1NDCA

X-ray structure of nucleoside diphosphate kinase complexed with dtdp and mg2+ at 2 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title X-ray structure of nucleoside diphosphate kinase complexed with thymidine diphosphate and Mg2+ at 2-A resolution.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndcA00
5CAAA 1B99A 3FKBA 4FKXA 3VVTA 5C7PA 2BEFA 2DYAA 4UOFA 2AZ1A 1S57A 3FBEA 1LEOA 3ZTSA 4DZ6A 3DKDA 1NSQA 3B54A 3VGVA 3NGSA 4FKYA 3EE3A 1WKJA 1HIYA 1BUXA 4ANCA 1NSPA 4S0MA 2DY9A 3Q8VA 3Q8UA 1NSKL 3BH6B 2B8PA 3FBBA 2HVEA 2DXEA 3NGRA 5BXIA 1EHWA 1NCLA 2CWKA 1HHQA 1K44A 4F4AA 1NDPA 1NLKL 1UCNA 3ZTQA 2DXFA 1LWXA 1NDKA 3DDIA 3Q86A 3Q89A 3VVUA 1NDCA 4CP5A 2DXDA 3ETMA 3EICA 1PAEX 4DI6A 1BHNA 4ENOA 1NB2A 1XQIA 2ZUAA 4UOHA 1F3FA 1WKKA 2HVDA 1ZS6A 3ZTRA 5CABA 2VU5A 3B6BA 3G2XA 3NGTA 3R9LA 4KPCA 1NDLA 3PJ9A 3BH7B 3ZTPA 3EJMA 3VGTA 1NUEA 1PKUA 3BBCA 1S5ZA 3FBFA 3PRVA 3VGSA 3FC9A 3BBBA 1B4SA 1WKLA 2NCKL 3ZTOA 1F6TA 1MN7A 4EK2A 1HLWA 4ANDA 1JXVA 4WBFA 3NGUA 4O0NA 3FCWA 4UOGA 3ELHA 1W7WA 1MN9A 4ANEA 3BBFA 1VYAA 3JS9A 4W98A 3Q83A 3EVWA 3ENAA 4F36A 1U8WA 1BE4A 3FBCA 3EVOA 3EMTA 3VGUA 1S59A 5IOLA 4C6AA 2B8QA 1NHKL 1NPKA 3GPAA 2AZ3A 3GP9A 1XIQA 3EVMA 3Q8YA 2HURA 4HR2A 1KDNA 3L7UA 3MPDA 3WX8A 4DUTA 3EM1A 3FCVA 2BX6A
chains in the Genus database with same CATH superfamily
4IH6A 3M8WA 2DIVA 4CI0B 1F1BB 1DZ5A 2VPYB 3EDQB 3M6UA 1VRTA 2B5JB 1GXLA 3TUJC 1MLAA 1NDPA 5B09A 2E7WA 1U2CA 4RW4B 4ZLPA 1AYEA 2WB1D 4X66F 1VIXA 1JLBA 3C14B 2ZH2A 3VAKA 5EX0A 2IVYA 1KLMB 2LEBA 1S72S 2H5IB 4OX8A 3KNAA 1BQNB 1UZHA 1U0HA 1WI6A 2KXFA 3NAIA 4P7VA 3HM9A 5H9EK 4W98A 4YB1P 5HLFB 3W64A 1RU2A 4FPRA 1WC3A 3SSQA 2P6TA 3X1LB 5HAOA 3UNGC 5BYRA 5HO4A 4C6AA 3GV8B 1X9WA 2OUGA 4F26A 2F4VF 1SQGA 1N5VA 1FE4A 1UVJA 1R43A 4E98A 3R1LA 1S57A 4IRCA 5I4MA 4RW6A 3H20A 4NLDA 4IO9Q 1IR1A 2N7YA 4F4AA 3DRXA 4QJVA 4M1KA 1T94A 3CCVS 1NK0A 3A3PB 1NK7A 1IKVB 1TKTA 5AT1B 4HI2A 1WG5A 3CCES 3D1OA 2Q6CA 3EZOA 1REVB 2J9DA 4DR4F 1BC6A 3JQKA 3CCUS 5AXKA 3U02A 3H5YA 4EZ9A 5HN0A 2AYBA 4AYBD 2DT9A 1UJ6A 2VFTA 4JI3F 1RWPB 2B51A 4KHRA 4KC5A 1HNWF 4ANEA 2B7CB 2MLZA 4B3SJ 1X7VA 1S6QB 1RT1A 4RW8B 3ILIA 4E8UA 4IUFA 1YSJA 1R0CB 4C8LA 5GAHI 1S4EA 3TUPA 2B6AA 5D4OA 2FC9A 2M52A 4ZN1A 4J9UE 5F8LA 3HX9A 2BX6A 1EETA 2D7SA 1ZM9A 2MY7A 3W5XA 3V6JA 3LALA 2DNZA 3Q8VA 2Y9HA 5LJ5Y 2C3PA 3AXKA 5ETLA 2B9WA 1HHQA 1ULRA 3C6UB 2KH9A 1UCNA 2M8HA 4CYUA 2I9SA 5IWAF 3KOAA 