MA 4K7QA 1UVNA 3R2DJ 1RAAB 4C4WA 2IYGA 3LP2B 4M8LA 4NASA 5CQGA 3DLGB 2VQEJ 1R6YA 3I0RA 3JSBA 5LXYA 2KRBA 4USWA 1RA7A 3ZNUA 2B9XA 3R5DA 1XMOF 1HQEA 4ZJLA 5ADZA 2C3OA 1K9MT 2MZRA 4L73A 4QWEA 2X1BA 4EYHB 2RNEA 4CLTA 1S77D 3FSXA 2YWKA 4A47A 2FHKA 2ACYA 3HSGA 1UA1A 4C11B 2CRLA 2HGLA 2WBRA 1IR0A 3HPOA 3JQJA 3K17A 4OL8A 1ITPA 3GIJA 3OL9A 2QLFB 2UV8G 3Q8YA 2QIFA 1S0VA 3PO4A 1DFDA 3MPDA 3AJ2A 1C1BA 1X7VA 5KFYA 3ZTQA 4OV6A 1Q82T 3WC2A 3D1OA 4MIWA 3HM9A 2GVZA 3FCWA 3CF5Q 5ETLA 4OV1A 1HD0A 2FIUA 1NJZA 2C22A 3SFGA 4K5RA 3EICA 5DZ6A 2K3IA 2ZKTA 3OPKA 4WIQA 4URGA 3M05A 3JQMA 3DI6B 2WW8A 2VPXB 1JLBB 1OYEA 3S8SA 1RT5B 3DOMA 2R7WA 4CO2A 2FVSA 2XS7A 4EBDA 2YNHB 3EXCX 4DL3A 1UVLA 1HMVB 4H4MA 1XMBA 2QLJB 4IO1A 1LQ9A 2FGOA 2R2UA 1S99A 1NDLA 4WTYA 1LEOA 3PJ9A 4ECXA 4TXSA 1PAEX 4IKAA 3BH6B 3KLGB 2Y1JA 2YH0A 4Q8EA 2FB0A 4IFVB 4L72B 4ELUA 4JP8A 1QSYA 3VGSA 5B0FA 2EVZA 4L6V3 1OSCA 1SUQA 1BC6A 4WFZA 1HWJA 3UVJB 1P27B 3IM9A 4TU8A 2ATCB 2ZJRQ 3GU0A 4NZ0A 2BE7D 1NPKA 2DGSA 1VQOS 3OFGA 2JEFA 3D6MB 3VQSA 1WF1A 4U95A 2D9PA 1JMTA 4DUYJ 3D9BA 3BR8A 3S1TA 5I3UB 1IBKJ 4IRDA 4KBIA 1F5AA 5K8PA 3DOLB 4ED3A 4XDCA 1S1VA 3MEGA 2R7QA 1X5PA 3C15A 3UE2A 2VF3A 3CJ4A 4X64F 4DR3J 4DX5A 1NMEB 1V9OA 3UNYA 3ZXWA 4NE9C 4YB7A 3W62A 2V9KA 1FKPB 2ZH5A 4DLGA 4X84A 4IDKA 1WOPA 3JS9A 2ASJA 1N0UA 3OSNA 2Z2YB 1KDNA 4ECWA 2DXFA 4ED8A 5J2QB 3VALA 4DPXA 1TVRB 1VQ6S 4YR0A 3GJRB 1KOOA 4Q0BB 1VQ8S 3R5CA 1XNRJ 1UJ6A 5K8NA 3DMJA 5THWA 3POTA 3RB0A 1R0AB 3TARA 4KHRA 2Y0SD 1RJJA 2CAJA 4DPTA 3BQ0A 2CFXA 1FWLA 3LPEA 1VMBA 4GVBA 5I3QA 4MMOA 1WC5A 4DV2J 2D9OA 2YQ1A 3K5OA 1PAUB 4N77A 4RJVA 1PILA 2WVCA 3GIMA 2GV1A 3B6BA 1D9FA 4RUAA 3FMBA 2LECA 4OHXA 5KG1A 4KO0B 2KXHA 2VQFJ 3K0JA 3VAIA 3JAMY 4Z7CA 2H4YB 2FDNA 1J27A 4AL6A 2ERRA 5T41A 2VHGA 2IY5B 4PPZA 4ECYA 1IJFB 3HMJG 2KZMA 2EK6A 2BKPA 2CPJA 2IPOB 5M2UA 5M2RA 5F0UA 4QYRA 4I7FA 1Y0HA 1N6QA 4JI6J 5HQLA 2R7XA 4G1QB 1M1HA 3AA8A 2AU0A 2Z4PA 1TP7A 4Q43A 2RB7A 3FGVA 2BM0A 1JJ4A 2JL9A 4B9VA 4OLPA 1CQNA 4F3MA 5HL7Q 3KHRA 3RG6A 4B3MF 4RLEA 2DD8S 2XCPA 2UXDJ 3MTKA 3QGIA 1GMUA 3MFHA 3ENVA 4F4ZA 1D0EA 4WU2A 3EE3A 1E6VB 3FVYA 4U7CA 1SJ4P 2W7AA 4DV6F 3FEZA 2E66A 2VBWA 1NDPA 3OR2B 3GB0A 3KLEA 3MI7X 2X1GA 4KGXB 3KYLA 1HQUB 2MHEA 1RAJA 4NLDA 2ZH4A 4CCHA 5A8WB 1RBOB 1F3VA 2N7YA 1RABB 1WJ9A 4LFBJ 1HI0P 5GMEA 1DAXA 2QA4S 1JLQB 2QE5A 4DI6A 3V81B 1S6QB 3A8EA 2DNHA 2ASYA 3L95X 1WG1A 4PG8A 2W24A 2ZITA 1GNKA 4RNHA 4HACA 4LREA 5JMNA 4DWIA 1JNRB 4P75A 3SXLA 5LSOA 5LMUJ 4Z2XA 2COLA 3MAHA 4NXMJ 3HHKA 1U26A 2VG6A 3MUVP 1UWBB 3TAQA 1HR0F 4OI1A 4P6QA 2RVJA 2XWXA 4YR3A 4F50A 2ZE2B 1FEEA 1Q5YA 3SYZA 1JLEB 3R5JB 4RWWA 4Y2MA 4I2PB 2WB1D 2M8DB 1LKZA 3GFXA 2XGQA 2AHOB 3TQEA 2C2NA 1GTHA 3OJUA 1VR6A 4QQBA 3ZZZA 3D1HA 2OLWA 3T41A 2JX2A 1NDKA 1RWPB 2FJWA 3ITHB 1TL1A 4YY3J 3MTJA 3JQKA 4KB7A 4RUCA 2L41A 3I9ZA 1RTIA 1FX2A 2DR7A 2AYGA 5EN1A 2V2VA 4PWWA 2HVIA 1QUVA 2OPRA 4LRAA 5HQ8A 2LDIA 3KNAA 5DM7Q 3L7OA 4FVMA 2B6AB 4Y2IA 4ZVTB 4KR0B 3MEEB 3CC2S 4Y28C 1BQNB 3ADAC 1GTEA 3D3CJ 4X2BA 5A6WA 1ZPWX 2V4JA 3MPVA 2O67A 2RDJA 3PEHA 4NMXA 3M2VA 4ZPDA 5GAGU 4DPYA 1N5SA 1HBUA 2B4OA 4WP3A 4F3OA 2YKOA 4DL0C 4TVAB 4HT5A 2XS5A 2HHUA 2D41A 4ETXA 1CJTA 3R2CJ 3HD2A 3ET6A 1GXTA 1ULRA 2R7RA 2FJXA 2QFIA 5FDLA 1ZYQA 4JI3F 3I0RB 2EFPA 1Z2ZA 2GMHA 3GIIA 1RT7A 1LV5A 4FNHA 3HKWA 4P2XA 5ETVA 1HQEB 4RR5A 1NZ8A 1U6ZA 1SL1A 2G4BA 2ZWPA 1FRKA 2F4VJ 3I4HX 1QM9A 2RQKA 4C8MA 2Z2MA 1OQ3A 1S7IA 2CPFA 3NG8A 1TU0B 2E44A 5IOLA 1UEKA 2VG5A 3M2UB 2YQ3A 1RAGB 2W7PA 2I8EA 1AROP 2AT1B 5HVFA 5A8KA 3I5BA 2Q66A 4DX7A 2OPSA 1L3VA 4ZPWR 1FA0A 4I64A 3KJVA 5GVQA 3A4TA 2DGVA 1C1BB 4RW7A 1CJVA 3UDVA 3CB4A 1PYTA 3SEOA 9RUBA 3TAPA 2LCWA 4PPDA 3NCQA 5IV3A 1ZZFA 2GVZB 4XIUA 1UFKA 1T9VA 4WYWA 1KLMA 3FFIA 3VAKA 1JLAA 1YZ7A 1TZ0A 4ECSA 1AFJA 2ACMA 3BGFA 2HNZA 4QIFA 3G8SA 1HIYA 5KG0A 4FF1A 2HQDA 3IN5A 4FBTA 1EHWA 1HWKA 2EFQA 1TL5A 2YY3A 5D0RA 2G2OA 3VAGA 2B9EA 2E9RX 1FRMA 4PXEA 1SC6A 3DOMB 3JSYA 3OTOF 1VJQA 3VCDA 2WRMA 1PBAA 3KKFA 1RAFB 3K5PA 1XR6A 2AJQA 3R9LA 4LIWA 2FJDB 3FZ2A 1JLGA 1SCJB 2WVDA 2VICA 1M5KC 3TR5A 4DSLA 4LQ9A 4WK3A 1RBAA 2IVYA 3DFEA 2KL8A 1YJVA 2W2PP 1Y3JA 1R0BG 1F1BB 3QFHA 3QO9A 2H9ZA 2B5JA 1RHUB 4ZHRA 2KHDA 2PI5A 1FXRA 3FNNA 4DOZA 1SUQB 4FP9A 2Z0GA 4C6AA 3W5ZA 2VFRA 2ILZA 3BGLA 5DZ7A 5A8RB 4AL5A 3BO2A 4NXNJ 4NZ7A 2VZ9A 1O5JA 3WX4A 4IRCA 1JIHA 2YNGA 1IKXA 2KKHA 4B9MA 3G71S 4ECZA 4UOHA 2BE2B 1S1VB 1GQEA 1VJWA 2JHEA 3MEGB 2VC0A 1OMSA 3C15B 3HVAA 3IS9A 3M9OB 4K50A 2ROPA 5DO2A 3JTPA 4R25A 1XMQJ 4LVOP 1HA1A 2VONA 1IWAA 3HKZD 1Z2LA 1SBRA 5E3QA 5BYRA 5AXMA 1NB7A 3TYTA 2ZM6F 2EKYA 2AW0A 3TZXA 5KFWA 3F73A 1U25A 2DR5A 2ALYB 4IDKB 1REGX 4CLZA 4F8RA 1WKJA 4DFMA 3EGWB 1YG0A 3QLHA 8ATCB 3N5FA 2DNLA 5SZTA 2LKZA 1LK5A 4OZ0A 5HN0A 3J7A1 2QL5B 1C4AA 1ZTWA 2QMUB 3KMQA 4HT7A 3DMJB 4IOAQ 3UQSA 3POTB 3BSAA 3KHLA 1ZTTA 5B0CA 4UY85 1FXLA 4LF9J 4MYUA 3GR0A 4QBUA 4TY8B 1U1LA 1TUVA 3W2WB 1I94J 4P74A 1FEHA 4ES2A 5KFKA 4ZJQA 4EWTA 3SV4A 1YGYA 3BB5A 4LR9A 1LW0A 4KGKA 3AFGA 3SQGA 2J76E 3KUEA 4JI4F 2V8DA 4BWJA 4GKJJ 2I0XA 1F6TA 3IAM9 4LF5J 4ER8A 2HFVA 2CQ4A 3C6TA 4MKYA 5HO4A 3KDNA 5H9EJ 4FPRA 2M9KA 4Y2CA 2DISA 1WDTA 3H90A 2CQIA 4HHJA 4LF4J 4R0EA 2HMIA 2QT7A 2PC6A 1RAHB 3T5KA 4YHHF 1WTFA 1N6QB 2DNMA 4M5IA 1FNXH 4IYQA 3NKYA 2KYZA 4CWBA 2CQCA 1XJWB 2KXFA 3O2IA 1XK8A 3AXKA 4BHQA 2MLZA 1VK8A 3SCJE 2LQBA 1R89A 1F2GA 3LH2S 3N6MA 4L3KA 3KG0A 1OIAA 3I87A 1YZ6A 2AJFE 3CCTA 4PEOA 2VJUA 3QJJA 2M5YA 2ILYA 2M52A 1SI9A 2CQBA 1PJ5A 4RW8A 3ILOA 1UCNA 4DQSA 4J9MA 2X7IA 2XMTA 2FZKB 4PRFA 1YKWA 3LP0A 3OR1B 4ZVPB 3FMWA 2VPWB 3MF5A 4P2SA 2M3DA 2B3TB 3K8WA 3C16A 2P2CB 2UUWA 4NPOA 4TQSA 5HK4A 2Q3PA 4A8QA 2ZOGA 4DU7A 3D66A 1IVZA 3VGTA 3SSQA 5DDQC 1GK8A 1PJ7A 1WOOA 3R97A 1MU2B 4HACB 4OZ3A 2OJ3A 3S01A 5L39A 3PYEA 4K4VA 3D3BJ 2WSCC 4FF2A 2QL7B 3TEGA 2XWYA 3FKBA 2VG6B 2DHAA 1RZMA 4DR4F 1B0TA 3LA0A 3EZUA 2W4CA 2E1PA 5KG2A 1JLFA 4FYYB 3NS7B 3VAMA 4N41A 4CH1A 3R27A 2DO4A 4B17A 5B0BA 4LVNP 5J1PA 1EX8A 3MUTP 3VTIA 3RB6A 2FVCA 2OI2A 4DQQA 2KT3A 3H4BA 4CM0A 1IBCB 1JXVA 2IJRA 2GO8A 1QSSA 2M2BA 2P6SA 3JTNA 2EBEA 2BOAA 4JV5F 2CXEA 1RTIB 4OHZA 2D1CA 2OPRB 1Q8IA 3HDSA 3QIDA 2RUGA 7AT1B 3Q8QB 5J2NA 1X8DA 1N36F 1BMQB 4F26A 3G2XA 2E1AA 2CJKA 4RUHA 4CZCA 4DV1F 2CJAA 2HHHF 5F8JA 2F4FA 2J9DA 2U1AA 2V4JB 4B3SF 1B3TA 4NX9A 4F4YA 2DR6A 4JI2J 2HVZA 2MQLA 2PMWA 2VA2A 3D67A 3G6YA 1RWXB 1BQMB 1HBUB 5IQQA 1RT1A 1YHQS 1I51B 3R7BB 4FF3A 1UP1A 4C8KA 2EI5A 3ET6B 1KEKA 5L9NA 2EC2A 3FC9A 3H5SA 4O4GA 3VZHA 5FDLB 3HF5A 2ROEA 4JYAJ 2KZZA 1UFWA 3ZNJ1 1M5SA 3DDNA 1C1CA 4F4AA 4TLQA 3GG0A 2DR8A 4LF8F 1ZM2A 1LK7A 1Q53A 1RT7B 3TNVA 2NPIA 4F4KA 3HD1A 2JLGA 2I5JB 4DPWA 3CMES 2X3DA 2ZJPQ 2C2OB 4URQU 1VQKS 2ZH7A 2DT9A 3KDOA 3E01A 2M70A 3UO0A 2OEMA 2G0CA 2VG5B 5DG7A 4X4UA 3CO9A 3LANA 1NHUA 3OVBA 2IRXA 3TVZA 6AT1B 1FT8A 3JSMA 3DLKA 3HVTB 1KNZA 1YJ7A 1RTHA 1S1WA 3BN4A 3DXBA 4OHWA 4YUDA 2RAQA 4ZVHA 3EZ5A 1U1MA 4DR2J 2YNFA 2FLNA 5D4OA 4K4SA 1SL2A 4RW4A 1DQ9A 4CLFA 2OMOA 2C3UA 5GADI 3T9ZA 2HYIB 4LR7A 3M6UA 2DNQA 2VOPA 4KHPF 2NZCA 2W4PA 3D7SB 5LM7E 3FFIB 1RT3A 1JLAB 3CCES 2F65A 1P1LA 3FCVA 2HNZB 1RYRA 6FDRA 1SQEA 1VRUA 3NGKA 5KOWA 4WXOA 2J0SD 2HGNA 4DJBA 4RL1A 1F5CA 3RJMB 4CLYA 3IBFB 1N5VA 3CJTA 3AB2B 3NBPA 4C3LA 2V8HA 1R27B 3RW6A 1WEZA 3GV5B 1YRXA 1UETA 5HMYA 4OFZA 2HFSA 4WKYA 2PMHA 1S9GA 3CSKA 2HG4A 2I2YA 2XULA 4CH7A 2OPPA 4WK1A 1Y11A 4O44A 2JLEA 4YP3A 2HQIA 4I4BA 2B5JB 4ZHRB 2YTCA 2FLOA 3BGUA 3HSDA 5J1EA 2MKCA 2AJ1A 4TYBA 3ISNC 4M5DA 1FTCA 3AH6A 5L1LA 1RAOA 4NYOA 4LBPA 2CJBA 3HZGA 1XIQA 4DQIA 2DH9A 2XI3A 1WHVA 5CH7B 4YDXA 4JI7F 1F5BA 3GJTB 4CO0A 4Y6IA 2W9BA 4P9SA 2C2ZB 2XMJA 1OSDA 4WZMA 5IV4A 3GTYX 4V1Ak 4NOHA 5ETMA 3FRYA 2YX1A 1EZZB 3DRYA 4X4QA 4ZCIA 2R2RA 3H2LA 2J9EA 2MDAA 1UPMB 3KFWX 2V6AA 5G0RA 1SKWA 1HBMB 2MQPA 1ZZNA 2IHR1 1X9MA 1SH2A 4LSZB 4LQ3A 4LFCF 2HNYA 1KHVA 3D6HB 1TK5A 1UJ5A 4LFAF 4CLWA 3U02A 1CVJA 4ZPTR 1RCOB 3W7BA 3UW1A 2GJ2A 4JV2A 1XMOJ 3H42A 2OTLS 3TWZA 2LMIA 2KU7A 1S1XB 1UJ4A 2VPYB 4OI3A 3B82A 3M6XA 5KG4A 4ERDA 2HFZA 2X3GA 3Q8PB 4PAAA 3HHLC 3JYTA 2B4VA 2GS8A 1SQFA 1WHXA 4ZCKA 1ZAXA 1LW0B 3CC4S 3LWMA 2KB2A 5RUBA 1YDLA 2IFXA 7FD1A 3U7JA 4V19J 4BC7A 1TFYA 7FDRA 1NHVA 1FFGB 3CO0P 1NDCA 3CWJA 1LWCA 2KO1A 3HHEA 1HW9A 2QTWA 4FVCA 1YX2A 5KFQA 3AB4B 2HMIB 1S72S 2ZHBA 3FZBA 1FX4A 3CD0A 4KKOA 2VC1A 2FGCA 5D78A 4QPTA 2XY5A 2H48B 5KFFA 4ECRA 3SSSA 3Q24A 2BKOA 1CJKA 2KI2A 5LSLA 3UDCA 3MMCA 1UKUA 4JV0A 3IAS9 2CPIA 3GILA 1FFWB 3VR1A 3ETMA 3G9CA 3DRPA 1N32F 2RH3A 4PG7A 4HI2A 2ZJQQ 3H40A 2GFFA 5F8MA 5FIIA 1RE1B 1Y00A 1ZA2B 4B08A 3H8YA 2NLWA 1U48A 4YDDB 4WFYA 3QNWB 3CDEA 3GONA 1GMWA 1RHJB 4CO3A 1P9YA 2C42A 2IMOA 1FVQA 1U6BA 2C2EA 1DQ8A 1KWMA 2K1RA 4PWUA 1HHQA 2J6TA 4PUOA 3MHYA 2PFDA 1FRJA 1IKVA 4HH1A 4O3PA 2IRYA 3CIMA 3CE8A 3LP0B 3HP6A 3QQCD 2EWHA 4MKAA 1YBUA 2DEJA 4M5KA 4QWBA 3MGJA 4FF4A 2UUBF 1B64A 4HHUA 4JI0F 3C16B 4MJKA 2ZFHA 2N3OA 3J7ZT 1KD1T 3M2RA 2ZEJA 4PXBA 4OX7A 3T3FA 2HS3A 2HWTA 2PD1A 3H4DA 4J9UE 1MN7A 2QA1A 4NEZA 2IDEA 3K5NA 4WZQA 3GP9A 5ETRA 4FNIA 3ENAA 4X64J 4DSIA 5G4DA 2JH3A 3R6LB 1DJ0A 4AT1B 2V9WA 1R8HA 1T8EA 2GMLA 4FPIA 1RHQB 2CQ3A 4DR5F 4MFBA 4ALZA 2JJ4D 2ZDPA 2PDAA 3AOBA 1GMVA 2VKRA 1NO8A 1MMDA 1ZH5A 2XI2A 1YJTA 1JLFB 4C97A 4DV5F 4NCBA 3PFEA 2MZTA 1UL3A 5LMNF 2YWHA 2UXCF 3GSIA 3DOKA 3NXZA 3D68A 3LP1B 4ES1A 4FYDA 2L48A 4X4PA 4YN3B 3BO3A 5GMDA 2J6UA 3CEDA 1NPPA 4ZVEA 5C25A 1W7WA 4L75A 4UZBA 4OQJA 4W98A 4TU9A 2XMAA 2HPUA 1K47A 2LEBA 2OELA 3RAXA 3Q89A 5KFRA 4ZN1A 1RWWB 2MLXA 4TNOA 3PW5A 2YWWA 2D74B 4X65F 3CJRA 3CC7S 5T7LA 4OZLA 3ILIA 1J5EF 1UAWA 3W9JA 4PQUA 2R8JA 4A8FA 5JVHQ 3LO3A 3CCJS 1LFPA 1HNXF 2ZD1A 4I0WA 1RT1B 3FEYB 1WEYA 5B0GA 1MMNA 3G82B 5HP1A 2V8VA 2BQRA 4ZVOB 3DLLQ 3QZ8A 2LU2A 3SCKE 3BYRA 4B3MJ 3K5LA 3T5LA 4K2JA 4O4GB 4OYPA 1S9FA 1C1CB 1ICEB 2PMZD 2DKOB 2IJFA 1F3FA 4OX9F 3T5JA 4UZCA 1ELOA 2RIJA 4DL7A 2W01A 1L3TA 2B0GA 1PCAA 3N28A 4CDIA 4KRWA 