2BJ9A 3UFCX 3KHHA 2KT2A 2YKNA 1H2VZ 2VKRA 1AZSA 4KPCA 4JUZA 3GLJA 5D4LA 3J7YU 3BQ1A 1RHKB 1U7LA 1F6TA 3KHGA 1JLEB 4YP3A 2ZZMA 3BS9A 1LFPA 2ZH5A 3J7Z5 1E6VB 2OFHX 3EMTA 3JTOA 4ZVOB 1NO8A 5MAOA 2P2CB 3TI0A 2N4CA 4M5LA 1Q8BA 4NZ0A 3M8PB 2VOOA 3F56A 3OFHA 2UUCF 3KK2A 4KKOB 2UU9F 3D5MA 3JXOA 2E9RX 3DRSB 4ZVUB 2FJAB 1M5VC 2HGNA 4HTJA 2JEFA 3NGSA 1QUPA 3IBCB 1ICEB 1LNQA 3ILJA 5D4NA 4RZRA 2KYZA 5J2PA 3GTYX 4DV4J 2IVMA 1S1UA 1JLFB 4Q5VA 2ZH7A 2GHPA 3OVSA 1IBKJ 3R7BB 3N5FA 3G6XA 3LP1B 4C4WA 2FVCA 4OI0A 3GFHA 3Q2SC 1EP4B 3GIJA 3DI6A 1XNQF 4FZVA 3BH7B 1Y11A 2CQBA 3QT7A 3Q22A 3BBCA 5A8WA 1N6QA 1UVLA 1TKDA 4USKA 1YKWA 5D4PA 3DOKA 4ZS6A 1Q86T 1V3SA 2ZWOA 3LAMA 1X5PA 3THTA 1M5SA 2V8GA 4OHVA 2VG7B 4X66J 2R8KA 2JDJA 3EPGA 1X4CA 1GX5A 2D3ZA 2OH2A 2CVEA 4J5OA 2CPYA 1QY7A 3FEXB 4TLRA 4DCJB 2OLWA 4JI7J 2RS8A 4KY3A 2CQDA 3BGRB 3PFOA 3SSRA 3ENQA 3CIMA 4NMXA 4RUAA 2X1AA 1ZTTA 4NMLA 4DV1F 3GFZA 3M30B 3DDIA 5D3GA 3HVAA 2OPQB 2B4UA 5FDLA 1S1VA 3CMES 4MAKA 2F4VJ 5M2UA 1I3OB 2G9OA 6FD1A 1F9FA 5HQ8A 1JLAA 3NNAA 3KLGB 5ETRA 2AGOA 1RT4A 4WP8A 2VPZB 4K4UA 3SMZA 3GV5B 3K5LA 4DR3F 2EI5A 2E7XA 2DPIA 2W2PP 1RAJA 3KXDA 2XG8A 3BBFA 4F0KA 3TWZA 3US5A 1S77D 1E6YA 3OL7A 5CXTA 1SL0A 1F5BA 4ZVGA 3PKMA 3GPAA 3QNWB 3G82A 3M8ZA 1S6OA 2YX1A 2HGMA 4DR4J 5CZXA 4DS4A 4J9LA 4I56A 4DV2F 3DMJA 2CXEA 2H3EB 3M05A 4J9OA 1HARA 3CJRA 4IG3B 4KE5A 4K0KF 4JI3J 1HNWJ 2LQBA 2Z0GA 4LRCA 1FJGF 2BW7A 5C42B 3GJSB 2J8SA 2DHGA 2YWEA 1C0UB 3A1YG 4P75A 3ZZTA 1FKAF 1B0VA 2MHNA 5CH7B 2YPYA 2NPFA 1JLQB 1NB2A 4H4OA 1RTHA 4B9MA 2OI2A 1ELOA 1WC6A 3E51A 3FZ2A 4MIWA 2PI4A 4JI2J 4RWXA 2LECA 4YS2A 4MKBA 2FHKA 3SDEA 2NZ4A 1XJWB 1R89A 1S7IA 2DITA 3KUGA 2JLFA 1RACB 2VD3A 2A2DA 4QR2A 4I0WA 1IBMF 3KLEB 2RIJA 2AIRB 5IWAJ 2E9TA 3Q83A 1SPBP 5FLXU 3T19A 1VFJA 4E2FB 4FBUA 1WHYA 5HQLA 2RRNA 2O1PA 3IFEA 2HAIA 4OI1A 3NP5A 4ED7A 3OUYB 2ZNZA 1XEZA 2VPWB 4ETZA 5J2MA 4ANCA 4HT5A 2MKSA 2DY1A 3AD7C 1AUSL 2XS5A 4L3KA 5L9XA 3VZHA 1RWUA 1S9EA 1X4FA 2FVRA 1KP6A 4ES1A 2UUCJ 3VALA 1X5OA 3IWNC 4NLOA 4ZIWA 2UU9J 1U1QA 2QYCA 1Y0HA 2I6WA 4KHMA 1TVRA 1QVGR 4WIIA 2E1RA 4AL6A 1TL3B 3VGTA 1CPZA 1CJTB 1WACA 4KQZA 3CVKA 3L3CA 4OZ2A 2YKAA 1RHUB 2PMHA 3GONA 2ZBIA 2CRLA 1SKRA 5CD4H 1NZAA 3GWCA 3I5CA 1FRJA 3ZZRA 3E01B 4PXDA 2V2VA 4DQRA 1XNQJ 1RWXB 5E2QA 1SC1B 3QZ8A 1W2BR 2BABA 3V6DA 2AD9A 1YBUA 2LXIA 4URQU 4DG1A 3D68A 3D6TB 5T14A 4R8UA 2YNIB 3PACA 4OHWA 3DGPB 3KHLA 1EZZB 1NSKL 3KLHA 5DRKA 3NAHA 2DXEA 3CE8A 4MK9A 3LGHA 5GAGI 3O1LA 3H40A 2R2SA 4JI8F 2GGPA 3X3UA 2RU3A 1IM6A 2XGPA 1GFWB 1FX2A 3EICA 4KHPF 1YJNS 2LQ8A 4O3RA 2HHHF 1EJ7L 4UTGA 2WBRA 2R8HA 1VGYA 4M5GA 3I9V9 2W7PA 2FVSA 2B5JA 1OIAA 3BBBA 3BPSP 3I4PA 2IM2A 4GC7A 5F9NA 1MWZA 4RW4A 3HJVA 2XYGB 2D1CA 4OZNA 2GQQA 1LKZA 3CCQS 1KLMA 3ILOA 2XZDB 5KT5A 3BR9A 4MKVA 1BQNA 3GSIA 3ZZZA 3M2RB 4RW9B 4WWSA 2BBEA 4TY8A 1HMVB 4JP8A 3OLAA 1PIEA 2M5YA 4DL2A 4J9QA 4I4BA 2HEKA 1RKIA 3G6YA 2QN6B 2RHQB 4RLEA 3W3SA 4ZP9A 1R7IA 5HLFA 3BGFA 5KFTA 5HANA 1TL1B 3SIPB 2PE8A 4Y28C 1R0AA 1YZ7A 3IG1B 4ETXA 4Q43A 2CPJA 4ZITA 3BQ0A 3DLBA 5AXLA 2HVZA 3ZTRA 2QMXA 2GIRA 4DV2J 4RBVA 2BE2B 1ROFA 4HHJA 4K0KJ 4KV8B 3PZPA 2GJ2A 3M4XA 4JI6F 4D3GA 3UDCA 3M1VB 1SUQB 3N4WA 1S0VA 2DJWA 4LF9F 5HROB 3QSIA 2I38A 3IS9A 2MMYA 2GIQA 2GVZA 1S6UA 2FVQA 3RBXA 2MZRA 2HNYB 3FEYB 2C3OA 3OR1B 1HYSB 3VGUA 3VAGA 4WU3A 2DGTA 2GJFA 1REVA 4WFZA 1VCTA 3V6HA 2R7QA 1UFLA 2R7OA 3NCQA 2LU1A 4ILLA 3EUNA 1IBMJ 3AQOA 3WC0A 3DYAB 4K50A 4RW8A 3T5KA 2CWKA 1K44A 1VBKA 4KGMA 4NCGA 3CB4A 3RUBL 3PEHA 5K14A 4DL4A 2CNNB 2H54B 2F8MA 2CNLB 4B3OB 2YNFB 1ZH5A 3NGTA 4A8QA 4DOZA 2MZ1A 2V8HA 2LVWA 2QO3A 1Q8LA 2ZC4A 3A3OB 4M94A 1VHFA 2VG6B 1T03A 2W4DA 4DF8A 1U2RA 3RYLA 2RSQA 5JMNA 2KFNA 2HWTA 3AY0A 3PHTA 2BXJA 3BJYA 3CJ4A 1EKRA 1CSJA 3AB4B 5DLGA 3RJMB 2OPRB 4UOFA 2LMIA 3FBEA 3CWJA 4AFFA 3ETOA 3W60A 4K4WA 3NS6A 2W9BB 1YJ7A 4CO2A 2MY8A 3POTA 4N8NA 1A6LA 3VV2B 3R27A 5K8PA 2ZH9A 3Q86A 2XNQA 1FTRA 4V19J 3I56S 3CDWA 2DXDA 4CTAB 3N28A 3BN4A 4ID5B 1S1XB 5ETPA 1F5AA 3F73A 1TK5A 4V19X 3CEDA 3JYTA 5IT0A 3IM9A 4OMFG 1EARA 4I6AA 2QLJB 4ZCLA 1REGX 2XZTB 1OSDA 5ETVA 1S9FA 4PG5A 5A6PA 5FJ4A 3D3CJ 4JI8J 3T9ZA 4RNFA 3QT5A 8ATCB 2LQJA 2XQCA 4KHPJ 2DO0A 2Y3YA 4AD6A 2HHHJ 2XI2A 2EC0A 4IOAQ 1EP4A 2Y8YA 1V3ZA 3KHRA 3VCDA 3ZO7A 2EEYA 2CIMA 2MQQA 2Y0BB 4KSEB 1VJQA 3KMSA 4CLZA 2QMUB 4P73A 4ZMMA 1RAOA 1JQGA 3HVTB 2KYXA 1UPPA 4DV0F 4IFVB 1P1TA 5KG7A 1FK9A 1Y10A 4ED3A 5A0YA 4U95A 4U7UD 1KD1T 3NWGA 5KG5A 2VICA 1YLXA 2X1FA 2V34A 3GIKA 2RD5C 1MW7A 2YKPA 5CABA 1PJ5A 2C2EA 2HQIA 1BXNA 2XNRA 3THVA 3W8PA 3O8WA 3M32B 2ZVIA 3BGRA 2XO6A 1FERA 1UEUA 3LPYA 4UQGA 3W2WA 1TKZB 3BDPA 3PXGa 5F8JA 1B4SA 3FGVA 1HD0A 3QLHB 4EK2A 2QGFB 5LOQA 3IRXA 1SL1A 2CNOB 4OLPA 1JLGA 1V6HA 2RNEA 1C1CB 3MEEB 4K4ZA 5J1NA 2L9DA 1TMJA 3MD3A 4XAKA 4NA2A 3BPDA 4CO0A 4LF1A 4CLKA 1F60B 1KDNA 1S49A 4FN5A 4I2PB 4J9PA 3PW2A 4JI6J 2YH1A 1ZA2B 1N88A 4PG4A 4LF9J 1WKJA 1BUXA 3KJFB 