4DV6J 2HBZB 2MY8A 2NUHA 4X4NA 1ZM4A 3EZOA 4M5GA 2CUYA 2MGZA 3TJAA 1NB2A 5KFEA 2NR0A 4WF9Q 2AWZA 1A9NB 1S6UA 5IWAF 5KFNA 1R31A 1V5IB 2LQ9A 1RHKB 3DLKB 2LA4A 2IBKA 1SKSA 3K58A 3R7SB 1S1UB 3ZTOA 2R8IA 3FDSA 4XDDA 4X4VA 4OI4A 2E7WA 4OHYA 2OH2A 3TO8A 3IBCB 2LP4A 2OPQB 2LU1A 3UN2A 2OEKA 5EHHA 1FRHA 4YQWA 2VBYA 1RT4A 1RB0A 1NEEA 1AYEA 1MG7A 3OJSA 1TUGB 1RT3B 1Z1ZA 2X51A 4H4KA 4TYAA 2GIFA 2XM3A 4TY9A 2PIIA 1IN0A 4WKRA 3HO1A 5F9NA 2GAGC 2EG1A 3LWLA 1HR0J 3KLVA 4XAKA 3MM8A 4NLTA 2QSFA 3KK1B 1JJCB 2HW3A 3NBPB 3GV7B 4OZ5A 1VIXA 3MZIA 4TQRA 1RAEB 1U1OA 2CPHA 3MEKA 2MTLA 4N76A 1VLOA 2G9OA 3A8KA 3FCHA 3DLGA 3EM1A 4FKYA 2DK2A 1WG5A 1S9GB 4KYZA 3TJ8A 2C28A 2OKQA 5AXKA 4NA3A 3UWTA 2DNPA 4O44B 2VG7B 1U02A 1JXLA 5H9FJ 4K4TA 5IT4A 2YNIB 2HK2A 1S4FA 2FVRA 1R3NA 1DARA 3LGNA 4C11A 5J1EB 3EJMA 4M5DB 3ISND 3CCSS 4IG3A 1G6BA 2EFGA 4KGMA 3M7VA 5A2QY 1AUDA 2HAFA 2XSJA 2ZZMA 3MPWA 4BS2A 1TAQA 1FRLA 1QDUB 3R1LA 5HBMA 4MIAA 5DGAA 3DXSX 3RBDA 4NYPA 3S6EA 1HNZF 4GKKJ 4FS2A 2H3EB 2GA7A 1UVMA 5KFSA 4PG5A 3ONQA 4LUBA 2MSTA 3TA2A 2PE8A 4CRJA 1U6FA 1RCXB 2LYVA 2R7TA 1U2FA 4HTJA 1YJ9S 2GJIA 3KTQA 2A1BA 4EBCA 1X0PA 2CJYB 5G0RB 1A7GE 2DCUB 4ZA1A 2GZOA 2OMLA 2GIQA 2HNYB 3T1HF 4LRBA 1GMWD 3AD8C 5DQHA 4JI3J 3IXQA 2M0GB 3UPFA 4OI0A 1DY3A 3TRGA 3BR9A 4F4XA 3RUBL 3IRXB 3M8WA 4AD6A 4ZVRB 2QN6B 1U49A 2RHQB 4F25A 4DR1F 2Y8YA 4WP8A 1HBOA 2XNRA 2CDRB 2MKHA 1EP4B 2FQQB 4ZN3A 1XWLA 1Q95G 3BV8A 4JOUA 1HBNA 3TZZA 3TOQA 1IWGA 1HKAA 4RNOA 1HNWF 3JYTB 1DQAA 2W9CB 2WCXA 5LJ5Y 1HL6A 1JWWA 3NGDA 4WBFA 3MM7B 2XTJP 2XYHB 1T05A 2MXYA 3EYZA 4CLUA 3J7YI 1VHIA 4DUZF 3H25A 1RT6A 5GAHI 4Y00A 3OW2R 2IMWP 3M8QA 2J7WA 1IBLF 1IXKA 1NXIA 5I3UA 1KFDA 1C2PA 4ILRA 4KKOB 2CPDA 4QZVB 1Q7LB 5IT9U 5D77A 3KHHA 3NGTA 1CJKB 1YK9A 3OTOJ 3MMCB 4FKXA 4DR7F 4EU0A 3DRPB 2Y3YA 2HEKA 3HLUA 1RU2A 1PGZA 2M7SA 4RBUA 4NI2A 5B09A 3VGVA 3TI0A 2GQ2A 3QBCA 3EDQB 5B7WA 1U45A 3AJDA 4O3OA 3PTWA 4Q0BA 3CCQS 4HTIA 2K1RB 1N48A 3AQOA 4PUOB 5F8LA 4CTAA 3QIPA 5H1SV 3G6VA 3K89A 4P7VA 1NJXA 3VZIA 4I68A 2MZQA 2OUGA 3ULHA 2DNOA 5IXUA 3VQTA 2VFVA 1RXOB 1U2RA 3M4XA 2AMCB 1XERA 2RHSB 4URSA 3G6XA 2W8KA 2KJVA 3L3CA 1DRZA 3NMRA 4KSEB 2ZH6A 3EXYA 1R6VA 4DV3F 2HRUA 2Q43A 4C48A 2ZZTA 5F9LA 2D69A 2EBGA 2ZNZA 2RS2A 1MWZA 1BD6A 2XEXA 5EX3A 2X1AA 4NLYA 2ZM6J 2LQ5A 4C0BA 3M8SA 2CJ9A 4PXDA 3UD5A 2MEWA 1KHWA 2DHSA 2KVQE 3RBXA 1AUSL 2ZBRA 2JFKA 2HFUA 4ECVA 5FLXU 1EKRA 4PG6A 1EAYC 4ZITA 2W2QP 4HHHA 2ZZNA 1BUXA 2RUSA 1NKBA 1UPPA 5KFLA 2CWKA 1URNA 3DOKB 2EPIA 5CYJA 1K8AT 1YJUA 1RUSA 3DKDA 5L38A 2HVHA 4GC7A 2XMUA 3P4UB 2GJFA 3MR6A 1PBUA 2DHHA 2DGQA 4CYUB 3LUYA 2YKAA 1WEXA 4JI4J 1KVIA 5C25B 3BPDA 3P5TL 2DBBA 4K0KF 3JB9k 4ZLNA 4O0NA 5KG7A 3TANA 3V4MA 4Q5VA 1V3ZA 2CPZA 3SFUA 1HQUA 2LEAA 3LAKA 4G1PA 4KIAA 4A8SA 4LIRA 1FRXA 3Q8RB 5AE1A 4MK8A 2CVEA 2YKNA 3DM2B 1DHMA 2DNRA 5E3RA 4F0KA 3FQKA 1GAOA 5IC6B 3PVXA 4KY3A 2GAHC 1JLQA 4ELTA 1S6QA 5T7LB 4HYKA 4YHHJ 2GCFA 3BGRA 3C14B 2KG0A 2AEJA 4PQUB 4EO6A 1ZS6A 1SKRA 3G4SS 2RSQA 1HFEL 2RD5C 1ZAWA 4LF1A 1VQNS 4DPUA 2Z30B 2VPZB 5HP1B 3BKUA 1SIWB 4ECUA 3QSIA 4QIVA 2Z8QA 1YI2S 3I5AA 5E2QA 3QMQA 4X4SA 1E6YB 4I2PA 4Q8FA 4ENOA 1SC1B 1SJ1A 2DRAA 1OPIA 2CPYA 2GGPB 4UT4A 1WNEA 1T9WA 2C1EB 2QV6A 1HWIA 5DG9A 2R7UA 2G2ZA 5D6GA 3GYNA 3D54A 1WTBA 4HR2A 3ITHA 1Q81T 1HPZB 5L1KA 1GX6A 2MGZB 3S7RA 4LSNB 3M8YA 1KFSA 1WC6A 1H98A 3M1VA 5C24B 3A3PB 2EFNA 2QZ8A 2FZCB 5ITHA 1JX4A 2WHOA 3M30B 5EWFA 2B6AA 2XZDB 2ZDOA 1JNZB 4B9UA 4I6AA 1NJIT 1FDBA 1RT4B 1LW2A 3EVMA 3HHNB 1KQFB 3VF0B 5KFXA 3E51A 4CLSA 1XN9A 3RAQA 4YS2A 1H6KX 4YB6A 1U2CA 4I1TA 4DR4J 5I4MA 3LF0A 5IS2A 3IA0A 3U1NA 2RQMA 4E0DA 1Q1KA 3I4PA 3MM8B 4Y3CA 4C0HA 4OZJA 4J5OA 4OYXA 4J9RA 1H2TZ 1FK9A 3HSJA 1R8AA 2FHOB 2EK1A 5HANA 2GVDA 2IJNA 4I6WA 2XCAA 3D2WA 4Q45A 1NLKL 3MURP 2AEFA 5IT9Y 5L1JA 4JV5J 1L3SA 3SIPB 4J91A 4I56A 2MYFA 3LOUA 1YLXA 1M1GA 4Y2AA 1NK6A 4JI5F 3NL0A 5E0OA 3M2UA 3Q0AA 1VBXA 1N36J 1PC4A 4G65A 4Y65A 2W25A 4IG3B 1B0VA 5BXIA 2RILA 4RUBA 3TAMB 2IA6A 2XSJB 1N54B 3V6KA 4ICLB 1X4CA 4DV1J 1OS5A 5HBMB 2F8MA 2OFGX 2HHHJ 1QE1A 1UW4A 3HVRA 1ZAVA 4B3SJ 3AXMA 4KV8A 3OLAA 4U6PA 2CNLB 1NK9A 4USJC 4J9SA 1M0SA 2EFVA 3W2VB 4QWDA 2AYBA 3PKMA 3FEXB 3GV8B 2BA9A 3OD2A 4UUXA 4LBIA 2YBVA 5GMKa 2Y8WA 4J9NA 2ZBPA 2IM2A 1S57A 4L3NA 1NUEA 2YVSA 3TA0A 5ETTA 4B3OA 1X4GA 2FUG9 4MK9A 2MQMA 4LF8J 4KT0C 5GAEI 2ROGA 2W2MP 1WC0A 1C0UA 2BANB 1NSPA 4MYTA 4Z37A 4DL5A 2YWEA 4QYZJ 1S0MA 5DDPC 1HBOB 4C8YA 2QC3A 2JC1A 2BJ1A 1SL0A 2K3KA 2YPYA 1HBNB 4LSLA 1KVKA 2YQ0A 3O44A 5F41A 3DN9A 3CT9A 1T3OA 3QT7A 5E33A 4DFPA 2DGTA 2DPJA 1R43A 5MAOA 2Z2LA 3L7PA 3NLCA 1VISA 1HD1A 3TQ1A 3PJWA 3MDFA 3EVWA 5FLXY 2MKSA 3NGSA 3ENQA 1T05B 1VRQC 3E3XA 4DUTA 2LXUA 2NZ4A 4KHPJ 1FDAA 1RLDA 2BJEA 1OO0B 2K7KA 3U1MA 5A8RA 1RT6B 2VKZG 5E41A 3M8QB 1FVSA 3DLEA 4N8OA 4YB5A 5E3CA 3VAHA 4OYWA 2IA0A 1OJ4A 1ACMB 1VQ5S 2BE2A 3UR3C 2E1MC 4UOFA 3FBFA 3B4DA 4RNNA 2ZH8A 3G86A 1JKHA 2FD2A 5F8NA 1KR4A 5D4PA 1WOSA 2C2RA 2GQCA 2QL9B 4NI2B 2QGFB 2YX4A 1RAIB 3T6JA 3SCLE 5AXNA 4IR9A 3KLHA 2XBPA 3D0HE 2JRSA 2J7UA 3PRDA 1TKXB 2FJEB 5D0EA 3GLJA 4A48A 1RWOB 2RRNA 3TVKA 2J5AA 5H9EK 3BS9A 3EGVA 2KHCA 3J80U 5KFOA 3D28A 4CTAB 4MT1A 3QIPB 3KJQB 4TY8A 3MOZA 4RWXA 3W2WA 1WORA 2DVIA 5D0GA 5F0WA 3B8HA 1UW9A 2NUUG 4JI7J 4TU7A 2UXBF 4K4WA 1KONA 4BC9A 2XMVA 2DH7A 2ZHAA 3PNIA 4W92B 1UWAA 1JB0C 2BBEA 5KT3A 4ZCMA 1F9FA 2CKWA 4NLUA 5DLGA 2KG1A 1LNQA 4PR6A 2WZ1A 2IM1A 3AOAA 4I2QA 4WFNQ 2VA3A 3N9UC 4LFCJ 4LFAJ 1YRTA 1R0CB 2K7JA 4KH0B 4H4OB 4N7TA 1NPRA 4IO9Q 3GSDA 4DS4A 2NQPA 1QAXA 2HHVA 5C42A 3T1YF 4PG4A 2UU9F 1FF2A 3FSIA 4DN9A 4DV7F 2CQHA 4Z7YA 4DL6A 4LMZA 4DCJB 1RTJA 3I31A 3OFFA 3PY8A 2CQ1A 3BSCA 3NGRA 2ZH2A 2HBRB 4F67A 3CCVS 1EQMA 1CBKA 4QJVA 3OXGA 2J9CA 2AF6A 2A6OA 2P5VA 3IR6B 3PDNA 2OO4A 1FJGF 3OR1A 2CZVC 3A12A 3IGNA 1SKUB 1T9XA 5HJXA 1FNOA 3J7YU 1VI7A 2H54B 2F40A 3JXOA 3M9MB 3NOCA 4OI6A 5FD1A 2YKNB 3B4MA 1NCLA 1UVIA 2E5JA 1UFLA 1NNDA 2FY8A 3KLIA 3ZC4A 3NWGA 2QA2A 3TP2A 2UV8A 4UQTA 3EPIA 5KFAA 3BGRB 4MK7A 3BPSP 3OVAA 5EWGA 5CCMA 1VS3A 1PYOB 1N5QA 3MCSA 2ADCA 1MU2A 1FJCA 3KJFB 2QRRA 1NK4A 1NZAA 2DHGA 2VOOA 4LF6F 1N32J 3QYYA 4QWAA 1CSJA 3CJSA 3PRBA 2Q6BA 1SVDA 2PEHA 4A4JA 3WIUA 3I82A 1XC9A 5BYQA 3GIRA 1FE0A 8AT1B 3MD3A 1M5VC 4OJ3A 1CS4A 3MPYA 2MZJA 3PM9A 3EPGA 1TK0A 1MW7A 1CULA 3CULA 2RDIA 5DM6Q 2E5IA 1KP6A 2O66A 2XQCA 1QJHA 2UUBJ 4ELVA 4JI0J 3CJQA 4J37A 2NSBA 3PACA 1O6XA 2ZUAA 3M1VB 5AJ3F 1VQSA 3PW0A 2R2TA 4C3MA 2UUAF 2CQGA 4QW8A 4QCLA 4FYWB 4P52A 3HVWA 3D0GE 1SPBP 4B02A 3MWBA 1W25A 2JEIA 1MROA 2BQ3A 1QUPA 4IR1A 1TR0A 2BMBA 4LRCA 1LW2B 4AXIA 2XZTB 4BCAA 3DGPB 5D4NA 3C6UA 2PGCA 2HAIA 1N34F 1DZ5A 2N4CA 4GKKF 2UUCF 3BZQA 1D9AA 1DBDA 4DR5J 2FLLA 3L4BC 2D3OR 1BQMA 3GCWP 2HQCA 3LALA 3I56S 3PW2A 1IM4A 2JSXA 4CO1A 4A8KA 3OFHA 1HYSA 2IC3A 3CMAS 2AKWB 1U1KA 4JI1F 4DV5J 2YKPA 1FK9B 2HBYB 4GC6A 5HI7A 2HIYA 4CT9A 3V6DB 2BR0A 4CIOA 1SXLA 5LMNJ 2GVDB 2UXCJ 5HMXA 5CAAA 4OYMA 1CC8A 1IR1A 3OBIA 3FBCA 1T02A 1KQGB 3N6LA 2WVBA 3GWCA 4ED2A 4DZDA 2I5JA 3QRQA 2MJNA 4HL9A 2F3JA 2FYXA 5KT2A 5KAKA 2J0XA 4PZVA 1B7FA 5LL6d 2HFNA 3W9HA 1BE4A 4CO4A 1X0FA 2XS2A 2L9WA 1K1SA 3FUYA 3HVTA 4M5JA 5KTQA 4ZOSA 1NJWA 2VFTA 2I6WA 3Q22A 2ZH9A 4ITSA 1NK8A 3RR7A 1LWEA 2MQOA 4X65J 1MWQA 3T6BA 3CGIA 1RT2B 3BBBA 1QE1B 4ZS6A 3CCRS 2XC9A 1X5SA 2CNKB 1J5EJ 4KV8B 1UVKA 3HXMA 2VUGA 3W61A 1Y10A 1G3OA 4B3RF 1SIZA 3KXDA 1HNXJ 4X4RA 3CDAA 4OYIA 3P8BB 2FC8A 1K73T 5D15A 1KOHA 1RACB 5DDRC 2R42A 4K4ZA 3LAMA 4NLQA 4Q2LA 2WTFA 2BW7A 4DHVA 5B0DA 3MAQA 3BEGB 4ETZA 3TUPA 2RU3A 4B3OB 1G1XA 1YIJS 1C0UB 4OX9J 1UEUA 2QO3A 5GAGI 4PYAA 3DCAA 4WFAQ 3OSPA 5B0EA 2UVVA 1HI1A 3MXHP 5F3TA 5CD4A 5IWAJ 1KVJA 2GHWA 4DEZA 1VDHA 5L8RC 4LSLB 2FVQA 2OSRA 3PHEA 4PABA 4PCQA 2B7BB 3WIVA 3NNHA 3FQLA 4RU2A 2RQCA 3TVYA 1TKDA 4I6YA 5I42A 1TKTB 2LVWA 1S5ZA 2V5HG 1HHTP 4ED1A 2MZ1A 1V3SA 1TL3A 4NLWA 2DNKA 3DLEB 5KG3A 2F1FA 1X4EA 1N5YB 2OTJS 2M4MA 3J81U 3PV8A 4RBVA 4D3HA 2RKIB 5L1IA 1W26A 5J2MA 2CADA 2ZKUA 1S10A 3ZZUA 3BDEA 4C7QA 4OYZA 3EUNA 2LDYA 1JKHB 1T94A 1YTYA 3CCMS 3NS6A 1HBMA 2AGQA 1I6JA 4OJHA 3BSOA 3BBFA 3M8RA 1P9QC 2JVRA 1QY7A 2BKNA 3KLHB 1I5OB 1IKYA 2EKNA 1RA6A 1YWXA 3AD9C 1VQ9S 3I9V9 1HNIA 2EC0A 4DSKA 3K7RA 3PYGA 1S1XA 1F2HA 2V2ZA 3C8YA 4G6VB 1S7HA 3QRRA 2NXNA 3OTDA 3OUYB 1WI8A 3G8TA 1Q7YT 4XO0A 3H2VE 3N5BA 3SQOP 4DPOA 3MUMP 3SDEA 3ZTSA 2RDDA 4TKTA 3PYDA 2F5GA 1QTNB 4NLRA 3NNCA 3CPWR 1HNZJ 3PKYA 3VVTA 2GW8A 3IWLA 4RW6A 2V0NA 3MAAA 5HLFA 1N5TA 4ID5A 5I3PA 3W9IA 3PR4A 3QJPA 4I2QB 2YWFA 4N8NA 2MZSA 3DU6A 3BO4A 3T1HJ 1NAQA 3NOGA 3V4IB 3SZ2A 1VQLS 5HROA 1FO1A 4FXVA 3HT0A 3B78A 2DY9A 3GJQB 2BQUA 4GVLA 3KJNB 4C0OC 5C42B 1YVFA 3MM6A 4AYBD 4DR1J 5E7OB 2ATLA 5DRKA 3MCOA 3RTVA 1VBYA 1RTJB 3GYXB 1HNWJ 4J9LA 2VODA 3DLHA 3TUZC 2V34A 3PFOA 3AT1B 3OVSA 3OXLA 1OPZA 4ZPVR 4Y34A 1DURA 3NCRA 5KFDA 4DUZJ 3GIKA 1L5UA 3PX0A 2BZ2A 2A0FB 2DRBA 1WKKA 4EI2A 2QG9B 1GFWB 5KFJA 2VBXA 1IBLJ 3OTBA 2XY6A 4WTOB 4M95A 1QLNA 4U96A 3THVA 1RWKB 2FLPA 3Q2SC 3BKFA 3Q23A 3KLIB 4IQMA 4EGLA 5HVHA 3GCXP 4NLGA 2HQ3A 3NGUA 1ZPVA 1TUWA 4RNMA 1A0OB 4IOBA 4I69A 4DR7J 4KTQA 2E7VA 4PKDB 2EFOA 6FD1A 2QX0A 2B7CB 1XBWA 3IFEA 3CJ2A 4BBYA 2JZ5A 4P2FA 4LBHA 4OJ1A 3KMSA 1PKUA 2B56A 1CS4B 2CJQA 4DSEA 2V4QA 2GHPA 3I0SA 3T9NA 5KFVA 3AJ1A 1GEHA 1B99A 1M5HA 2QMXA 1CULB 2Y9HA 3NEKA 1EIYB 3AY0A 2XB2D 1I1GA 3TZYA 1VQMS 1NBEB 2ALZA 4N56A 5F3ZA 4QU6A 3LP1A 3J7Z5 3IR7B 2GNKA 8RUCA 3O8WA 4IH5A 4DDFA 3SV3A 1HNVA 4WJBA 2W1BA 2G2YA 5ETSA 4WP9A 3N0VA 2B4PA 2K2PA 3ZZPA 4C8LA 1Q0NA 3GMGA 4DV3J 4QIWD 1MROB 1K0VA 2W9AA 1EARA 3BDPA 3HT3A 3P49B 1FFSB 2Z2ZA 2KYXA 2YH1A 1U1PA 3C6UB 4DCOB 2AP6A 4N47A 3T19A 3SI8A 3CD7A 4RBTA 2DH8A 4OYOA 3WHIA 4HLBA 2V2QA 1YRUA 5K14A 3TW0A 2P9GA 4AE5A 1N33F 1YBTA 3DRSA 2CG8A 2NREA 5CYMB 2CDQA 5C2GA 2MHNA 1Q8LA 4UOCA 3CJ8A 4DR6F 3CJ3A 2RRAA 3GG1A 5IZHA 1HYSB 3G82A 2IC3B 1RI7A 5LJ3Y 2CZ4A 5LXRA 5KFBA 2HHWA 3LTOA 5A76A 3I32A 2ZH1A 