1JNRB 2RT3A 5GAEI 1X4AA 4ICLB 3OSPA 3QO9A 4KAIA 2VDHA 3OR2A 4LJMA 3DRRB 2AQ4A 3GYNA 5J1PA 4DV7F 2C2OB 1O0PA 4DQIA 1N32F 4ZA1A 1XTZA 4C11A 3OVAA 2DR9A 3MWBA 2XS2A 1VQ6S 1RCOB 4X62F 3CC7S 3AOBA 2RQ4A 1JJ2R 3MMAA 3BV8A 4OYBA 3D54A 3TUIC 2ZH3A 4KGZB 1AFJA 1U1RA 1JIHA 4BWJA 2A6MA 3KLIA 1T05B 1FO1A 1RZMA 4EZ6A 3BO2A 4NRTA 3L7UA 3E8OA 4BDPA 1HQEB 2XB2D 3RR7A 3PYEA 2AYMA 3MMBB 5J2QB 2WSCC 3KLEA 2MKCA 4AL7A 3VZIA 3DXBA 2V5HG 3SCLE 4P2XA 2O66A 1S0MA 4ZLJA 3FSXA 3D0IE 5GAHU 5K8MA 2AJ0A 5B0BA 2JFKA 8AT1B 4YN3B 1NJIT 5T7LA 1TFWA 5ETNA 3O5TB 1N0VC 1AFIA 5DO2A 2OFGX 3B78A 2OPSA 4WXWA 3OUYA 3QWPA 5E7OB 1F5CA 1W25A 2Z2LA 2CQHA 4OI6A 1UAWA 1S97A 3H2UB 3W66A 4CQ1A 4X4SA 1FWPA 4WXOA 2HG4A 3HJFA 4HYKA 1FXDA 3LH2S 1NU4A 3KMQA 1QD1A 4ID8A 1PYTA 4QU7A 3PRBA 2XSJA 2MQ8A 5CYMB 3SYZA 1TL3A 4CH0S 2VIHA 2V8DA 2ZHOA 1CJTA 3CXCR 3ADAC 4O3PA 2CPXA 3S8SA 1RB0A 2L48A 4NXMF 1V5IB 4RX6A 1SKWA 3HHNB 1EIYB 4RNHA 2D3UA 1YK9A 3QGHA 3MCOA 2G0CA 5AXNA 4TYBA 3DOLB 3H42A 4OZ1A 3E01A 1WTFA 5D0HA 1HHTP 1EX8A 1LWXA 4B9TA 1FFSB 3ETMA 4J91A 2VODA 1WNEA 1XQIA 4F2SA 3DGVA 3HK2A 4FS1A 2F3JA 1NHVA 2ZEJA 1RBLA 3UN2A 2ILZA 4USHA 4KPYA 1QE1B 3I31A 2B9EA 2G1HA 4DV0J 2BDPA 2DGVA 2YKMB 3PR4A 4B9VA 4WFBQ 1UJ5A 2DO4A 1GMWA 4GRSA 1VQSA 1NM2A 5HMYA 4FYDA 2WHOA 1WF2A 3NNCA 3DDNA 3PO4A 1DTTB 1ZZNA 1CBKA 5F9LA 4KO0B 3UN5A 2P9GA 2XMTA 1M1GA 3V4IA 2YQ3A 3I0SA 4ZP6A 3OL9A 2SXLA 2LQ9A 2P8IA 1LWCB 2HQDA 3CJTA 2EFOA 1MMNA 1OO0B 5LT5A 2F5GA 2WTFA 1TL4A 2GX8A 4MKYA 2ZH8A 2OD6A 2CQ4A 4LBPA 1J2VA 4DV5F 2XULA 1ACMB 4Y00A 4UUXA 2PMZD 3MR3A 4LFAF 3BYPA 1MROB 4DBQA 4FVCA 3M9OB 1PJ7A 1TUGB 1TL1A 3FJ2A 1S12A 4PRFA 1CQMA 3G96A 4M5HA 4K4TA 2VJUA 2LEAA 3NLCA 2GO8A 3DLGB 2AJFE 3TR5A 4DV7J 1N32J 3HSJA 3HHLD 2NSCA 4MMOA 4X62J 1GEHA 4K4YA 4BC9A 2DNYA 4KV8A 1IXKA 3MAAA 2QA4G 3NY0A 1NKCA 5HL7Q 1R8AA 3RB3A 1SC4B 5B0GA 3G6ES 5KFKA 2NS1B 2XMAA 5HROA 3JTPA 2MDAA 4LVOP 4QW8A 2A6OA 2JC1A 1PGZA 3DC2A 5KFIA 1NSPA 1Y5LB 3OFFA 2HNYA 3CCJS 2V4JB 1K73T 3OR1A 1QTNB 2QEXS 2RKIB 1ZETA 1TFYA 2UP1A 2JX2A 2CJXB 1O6XA 4NXNF 2FIUA 2DNMA 2QC3A 4P71A 2IM1A 3JAMY 2FHJA 4BWMA 3T6BA 2UXCF 2WRMA 1JNZB 5HVGA 4YFUA 5B08A 3DYAA 3PX4A 1LV5A 2FJDB 4TNOA 2BANB 4YDXA 2GC8A 1UVMA 1GXTA 5HMXA 2FTRA 1M1HA 5HATA 5CCMA 4IRKA 4B3OA 2MZQA 1P9YA 4OZ0A 5IT9U 1XMOF 1LWFB 2E5IA 2IHR1 2ZZNA 4DFPA 3QYYA 2FDNA 1S7HA 3H4BA 3OTOF 2LXUA 2VG6A 2QMWA 1D9FA 1SJ3P 2IPOB 4DUYF 3M2VB 2CAJA 2XMUA 2HWIA 4CLPA 4DEZA 5IT4A 2E66A 