4I67A 4NLOA 1T11A 1T9YA 1IJEB 3RAMA 2B9YA 3CTRA 4X66F 1R7IA 3J81Y 2CA9A 4AQYF 4ZPCA 4U67Q 2WB4A 3US5A 1QVGR 3RYLA 1LFWA 3R5GA 2JEGA 1XR7A 1Q5VA 1N8RT 1JLCA 5KOXA 4K0KJ 2H1YA 3PX6A 4OIXA 3OXFA 2YXLA 3Q83A 3QGGA 4NCGA 1TFWA 2WK4A 3P45B 4KC5A 4KGZB 1OY6A 4K4UA 3EVOA 3PG9A 4RX6A 3ZTRA 1WI6A 2HURA 1S1UA 3ICLA 3CJ0A 2N7CA 1LWEB 1DLOB 2OHDA 2WONA 3IRWP 5U47A 2OPQA 4NRTA 5D3GA 1IQZA 3ZTPA 2PT0A 4Y0FA 1WACA 1BXNA 3OL7A 3ENWA 4ZVUB 5IM0A 1AZSA 3MOJB 4F36A 4WCEQ 2DB1A 2V69A 3M9NB 4USKA 5H9FK 3DNCA 3HHDA 4Q44A 2XLKA 2JEJA 4UOGA 1UTAA 1X4FA 1JQGA 3R5BA 2ZVSA 2AIRB 5HSPA 3KK1A 1V6HA 1T03B 1GT8A 2AGPA 3UI3A 2CQDA 2ASLA 1YJNS 1AW0A 1Y5NB 2V4RA 3G8QA 4PYDA 4JI8F 1NM2A 3FK4A 2HZAA 5BR8F 1Q8BA 3THPA 2VG7A 5CYQB 1PSDA 2F9DA 5KFZA 2V68A 2QSWA 5JUMA 1YJRA 1WHWA 2ZWOA 2YNIA 3AD7C 1KQSR 5DQIA 1IQTA 2DEIA 2VDIA 4ILLA 3CCWA 2OSQA 4IUFA 1KTQA 1WWHA 1S1TB 3MFIA 1SC4B 4HDHA 3E8OA 4P73A 5ETNA 3IR5B 1H7XA 2DPIA 5I42B 5J2PA 5ETOA 1Q86T 1C0TB 1WUUA 5E3AA 2LXFA 1X4AA 1TL3B 3H59A 1NSAA 4ZLLA 5DGBA 4WPAA 2R8KA 3RBEA 2R8HA 4X4OA 3HK2A 3W8GA 1NHKL 1JK9B 1WELA 5J2MB 2F8EX 4B9SA 1DTQA 1HLWA 1KRPA 2K8GA 4IQXA 4NRUA 4AXJA 3ELHA 3VVUA 3KK2A 5D4LA 2PEBA 3E2EA 1FDDA 4IG0B 1HQ2A 4XK8C 3IRXA 1IKYB 1NU4A 1RSCA 5EDWA 4J9PA 3RW7A 3BQ1A 2AJ2A 1HNIB 3CIZA 4IFYB 4A8MP 4FYVB 4JI5J 1EQ0A 2UVRA 2QLBB 3CMQA 1EP4A 4DS5A 4N5SA 2C2MB 3MEDA 1TQLA 4DU8A 2V8GA 4QOTA 1RYSA 3SDEB 2ABYA 4RW9B 2W9CA 3CCZA 4G1IA 1UEVA 4GRSA 2XLIA 4X62F 2NCKL 3RB4A 2HSEB 1IBMF 1F9HA 3MM7A 5L46A 1A6LA 5HAOA 5SUHA 2L3MA 3CDWA 3SMZA 2VFUA 1URRA 2BJ9A 2BABA 4DN0A 2HNDA 4RW6B 2ZC3A 3MAAB 5HLFB 1PIEA 4NZ6A 4ID5B 1RWNB 3O3LA 3EX7B 3FBBA 4P10A 1FWKA 2RQ4A 2LEPA 2IYIA 3IO1A 3WQPA 1KSPA 3FBEA 3F44A 4S0MA 3TX8A 3SSRA 5KT7A 1U7LA 5HROB 2KH9A 4OX8A 1KC8T 3UD3P 3LQVA 4ZPBA 5DJBA 2WW4A 3DDKA 4M63A 2W8LA 2HHQA 2C3YA 3MM6B 4DBQA 1S76D 4ZP9A 1AB8A 2SXLA 1D8YA 1YITS 3AQPA 3FSYA 2N82B 3PCOB 3AODA 2LA6A 3I5CA 5E5NA 2L9DA 2VIHA 3M8ZA 3KK3A 1FKOA 4MKBA 3T5HA 1FTRA 1N56A 4OYBA 4WU3A 5CHCB 2FHMA 2B8QA 2QLWA 4XPCA 2BVZA 4DL4A 3GFHA 3M6WA 2BJ8A 3F41A 3UCZP 3F56A 2OD6A 3QT8A 1KS2A 1U4BA 1BWEA 3UCGA 1Y5LB 1VC0A 2F9JA 1WC1A 1CG2A 4R5PA 1NK7A 3K8VA 2MMYA 3PX4A 5AT1B 1UMJA 2KM8C 4LF7J 2HS0A 2V2KA 3UR0A 3GYGA 1S6PA 1GH8A 4ED4A 1U24A 3X1LB 3JTOA 4UF4A 3TJ9A 1RHRB 3NRBA 1N0VC 3QATA 3V2UC 1ZOTA 3EGZA 3I0SB 5BYSA 3PIOQ 2F63A 2VL1A 3KUHA 4ZVFA 3DGVA 1O0PA 2F8HA 3Q8UA 3HJVA 4OZNA 4F2RA 2KXNB 1TKZA 3DU5A 1Y9OA 2HHPA 1N52B 3ZZRA 2AQ4A 1HNVB 4CYUA 5CZVA 4H4MB 2PFFB 2E5HA 3QAEA 2DR9A 4GO7X 2UXBJ 2BXJA 4O3QA 1OY9A 4U8VA 4H4KC 1S0OA 2FHJA 2A2CA 2MKYA 2D3UA 2LFVA 3UDEA 3MMAA 1RISA 4MAKA 2BW2A 1SJFA 3IBWA 1VQYA 2GX8A 3DM2A 4OI2A 4B9NA 1MSWD 4A8YA 4L76A 2ZVIA 1M5OC 2J0WA 2HGMA 1IM6A 3GFZA 4USHA 2ZBIA 4O0IA 2XHCA 3C14A 2OFHX 5K14B 3H5YA 5J1NA 3DRSB 3BREA 4QWCA 3G87A 3K5MA 2O01C 1WDDA 3T1YJ 2UU9J 3MPUB 2ZHOA 4DV7J 4RNFA 3U1LA 3PXGa 4UUWA 4K5SA 1NSKL 3TZWA 4ZCLA 2C3PA 2KN4A 3BGOP 1PG5B 3TUIC 1N4LA 1E6YA 2H4WB 2KRRA 1CQMA 2GGPA 1V5VA 3W66A 2Z58B 4W90B 1QAJA 4UW2A 4KAIA 1JLCB 1J5OA 4HEA9 2JOQA 3OTEA 1FJGJ 1HPZA 3P6YC 4NLVA 2OD4A 4USVA 2HWIA 4NCGB 4LSNA 2VU5A 3IC1A 1LOUA 2QLXA 4DV4F 1VYAA 5C24A 1CEZA 2WSFC 1B7YB 1G7CB 2G0IA 4K59A 4HI1A 5HMZA 3M30A 1IKWA 4CP5A 5LSRA 4B3TF 4CQ1A 2WONB 1U8SA 4CT8A 1SJ3P 4NL5A 1SV5A 5D3GB 3B54A 4GVBB 2W4DA 1RDRA 5DQGA 3G96A 2MQNA 4UQGA 4WWSA 5IM0B 1AZSB 3QT5A 2CYYA 3UCUP 4LF6J 2ZOFA 2XO7A 1BHNA 2OP5A 1T3NA 2HWHA 1HI8A 4CO5A 1XNQF 4DMZA 5C5JA 1NK5A 4U9RA 1N88A 4ATNA 3EGNA 1H0HB 2BJDA 4DV0F 3DYAA 2B4UA 1R8PA 4RU9A 1U1QA 4OMFG 2V63A 4I7FB 1H2UX 3H98A 2DNZA 1Q16B 3RB3A 3DHXA 1RHMB 2JWNA 4EEYA 2E5LF 4CNYA 4CNZA 2DGXA 2PSZA 5AJ3J 5A0YA 3JSRA 2UUAJ 1YBAA 1MLAA 3I6PA 1LWXA 3RZAA 3OL6A 3WX8A 3BYPA 2ZBCA 3IGVA 3H5XA 1EETA 4L74A 4DF8A 3BBCA 1H72C 5BJRA 3N6NA 1FWPA 1GXLA 1T0TV 1WSRA 3M8PA 1FXDA 1R8CA 1TL7A 5J2PB 3TAMA 4M5LA 2N4DA 4MKVA 2FZGB 2DITA 4ICLA 4QR1A 5JJBA 2IRUA 3DRXA 2KT2A 2RRBA 3H2UB 1OYDA 1M5PC 1N34J 2J0QD 2DYAA 2CG4A 2UUCJ 4CM2A 2Z56B 3RU0A 5C7PA 1TMJA 3KLEB 4QU7A 5KFGA 1X9WA 3CVKA 1F60B 3W2VA 1RWMB 3O5TB 3PEJA 4QYZK 4EFAC 4EZ6A 3L9ZA 4PWDA 1DTQB 4WFBQ 3W8PA 4RZRA 4JI1J 2MJUA 5AXLA 2R8GA 2P8IA 5JXSA 3N79A 3KK2B 2BRKA 4QR0A 2KT5A 4J90A 5F8IA 2E1CA 2RT3A 3KOAA 1ZM9A 2BANA 4YR2A 2W2NP 3I96A 3P3DA 4JUZA 4U7UD 1WF0A 4KE5A 2BV3A 2A18A 4C3KA 1Y4ZB 4IRKA 3QSYB 3MEDB 5ETQA 4DX6A 1H73A 4HDGA 2AJ4A 4Q2MA 4JB8B 2HQFA 2IBOA 2CWXA 4ZP7A 2V8PA 2IM3A 2M8HA 4KFBA 2VQEF 4M94A 5HATA 2YPZA 3OV7A 4K4YA 4NMLA 3ISZA 4R8UA 5GADU 1TL1B 2HNDB 3QWUA 4B3RJ 2CJXB 3N01A 2QA4G 2Q1LA 4A8XA 2AEMA 5M2PA 1P6TA 5DS7A 2DRDA 2H5JB 1QSLA 3QRPA 3FRZA 1TV6A 2KTQA 2VASA 3ZZ0A 2K06A 4QPXA 4V19X 1CJUA 3VHQA 1REVA 3CDUA 4E2FB 4USMA 4FN5A 5EX0A 3ILLA 1RTDA 4P71A 4ANDA 3NAHA 3GQCA 4ZP6A 1KTVA 3F0NA 2V94A 1FJ7A 4FZVA 3M2VB 3GJSB 3PYFA 2KDOA 2LXIA 4O23A 2MQQA 3RRGA 4QR2A 4U7UK 4WE1A 2RU9A 1TKXA 4DX8H 2NYIA 3C46A 3MMJA 1CJTB 3KK3B 4G3IA 1FKOB 1SJRA 1X4BA 2FHJD 2IM0A 1KQKA 3A8IA 1LXJA 4B9LA 2G13A 2BJ3A 1F0XA 3RBZA 1H38A 2BJ7A 4YOEA 4ED7A 2FJAB 2DIVA 2O3DA 1Q4RA 3ETOA 5F8GA 4ED0A 2NS1B 2UUTA 4C8ZA 1U47A 4QIEA 1QAIA 2VH7A 1CC7A 4R5PB 4CH0S 5A8KB 1TELA 1K44A 2OPSB 4J9VA 3C3LA 3HCXA 3SCIE 3NS5A 2R7OA 3KJVB 5ETPA 5B08A 1OWXA 4RW7B 4K8RA 3MMBA 1CJVB 3UN5A 5HJYA 2MLYA 4LRFA 4R0JA 4ZIWA 1S6PB 1RK8A 1M1KT 3BH7B 2HQGA 4H4OA 1K0TA 1KLMB 3OTCA 3D4JA 1K1QA 2DXEA 4RKUC 3RGIA 3PO5A 4DL2A 5EGYA 1PO6A 4DUYF 3MR3A 3VAFA 3BN7A 4E98A 3VV2B 1TK8A 1IBKF 1WD6A 3DLJA 2R3VA 2BOPA 1S59A 5K8OA 1U8WA 1APSA 4NCAA 2XY7A 2GC8A 2DGWA 4P2MA 5F8HA 1TKZB 2B51A 3UD4P 3CD5A 4PXCA 1ZBTA 1WHYA 1X31C 2H51B 4DR3F 4DFJA 4HH0A 2Y0BB 5IFMA 2FJBB 2HIQA 4OHVA 4B9TA 1SC3B 2B8PA 2UVWA 1JLGB 1NSQA 3CW2C 2IAJA 1VRTA 5K9FA 2HKEA 3PHTA 3MMAB 2PA8D 3I55S 3QO9B 1FJEB 1XNRF 1YSJA 3ILJA 3ZZOA 4NWBA 2RF2A 1VCTA 2J8SA 2DGOA 5DLFA 4FBUA 1Q78A 4DSFA 3W64A 2MB0B 3MM9A 4OX6A 4DV2F 2XG8A 5DDOC 2IDLA 1HHSA 3W63A 4UY8T 3BM7A 2UZAA 1H74A 3D1QA 3AA9A 2YNGB 2XHWA 2NPFA 1IKXB 1U09A 2VQFF 3N4WA 2KM8B 1MMLA 4KH1B 3THTA 3DC2A 3KLFA 4F2SA 3IS9B 1JJHA 3MCNA 3O6QA 1KN6A 4F7VA 2BUNA 3LGHA 2XYGB 1U0HA 3J7AN 4RO0A 1KKHA 3HFVA 1J5OB 4JI6F 2AJ0A 1L3UA 3IWNC 1KLNA 1VIOA 2E29A 1LXNA 3QLHB 3RRKA 3KUGA 2OEJA 2W7OA 5LOQA 4A46A 2RS8A 5KFTA 1RWVB 3W60A 1VGYA 4WYLA 1IKWB 2L9NA 4EK2A 4NA1A 2LQ8A 1U1RA 3H7HB 2UXDF 5IT0A 3MR7A 3U27A 5KFUA 1SV5B 2HFOA 2CNOB 3L09A 4QIGA 2CZ9A 2WVFA 4ANEA 2BM1A 1T7PA 1OY8A 2AD9A 3DGPA 3R7NB 3SQGB 2E9TA 5IQ6A 2OGUA 3D6FB 2DGUA 1FD8A 3C6TB 2LLZA 4DQRA 1U0SA 3KNGA 2ZNYA 3AAWB 1NKCA 3DYAB 2QEXS 3WC0A 1IR2A 2JNJA 3DHWC 4LFBF 3V6DA 2Y1RI 2L08A 3IG1A 3W65A 3PRVA 1T9TA 4FXWA 3IWXA 3QFWA 2AV5A 4ZP8A 1WC3A 3C19A 2F7VA 4BDPA 4ZJOA 1DTTA 2CIMA 5HQMA 1MNEA 1UA0A 2NYHA 1P8GA 5A0YB 3TUJC 1TTHB 1RKIA 4ID8A 5LMUF 4NXMF 3QGPA 3MM5A 5AE2A 2D3ZA 2AZ3A 2GMJA 2YX7A 2DXDA 1FRIA 1EETB 5A2QU 2RMLA 4USIA 2XO6A 3DRRA 2R9LA 1YQHA 3HZEA 2OIHA 3M8PB 1TL7B 3GR1A 2ZH3A 4GMKA 3VGUA 1TL4A 3TA1A 1FDNA 3VAJA 3K57A 1HARA 1I3OB 3MECA 4RW8B 5KFMA 2W2OP 1RT2A 2FC9A 2HBQB 1X4DA 4J9QA 2FVPA 2ZOMA 2HS4A 2JDJA 2KVIA 1N33J 3LGMA 4YY3F 1VC6A 1BQXA 1H2VZ 4UTGA 4DR6J 4O3SA 1VQ4S 1WSVA 2HZVA 2VDHA 4PWDB 3NNAA 1S9EA 1RADB 1VBZA 3Q86A 3HHLA 1F9EB 2BRLA 3Q2TC 1CLFA 4ZVSB 2BDPA 3R3TA 3H20A 4ZLJA 4LT6A 1BLUA 1ZM3A 4X66J 1KBRA 4AQYJ 3GFYA 1JXEA 4ECQA 2KJWA 5K5MA 1B0PA 4ZIVA 2YKMA 1XEZA 3HX9A 2CQ2A 1SH3A 1FD2A 3W1YC 4F3QA 2A3JA 4F02A 3WDOA 4HVZA 3QGHA 2A6MA 2VD3A 4ED5A 4HKQA 3M32A 5CXTA 2D7SA 2DNYA 3T1AA 4MH8A 4WXWA 1WF2A 2J9DE 4NLSA 3W5YA 4KFBB 1Q8KA 3AOCA 2EG2A 3TEHB 4R8UB 2I9SA 5JVGQ 1TKTA 2IVMA 3ZZTA 3OT9A 4AL7A 2HHSA 2YKQA 2B43A 1FESA 5KG5A 1PYSB 1O8BA 2JFDA 3P5BP 4YB1P 5DG8A 2MQ8A 2G1DA 2F4VF 3FJ2A 4F04B 1N5YA 2BX6A 4NYZA 3NAIA 4OYAA 4MTPA 3V5RA 1TV6B 5J2NB 2RKIA 4ED6A 2XMKA 3CUNA 2VFSA 2POKA 1ZETA 1CJUB 1REVB 4DG1A 4FS1A 2J6SA 3L7UA 3HI9A 1ZA1B 1RTDB 4BWMA 4LF7F 4C8OA
chains in the Genus database with same CATH topology
5C7PA 1NPKA 3VGTA 3VGVA 1B4SA 3EVOA 3FBEA 1WKJA 4S0MA 4ANEA 3ZTRA 4UOFA 1NDCA 2HURA 4DZ6A 3EICA 1S5ZA 1S59A 3FBFA 3EE3A 1U8WA 3VGUA 1NSPA 1ZS6A 3B6BA 3ZTSA 4C6AA 3G2XA 1PKUA 5CAAA 4WBFA 4KPCA 3FBCA 1NCLA 1F3FA 3Q8VA 2VU5A 3ZTPA 1NDPA 2ZUAA 3EVMA 5BXIA 1W7WA 1B99A 3FKBA 3VVTA 5CABA 1MN7A 1NDKA 1VYAA 1BUXA 1WKLA 4W98A 4F36A 2CWKA 1HIYA 3DKDA 1EHWA 3ETMA 2B8PA 4CP5A 1MN9A 1NSQA 3EM1A 1LWXA 1NB2A 3GP9A 3Q86A 3GPAA 1WKKA 3DDIA 1NDLA 3Q89A 4FKYA 3ENAA 4ANCA 1F6TA 1LEOA 3PJ9A 3WX8A 2NCKL 1PAEX 4ANDA 3BBFA 1K44A 3BBCA 1BE4A 4ENOA 3B54A 4UOGA 3PRVA 1UCNA 3BH6B 3EVWA 3JS9A 4UOHA 3NGSA 3Q8YA 4DI6A 4DUTA 1KDNA 2BX6A 3ZTOA 2DXFA 2HVDA 1NHKL 3NGTA 1XIQA 2BEFA 3FCVA 3Q8UA 3MPDA 3VGSA 2B8QA 2AZ1A 4FKXA 4O0NA 1BHNA 3FC9A 1XQIA 1HLWA 4HR2A 5IOLA 3ZTQA 3BH7B 3EMTA 3R9LA 2DY9A 1NSKL 3BBBA 4EK2A 3NGUA 2HVEA 3L7UA 4F4AA 3EJMA 3ELHA 3FCWA 2AZ3A 1JXVA 3FBBA 2DXEA 3NGRA 3VVUA 3Q83A 1NLKL 2DXDA 1S57A 1NUEA 1HHQA 2DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C7P A;  1NPK A;  3VGT A;  3VGV A;  1B4S A;  3EVO A;  3FBE A;  1WKJ A;  4S0M A;  4ANE A;  3ZTR A;  4UOF A;  1NDC A;  2HUR A;  4DZ6 A;  3EIC A;  1S5Z A;  1S59 A;  3FBF A;  3EE3 A;  1U8W A;  3VGU A;  1NSP A;  1ZS6 A;  3B6B A;  3ZTS A;  4C6A A;  3G2X A;  1PKU A;  5CAA A;  4WBF A;  4KPC A;  3FBC A;  1NCL A;  1F3F A;  3Q8V A;  2VU5 A;  3ZTP A;  1NDP A;  2ZUA A;  3EVM A;  5BXI A;  1W7W A;  1B99 A;  3FKB A;  3VVT A;  5CAB A;  1MN7 A;  1NDK A;  1VYA A;  1BUX A;  1WKL A;  4W98 A;  4F36 A;  2CWK A;  1HIY A;  3DKD A;  1EHW A;  3ETM A;  2B8P A;  4CP5 A;  1MN9 A;  1NSQ A;  3EM1 A;  1LWX A;  1NB2 A;  3GP9 A;  3Q86 A;  3GPA A;  1WKK A;  3DDI A;  1NDL A;  3Q89 A;  4FKY A;  3ENA A;  4ANC A;  1F6T A;  1LEO A;  3PJ9 A;  3WX8 A;  2NCK L;  1PAE X;  4AND A;  3BBF A;  1K44 A;  3BBC A;  1BE4 A;  4ENO A;  3B54 A;  4UOG A;  3PRV A;  1UCN A;  3BH6 B;  3EVW A;  3JS9 A;  4UOH A;  3NGS A;  3Q8Y A;  4DI6 A;  4DUT A;  1KDN A;  2BX6 A;  3ZTO A;  2DXF A;  2HVD A;  1NHK L;  3NGT A;  1XIQ A;  2BEF A;  3FCV A;  3Q8U A;  3MPD A;  3VGS A;  2B8Q A;  2AZ1 A;  4FKX A;  4O0N A;  1BHN A;  3FC9 A;  1XQI A;  1HLW A;  4HR2 A;  5IOL A;  3ZTQ A;  3BH7 B;  3EMT A;  3R9L A;  2DY9 A;  1NSK L;  3BBB A;  4EK2 A;  3NGU A;  2HVE A;  3L7U A;  4F4A A;  3EJM A;  3ELH A;  3FCW A;  2AZ3 A;  1JXV A;  3FBB A;  2DXE A;  3NGR A;  3VVU A;  3Q83 A;  1NLK L;  2DXD A;  1S57 A;  1NUE A;  1HHQ A;  2DYA A; 
#chains in the Genus database with same CATH topology
 5ETK A;  2C3M A;  3R8Y A;  5KT6 A;  3EWG A;  3ZO7 A;  3WZ0 A;  4JI8 J;  1D9D A;  4KHM A;  2BE9 B;  5BR8 J;  1H3D A;  3BF4 A;  1S49 A;  2WVE A;  4OZ2 A;  5E3P A;  4K2X A;  4WE1 B;  2YWG A;  4C2M A;  3D5M A;  4NLX A;  3D0I E;  1J2V A;  2X1F A;  3HFK A;  3HFZ B;  5HMW A;  2Q6C A;  5KFP A;  3OFE A;  1FHT A;  1LWF A;  3OUY A;  2NXU A;  2HLU A;  1XTZ A;  2FPH X;  3CCU S;  1Y3K A;  3DDI A;  4CLP A;  3IP0 A;  1EB0 A;  3PIP Q;  1QVF R;  1D8Z A;  3E01 B;  4DLE A;  3W5X A;  3NWR A;  5KFH A;  1RLC L;  4C9D A;  1C4C A;  1GX5 A;  3KHG A;  2VB6 A;  3MD1 A;  1CPZ A;  4A8W A;  5KFI A;  1NH8 A;  2ZC4 A;  4ZPA A;  3JSM B;  1RTH B;  1S1W B;  4EO8 A;  4KJI A;  2HHT A;  3SBM A;  3V6J A;  1VOM A;  2XNQ A;  3PJX A;  1R8B A;  4DZ6 A;  3MMB B;  1BY9 A;  2CPE A;  2YNF B;  2AYE A;  1XR5 A;  3V4I A;  4RW4 B;  3UDL A;  3NCP A;  2NXE A;  2JLF A;  2HK3 A;  2ZBQ A;  2E1R A;  1FER A;  3OHA A;  4O4R A;  2A10 A;  2H5E A;  4NXN F;  2G1H A;  3OHB A;  2WOM A;  3PZP A;  5CAB A;  3Q8S B;  2MSS A;  2R4F A;  1VRU B;  3C2P A;  2AGO A;  3X3U A;  3CJK A;  3HJF A;  2N3L A;  3AHP A;  2GIR A;  3A1Y G;  2DNG A;  2M88 A;  2PO4 A;  4Q7A A;  3QJL A;  1IUJ A;  4NA2 A;  3A8J A;  4X62 J;  1XMQ F;  1BWV A;  3CXC R;  4WFX A;  4MIB A;  3LP2 A;  1IBM J;  4J7C A;  2XMM A;  3EDR B;  3RRH A;  1WG4 A;  1QD1 A;  3BSN A;  2CNN B;  1AXQ A;  4KGV B;  2OPP B;  3D6T B;  4OJG A;  2IAJ B;  1VRT B;  1Y5I B;  2I1R A;  3GZ7 A;  3KWM A;  2QFJ A;  2BYC A;  4O3N A;  3LW5 C;  5GAH U;  2QYG A;  2Y1L B;  4AUK A;  2P9C A;  3A3O B;  2EXU A;  2LQJ A;  3NY0 A;  2OAU A;  2RF2 B;  1W2I A;  4ECT A;  2DNN A;  2IIH A;  1SH0 A;  4M5N A;  4M1K A;  2JC0 A;  1VQP S;  2FJV A;  4LF9 F;  2J7K A;  1UZH A;  1V3R A;  4TLR A;  2QMW A;  3MM9 B;  1I94 F;  4NLP A;  1B70 B;  4DFK A;  4YEA A;  1RP5 A;  1H7W A;  1S48 A;  4GKJ F;  4YFU A;  4U8Y A;  4LJM A;  5EUH A;  3CD6 S;  2W9B B;  4JV1 A;  4LF5 F;  3QPI A;  1D1U A;  4KQZ A;  2PN6 A;  2CVI A;  3KLF B;  5D0H A;  3IM8 A;  2BAC A;  4LF4 F;  2KFN A;  4PQA A;  2WAQ D;  2HRT A;  3ZZY A;  1VC5 A;  2E5G A;  1FKA F;  2DY1 A;  1PJ6 A;  2E9Z A;  1U0H B;  1RU1 A;  4RPF A;  3DI6 A;  3W3S A;  4ZVQ B;  4FXD A;  1JLB A;  3A3N B;  2R2S A;  2HVE A;  2I38 A;  1L3K A;  1RT5 A;  1D3W A;  4ZVG A;  2DO0 A;  4EMD A;  2XLJ A;  2YNH A;  4NEY A;  3VWS A;  4ZMM A;  1P1T A;  1G2E A;  2NSC A;  4EBE A;  1HMV A;  4EYI B;  5D8H B;  1S79 A;  4J9O A;  2XSF A;  3PW7 A;  3H5U A;  5B0A A;  2GQQ A;  2ADB A;  4IOC Q;  3H0P A;  1M90 T;  3KLG A;  1VLY A;  1Z4U A;  3Q8V A;  4IFV A;  5A6P A;  3HHL D;  2KFY A;  4C98 A;  4WII A;  4Y2K A;  1Q79 A;  4CLK A;  1AT1 B;  2C2K B;  1JJ2 R;  3OQ2 A;  3UVJ A;  2P6T A;  3UFC X;  1T95 A;  3G6E S;  1X5O A;  1NJY A;  5CYM A;  3CNQ P;  3R5A A;  1TMM A;  2GO9 A;  2MKK A;  2BEF A;  1LWC B;  2AZ1 A;  1FE4 A;  1Y7P A;  3J81 j;  1AFI A;  4DF4 A;  3OL8 A;  3DOL A;  3IG1 B;  4TN2 A;  2C2D A;  2XMW A;  4O3R A;  3ZFV A;  3PW4 A;  5CA5 A;  1DTT B;  1S97 A;  5C2C A;  1HW8 A;  2APO A;  4KPY A;  3HSZ A;  2ASD A;  1QTM A;  1FKP A;  3MM5 B;  2VJV A;  1NK0 A;  4CI0 B;  1OQ6 A;  5AE3 A;  9ATC B;  2O1P A;  2PI4 A;  4LR8 A;  1S4E A;  4C8N A;  2JVO A;  4BLG A;  3QWP A;  3DRR B;  5KFC A;  1X9S A;  2A2D A;  5J2Q A;  4ZDN A;  2UP1 A;  1TVR A;  4DCP B;  3KG1 A;  2MY7 A;  4F0H A;  1DLO A;  2NXJ A;  4ANC A;  3MEC B;  1MWY A;  1R0A A;  4IH7 A;  3DLB A;  2HRY A;  4CLL A;  2GHV C;  1IKV B;  1FCA A;  2WSE C;  4QW9 A;  1NKE A;  2J8A A;  1HWL A;  1BGX T;  2P9E A;  3J80 Y;  2KFZ A;  4UST A;  4FYX B;  4P72 A;  2R7S A;  4DXL A;  5CD4 H;  3OLB A;  4OLO A;  1S9E B;  3M2R B;  3K59 A;  3C66 A;  3HHL B;  1RTZ A;  4KO0 A;  1RQ0 A;  2AX1 A;  1VBK A;  1HWU A;  1T03 A;  3PR5 B;  2XZW A;  3CCL S;  2YKM B;  2CQ0 A;  5K8M A;  2DTJ A;  2CPX A;  3R6G B;  1RWU A;  2VBZ A;  1S0N A;  2QYC A;  2DHX A;  3QT6 A;  4JI2 F;  4G1Q A;  4MFB B;  4OZ1 A;  5CYQ A;  2ZUG A;  2QJ3 A;  3M32 B;  2WBM A;  1MN9 A;  4DV4 J;  2AX0 A;  2XYP B;  3V6H A;  3GPA A;  3R1H A;  4M5H A;  1SJQ A;  2Y1I A;  1UZD A;  4H54 A;  2HHX A;  1S1T A;  4B3T J;  1G4C A;  4JYA F;  5EWE A;  3NP5 A;  4EUV A;  1X4H A;  2DJW A;  5LT5 A;  2PA3 A;  4ILM A;  1E6V A;  1XQI A;  1RGV A;  5KT5 A;  2CQP A;  4P7T A;  1C0T A;  2EW9 A;  1VQ7 S;  2MKJ A;  4USU A;  4F4W A;  3RR8 A;  4XTT A;  2MKI A;  1SB6 A;  3CJ5 A;  3OR2 A;  3MCM A;  1XNQ J;  2R7V A;  2V67 A;  1X5T A;  2RJZ A;  5L9X A;  3UNG C;  3TX0 A;  4DV0 J;  5A8W A;  4DG1 B;  4YME A;  1ROF A;  1S12 A;  5K20 B;  4DQP A;  1RKJ A;  4F0M A;  3V81 A;  4DR2 F;  2HLT A;  3BKT A;  1X60 A;  1WC4 A;  5MLC V;  5FJ4 A;  3LPY A;  4IG0 A;  4D3G A;  1WKL A;  2NXC A;  4EZ9 A;  1O51 A;  2FY1 A;  1EJ7 L;  2E5L J;  1NH7 A;  2ZD1 B;  4E8U A;  5T14 A;  2HZC A;  5CZX A;  3UN3 A;  1RBL A;  2D3O 1;  3QZ7 A;  2Q79 A;  2E7X A;  4K4X A;  4IFY A;  5KG6 A;  4X4T A;  2VV5 A;  1UWB A;  1VFJ A;  2V50 A;  3O1L A;  2FTR A;  1LWF B;  3CDB A;  1TAU A;  3BQ2 A;  2B9W A;  2ZE2 A;  1T9U A;  3EMT A;  1JLE A;  1EKS A;  1W2B R;  4ES3 A;  2U2F A;  3HUL A;  4J9K A;  4RW9 A;  4LRD A;  1PC5 A;  2G0J A;  3MR2 A;  1B4S A;  3JAM U;  2RE1 A;  2O5D A;  1AA1 B;  2H5I B;  1U1N A;  2IVF B;  1YJW S;  4DSJ A;  4KPC A;  5IC4 B;  3GE9 A;  5HVG A;  3QAU A;  4JBC A;  4XPE A;  4GO5 X;  2UVU A;  3BJY A;  1D09 B;  1NRK A;  1SQG A;  2AYM A;  2Z57 B;  2XGP A;  4M5M A;  2DCL A;  1VHF A;  3KG4 A;  4ZK7 M;  1QAY A;  1UVJ A;  3MEE A;  1GXU A;  1VK3 A;  4IH6 A;  5GAE U;  3NMA A;  4ZLP A;  1BQN A;  3P96 A;  3IMQ J;  3WBZ A;  2WOM B;  5KT4 A;  2EEY A;  2HVD A;  5CCL A;  3A13 A;  4LF2 A;  2MPU A;  2H65 B;  3K2Y A;  4AFF A;  1S6O A;  4ZKA A;  4A8O A;  2DIU A;  3CJK B;  3M6V A;  5DET A;  1FNM A;  4FDF A;  3MR5 A;  1FI4 A;  4W4M A;  4K7Q A;  1UVN A;  3R2D J;  1RAA B;  4C4W A;  2IYG A;  3LP2 B;  4M8L A;  4NAS A;  5CQG A;  3DLG B;  2VQE J;  1R6Y A;  3I0R A;  3JSB A;  5LXY A;  2KRB A;  4USW A;  1RA7 A;  3ZNU A;  2B9X A;  3R5D A;  1XMO F;  1HQE A;  4ZJL A;  5ADZ A;  2C3O A;  1K9M T;  2MZR A;  4L73 A;  4QWE A;  2X1B A;  4EYH B;  2RNE A;  4CLT A;  1S77 D;  3FSX A;  2YWK A;  4A47 A;  2FHK A;  2ACY A;  3HSG A;  1UA1 A;  4C11 B;  2CRL A;  2HGL A;  2WBR A;  1IR0 A;  3HPO A;  3JQJ A;  3K17 A;  4OL8 A;  1ITP A;  3GIJ A;  3OL9 A;  2QLF B;  2UV8 G;  3Q8Y A;  2QIF A;  1S0V A;  3PO4 A;  1DFD A;  3MPD A;  3AJ2 A;  1C1B A;  1X7V A;  5KFY A;  3ZTQ A;  4OV6 A;  1Q82 T;  3WC2 A;  3D1O A;  4MIW A;  3HM9 A;  2GVZ A;  3FCW A;  3CF5 Q;  5ETL A;  4OV1 A;  1HD0 A;  2FIU A;  1NJZ A;  2C22 A;  3SFG A;  4K5R A;  3EIC A;  5DZ6 A;  2K3I A;  2ZKT A;  3OPK A;  4WIQ A;  4URG A;  3M05 A;  3JQM A;  3DI6 B;  2WW8 A;  2VPX B;  1JLB B;  1OYE A;  3S8S A;  1RT5 B;  3DOM A;  2R7W A;  4CO2 A;  2FVS A;  2XS7 A;  4EBD A;  2YNH B;  3EXC X;  4DL3 A;  1UVL A;  1HMV B;  4H4M A;  1XMB A;  2QLJ B;  4IO1 A;  1LQ9 A;  2FGO A;  2R2U A;  1S99 A;  1NDL A;  4WTY A;  1LEO A;  3PJ9 A;  4ECX A;  4TXS A;  1PAE X;  4IKA A;  3BH6 B;  3KLG B;  2Y1J A;  2YH0 A;  4Q8E A;  2FB0 A;  4IFV B;  4L72 B;  4ELU A;  4JP8 A;  1QSY A;  3VGS A;  5B0F A;  2EVZ A;  4L6V 3;  1OSC A;  1SUQ A;  1BC6 A;  4WFZ A;  1HWJ A;  3UVJ B;  1P27 B;  3IM9 A;  4TU8 A;  2ATC B;  2ZJR Q;  3GU0 A;  4NZ0 A;  2BE7 D;  1NPK A;  2DGS A;  1VQO S;  3OFG A;  2JEF A;  3D6M B;  3VQS A;  1WF1 A;  4U95 A;  2D9P A;  1JMT A;  4DUY J;  3D9B A;  3BR8 A;  3S1T A;  5I3U B;  1IBK J;  4IRD A;  4KBI A;  1F5A A;  5K8P A;  3DOL B;  4ED3 A;  4XDC A;  1S1V A;  3MEG A;  2R7Q A;  1X5P A;  3C15 A;  3UE2 A;  2VF3 A;  3CJ4 A;  4X64 F;  4DR3 J;  4DX5 A;  1NME B;  1V9O A;  3UNY A;  3ZXW A;  4NE9 C;  4YB7 A;  3W62 A;  2V9K A;  1FKP B;  2ZH5 A;  4DLG A;  4X84 A;  4IDK A;  1WOP A;  3JS9 A;  2ASJ A;  1N0U A;  3OSN A;  2Z2Y B;  1KDN A;  4ECW A;  2DXF A;  4ED8 A;  5J2Q B;  3VAL A;  4DPX A;  1TVR B;  1VQ6 S;  4YR0 A;  3GJR B;  1KOO A;  4Q0B B;  1VQ8 S;  3R5C A;  1XNR J;  1UJ6 A;  5K8N A;  3DMJ A;  5THW A;  3POT A;  3RB0 A;  1R0A B;  3TAR A;  4KHR A;  2Y0S D;  1RJJ A;  2CAJ A;  4DPT A;  3BQ0 A;  2CFX A;  1FWL A;  3LPE A;  1VMB A;  4GVB A;  5I3Q A;  4MMO A;  1WC5 A;  4DV2 J;  2D9O A;  2YQ1 A;  3K5O A;  1PAU B;  4N77 A;  4RJV A;  1PIL A;  2WVC A;  3GIM A;  2GV1 A;  3B6B A;  1D9F A;  4RUA A;  3FMB A;  2LEC A;  4OHX A;  5KG1 A;  4KO0 B;  2KXH A;  2VQF J;  3K0J A;  3VAI A;  3JAM Y;  4Z7C A;  2H4Y B;  2FDN A;  1J27 A;  4AL6 A;  2ERR A;  5T41 A;  2VHG A;  2IY5 B;  4PPZ A;  4ECY A;  1IJF B;  3HMJ G;  2KZM A;  2EK6 A;  2BKP A;  2CPJ A;  2IPO B;  5M2U A;  5M2R A;  5F0U A;  4QYR A;  4I7F A;  1Y0H A;  1N6Q A;  4JI6 J;  5HQL A;  2R7X A;  4G1Q B;  1M1H A;  3AA8 A;  2AU0 A;  2Z4P A;  1TP7 A;  4Q43 A;  2RB7 A;  3FGV A;  2BM0 A;  1JJ4 A;  2JL9 A;  4B9V A;  4OLP A;  1CQN A;  4F3M A;  5HL7 Q;  3KHR A;  3RG6 A;  4B3M F;  4RLE A;  2DD8 S;  2XCP A;  2UXD J;  3MTK A;  3QGI A;  1GMU A;  3MFH A;  3ENV A;  4F4Z A;  1D0E A;  4WU2 A;  3EE3 A;  1E6V B;  3FVY A;  4U7C A;  1SJ4 P;  2W7A A;  4DV6 F;  3FEZ A;  2E66 A;  2VBW A;  1NDP A;  3OR2 B;  3GB0 A;  3KLE A;  3MI7 X;  2X1G A;  4KGX B;  3KYL A;  1HQU B;  2MHE A;  1RAJ A;  4NLD A;  2ZH4 A;  4CCH A;  5A8W B;  1RBO B;  1F3V A;  2N7Y A;  1RAB B;  1WJ9 A;  4LFB J;  1HI0 P;  5GME A;  1DAX A;  2QA4 S;  