1H72C 1AW0A 3NEKA 1NDCA 4KRWA 1VMBA 4C8OA 2XY7A 2UV8G 3TJ9A 1D1UA 4OIXA 4ECZA 4U8VA 3WHIA 2OPRA 2KFYA 4NXMJ 3CJ8A 4DR7F 3CJ0A 2QYGA 3C16B 2W9BA 3I0RB 5KT3A 2Q1LA 1PYSB 4FBTA 3NCRA 3MM8A 2WONA 3UVJA 2H9ZA 1M5HA 4FXWA 2EC2A 2CQ2A 3FCWA 1DARA 3H2LA 4Y65A 4CTAA 5KG1A 5KG0A 3ZZOA 4ID5A 3JQJA 2HMIA 5D8HB 3GQCA 2JL9A 2FZCB 1R31A 2CQ3A 4LF8F 5KFBA 4KBIA 4K4VA 4EUVA 4TU9A 4DJBA 3OHBA 4GO5X 5DDRC 4LRFA 3D7SB 3PYDA 4P2FA 4XDDA 3NBPA 3EGNA 2MKKA 4PEOA 2V6AA 4ZCMA 4O3QA 5I42B 1TP7A 3C6TB 4QIWD 4UUWA 1DURA 1S10A 2E5LF 2R8GA 1TV6B 4LT6A 4PYAA 5KT6A 1HWUA 2KM8B 3M9NB 3Q23A 3UD3P 3MM6B 4C48A 4N76A 2HK3A 9RUBA 1X9SA 3MCNA 1WC4A 4CWBA 1HBUA 5IV4A 1I5OB 2VL1A 1YJTA 5GAGU 4UOGA 2KI2A 3G8SA 1VYAA 2QSWA 3QGGA 4F36A 3CJKA 1BY9A 3MUVP 4DV5J 2DHAA 3OTDA 3QJJA 2W9CB 3M32A 4LFAJ 4LF2A 1YGYA 4OYAA 1TKZA 3E2EA 2IDLA 2E5HA 4Z2XA 3AODA 4USWA 3RTVA 4K8RA 2MZJA 5EWFA 5HMWA 1D9AA 1UP1A 5KFZA 1ZA1B 2VJVA 4EO8A 1QM9A 3H98A 5KFVA 1OYDA 1RWMB 3OFGA 4ZIVA 3TO8A 2HNZB 4ZOSA 2L3MA 3CULA 2FJEB 4I2PA 1EQ0A 3W8GA 2H4WB 3P8BB 2VBZA 3JB9k 1APSA 4JB8B 5L46A 2GVDA 2WOMA 1DLOB 4A8FA 1DBDA 5A8KB 1UFWA 3QBCA 4NL5A 4CNZA 2RVJA 3IGNA 1FWLA 2M70A 2GNKA 3AJ1A 3DRRA 3RG6A 2J0XA 1NK4A 2RMLA 3KLFB 2WVEA 4OLOA 2JEIA 3D2WA 5KG2A 2KKHA 1S9GB 1YJ9S 1G3OA 4NXNJ 3EVOA 2E29A 2RRBA 3ITHB 3R6LB 2QA4S 1LW0B 4K5RA 2MQOA 2JJ4D 3IR6B 2UVWA 4WF9Q 1QSLA 2D9OA 2UXCJ 2VB6A 2DNOA 1TAUA 2GW8A 4ECXA 2HAFA 3V81B 2ZM6F 2ZDOA 3OTCA 2F8HA 1B99A 4HI1A 5F0UA 1R3NA 1X60A 1FTCA 3FRZA 3DNCA 3ISNC 2VBWA 3CJ5A 2F9JA 4W92B 3NGRA 4LREA 2V2QA 3FDSA 3KDOA 1NKBA 1XMOJ 2VOPA 3MPYA 3IXQA 4A8WA 4ZVTB 5KFGA 2YNGB 1HQEA 2HVDA 3OTOJ 2EWHA 4NZ6A 3EGZA 4CM2A 2BE7D 4IOCQ 4DUYJ 1Q16B 2XWYA 4USJC 5B0CA 1D8YA 1T9XA 3HKWA 4OI4A 3RB0A 5LJ3Y 3IP0A 1IKXA 4PYDA 1RP5A 3V5RA 1WKLA 1NH7A 4QR1A 4DXLA 2E1CA 3PTWA 2LA4A 5CD4A 2QSFA 3QJLA 2XTJP 1LWEB 1TQLA 2UUBF 2MKYA 1SIZA 4EEYA 4IH7A 4M5KA 2UUAF 1WG1A 4QPXA 3KFWX 1SI9A 4DR7J 1VC0A 2BJ1A 4DQQA 2IDEA 2QLFB 1DQ9A 1VQ5S 4C8KA 5ETKA 2BJDA 1YG0A 4ZVFA 1ZAXA 4YR0A 1CC7A 2PMWA 3Q0AA 1EQMA 3G9CA 1EHWA 2ABYA 4CO4A 2KG0A 5CYMA 2HRUA 4LF8J 1FRHA 2PN6A 2CJBA 3CPWR 2G13A 2DRAA 4DI6A 4OJGA 1XK8A 4KR0B 2N4DA 2EK1A 4IYQA 3R1HA 1UL3A 2IRYA 3C2PA 2LDIA 1PBUA 4ZPWR 4KTQA 4UF4A 3G71S 3MECB 3TZWA 2AGPA 4OQJA 3ELHA 5A2QU 2E5LJ 3BYRA 1BLUA 3LF0A 4QQBA 1N52B 3GR0A 4Z37A 1RT5A 2W25A 2DH9A 2ZBRA 3T3FA 5HQMA 2JLEA 3CJ2A 1NPKA 3GP9A 3H5UA 2UUTA 4PQUB 3CMAS 1FVSA 1PG5B 1UFKA 3BGUA 3BKFA 2N3OA 1RAFB 2KHCA 3CIZA 2MLYA 1RQ0A 3EE3A 1PILA 4LSLA 3C46A 2HW3A 1UW9A 1TKXB 1OS5A 1R27B 2K8GA 2HNDB 5KFEA 5B0AA 2LYVA 3IA0A 1DTTA 1IWAA 1NMEB 2HPUA 5C25B 1KOHA 2Z56B 2OMOA 1IQZA 4B3RF 3TUZC 4PWDB 2QLBB 1SH2A 1FNXH 1PSDA 1SC6A 5KG4A 1SCJB 5HP1A 3CO9A 3KJVB 1Z1ZA 1RTJB 2BJEA 2PA3A 1WG4A 4CM0A 1X8DA 1W26A 1R8HA 3CNQP 1VC5A 2H4YB 2MQPA 3MTJA 1JJ4A 1U4BA 2VFVA 5DETA 4ELVA 2WW8A 3MXHP 2OAUA 3SEOA 2DNPA 3ZNJ1 3FEZA 3B4DA 3TYTA 1ZYQA 2J6TA 1HNXJ 5DS7A 2Y1IA 4O4GB 3NMAA 2CZ4A 2HFNA 4FYVB 3FFIB 2EXUA 2I5JB 3NOCA 3D1HA 4M5MA 4N77A 4Q0BA 2YQ0A 2DPJA 2YX7A 1H74A 1CULB 3N0VA 2ZM6J 1WKKA 2L9WA 1TL7B 1IJFB 2APOA 1R6VA 4F3OA 1PKUA 5GAEU 4IG0B 2DGUA 2MLXA 1C4AA 4L75A 1NSAA 4RO0A 2GAGC 1ZAWA 4DU7A 2KRRA 3SQGB 1UEVA 3IWLA 4CCHA 4ILMA 2J0WA 3FVYA 3OD2A 4O44B 2DHHA 2OMLA 1BD6A 2JLGA 5L1JA 5F8HA 2CADA 4DZ6A 5FLXY 3D1QA 4Z7YA 5DM7Q 3J80U 1CLFA 1QJHA 4MTPA 1FE0A 3A8JA 2N82B 1RAHB 3MM9B 4CO5A 1FEHA 2UUBJ 4IOBA 4Q45A 3M6VA 4N47A 4N41A 4KYZA 1SKSA 5GADI 3CTRA 4OX9F 5LM7E 1T9TA 4QBUA 3QIDA 3U7JA 3J81j 3K8WA 4CNYA 5A8RB 3LAKA 3CJSA 3VAHA 2CA9A 1OMSA 2ACYA 3OJUA 4WIQA 4I2QB 1T02A 3GMGA 4MFBA 2V2ZA 1C0TA 4X4PA 1SL2A 4I69A 2FPHX 2UXBF 1CS4A 4RL1A 1IKWA 3HD1A 4A46A 4QR0A 4R5PB 4H4KC 3M6XA 1HNZF 2MQNA 3MCMA 2Z57B 3I0RA 3Q24A 4YMEA 3MAQA 1FKPB 1U48A 4NZ7A 2KZZA 3R97A 2K7JA 1KQFB 1RDRA 4DX6A 1Q81T 2XMWA 4DMZA 1DJ0A 1WEYA 2HS4A 2V68A 1Q8KA 4ZHRA 3JSYA 3FSYA 4MIBA 3DLEB 1IBLF 1HBOA 2FC8A 3Q8SB 2IJFA 2BRKA 2W1BA 3HT0A 4LIRA 1CEZA 2OD4A 2QL9B 1IJEB 1MWQA 1SV5A 5I42A 2XMKA 2HQFA 3C6TA 4I7FB 1MMLA 2FHJD 5DZ6A 1V3RA 1JXVA 2M9KA 5E33A 3MPUB 1U1KA 1TV6A 2BW2A 3OPKA 4B3RJ 3DU6A 2YBVA 4WFAQ 4ED6A 4IQMA 4XIUA 1LW2B 4KFBA 1MU2B 2CQGA 2R7UA 1HBNB 3CJQA 1Y5IB 3K89A 3D6FB 2GAHC 2GQCA 1QAXA 2FJVA 2Z2ZA 2K7KA 3MMCA 3LO3A 1R8PA 2BA9A 3A8KA 1LXNA 4OJ1A 4DHVA 1Q0NA 3DLKB 4P6QA 2GMLA 2OELA 2RDIA 3AA9A 2V94A 1M5OC 5B7WA 1RWOB 1ZPVA 1WHVA 3AJDA 4DX7A 4WFYA 2DGSA 1IUJA 3K58A 2PC6A 1F2GA 3HMJG 4LVNP 3BF4A 1U45A 4ECQA 4RUBA 3QJPA 4H4MB 1TAQA 5J2NB 1K1QA 2JFDA 1SJRA 2R9LA 1XBWA 3O6QA 2HNZA 4QIFA 1SQEA 3QT6A 2WK4A 4EBCA 1IM4A 2JVOA 3LPEA 1VQ4S 3PIOQ 3G86A 5L1LA 1VS3A 4F25A 3M6WA 2EFQA 2CQ1A 3GSDA 3MURP 3UD5A 1H98A 4URSA 5IC6B 2VQFJ 3SBMA 1DFDA 3CF5Q 3DRPB 4YOEA 1HNIA 1DY3A 1RWVB 2ZVSA 3OBIA 2RH3A 3ZTSA 1UWBA 3AQPA 3HT3A 4LR8A 5C2CA 1VC6A 1UETA 1N5QA 1S9GA 2PIIA 4P2SA 5I3UB 3ITHA 1ZAVA 5G0RA 4CIOA 4OJ3A 1SXLA 2XBPA 3R5GA 