1JLQ B;  2QE5 A;  4DI6 A;  3V81 B;  1S6Q B;  3A8E A;  2DNH A;  2ASY A;  3L95 X;  1WG1 A;  4PG8 A;  2W24 A;  2ZIT A;  1GNK A;  4RNH A;  4HAC A;  4LRE A;  5JMN A;  4DWI A;  1JNR B;  4P75 A;  3SXL A;  5LSO A;  5LMU J;  4Z2X A;  2COL A;  3MAH A;  4NXM J;  3HHK A;  1U26 A;  2VG6 A;  3MUV P;  1UWB B;  3TAQ A;  1HR0 F;  4OI1 A;  4P6Q A;  2RVJ A;  2XWX A;  4YR3 A;  4F50 A;  2ZE2 B;  1FEE A;  1Q5Y A;  3SYZ A;  1JLE B;  3R5J B;  4RWW A;  4Y2M A;  4I2P B;  2WB1 D;  2M8D B;  1LKZ A;  3GFX A;  2XGQ A;  2AHO B;  3TQE A;  2C2N A;  1GTH A;  3OJU A;  1VR6 A;  4QQB A;  3ZZZ A;  3D1H A;  2OLW A;  3T41 A;  2JX2 A;  1NDK A;  1RWP B;  2FJW A;  3ITH B;  1TL1 A;  4YY3 J;  3MTJ A;  3JQK A;  4KB7 A;  4RUC A;  2L41 A;  3I9Z A;  1RTI A;  1FX2 A;  2DR7 A;  2AYG A;  5EN1 A;  2V2V A;  4PWW A;  2HVI A;  1QUV A;  2OPR A;  4LRA A;  5HQ8 A;  2LDI A;  3KNA A;  5DM7 Q;  3L7O A;  4FVM A;  2B6A B;  4Y2I A;  4ZVT B;  4KR0 B;  3MEE B;  3CC2 S;  4Y28 C;  1BQN B;  3ADA C;  1GTE A;  3D3C J;  4X2B A;  5A6W A;  1ZPW X;  2V4J A;  3MPV A;  2O67 A;  2RDJ A;  3PEH A;  4NMX A;  3M2V A;  4ZPD A;  5GAG U;  4DPY A;  1N5S A;  1HBU A;  2B4O A;  4WP3 A;  4F3O A;  2YKO A;  4DL0 C;  4TVA B;  4HT5 A;  2XS5 A;  2HHU A;  2D41 A;  4ETX A;  1CJT A;  3R2C J;  3HD2 A;  3ET6 A;  1GXT A;  1ULR A;  2R7R A;  2FJX A;  2QFI A;  5FDL A;  1ZYQ A;  4JI3 F;  3I0R B;  2EFP A;  1Z2Z A;  2GMH A;  3GII A;  1RT7 A;  1LV5 A;  4FNH A;  3HKW A;  4P2X A;  5ETV A;  1HQE B;  4RR5 A;  1NZ8 A;  1U6Z A;  1SL1 A;  2G4B A;  2ZWP A;  1FRK A;  2F4V J;  3I4H X;  1QM9 A;  2RQK A;  4C8M A;  2Z2M A;  1OQ3 A;  1S7I A;  2CPF A;  3NG8 A;  1TU0 B;  2E44 A;  5IOL A;  1UEK A;  2VG5 A;  3M2U B;  2YQ3 A;  1RAG B;  2W7P A;  2I8E A;  1ARO P;  2AT1 B;  5HVF A;  5A8K A;  3I5B A;  2Q66 A;  4DX7 A;  2OPS A;  1L3V A;  4ZPW R;  1FA0 A;  4I64 A;  3KJV A;  5GVQ A;  3A4T A;  2DGV A;  1C1B B;  4RW7 A;  1CJV A;  3UDV A;  3CB4 A;  1PYT A;  3SEO A;  9RUB A;  3TAP A;  2LCW A;  4PPD A;  3NCQ A;  5IV3 A;  1ZZF A;  2GVZ B;  4XIU A;  1UFK A;  1T9V A;  4WYW A;  1KLM A;  3FFI A;  3VAK A;  1JLA A;  1YZ7 A;  1TZ0 A;  4ECS A;  1AFJ A;  2ACM A;  3BGF A;  2HNZ A;  4QIF A;  3G8S A;  1HIY A;  5KG0 A;  4FF1 A;  2HQD A;  3IN5 A;  4FBT A;  1EHW A;  1HWK A;  2EFQ A;  1TL5 A;  2YY3 A;  5D0R A;  2G2O A;  3VAG A;  2B9E A;  2E9R X;  1FRM A;  4PXE A;  1SC6 A;  3DOM B;  3JSY A;  3OTO F;  1VJQ A;  3VCD A;  2WRM A;  1PBA A;  3KKF A;  1RAF B;  3K5P A;  1XR6 A;  2AJQ A;  3R9L A;  4LIW A;  2FJD B;  3FZ2 A;  1JLG A;  1SCJ B;  2WVD A;  2VIC A;  1M5K C;  3TR5 A;  4DSL A;  4LQ9 A;  4WK3 A;  1RBA A;  2IVY A;  3DFE A;  2KL8 A;  1YJV A;  2W2P P;  1Y3J A;  1R0B G;  1F1B B;  3QFH A;  3QO9 A;  2H9Z A;  2B5J A;  1RHU B;  4ZHR A;  2KHD A;  2PI5 A;  1FXR A;  3FNN A;  4DOZ A;  1SUQ B;  4FP9 A;  2Z0G A;  4C6A A;  3W5Z A;  2VFR A;  2ILZ A;  3BGL A;  5DZ7 A;  5A8R B;  4AL5 A;  3BO2 A;  4NXN J;  4NZ7 A;  2VZ9 A;  1O5J A;  3WX4 A;  4IRC A;  1JIH A;  2YNG A;  1IKX A;  2KKH A;  4B9M A;  3G71 S;  4ECZ A;  4UOH A;  2BE2 B;  1S1V B;  1GQE A;  1VJW A;  2JHE A;  3MEG B;  2VC0 A;  1OMS A;  3C15 B;  3HVA A;  3IS9 A;  3M9O B;  4K50 A;  2ROP A;  5DO2 A;  3JTP A;  4R25 A;  1XMQ J;  4LVO P;  1HA1 A;  2VON A;  1IWA A;  3HKZ D;  1Z2L A;  1SBR A;  5E3Q A;  5BYR A;  5AXM A;  1NB7 A;  3TYT A;  2ZM6 F;  2EKY A;  2AW0 A;  3TZX A;  5KFW A;  3F73 A;  1U25 A;  2DR5 A;  2ALY B;  4IDK B;  1REG X;  4CLZ A;  4F8R A;  1WKJ A;  4DFM A;  3EGW B;  1YG0 A;  3QLH A;  8ATC B;  3N5F A;  2DNL A;  5SZT A;  2LKZ A;  1LK5 A;  4OZ0 A;  5HN0 A;  3J7A 1;  2QL5 B;  1C4A A;  1ZTW A;  2QMU B;  3KMQ A;  4HT7 A;  3DMJ B;  4IOA Q;  3UQS A;  3POT B;  3BSA A;  3KHL A;  1ZTT A;  5B0C A;  4UY8 5;  1FXL A;  4LF9 J;  4MYU A;  3GR0 A;  4QBU A;  4TY8 B;  1U1L A;  1TUV A;  3W2W B;  1I94 J;  4P74 A;  1FEH A;  4ES2 A;  5KFK A;  4ZJQ A;  4EWT A;  3SV4 A;  1YGY A;  3BB5 A;  4LR9 A;  1LW0 A;  4KGK A;  3AFG A;  3SQG A;  2J76 E;  3KUE A;  4JI4 F;  2V8D A;  4BWJ A;  4GKJ J;  2I0X A;  1F6T A;  3IAM 9;  4LF5 J;  4ER8 A;  2HFV A;  2CQ4 A;  3C6T A;  4MKY A;  5HO4 A;  3KDN A;  5H9E J;  4FPR A;  2M9K A;  4Y2C A;  2DIS A;  1WDT A;  3H90 A;  2CQI A;  4HHJ A;  4LF4 J;  4R0E A;  2HMI A;  2QT7 A;  2PC6 A;  1RAH B;  3T5K A;  4YHH F;  1WTF A;  1N6Q B;  2DNM A;  4M5I A;  1FNX H;  4IYQ A;  3NKY A;  2KYZ A;  4CWB A;  2CQC A;  1XJW B;  2KXF A;  3O2I A;  1XK8 A;  3AXK A;  4BHQ A;  2MLZ A;  1VK8 A;  3SCJ E;  2LQB A;  1R89 A;  1F2G A;  3LH2 S;  3N6M A;  4L3K A;  3KG0 A;  1OIA A;  3I87 A;  1YZ6 A;  2AJF E;  3CCT A;  4PEO A;  2VJU A;  3QJJ A;  2M5Y A;  2ILY A;  2M52 A;  1SI9 A;  2CQB A;  1PJ5 A;  4RW8 A;  3ILO A;  1UCN A;  4DQS A;  4J9M A;  2X7I A;  2XMT A;  2FZK B;  4PRF A;  1YKW A;  3LP0 A;  3OR1 B;  4ZVP B;  3FMW A;  2VPW B;  3MF5 A;  4P2S A;  2M3D A;  2B3T B;  3K8W A;  3C16 A;  2P2C B;  2UUW A;  4NPO A;  4TQS A;  5HK4 A;  2Q3P A;  4A8Q A;  2ZOG A;  4DU7 A;  3D66 A;  1IVZ A;  3VGT A;  3SSQ A;  5DDQ C;  1GK8 A;  1PJ7 A;  1WOO A;  3R97 A;  1MU2 B;  4HAC B;  4OZ3 A;  2OJ3 A;  3S01 A;  5L39 A;  3PYE A;  4K4V A;  3D3B J;  2WSC C;  4FF2 A;  2QL7 B;  3TEG A;  2XWY A;  3FKB A;  2VG6 B;  2DHA A;  1RZM A;  4DR4 F;  1B0T A;  3LA0 A;  3EZU A;  2W4C A;  2E1P A;  5KG2 A;  1JLF A;  4FYY B;  3NS7 B;  3VAM A;  4N41 A;  4CH1 A;  3R27 A;  2DO4 A;  4B17 A;  5B0B A;  4LVN P;  5J1P A;  1EX8 A;  3MUT P;  3VTI A;  3RB6 A;  2FVC A;  2OI2 A;  4DQQ A;  2KT3 A;  3H4B A;  4CM0 A;  1IBC B;  1JXV A;  2IJR A;  2GO8 A;  1QSS A;  2M2B A;  2P6S A;  3JTN A;  2EBE A;  2BOA A;  4JV5 F;  2CXE A;  1RTI B;  4OHZ A;  2D1C A;  2OPR B;  1Q8I A;  3HDS A;  3QID A;  2RUG A;  7AT1 B;  3Q8Q B;  5J2N A;  1X8D A;  1N36 F;  1BMQ B;  4F26 A;  3G2X A;  2E1A A;  2CJK A;  4RUH A;  4CZC A;  4DV1 F;  2CJA A;  2HHH F;  5F8J A;  2F4F A;  2J9D A;  2U1A A;  2V4J B;  4B3S F;  1B3T A;  4NX9 A;  4F4Y A;  2DR6 A;  4JI2 J;  2HVZ A;  2MQL A;  2PMW A;  2VA2 A;  3D67 A;  3G6Y A;  1RWX B;  1BQM B;  1HBU B;  5IQQ A;  1RT1 A;  1YHQ S;  1I51 B;  3R7B B;  4FF3 A;  1UP1 A;  4C8K A;  2EI5 A;  3ET6 B;  1KEK A;  5L9N A;  2EC2 A;  3FC9 A;  3H5S A;  4O4G A;  3VZH A;  5FDL B;  3HF5 A;  2ROE A;  4JYA J;  2KZZ A;  1UFW A;  3ZNJ 1;  1M5S A;  3DDN A;  1C1C A;  4F4A A;  4TLQ A;  3GG0 A;  2DR8 A;  4LF8 F;  1ZM2 A;  1LK7 A;  1Q53 A;  1RT7 B;  3TNV A;  2NPI A;  4F4K A;  3HD1 A;  2JLG A;  2I5J B;  4DPW A;  3CME S;  2X3D A;  2ZJP Q;  2C2O B;  4URQ U;  1VQK S;  2ZH7 A;  2DT9 A;  3KDO A;  3E01 A;  2M70 A;  3UO0 A;  2OEM A;  2G0C A;  2VG5 B;  5DG7 A;  4X4U A;  3CO9 A;  3LAN A;  1NHU A;  3OVB A;  2IRX A;  3TVZ A;  6AT1 B;  1FT8 A;  3JSM A;  3DLK A;  3HVT B;  1KNZ A;  1YJ7 A;  1RTH A;  1S1W A;  3BN4 A;  3DXB A;  4OHW A;  4YUD A;  2RAQ A;  4ZVH A;  3EZ5 A;  1U1M A;  4DR2 J;  2YNF A;  2FLN A;  5D4O A;  4K4S A;  1SL2 A;  4RW4 A;  1DQ9 A;  4CLF A;  2OMO A;  2C3U A;  5GAD I;  3T9Z A;  2HYI B;  4LR7 A;  3M6U A;  2DNQ A;  2VOP A;  4KHP F;  2NZC A;  2W4P A;  3D7S B;  5LM7 E;  3FFI B;  1RT3 A;  1JLA B;  3CCE S;  2F65 A;  1P1L A;  3FCV A;  2HNZ B;  1RYR A;  6FDR A;  1SQE A;  1VRU A;  3NGK A;  5KOW A;  4WXO A;  2J0S D;  2HGN A;  4DJB A;  4RL1 A;  1F5C A;  3RJM B;  4CLY A;  3IBF B;  1N5V A;  3CJT A;  3AB2 B;  3NBP A;  4C3L A;  2V8H A;  1R27 B;  3RW6 A;  1WEZ A;  3GV5 B;  1YRX A;  1UET A;  5HMY A;  4OFZ A;  2HFS A;  4WKY A;  2PMH A;  1S9G A;  3CSK A;  2HG4 A;  2I2Y A;  2XUL A;  4CH7 A;  2OPP A;  4WK1 A;  1Y11 A;  4O44 A;  2JLE A;  4YP3 A;  2HQI A;  4I4B A;  2B5J B;  4ZHR B;  2YTC A;  2FLO A;  3BGU A;  3HSD A;  5J1E A;  2MKC A;  2AJ1 A;  4TYB A;  3ISN C;  4M5D A;  1FTC A;  3AH6 A;  5L1L A;  1RAO A;  4NYO A;  4LBP A;  2CJB A;  3HZG A;  1XIQ A;  4DQI A;  2DH9 A;  2XI3 A;  1WHV A;  5CH7 B;  4YDX A;  4JI7 F;  1F5B A;  3GJT B;  4CO0 A;  4Y6I A;  2W9B A;  4P9S A;  2C2Z B;  2XMJ A;  1OSD A;  4WZM A;  5IV4 A;  3GTY X;  4V1A k;  4NOH A;  5ETM A;  3FRY A;  2YX1 A;  1EZZ B;  3DRY A;  4X4Q A;  4ZCI A;  2R2R A;  3H2L A;  2J9E A;  2MDA A;  1UPM B;  3KFW X;  2V6A A;  5G0R A;  1SKW A;  1HBM B;  2MQP A;  1ZZN A;  2IHR 1;  1X9M A;  1SH2 A;  4LSZ B;  4LQ3 A;  4LFC F;  2HNY A;  1KHV A;  3D6H B;  1TK5 A;  1UJ5 A;  4LFA F;  4CLW A;  3U02 A;  1CVJ A;  4ZPT R;  1RCO B;  3W7B A;  3UW1 A;  2GJ2 A;  4JV2 A;  1XMO J;  3H42 A;  2OTL S;  3TWZ A;  2LMI A;  2KU7 A;  1S1X B;  1UJ4 A;  2VPY B;  4OI3 A;  3B82 A;  3M6X A;  5KG4 A;  4ERD A;  2HFZ A;  2X3G A;  3Q8P B;  4PAA A;  3HHL C;  3JYT A;  2B4V A;  2GS8 A;  1SQF A;  1WHX A;  4ZCK A;  1ZAX A;  1LW0 B;  3CC4 S;  3LWM A;  2KB2 A;  5RUB A;  1YDL A;  2IFX A;  7FD1 A;  3U7J A;  4V19 J;  4BC7 A;  1TFY A;  7FDR A;  1NHV A;  1FFG B;  3CO0 P;  1NDC A;  3CWJ A;  1LWC A;  2KO1 A;  3HHE A;  1HW9 A;  2QTW A;  4FVC A;  1YX2 A;  5KFQ A;  3AB4 B;  2HMI B;  1S72 S;  2ZHB A;  3FZB A;  1FX4 A;  3CD0 A;  4KKO A;  2VC1 A;  2FGC A;  5D78 A;  4QPT A;  2XY5 A;  2H48 B;  5KFF A;  4ECR A;  3SSS A;  3Q24 A;  2BKO A;  1CJK A;  2KI2 A;  5LSL A;  3UDC A;  3MMC A;  1UKU A;  4JV0 A;  3IAS 9;  2CPI A;  3GIL A;  1FFW B;  3VR1 A;  3ETM A;  3G9C A;  3DRP A;  1N32 F;  2RH3 A;  4PG7 A;  4HI2 A;  2ZJQ Q;  3H40 A;  2GFF A;  5F8M A;  5FII A;  1RE1 B;  1Y00 A;  1ZA2 B;  4B08 A;  3H8Y A;  2NLW A;  1U48 A;  4YDD B;  4WFY A;  3QNW B;  3CDE A;  3GON A;  1GMW A;  1RHJ B;  4CO3 A;  1P9Y A;  2C42 A;  2IMO A;  1FVQ A;  1U6B A;  2C2E A;  1DQ8 A;  1KWM A;  2K1R A;  4PWU A;  1HHQ A;  2J6T A;  4PUO A;  3MHY A;  2PFD A;  1FRJ A;  1IKV A;  4HH1 A;  4O3P A;  2IRY A;  3CIM A;  3CE8 A;  3LP0 B;  3HP6 A;  3QQC D;  2EWH A;  4MKA A;  1YBU A;  2DEJ A;  4M5K A;  4QWB A;  3MGJ A;  4FF4 A;  2UUB F;  1B64 A;  4HHU A;  4JI0 F;  3C16 B;  4MJK A;  2ZFH A;  2N3O A;  3J7Z T;  1KD1 T;  3M2R A;  2ZEJ A;  4PXB A;  4OX7 A;  3T3F A;  2HS3 A;  2HWT A;  