1FRMA 1T0TV 2CVIA 2W2OP 2N7CA 4JI7F 4DR1F 1K8AT 1RAGB 2ZHAA 5H9FK 4R0EA 2CDRB 1RTDB 2Y1JA 1PC5A 1B7YB 2C28A 4X4OA 1GK8A 4ZCKA 4F04B 1JLCA 1NDLA 4PUOB 1VK8A 5L1KA 2EPIA 1AROP 1VISA 3EX7B 2BMBA 1WC5A 4DDFA 3N01A 3J7A1 4OHXA 3K59A 2PT0A 1HQUA 5C5JA 2CPIA 1J27A 3MM5B 2D3OR 1NJWA 3C15B 2B3TB 4OX9J 1G4CA 2GO9A 3VAMA 3OJSA 2IC3B 3JSBA 2MZSA 2KRBA 4KT0C 4NPOA 2HLTA 1CJVB 1RT7B 3GYXB 2JEGA 4WE1B 1URRA 2ZH6A 2E5GA 2YNHA 1RAAB 2ZHBA 2CJQA 3DXSX 4CLTA 3GIIA 1HIYA 5F8GA 3HPOA 3GU0A 2K1RB 2UXBJ 2OHDA 3MEGB 1X4EA 3NG8A 1Z4UA 3KK3A 3BSNA 3C66A 5F41A 2M3DA 3MUMP 2BE9B 1HNZJ 4P52A 3RW6A 1RAIB 3W7BA 3F44A 2D3O1 2RUSA 1LOUA 4B3MF 5KFUA 3CCMS 2EK6A 2CJAA 5A76A 4G1PA 2MGZA 1N8RT 1X5SA 1DHMA 1RE1B 4YY3F 4EBDA 3I82A 2B9YA 4DV6F 2ZE2B 2HHUA 1F9EB 1T3OA 4B3TF 5HI7A 3UDVA 2JVRA 2Z30B 3JS9A 1JWWA 1IBLJ 2XLKA 4RWWA 4JI2F 1S1TB 1YRTA 5IM0B 2HFZA 4NLSA 5ETOA 1Q5VA 3K57A 1RHRB 5CYQB 3OQ2A 4YB7A 4DSIA 3MECA 2J9EA 3DM2A 2WSFC 1ZTWA 2C2RA 2B9XA 5CQGA 4PWUA 3CD7A 3R7NB 3FZBA 1L3VA 3VAFA 3GG0A 2V2KA 2KT3A 1KS2A 3TEHB 1FHTA 4NLQA 1IWGA 2QA1A 2Y1LB 3N6MA 2AV5A 4NA3A 3GE9A 4MYUA 4PKDB 2JC0A 3N79A 2GFFA 4DCOB 2W9AA 2ZNYA 2XMVA 1NPPA 2X1BA 2HNDA 2AT1B 4HACB 4K7QA 2ROGA 5H9FJ 3CO0P 1VRQC 4U7UK 4ILRA 4P2MA 2H65B 5RUBA 1CVJA 4DX5A 2B0GA 4OZ3A 3T1HF 3PW5A 3DOMB 1Y9OA 1Q7LB 2M7SA 2XGQA 1H0HB 1X0FA 2E44A 2PFDA 5J1EA 2HYIB 1UA0A 2G2ZA 1U1LA 1VRTB 4DR2J 4ECTA 1FJ7A 1Q7YT 2CZ9A 2HIYA 4NRUA 1T3NA 3CDBA 3HHDA 1TL5A 3KJQB 2NXJA 3Q8QB 3K0JA 2NYIA 1JLBB 2HHPA 4NWBA 4A4JA 4I1TA 4Q44A 3HO1A 2DGOA 1V9OA 1U25A 3RU0A 3DLLQ 1OWXA 1N34F 2O67A 1N5YB 3HFZB 4A47A 2KHDA 1U0HB 4LBHA 4LIWA 2NXUA 2KJVA 3IWXA 1J5OA 4O4GA 2W2MP 2R7XA 3ZTPA 4USTA 2AYEA 2HZVA 4XPEA 2UZAA 2DRBA 2OO4A 3FMWA 1TZ0A 3ZFVA 2I5JA 4M63A 2CG4A 3TA2A 1CJUA 2Y8WA 4L73A 3ENWA 2POKA 3EVWA 2QL5B 2XY5A 4DR1J 1FWKA 3PJXA 2W8KA 2W24A 5U47A 2OTLS 4ED2A 2GMHA 4K5SA 4N5SA 4RW6B 4PQAA 2WCXA 1CJKB 4PABA 2BJ8A 4HHUA 4DL6A 3M8YA 3L7PA 4F50A 1FJCA 3ULHA 4R0JA 2CKWA 3HHLC 4EGLA 1HI8A 3SQGA 4ZJQA 2GCFA 3W2VA 2GHWA 1KOOA 4LFCF 1QVFR 3KUEA 5ETSA 4I6WA 3QFWA 2RHSB 4X64F 3JSRA 3T1YF 1KKHA 3GG1A 1VQOS 3KUHA 1HWLA 3BQ2A 3I6PA 4UW2A 3ISND 2YXLA 5L39A 3TA1A 2G1DA 2IAJA 1BQMB 1B3TA 4A48A 3TNVA 2W01A 1DTQA 4ED4A 1D9DA 4NLWA 2DD8S 1N54B 4OX7A 2GS8A 1U6FA 1S99A 2B6AB 4OHYA 4WKRA 5DGBA 4DFJA 3O2IA 2EKYA 4B3MJ 4DV3F 1WDTA 1FRLA 4NI2A 4DWIA 2Q3PA 3M2UA 4ZVQB 4U7CA 4O3NA 4YY3J 1GMUA 2Z8QA 2W8LA 3AA8A 1BMQB 2AZ1A 