2PD1 A;  3H4D A;  4J9U E;  1MN7 A;  2QA1 A;  4NEZ A;  2IDE A;  3K5N A;  4WZQ A;  3GP9 A;  5ETR A;  4FNI A;  3ENA A;  4X64 J;  4DSI A;  5G4D A;  2JH3 A;  3R6L B;  1DJ0 A;  4AT1 B;  2V9W A;  1R8H A;  1T8E A;  2GML A;  4FPI A;  1RHQ B;  2CQ3 A;  4DR5 F;  4MFB A;  4ALZ A;  2JJ4 D;  2ZDP A;  2PDA A;  3AOB A;  1GMV A;  2VKR A;  1NO8 A;  1MMD A;  1ZH5 A;  2XI2 A;  1YJT A;  1JLF B;  4C97 A;  4DV5 F;  4NCB A;  3PFE A;  2MZT A;  1UL3 A;  5LMN F;  2YWH A;  2UXC F;  3GSI A;  3DOK A;  3NXZ A;  3D68 A;  3LP1 B;  4ES1 A;  4FYD A;  2L48 A;  4X4P A;  4YN3 B;  3BO3 A;  5GMD A;  2J6U A;  3CED A;  1NPP A;  4ZVE A;  5C25 A;  1W7W A;  4L75 A;  4UZB A;  4OQJ A;  4W98 A;  4TU9 A;  2XMA A;  2HPU A;  1K47 A;  2LEB A;  2OEL A;  3RAX A;  3Q89 A;  5KFR A;  4ZN1 A;  1RWW B;  2MLX A;  4TNO A;  3PW5 A;  2YWW A;  2D74 B;  4X65 F;  3CJR A;  3CC7 S;  5T7L A;  4OZL A;  3ILI A;  1J5E F;  1UAW A;  3W9J A;  4PQU A;  2R8J A;  4A8F A;  5JVH Q;  3LO3 A;  3CCJ S;  1LFP A;  1HNX F;  2ZD1 A;  4I0W A;  1RT1 B;  3FEY B;  1WEY A;  5B0G A;  1MMN A;  3G82 B;  5HP1 A;  2V8V A;  2BQR A;  4ZVO B;  3DLL Q;  3QZ8 A;  2LU2 A;  3SCK E;  3BYR A;  4B3M J;  3K5L A;  3T5L A;  4K2J A;  4O4G B;  4OYP A;  1S9F A;  1C1C B;  1ICE B;  2PMZ D;  2DKO B;  2IJF A;  1F3F A;  4OX9 F;  3T5J A;  4UZC A;  1ELO A;  2RIJ A;  4DL7 A;  2W01 A;  1L3T A;  2B0G A;  1PCA A;  3N28 A;  4CDI A;  4KRW A;  4DV6 J;  2HBZ B;  2MY8 A;  2NUH A;  4X4N A;  1ZM4 A;  3EZO A;  4M5G A;  2CUY A;  2MGZ A;  3TJA A;  1NB2 A;  5KFE A;  2NR0 A;  4WF9 Q;  2AWZ A;  1A9N B;  1S6U A;  5IWA F;  5KFN A;  1R31 A;  1V5I B;  2LQ9 A;  1RHK B;  3DLK B;  2LA4 A;  2IBK A;  1SKS A;  3K58 A;  3R7S B;  1S1U B;  3ZTO A;  2R8I A;  3FDS A;  4XDD A;  4X4V A;  4OI4 A;  2E7W A;  4OHY A;  2OH2 A;  3TO8 A;  3IBC B;  2LP4 A;  2OPQ B;  2LU1 A;  3UN2 A;  2OEK A;  5EHH A;  1FRH A;  4YQW A;  2VBY A;  1RT4 A;  1RB0 A;  1NEE A;  1AYE A;  1MG7 A;  3OJS A;  1TUG B;  1RT3 B;  1Z1Z A;  2X51 A;  4H4K A;  4TYA A;  2GIF A;  2XM3 A;  4TY9 A;  2PII A;  1IN0 A;  4WKR A;  3HO1 A;  5F9N A;  2GAG C;  2EG1 A;  3LWL A;  1HR0 J;  3KLV A;  4XAK A;  3MM8 A;  4NLT A;  2QSF A;  3KK1 B;  1JJC B;  2HW3 A;  3NBP B;  3GV7 B;  4OZ5 A;  1VIX A;  3MZI A;  4TQR A;  1RAE B;  1U1O A;  2CPH A;  3MEK A;  2MTL A;  4N76 A;  1VLO A;  2G9O A;  3A8K A;  3FCH A;  3DLG A;  3EM1 A;  4FKY A;  2DK2 A;  1WG5 A;  1S9G B;  4KYZ A;  3TJ8 A;  2C28 A;  2OKQ A;  5AXK A;  4NA3 A;  3UWT A;  2DNP A;  4O44 B;  2VG7 B;  1U02 A;  1JXL A;  5H9F J;  4K4T A;  5IT4 A;  2YNI B;  2HK2 A;  1S4F A;  2FVR A;  1R3N A;  1DAR A;  3LGN A;  4C11 A;  5J1E B;  3EJM A;  4M5D B;  3ISN D;  3CCS S;  4IG3 A;  1G6B A;  2EFG A;  4KGM A;  3M7V A;  5A2Q Y;  1AUD A;  2HAF A;  2XSJ A;  2ZZM A;  3MPW A;  4BS2 A;  1TAQ A;  1FRL A;  1QDU B;  3R1L A;  5HBM A;  4MIA A;  5DGA A;  3DXS X;  3RBD A;  4NYP A;  3S6E A;  1HNZ F;  4GKK J;  4FS2 A;  2H3E B;  2GA7 A;  1UVM A;  5KFS A;  4PG5 A;  3ONQ A;  4LUB A;  2MST A;  3TA2 A;  2PE8 A;  4CRJ A;  1U6F A;  1RCX B;  2LYV A;  2R7T A;  1U2F A;  4HTJ A;  1YJ9 S;  2GJI A;  3KTQ A;  2A1B A;  4EBC A;  1X0P A;  2CJY B;  5G0R B;  1A7G E;  2DCU B;  4ZA1 A;  2GZO A;  2OML A;  2GIQ A;  2HNY B;  3T1H F;  4LRB A;  1GMW D;  3AD8 C;  5DQH A;  4JI3 J;  3IXQ A;  2M0G B;  3UPF A;  4OI0 A;  1DY3 A;  3TRG A;  3BR9 A;  4F4X A;  3RUB L;  3IRX B;  3M8W A;  4AD6 A;  4ZVR B;  2QN6 B;  1U49 A;  2RHQ B;  4F25 A;  4DR1 F;  2Y8Y A;  4WP8 A;  1HBO A;  2XNR A;  2CDR B;  2MKH A;  1EP4 B;  2FQQ B;  4ZN3 A;  1XWL A;  1Q95 G;  3BV8 A;  4JOU A;  1HBN A;  3TZZ A;  3TOQ A;  1IWG A;  1HKA A;  4RNO A;  1HNW F;  3JYT B;  1DQA A;  2W9C B;  2WCX A;  5LJ5 Y;  1HL6 A;  1JWW A;  3NGD A;  4WBF A;  3MM7 B;  2XTJ P;  2XYH B;  1T05 A;  2MXY A;  3EYZ A;  4CLU A;  3J7Y I;  1VHI A;  4DUZ F;  3H25 A;  1RT6 A;  5GAH I;  4Y00 A;  3OW2 R;  2IMW P;  3M8Q A;  2J7W A;  1IBL F;  1IXK A;  1NXI A;  5I3U A;  1KFD A;  1C2P A;  4ILR A;  4KKO B;  2CPD A;  4QZV B;  1Q7L B;  5IT9 U;  5D77 A;  3KHH A;  3NGT A;  1CJK B;  1YK9 A;  3OTO J;  3MMC B;  4FKX A;  4DR7 F;  4EU0 A;  3DRP B;  2Y3Y A;  2HEK A;  3HLU A;  1RU2 A;  1PGZ A;  2M7S A;  4RBU A;  4NI2 A;  5B09 A;  3VGV A;  3TI0 A;  2GQ2 A;  3QBC A;  3EDQ B;  5B7W A;  1U45 A;  3AJD A;  4O3O A;  3PTW A;  4Q0B A;  3CCQ S;  4HTI A;  2K1R B;  1N48 A;  3AQO A;  4PUO B;  5F8L A;  4CTA A;  3QIP A;  5H1S V;  3G6V A;  3K89 A;  4P7V A;  1NJX A;  3VZI A;  4I68 A;  2MZQ A;  2OUG A;  3ULH A;  2DNO A;  5IXU A;  3VQT A;  2VFV A;  1RXO B;  1U2R A;  3M4X A;  2AMC B;  1XER A;  2RHS B;  4URS A;  3G6X A;  2W8K A;  2KJV A;  3L3C A;  1DRZ A;  3NMR A;  4KSE B;  2ZH6 A;  3EXY A;  1R6V A;  4DV3 F;  2HRU A;  2Q43 A;  4C48 A;  2ZZT A;  5F9L A;  2D69 A;  2EBG A;  2ZNZ A;  2RS2 A;  1MWZ A;  1BD6 A;  2XEX A;  5EX3 A;  2X1A A;  4NLY A;  2ZM6 J;  2LQ5 A;  4C0B A;  3M8S A;  2CJ9 A;  4PXD A;  3UD5 A;  2MEW A;  1KHW A;  2DHS A;  2KVQ E;  3RBX A;  1AUS L;  2ZBR A;  2JFK A;  2HFU A;  4ECV A;  5FLX U;  1EKR A;  4PG6 A;  1EAY C;  4ZIT A;  2W2Q P;  4HHH A;  2ZZN A;  1BUX A;  2RUS A;  1NKB A;  1UPP A;  5KFL A;  2CWK A;  1URN A;  3DOK B;  2EPI A;  5CYJ A;  1K8A T;  1YJU A;  1RUS A;  3DKD A;  5L38 A;  2HVH A;  4GC7 A;  2XMU A;  3P4U B;  2GJF A;  3MR6 A;  1PBU A;  2DHH A;  2DGQ A;  4CYU B;  3LUY A;  2YKA A;  1WEX A;  4JI4 J;  1KVI A;  5C25 B;  3BPD A;  3P5T L;  2DBB A;  4K0K F;  3JB9 k;  4ZLN A;  4O0N A;  5KG7 A;  3TAN A;  3V4M A;  4Q5V A;  1V3Z A;  2CPZ A;  3SFU A;  1HQU A;  2LEA A;  3LAK A;  4G1P A;  4KIA A;  4A8S A;  4LIR A;  1FRX A;  3Q8R B;  5AE1 A;  4MK8 A;  2CVE A;  2YKN A;  3DM2 B;  1DHM A;  2DNR A;  5E3R A;  4F0K A;  3FQK A;  1GAO A;  5IC6 B;  3PVX A;  4KY3 A;  2GAH C;  1JLQ A;  4ELT A;  1S6Q A;  5T7L B;  4HYK A;  4YHH J;  2GCF A;  3BGR A;  3C14 B;  2KG0 A;  2AEJ A;  4PQU B;  4EO6 A;  1ZS6 A;  1SKR A;  3G4S S;  2RSQ A;  1HFE L;  2RD5 C;  1ZAW A;  4LF1 A;  1VQN S;  4DPU A;  2Z30 B;  2VPZ B;  5HP1 B;  3BKU A;  1SIW B;  4ECU A;  3QSI A;  4QIV A;  2Z8Q A;  1YI2 S;  3I5A A;  5E2Q A;  3QMQ A;  4X4S A;  1E6Y B;  4I2P A;  4Q8F A;  4ENO A;  1SC1 B;  1SJ1 A;  2DRA A;  1OPI A;  2CPY A;  2GGP B;  4UT4 A;  1WNE A;  1T9W A;  2C1E B;  2QV6 A;  1HWI A;  5DG9 A;  2R7U A;  2G2Z A;  5D6G A;  3GYN A;  3D54 A;  1WTB A;  4HR2 A;  3ITH A;  1Q81 T;  1HPZ B;  5L1K A;  1GX6 A;  2MGZ B;  3S7R A;  4LSN B;  3M8Y A;  1KFS A;  1WC6 A;  1H98 A;  3M1V A;  5C24 B;  3A3P B;  2EFN A;  2QZ8 A;  2FZC B;  5ITH A;  1JX4 A;  2WHO A;  3M30 B;  5EWF A;  2B6A A;  2XZD B;  2ZDO A;  1JNZ B;  4B9U A;  4I6A A;  1NJI T;  1FDB A;  1RT4 B;  1LW2 A;  3EVM A;  3HHN B;  1KQF B;  3VF0 B;  5KFX A;  3E51 A;  4CLS A;  1XN9 A;  3RAQ A;  4YS2 A;  1H6K X;  4YB6 A;  1U2C A;  4I1T A;  4DR4 J;  5I4M A;  3LF0 A;  5IS2 A;  3IA0 A;  3U1N A;  2RQM A;  4E0D A;  1Q1K A;  3I4P A;  3MM8 B;  4Y3C A;  4C0H A;  4OZJ A;  4J5O A;  4OYX A;  4J9R A;  1H2T Z;  1FK9 A;  3HSJ A;  1R8A A;  2FHO B;  2EK1 A;  5HAN A;  2GVD A;  2IJN A;  4I6W A;  2XCA A;  3D2W A;  4Q45 A;  1NLK L;  3MUR P;  2AEF A;  5IT9 Y;  5L1J A;  4JV5 J;  1L3S A;  3SIP B;  4J91 A;  4I56 A;  2MYF A;  3LOU A;  1YLX A;  1M1G A;  4Y2A A;  1NK6 A;  4JI5 F;  3NL0 A;  5E0O A;  3M2U A;  3Q0A A;  1VBX A;  1N36 J;  1PC4 A;  4G65 A;  4Y65 A;  2W25 A;  4IG3 B;  1B0V A;  5BXI A;  2RIL A;  4RUB A;  3TAM B;  2IA6 A;  2XSJ B;  1N54 B;  3V6K A;  4ICL B;  1X4C A;  4DV1 J;  1OS5 A;  5HBM B;  2F8M A;  2OFG X;  2HHH J;  1QE1 A;  1UW4 A;  3HVR A;  1ZAV A;  4B3S J;  3AXM A;  4KV8 A;  3OLA A;  4U6P A;  2CNL B;  1NK9 A;  4USJ C;  4J9S A;  1M0S A;  2EFV A;  3W2V B;  4QWD A;  2AYB A;  3PKM A;  3FEX B;  3GV8 B;  2BA9 A;  3OD2 A;  4UUX A;  4LBI A;  2YBV A;  5GMK a;  2Y8W A;  4J9N A;  2ZBP A;  2IM2 A;  1S57 A;  4L3N A;  1NUE A;  2YVS A;  3TA0 A;  5ETT A;  4B3O A;  1X4G A;  2FUG 9;  4MK9 A;  2MQM A;  4LF8 J;  4KT0 C;  5GAE I;  2ROG A;  2W2M P;  1WC0 A;  1C0U A;  2BAN B;  1NSP A;  4MYT A;  4Z37 A;  4DL5 A;  2YWE A;  4QYZ J;  1S0M A;  5DDP C;  1HBO B;  4C8Y A;  2QC3 A;  2JC1 A;  2BJ1 A;  1SL0 A;  2K3K A;  2YPY A;  1HBN B;  4LSL A;  1KVK A;  2YQ0 A;  3O44 A;  5F41 A;  3DN9 A;  3CT9 A;  1T3O A;  3QT7 A;  5E33 A;  4DFP A;  2DGT A;  2DPJ A;  1R43 A;  5MAO A;  2Z2L A;  3L7P A;  3NLC A;  1VIS A;  1HD1 A;  3TQ1 A;  3PJW A;  3MDF A;  3EVW A;  5FLX Y;  2MKS A;  3NGS A;  3ENQ A;  1T05 B;  1VRQ C;  3E3X A;  4DUT A;  2LXU A;  2NZ4 A;  4KHP J;  1FDA A;  1RLD A;  2BJE A;  1OO0 B;  2K7K A;  3U1M A;  5A8R A;  1RT6 B;  2VKZ G;  5E41 A;  3M8Q B;  1FVS A;  3DLE A;  4N8O A;  4YB5 A;  5E3C A;  3VAH A;  4OYW A;  2IA0 A;  1OJ4 A;  1ACM B;  1VQ5 S;  2BE2 A;  3UR3 C;  2E1M C;  4UOF A;  3FBF A;  3B4D A;  4RNN A;  2ZH8 A;  3G86 A;  1JKH A;  2FD2 A;  5F8N A;  1KR4 A;  5D4P A;  1WOS A;  2C2R A;  2GQC A;  2QL9 B;  4NI2 B;  2QGF B;  2YX4 A;  1RAI B;  3T6J A;  3SCL E;  5AXN A;  4IR9 A;  3KLH A;  2XBP A;  3D0H E;  2JRS A;  2J7U A;  3PRD A;  1TKX B;  2FJE B;  5D0E A;  3GLJ A;  4A48 A;  1RWO B;  2RRN A;  3TVK A;  2J5A A;  5H9E K;  3BS9 A;  3EGV A;  2KHC A;  3J80 U;  5KFO A;  3D28 A;  4CTA B;  4MT1 A;  3QIP B;  3KJQ B;  4TY8 A;  3MOZ A;  4RWX A;  3W2W A;  1WOR A;  2DVI A;  5D0G A;  5F0W A;  3B8H A;  1UW9 A;  2NUU G;  4JI7 J;  4TU7 A;  2UXB F;  4K4W A;  1KON A;  4BC9 A;  2XMV A;  2DH7 A;  2ZHA A;  3PNI A;  4W92 B;  1UWA A;  1JB0 C;  2BBE A;  5KT3 A;  4ZCM A;  1F9F A;  2CKW A;  4NLU A;  5DLG A;  2KG1 A;  1LNQ A;  4PR6 A;  2WZ1 A;  2IM1 A;  3AOA A;  4I2Q A;  4WFN Q;  2VA3 A;  3N9U C;  4LFC J;  4LFA J;  1YRT A;  1R0C B;  2K7J A;  4KH0 B;  4H4O B;  4N7T A;  1NPR A;  4IO9 Q;  3GSD A;  4DS4 A;  2NQP A;  1QAX A;  2HHV A;  5C42 A;  3T1Y F;  4PG4 A;  2UU9 F;  1FF2 A;  3FSI A;  4DN9 A;  4DV7 F;  2CQH A;  4Z7Y A;  4DL6 A;  4LMZ A;  4DCJ B;  1RTJ A;  3I31 A;  3OFF A;  3PY8 A;  2CQ1 A;  3BSC A;  3NGR A;  2ZH2 A;  2HBR B;  4F67 A;  3CCV S;  1EQM A;  1CBK A;  4QJV A;  3OXG A;  2J9C A;  2AF6 A;  2A6O A;  2P5V A;  3IR6 B;  3PDN A;  2OO4 A;  1FJG F;  3OR1 A;  2CZV C;  3A12 A;  3IGN A;  1SKU B;  1T9X A;  5HJX A;  1FNO A;  3J7Y U;  1VI7 A;  2H54 B;  2F40 A;  3JXO A;  3M9M B;  3NOC A;  4OI6 A;  5FD1 A;  2YKN B;  3B4M A;  1NCL A;  1UVI A;  2E5J A;  1UFL A;  1NND A;  2FY8 A;  3KLI A;  3ZC4 A;  3NWG A;  2QA2 A;  3TP2 A;  2UV8 A;  4UQT A;  3EPI A;  5KFA A;  3BGR B;  4MK7 A;  3BPS P;  3OVA A;  5EWG A;  5CCM A;  1VS3 A;  1PYO B;  1N5Q A;  3MCS A;  2ADC A;  1MU2 A;  1FJC A;  3KJF B;  2QRR A;  1NK4 A;  1NZA A;  2DHG A;  2VOO A;  4LF6 F;  1N32 J;  3QYY A;  4QWA A;  1CSJ A;  3CJS A;  3PRB A;  2Q6B A;  1SVD A;  2PEH A;  4A4J A;  3WIU A;  3I82 A;  1XC9 A;  5BYQ A;  3GIR A;  1FE0 A;  8AT1 B;  3MD3 A;  1M5V C;  4OJ3 A;  1CS4 A;  3MPY A;  2MZJ A;  3PM9 A;  3EPG A;  1TK0 A;  1MW7 A;  1CUL A;  3CUL A;  2RDI A;  5DM6 Q;  2E5I A;  1KP6 A;  2O66 A;  2XQC A;  1QJH A;  2UUB J;  4ELV A;  4JI0 J;  3CJQ A;  4J37 A;  2NSB A;  3PAC A;  1O6X A;  2ZUA A;  3M1V B;  5AJ3 F;  1VQS A;  3PW0 A;  2R2T A;  4C3M A;  2UUA F;  2CQG A;  4QW8 A;  4QCL A;  4FYW B;  4P52 A;  3HVW A;  3D0G E;  1SPB P;  4B02 A;  3MWB A;  1W25 A;  2JEI A;  1MRO A;  2BQ3 A;  1QUP A;  4IR1 A;  1TR0 A;  2BMB A;  4LRC A;  1LW2 B;  4AXI A;  2XZT B;  4BCA A;  3DGP B;  5D4N A;  3C6U A;  2PGC A;  2HAI A;  1N34 F;  1DZ5 A;  2N4C A;  4GKK F;  2UUC F;  3BZQ A;  1D9A A;  1DBD A;  4DR5 J;  2FLL A;  3L4B C;  2D3O R;  1BQM A;  3GCW P;  2HQC A;  3LAL A;  3I56 S;  3PW2 A;  1IM4 A;  2JSX A;  4CO1 A;  4A8K A;  3OFH A;  1HYS A;  2IC3 A;  3CMA S;  2AKW B;  1U1K A;  4JI1 F;  4DV5 J;  2YKP A;  1FK9 B;  2HBY B;  4GC6 A;  5HI7 A;  2HIY A;  4CT9 A;  3V6D B;  2BR0 A;  4CIO A;  1SXL A;  5LMN J;  2GVD B;  2UXC J;  5HMX A;  5CAA A;  4OYM A;  1CC8 A;  1IR1 A;  3OBI A;  3FBC A;  1T02 A;  1KQG B;  3N6L A;  2WVB A;  3GWC A;  4ED2 A;  4DZD A;  2I5J A;  3QRQ A;  2MJN A;  4HL9 A;  2F3J A;  2FYX A;  5KT2 A;  5KAK A;  2J0X A;  4PZV A;  1B7F A;  5LL6 d;  2HFN A;  3W9H A;  1BE4 A;  4CO4 A;  1X0F A;  2XS2 A;  2L9W A;  1K1S A;  3FUY A;  3HVT A;  4M5J A;  5KTQ A;  4ZOS A;  1NJW A;  2VFT A;  2I6W A;  3Q22 A;  2ZH9 A;  4ITS A;  1NK8 A;  3RR7 A;  1LWE A;  2MQO A;  4X65 J;  1MWQ A;  3T6B A;  3CGI A;  1RT2 B;  3BBB A;  1QE1 B;  4ZS6 A;  3CCR S;  2XC9 A;  1X5S A;  2CNK B;  1J5E J;  4KV8 B;  1UVK A;  3HXM A;  2VUG A;  3W61 A;  1Y10 A;  1G3O A;  4B3R F;  1SIZ A;  3KXD A;  1HNX J;  4X4R A;  3CDA A;  4OYI A;  3P8B B;  2FC8 A;  1K73 T;  5D15 A;  1KOH A;  1RAC B;  5DDR C;  2R42 A;  4K4Z A;  3LAM A;  4NLQ A;  4Q2L A;  2WTF A;  2BW7 A;  4DHV A;  5B0D A;  3MAQ A;  3BEG B;  4ETZ A;  3TUP A;  2RU3 A;  4B3O B;  1G1X A;  1YIJ S;  1C0U B;  4OX9 J;  1UEU A;  2QO3 A;  5GAG I;  4PYA A;  3DCA A;  4WFA Q;  3OSP A;  5B0E A;  2UVV A;  1HI1 A;  3MXH P;  5F3T A;  5CD4 A;  5IWA J;  1KVJ A;  2GHW A;  4DEZ A;  1VDH A;  5L8R C;  4LSL B;  2FVQ A;  2OSR A;  3PHE A;  4PAB A;  4PCQ A;  2B7B B;  3WIV A;  3NNH A;  3FQL A;  4RU2 A;  2RQC A;  3TVY A;  1TKD A;  4I6Y A;  5I42 A;  1TKT B;  2LVW A;  1S5Z A;  2V5H G;  1HHT P;  4ED1 A;  2MZ1 A;  1V3S A;  1TL3 A;  4NLW A;  2DNK A;  3DLE B;  5KG3 A;  2F1F A;  1X4E A;  1N5Y B;  2OTJ S;  2M4M A;  3J81 U;  3PV8 A;  4RBV A;  4D3H A;  2RKI B;  5L1I A;  1W26 A;  5J2M A;  2CAD A;  2ZKU A;  1S10 A;  3ZZU A;  3BDE A;  4C7Q A;  4OYZ A;  3EUN A;  2LDY A;  1JKH B;  1T94 A;  1YTY A;  3CCM S;  3NS6 A;  1HBM A;  2AGQ A;  1I6J A;  4OJH A;  3BSO A;  3BBF A;  3M8R A;  1P9Q C;  2JVR A;  1QY7 A;  2BKN A;  3KLH B;  1I5O B;  1IKY A;  2EKN A;  1RA6 A;  1YWX A;  3AD9 C;  1VQ9 S;  3I9V 9;  1HNI A;  2EC0 A;  4DSK A;  3K7R A;  3PYG A;  1S1X A;  1F2H A;  2V2Z A;  3C8Y A;  4G6V B;  1S7H A;  3QRR A;  2NXN A;  3OTD A;  3OUY B;  1WI8 A;  3G8T A;  1Q7Y T;  4XO0 A;  3H2V E;  3N5B A;  3SQO P;  4DPO A;  3MUM P;  3SDE A;  3ZTS A;  2RDD A;  4TKT A;  3PYD A;  2F5G A;  1QTN B;  4NLR A;  3NNC A;  3CPW R;  1HNZ J;  3PKY A;  3VVT A;  2GW8 A;  3IWL A;  4RW6 A;  2V0N A;  3MAA A;  5HLF A;  1N5T A;  4ID5 A;  5I3P A;  3W9I A;  3PR4 A;  3QJP A;  4I2Q B;  2YWF A;  4N8N A;  2MZS A;  3DU6 A;  3BO4 A;  3T1H J;  1NAQ A;  3NOG A;  3V4I B;  3SZ2 A;  1VQL S;  5HRO A;  1FO1 A;  4FXV A;  3HT0 A;  3B78 A;  2DY9 A;  3GJQ B;  2BQU A;  4GVL A;  3KJN B;  4C0O C;  5C42 B;  1YVF A;  3MM6 A;  4AYB D;  4DR1 J;  5E7O B;  2ATL A;  5DRK A;  3MCO A;  3RTV A;  1VBY A;  1RTJ B;  3GYX B;  1HNW J;  4J9L A;  2VOD A;  3DLH A;  3TUZ C;  2V34 A;  3PFO A;  3AT1 B;  3OVS A;  3OXL A;  1OPZ A;  4ZPV R;  4Y34 A;  1DUR A;  3NCR A;  5KFD A;  4DUZ J;  3GIK A;  1L5U A;  3PX0 A;  2BZ2 A;  2A0F B;  2DRB A;  1WKK A;  4EI2 A;  2QG9 B;  1GFW B;  5KFJ A;  2VBX A;  1IBL J;  3OTB A;  2XY6 A;  4WTO B;  4M95 A;  1QLN A;  4U96 A;  3THV A;  1RWK B;  2FLP A;  3Q2S C;  3BKF A;  3Q23 A;  3KLI B;  4IQM A;  4EGL A;  5HVH A;  3GCX P;  4NLG A;  2HQ3 A;  3NGU A;  1ZPV A;  1TUW A;  4RNM A;  1A0O B;  4IOB A;  4I69 A;  4DR7 J;  4KTQ A;  2E7V A;  4PKD B;  2EFO A;  6FD1 A;  2QX0 A;  2B7C B;  1XBW A;  3IFE A;  3CJ2 A;  4BBY A;  2JZ5 A;  4P2F A;  4LBH A;  4OJ1 A;  3KMS A;  1PKU A;  2B56 A;  1CS4 B;  2CJQ A;  4DSE A;  2V4Q A;  2GHP A;  3I0S A;  3T9N A;  5KFV A;  3AJ1 A;  1GEH A;  1B99 A;  1M5H A;  2QMX A;  1CUL B;  2Y9H A;  3NEK A;  1EIY B;  3AY0 A;  2XB2 D;  1I1G A;  3TZY A;  1VQM S;  1NBE B;  2ALZ A;  4N56 A;  5F3Z A;  4QU6 A;  3LP1 A;  3J7Z 5;  3IR7 B;  2GNK A;  8RUC A;  3O8W A;  4IH5 A;  4DDF A;  3SV3 A;  1HNV A;  4WJB A;  2W1B A;  2G2Y A;  5ETS A;  4WP9 A;  3N0V A;  2B4P A;  2K2P A;  3ZZP A;  4C8L A;  1Q0N A;  3GMG A;  4DV3 J;  4QIW D;  1MRO B;  1K0V A;  2W9A A;  1EAR A;  3BDP A;  3HT3 A;  3P49 B;  1FFS B;  2Z2Z A;  2KYX A;  2YH1 A;  1U1P A;  3C6U B;  4DCO B;  2AP6 A;  4N47 A;  3T19 A;  3SI8 A;  3CD7 A;  4RBT A;  2DH8 A;  4OYO A;  3WHI A;  4HLB A;  2V2Q A;  1YRU A;  5K14 A;  3TW0 A;  2P9G A;  4AE5 A;  1N33 F;  1YBT A;  3DRS A;  2CG8 A;  2NRE A;  5CYM B;  2CDQ A;  5C2G A;  2MHN A;  1Q8L A;  4UOC A;  3CJ8 A;  4DR6 F;  3CJ3 A;  2RRA A;  3GG1 A;  5IZH A;  1HYS B;  3G82 A;  2IC3 B;  1RI7 A;  5LJ3 Y;  2CZ4 A;  5LXR A;  5KFB A;  2HHW A;  3LTO A;  5A76 A;  3I32 A;  2ZH1 A;  4I67 A;  4NLO A;  1T11 A;  1T9Y A;  1IJE B;  3RAM A;  2B9Y A;  3CTR A;  4X66 F;  1R7I A;  3J81 Y;  2CA9 A;  4AQY F;  4ZPC A;  4U67 Q;  2WB4 A;  3US5 A;  1QVG R;  3RYL A;  1LFW A;  3R5G A;  2JEG A;  1XR7 A;  1Q5V A;  1N8R T;  1JLC A;  5KOX A;  4K0K J;  2H1Y A;  3PX6 A;  4OIX A;  3OXF A;  2YXL A;  3Q83 A;  3QGG A;  4NCG A;  1TFW A;  2WK4 A;  3P45 B;  4KC5 A;  4KGZ B;  1OY6 A;  4K4U A;  3EVO A;  3PG9 A;  4RX6 A;  3ZTR A;  1WI6 A;  2HUR A;  1S1U A;  3ICL A;  3CJ0 A;  2N7C A;  1LWE B;  1DLO B;  2OHD A;  2WON A;  3IRW P;  5U47 A;  2OPQ A;  4NRT A;  5D3G A;  1IQZ A;  3ZTP A;  2PT0 A;  4Y0F A;  1WAC A;  1BXN A;  3OL7 A;  3ENW A;  4ZVU B;  5IM0 A;  1AZS A;  3MOJ B;  4F36 A;  4WCE Q;  2DB1 A;  2V69 A;  3M9N B;  4USK A;  5H9F K;  3DNC A;  3HHD A;  4Q44 A;  2XLK A;  2JEJ A;  4UOG A;  1UTA A;  1X4F A;  1JQG A;  3R5B A;  2ZVS A;  2AIR B;  5HSP A;  3KK1 A;  1V6H A;  1T03 B;  1GT8 A;  2AGP A;  3UI3 A;  2CQD A;  2ASL A;  1YJN S;  1AW0 A;  1Y5N B;  2V4R A;  3G8Q A;  4PYD A;  4JI8 F;  1NM2 A;  3FK4 A;  2HZA A;  5BR8 F;  1Q8B A;  3THP A;  2VG7 A;  5CYQ B;  1PSD A;  2F9D A;  5KFZ A;  2V68 A;  2QSW A;  5JUM A;  1YJR A;  1WHW A;  2ZWO A;  2YNI A;  3AD7 C;  1KQS R;  5DQI A;  1IQT A;  2DEI A;  2VDI A;  4ILL A;  3CCW A;  2OSQ A;  4IUF A;  1KTQ A;  1WWH A;  1S1T B;  3MFI A;  1SC4 B;  4HDH A;  3E8O A;  4P73 A;  5ETN A;  3IR5 B;  1H7X A;  2DPI A;  5I42 B;  5J2P A;  5ETO A;  1Q86 T;  1C0T B;  1WUU A;  5E3A A;  2LXF A;  1X4A A;  1TL3 B;  3H59 A;  1NSA A;  4ZLL A;  5DGB A;  4WPA A;  2R8K A;  3RBE A;  2R8H A;  4X4O A;  3HK2 A;  3W8G A;  1NHK L;  1JK9 B;  1WEL A;  5J2M B;  2F8E X;  4B9S A;  1DTQ A;  1HLW A;  1KRP A;  2K8G A;  4IQX A;  4NRU A;  4AXJ A;  3ELH A;  3VVU A;  3KK2 A;  5D4L A;  2PEB A;  3E2E A;  1FDD A;  4IG0 B;  1HQ2 A;  4XK8 C;  3IRX A;  1IKY B;  1NU4 A;  1RSC A;  5EDW A;  4J9P A;  3RW7 A;  3BQ1 A;  2AJ2 A;  1HNI B;  3CIZ A;  4IFY B;  4A8M P;  4FYV B;  4JI5 J;  1EQ0 A;  2UVR A;  2QLB B;  3CMQ A;  1EP4 A;  4DS5 A;  4N5S A;  2C2M B;  3MED A;  1TQL A;  4DU8 A;  2V8G A;  4QOT A;  1RYS A;  3SDE B;  2ABY A;  4RW9 B;  2W9C A;  3CCZ A;  4G1I A;  1UEV A;  4GRS A;  2XLI A;  4X62 F;  2NCK L;  3RB4 A;  2HSE B;  1IBM F;  1F9H A;  3MM7 A;  5L46 A;  1A6L A;  5HAO A;  5SUH A;  2L3M A;  3CDW A;  3SMZ A;  2VFU A;  1URR A;  2BJ9 A;  2BAB A;  4DN0 A;  2HND A;  4RW6 B;  2ZC3 A;  3MAA B;  5HLF B;  1PIE A;  4NZ6 A;  4ID5 B;  1RWN B;  3O3L A;  3EX7 B;  3FBB A;  4P10 A;  1FWK A;  2RQ4 A;  2LEP A;  2IYI A;  3IO1 A;  3WQP A;  1KSP A;  3FBE A;  3F44 A;  4S0M A;  3TX8 A;  3SSR A;  5KT7 A;  1U7L A;  5HRO B;  2KH9 A;  4OX8 A;  1KC8 T;  3UD3 P;  3LQV A;  4ZPB A;  5DJB A;  2WW4 A;  3DDK A;  4M63 A;  2W8L A;  2HHQ A;  2C3Y A;  3MM6 B;  4DBQ A;  1S76 D;  4ZP9 A;  1AB8 A;  2SXL A;  1D8Y A;  1YIT S;  3AQP A;  3FSY A;  2N82 B;  3PCO B;  3AOD A;  2LA6 A;  3I5C A;  5E5N A;  2L9D A;  2VIH A;  3M8Z A;  3KK3 A;  1FKO A;  4MKB A;  3T5H A;  1FTR A;  1N56 A;  4OYB A;  4WU3 A;  5CHC B;  2FHM A;  2B8Q A;  2QLW A;  4XPC A;  2BVZ A;  4DL4 A;  3GFH A;  3M6W A;  2BJ8 A;  3F41 A;  3UCZ P;  3F56 A;  2OD6 A;  3QT8 A;  1KS2 A;  1U4B A;  1BWE A;  3UCG A;  1Y5L B;  1VC0 A;  2F9J A;  1WC1 A;  1CG2 A;  4R5P A;  1NK7 A;  3K8V A;  2MMY A;  3PX4 A;  5AT1 B;  1UMJ A;  2KM8 C;  4LF7 J;  2HS0 A;  2V2K A;  3UR0 A;  3GYG A;  1S6P A;  1GH8 A;  4ED4 A;  1U24 A;  3X1L B;  3JTO A;  4UF4 A;  3TJ9 A;  1RHR B;  3NRB A;  1N0V C;  3QAT A;  3V2U C;  1ZOT A;  3EGZ A;  3I0S B;  5BYS A;  3PIO Q;  2F63 A;  2VL1 A;  3KUH A;  4ZVF A;  3DGV A;  1O0P A;  2F8H A;  3Q8U A;  3HJV A;  4OZN A;  4F2R A;  2KXN B;  1TKZ A;  3DU5 A;  1Y9O A;  2HHP A;  1N52 B;  3ZZR A;  2AQ4 A;  1HNV B;  4CYU A;  5CZV A;  4H4M B;  2PFF B;  2E5H A;  3QAE A;  2DR9 A;  4GO7 X;  2UXB J;  2BXJ A;  4O3Q A;  1OY9 A;  4U8V A;  4H4K C;  1S0O A;  2FHJ A;  2A2C A;  2MKY A;  2D3U A;  2LFV A;  3UDE A;  3MMA A;  1RIS A;  4MAK A;  2BW2 A;  1SJF A;  3IBW A;  1VQY A;  2GX8 A;  3DM2 A;  4OI2 A;  4B9N A;  1MSW D;  4A8Y A;  4L76 A;  2ZVI A;  1M5O C;  2J0W A;  2HGM A;  1IM6 A;  3GFZ A;  4USH A;  2ZBI A;  4O0I A;  2XHC A;  3C14 A;  2OFH X;  5K14 B;  3H5Y A;  5J1N A;  3DRS B;  3BRE A;  4QWC A;  3G87 A;  3K5M A;  2O01 C;  1WDD A;  3T1Y J;  2UU9 J;  3MPU B;  2ZHO A;  4DV7 J;  4RNF A;  3U1L A;  3PXG a;  4UUW A;  4K5S A;  1NSK L;  3TZW A;  4ZCL A;  2C3P A;  2KN4 A;  3BGO P;  1PG5 B;  3TUI C;  1N4L A;  1E6Y A;  2H4W B;  2KRR A;  1CQM A;  2GGP A;  1V5V A;  3W66 A;  2Z58 B;  4W90 B;  1QAJ A;  4UW2 A;  4KAI A;  1JLC B;  1J5O A;  4HEA 9;  2JOQ A;  3OTE A;  1FJG J;  1HPZ A;  3P6Y C;  4NLV A;  2OD4 A;  4USV A;  2HWI A;  4NCG B;  4LSN A;  2VU5 A;  3IC1 A;  1LOU A;  2QLX A;  4DV4 F;  1VYA A;  5C24 A;  1CEZ A;  2WSF C;  1B7Y B;  1G7C B;  2G0I A;  4K59 A;  4HI1 A;  5HMZ A;  3M30 A;  1IKW A;  4CP5 A;  5LSR A;  4B3T F;  4CQ1 A;  2WON B;  1U8S A;  4CT8 A;  1SJ3 P;  4NL5 A;  1SV5 A;  5D3G B;  3B54 A;  4GVB B;  2W4D A;  1RDR A;  5DQG A;  3G96 A;  2MQN A;  4UQG A;  4WWS A;  5IM0 B;  1AZS B;  3QT5 A;  2CYY A;  3UCU P;  4LF6 J;  2ZOF A;  2XO7 A;  1BHN A;  2OP5 A;  1T3N A;  2HWH A;  1HI8 A;  4CO5 A;  1XNQ F;  4DMZ A;  5C5J A;  1NK5 A;  4U9R A;  1N88 A;  4ATN A;  3EGN A;  1H0H B;  2BJD A;  4DV0 F;  3DYA A;  2B4U A;  1R8P A;  4RU9 A;  1U1Q A;  4OMF G;  2V63 A;  4I7F B;  1H2U X;  3H98 A;  2DNZ A;  1Q16 B;  3RB3 A;  3DHX A;  1RHM B;  2JWN A;  4EEY A;  2E5L F;  4CNY A;  4CNZ A;  2DGX A;  2PSZ A;  5AJ3 J;  5A0Y A;  3JSR A;  2UUA J;  1YBA A;  1MLA A;  3I6P A;  1LWX A;  3RZA A;  3OL6 A;  3WX8 A;  3BYP A;  2ZBC A;  3IGV A;  3H5X A;  1EET A;  4L74 A;  4DF8 A;  3BBC A;  1H72 C;  5BJR A;  3N6N A;  1FWP A;  1GXL A;  1T0T V;  1WSR A;  3M8P A;  1FXD A;  1R8C A;  1TL7 A;  5J2P B;  3TAM A;  4M5L A;  2N4D A;  4MKV A;  2FZG B;  2DIT A;  4ICL A;  4QR1 A;  5JJB A;  2IRU A;  3DRX A;  2KT2 A;  2RRB A;  3H2U B;  1OYD A;  1M5P C;  1N34 J;  2J0Q D;  2DYA A;  2CG4 A;  2UUC J;  4CM2 A;  2Z56 B;  3RU0 A;  5C7P A;  1TMJ A;  3KLE B;  4QU7 A;  5KFG A;  1X9W A;  3CVK A;  1F60 B;  3W2V A;  1RWM B;  3O5T B;  3PEJ A;  4QYZ K;  4EFA C;  4EZ6 A;  3L9Z A;  4PWD A;  1DTQ B;  4WFB Q;  3W8P A;  4RZR A;  4JI1 J;  2MJU A;  5AXL A;  2R8G A;  2P8I A;  5JXS A;  3N79 A;  3KK2 B;  2BRK A;  4QR0 A;  2KT5 A;  4J90 A;  5F8I A;  2E1C A;  2RT3 A;  3KOA A;  1ZM9 A;  2BAN A;  4YR2 A;  2W2N P;  3I96 A;  3P3D A;  4JUZ A;  4U7U D;  1WF0 A;  4KE5 A;  2BV3 A;  2A18 A;  4C3K A;  1Y4Z B;  4IRK A;  3QSY B;  3MED B;  5ETQ A;  4DX6 A;  1H73 A;  4HDG A;  2AJ4 A;  4Q2M A;  4JB8 B;  2HQF A;  2IBO A;  2CWX A;  4ZP7 A;  2V8P A;  2IM3 A;  2M8H A;  4KFB A;  2VQE F;  4M94 A;  5HAT A;  2YPZ A;  3OV7 A;  4K4Y A;  4NML A;  3ISZ A;  4R8U A;  5GAD U;  1TL1 B;  2HND B;  3QWU A;  4B3R J;  2CJX B;  3N01 A;  2QA4 G;  2Q1L A;  4A8X A;  2AEM A;  5M2P A;  1P6T A;  5DS7 A;  2DRD A;  2H5J B;  1QSL A;  3QRP A;  3FRZ A;  1TV6 A;  2KTQ A;  2VAS A;  3ZZ0 A;  2K06 A;  4QPX A;  4V19 X;  1CJU A;  3VHQ A;  1REV A;  3CDU A;  4E2F B;  4USM A;  4FN5 A;  5EX0 A;  3ILL A;  1RTD A;  4P71 A;  4AND A;  3NAH A;  3GQC A;  4ZP6 A;  1KTV A;  3F0N A;  2V94 A;  1FJ7 A;  4FZV A;  3M2V B;  3GJS B;  3PYF A;  2KDO A;  2LXI A;  4O23 A;  2MQQ A;  3RRG A;  4QR2 A;  4U7U K;  4WE1 A;  2RU9 A;  1TKX A;  4DX8 H;  2NYI A;  3C46 A;  3MMJ A;  1CJT B;  3KK3 B;  4G3I A;  1FKO B;  1SJR A;  1X4B A;  2FHJ D;  2IM0 A;  1KQK A;  3A8I A;  1LXJ A;  4B9L A;  2G13 A;  2BJ3 A;  1F0X A;  3RBZ A;  1H38 A;  2BJ7 A;  4YOE A;  4ED7 A;  2FJA B;  2DIV A;  2O3D A;  1Q4R A;  3ETO A;  5F8G A;  4ED0 A;  2NS1 B;  2UUT A;  4C8Z A;  1U47 A;  4QIE A;  1QAI A;  2VH7 A;  1CC7 A;  4R5P B;  4CH0 S;  5A8K B;  1TEL A;  1K44 A;  2OPS B;  4J9V A;  3C3L A;  3HCX A;  3SCI E;  3NS5 A;  2R7O A;  3KJV B;  5ETP A;  5B08 A;  1OWX A;  4RW7 B;  4K8R A;  3MMB A;  1CJV B;  3UN5 A;  5HJY A;  2MLY A;  4LRF A;  4R0J A;  4ZIW A;  1S6P B;  1RK8 A;  1M1K T;  3BH7 B;  2HQG A;  4H4O A;  1K0T A;  1KLM B;  3OTC A;  3D4J A;  1K1Q A;  2DXE A;  4RKU C;  3RGI A;  3PO5 A;  4DL2 A;  5EGY A;  1PO6 A;  4DUY F;  3MR3 A;  3VAF A;  3BN7 A;  4E98 A;  3VV2 B;  1TK8 A;  1IBK F;  1WD6 A;  3DLJ A;  2R3V A;  2BOP A;  1S59 A;  5K8O A;  1U8W A;  1APS A;  4NCA A;  2XY7 A;  2GC8 A;  2DGW A;  4P2M A;  5F8H A;  1TKZ B;  2B51 A;  3UD4 P;  3CD5 A;  4PXC A;  1ZBT A;  1WHY A;  1X31 C;  2H51 B;  4DR3 F;  4DFJ A;  4HH0 A;  2Y0B B;  5IFM A;  2FJB B;  2HIQ A;  4OHV A;  4B9T A;  1SC3 B;  2B8P A;  2UVW A;  1JLG B;  1NSQ A;  3CW2 C;  2IAJ A;  1VRT A;  5K9F A;  2HKE A;  3PHT A;  3MMA B;  2PA8 D;  3I55 S;  3QO9 B;  1FJE B;  1XNR F;  1YSJ A;  3ILJ A;  3ZZO A;  4NWB A;  2RF2 A;  1VCT A;  2J8S A;  2DGO A;  5DLF A;  4FBU A;  1Q78 A;  4DSF A;  3W64 A;  2MB0 B;  3MM9 A;  4OX6 A;  4DV2 F;  2XG8 A;  5DDO C;  2IDL A;  1HHS A;  3W63 A;  4UY8 T;  3BM7 A;  2UZA A;  1H74 A;  3D1Q A;  3AA9 A;  2YNG B;  2XHW A;  2NPF A;  1IKX B;  1U09 A;  2VQF F;  3N4W A;  2KM8 B;  1MML A;  4KH1 B;  3THT A;  3DC2 A;  3KLF A;  4F2S A;  3IS9 B;  1JJH A;  3MCN A;  3O6Q A;  1KN6 A;  4F7V A;  2BUN A;  3LGH A;  2XYG B;  1U0H A;  3J7A N;  4RO0 A;  1KKH A;  3HFV A;  1J5O B;  4JI6 F;  2AJ0 A;  1L3U A;  3IWN C;  1KLN A;  1VIO A;  2E29 A;  1LXN A;  3QLH B;  3RRK A;  3KUG A;  2OEJ A;  2W7O A;  5LOQ A;  4A46 A;  2RS8 A;  5KFT A;  1RWV B;  3W60 A;  1VGY A;  4WYL A;  1IKW B;  2L9N A;  4EK2 A;  4NA1 A;  2LQ8 A;  1U1R A;  3H7H B;  2UXD F;  5IT0 A;  3MR7 A;  3U27 A;  5KFU A;  1SV5 B;  2HFO A;  2CNO B;  3L09 A;  4QIG A;  2CZ9 A;  2WVF A;  4ANE A;  2BM1 A;  1T7P A;  1OY8 A;  2AD9 A;  3DGP A;  3R7N B;  3SQG B;  2E9T A;  5IQ6 A;  2OGU A;  3D6F B;  2DGU A;  1FD8 A;  3C6T B;  2LLZ A;  4DQR A;  1U0S A;  3KNG A;  2ZNY A;  3AAW B;  1NKC A;  3DYA B;  2QEX S;  3WC0 A;  1IR2 A;  2JNJ A;  3DHW C;  4LFB F;  3V6D A;  2Y1R I;  2L08 A;  3IG1 A;  3W65 A;  3PRV A;  1T9T A;  4FXW A;  3IWX A;  3QFW A;  2AV5 A;  4ZP8 A;  1WC3 A;  3C19 A;  2F7V A;  4BDP A;  4ZJO A;  1DTT A;  2CIM A;  5HQM A;  1MNE A;  1UA0 A;  2NYH A;  1P8G A;  5A0Y B;  3TUJ C;  1TTH B;  1RKI A;  4ID8 A;  5LMU F;  4NXM F;  3QGP A;  3MM5 A;  5AE2 A;  2D3Z A;  2AZ3 A;  2GMJ A;  2YX7 A;  2DXD A;  1FRI A;  1EET B;  5A2Q U;  2RML A;  4USI A;  2XO6 A;  3DRR A;  2R9L A;  1YQH A;  3HZE A;  2OIH A;  3M8P B;  1TL7 B;  3GR1 A;  2ZH3 A;  4GMK A;  3VGU A;  1TL4 A;  3TA1 A;  1FDN A;  3VAJ A;  3K57 A;  1HAR A;  1I3O B;  3MEC A;  4RW8 B;  5KFM A;  2W2O P;  1RT2 A;  2FC9 A;  2HBQ B;  1X4D A;  4J9Q A;  2FVP A;  2ZOM A;  2HS4 A;  2JDJ A;  2KVI A;  1N33 J;  3LGM A;  4YY3 F;  1VC6 A;  1BQX A;  1H2V Z;  4UTG A;  4DR6 J;  4O3S A;  1VQ4 S;  1WSV A;  2HZV A;  2VDH A;  4PWD B;  3NNA A;  1S9E A;  1RAD B;  1VBZ A;  3Q86 A;  3HHL A;  1F9E B;  2BRL A;  3Q2T C;  1CLF A;  4ZVS B;  2BDP A;  3R3T A;  3H20 A;  4ZLJ A;  4LT6 A;  1BLU A;  1ZM3 A;  4X66 J;  1KBR A;  4AQY J;  3GFY A;  1JXE A;  4ECQ A;  2KJW A;  5K5M A;  1B0P A;  4ZIV A;  2YKM A;  1XEZ A;  3HX9 A;  2CQ2 A;  1SH3 A;  1FD2 A;  3W1Y C;  4F3Q A;  2A3J A;  4F02 A;  3WDO A;  4HVZ A;  3QGH A;  2A6M A;  2VD3 A;  4ED5 A;  4HKQ A;  3M32 A;  5CXT A;  2D7S A;  2DNY A;  3T1A A;  4MH8 A;  4WXW A;  1WF2 A;  2J9D E;  4NLS A;  3W5Y A;  4KFB B;  1Q8K A;  3AOC A;  2EG2 A;  3TEH B;  4R8U B;  2I9S A;  5JVG Q;  1TKT A;  2IVM A;  3ZZT A;  3OT9 A;  4AL7 A;  2HHS A;  2YKQ A;  2B43 A;  1FES A;  5KG5 A;  1PYS B;  1O8B A;  2JFD A;  3P5B P;  4YB1 P;  5DG8 A;  2MQ8 A;  2G1D A;  2F4V F;  3FJ2 A;  4F04 B;  1N5Y A;  2BX6 A;  4NYZ A;  3NAI A;  4OYA A;  4MTP A;  3V5R A;  1TV6 B;  5J2N B;  2RKI A;  4ED6 A;  2XMK A;  3CUN A;  2VFS A;  2POK A;  1ZET A;  1CJU B;  1REV B;  4DG1 A;  4FS1 A;  2J6S A;  3L7U A;  3HI9 A;  1ZA1 B;  1RTD B;  4BWM A;  4LF7 F;  4C8O A; 
#chains in the Genus database with same CATH homology
 5C7P A;  1NPK A;  3VGT A;  3VGV A;  1B4S A;  3EVO A;  3FBE A;  1WKJ A;  4S0M A;  4ANE A;  3ZTR A;  4UOF A;  1NDC A;  2HUR A;  4DZ6 A;  3EIC A;  1S5Z A;  1S59 A;  3FBF A;  3EE3 A;  1U8W A;  3VGU A;  1NSP A;  1ZS6 A;  3B6B A;  3ZTS A;  4C6A A;  3G2X A;  1PKU A;  5CAA A;  4WBF A;  4KPC A;  3FBC A;  1NCL A;  1F3F A;  3Q8V A;  2VU5 A;  3ZTP A;  1NDP A;  2ZUA A;  3EVM A;  5BXI A;  1W7W A;  1B99 A;  3FKB A;  3VVT A;  5CAB A;  1MN7 A;  1NDK A;  1VYA A;  1BUX A;  1WKL A;  4W98 A;  4F36 A;  2CWK A;  1HIY A;  3DKD A;  1EHW A;  3ETM A;  2B8P A;  4CP5 A;  1MN9 A;  1NSQ A;  3EM1 A;  1LWX A;  1NB2 A;  3GP9 A;  3Q86 A;  3GPA A;  1WKK A;  3DDI A;  1NDL A;  3Q89 A;  4FKY A;  3ENA A;  4ANC A;  1F6T A;  1LEO A;  3PJ9 A;  3WX8 A;  2NCK L;  1PAE X;  4AND A;  3BBF A;  1K44 A;  3BBC A;  1BE4 A;  4ENO A;  3B54 A;  4UOG A;  3PRV A;  1UCN A;  3BH6 B;  3EVW A;  3JS9 A;  4UOH A;  3NGS A;  3Q8Y A;  4DI6 A;  4DUT A;  1KDN A;  2BX6 A;  3ZTO A;  2DXF A;  2HVD A;  1NHK L;  3NGT A;  1XIQ A;  2BEF A;  3FCV A;  3Q8U A;  3MPD A;  3VGS A;  2B8Q A;  2AZ1 A;  4FKX A;  4O0N A;  1BHN A;  3FC9 A;  1XQI A;  1HLW A;  4HR2 A;  5IOL A;  3ZTQ A;  3BH7 B;  3EMT A;  3R9L A;  2DY9 A;  1NSK L;  3BBB A;  4EK2 A;  3NGU A;  2HVE A;  3L7U A;  4F4A A;  3EJM A;  3ELH A;  3FCW A;  2AZ3 A;  1JXV A;  3FBB A;  2DXE A;  3NGR A;  3VVU A;  3Q83 A;  1NLK L;  2DXD A;  1S57 A;  1NUE A;  1HHQ A;  2DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...