4I2QA 5KFSA 1GXUA 4DV6J 1NK9A 1LEOA 3PDNA 1M0SA 3IR5B 3CCLS 2CUYA 4B3TJ 1VK3A 4CYUB 2KFZA 5HK4A 3HFVA 4OZJA 5F8NA 1M5KC 2YKNB 2V50A 4YQWA 2LFVA 2ACMA 4WTOB 1FRKA 2R7WA 1AZSB 3GIRA 3VWSA 2EFGA 3B4MA 1FKPA 1F3FA 4NX9A 2YPZA 4GVLA 2JHEA 3CJ3A 1RT3B 2ASLA 3FC9A 2LCWA 2GA7A 4EBEA 4WYWA 3TZZA 5E5NA 5KFAA 2CDQA 2HFUA 1YVFA 4LQ3A 3AT1B 2WW4A 3FQLA 3DLEA 4C7QA 2HHTA 1AB8A 2DISA 4JV1A 4I6YA 3UQSA 4R25A 3M8QB 1YJWS 4JI4F 4KJIA 4Y2CA 4N8OA 5LSOA 4F2RA 4Y2KA 1FKOA 1GNKA 4IR1A 5J2PB 3BR8A 2C2MB 2C42A 4URGA 1S1UB 1CG2A 5L9NA 3MR5A 2NZCA 1TK8A 4QZVB 4QWEA 3VGVA 2VASA 3NXZA 2YX4A 2R7SA 1WC1A 1UTAA 3I4HX 3T1HJ 2R7VA 1P6TA 3H5SA 5LXYA 1LW2A 2VFRA 2V4RA 3H2VE 4HH0A 5G4DA 1XNRF 3AFGA 2XS7A 5A8WB 4LF7F 5LL6d 4ES3A 2GQ2A 2QT7A 3DOKB 1WHWA 3LGNA 2E9ZA 3SCJE 3MD1A 3W61A 2EG1A 3EWGA 2QG9B 4ECRA 2ZUGA 1TUWA 3KKFA 1YJUA 2GMJA 1RT2B 2BJ7A 4NLGA 1N34J 1UA1A 2W7AA 1WC0A 1ZM2A 3RAMA 2Z58B 3FBCA 4ZLNA 4A8YA 2OGUA 1Y3KA 5I3PA 1YDLA 3ENVA 3KG1A 1NHUA 4PG6A 5D0RA 1I94J 3QGPA 3GV7B 5D3GB 3NWRA 5FDLB 1D8ZA 2LEPA 2B8PA 2DNNA 2RAQA 3BKUA 5DDPC 3UNYA 1RTIB 3T6JA 4NLXA 3U1LA 2HRYA 1JLAB 2GJIA 2QJ3A 3DRPA 4RNOA 3D6HB 2Q79A 4WPAA 2V9KA 1NEEA 1L5UA 3C14A 1YX2A 1OYEA 1RHQB 3FQKA 2FLPA 3OL8A 4YDDB 2NXEA 5HBMB 4LFCJ 3D67A 1W7WA 4QWDA 1OJ4A 3K7RA 4CH7A 4X2BA 4X64J 1U8WA 3T1YJ 2FVPA 3TJAA 1FDNA 3AXMA 1RTDA 3I96A 1H2UX 1Q8IA 1P27B 1XERA 2CPFA 2IBOA 1UZDA 2AJ1A 4C9DA 2E5JA 4FKXA 3NOGA 2BEFA 3OXGA 1U49A 2IMWP 5KFJA 5IT9Y 1AA1B 1VQ7S 3MM5A 4OFZA 3CDEA 1SC3B 3OFEA 4MK8A 3NL0A 4HTIA 3VQSA 4ZPTR 4DV3J 1RJJA 1NLKL 4H4OB 1RTHB 1VQKS 1RYRA 4ECYA 2KT5A 3S7RA 1CJVA 1S6PB 2FLLA 1N4LA 2G2YA 3DDKA 3SDEB 1IKVA 4KGXB 3EPIA 4DR5F 4DPXA 4QYZJ 1FI4A 2H48B 5AXMA 3FUYA 3ILLA 3P5BP 3UWTA 4K59A 3LQVA 3D6MB 2ZKUA 2ZH4A 2ZBCA 3HLUA 5ETTA 1S1WB 2FYXA 5GVQA 1X31C 4KH1B 5GADU 4KIAA 1DAXA 1F2HA 1IKYB 4TQSA 3EZ5A 3PCOB 4HDGA 1S6QA 1XIQA 5LXRA 2IIHA 3PVXA 2HZCA 5J2MB 2NREA 2HHXA 1S76D 3VVTA 2DR7A 4ED5A 3TAPA 1S9EB 3DHXA 3BH6B 4NASA 3UPFA 4JI4J 2OEMA 2CPZA 4C97A 4X4TA 3P49B 2YVSA 2PDAA 3CCTA 4K2JA 3C6UA 1PAUB 1U2FA 4RUHA 3RR8A 3LWMA 1VRUB 1WDDA 3PJ9A 4J9KA 3HHLB 4H54A 1VIOA 3GYGA 1PO6A 3NGKA 4Q8FA 5KFYA 2YWFA 4QIGA 1GX6A 2X3GA 3PRDA 2RDJA 2VA2A 2I0XA 3RBZA 1JLEA 4DQSA 2NYHA 1XNRJ 3V6DB 3CCWA 4DFMA 3HSZA 2AX0A 4LF7J 4DSLA 4R8UB 2XCAA 2PEHA 2WBMA 1E6VA 2DH7A 4C3LA 1OQ6A 4UY8T 4Z7CA 4HACA 4TXSA 3M8PA 2ZJPQ 4KKOA 1FX4A 4M8LA 3DRSA 1MWYA 1X4HA 4ZP8A 4ED1A 2GGPB 3TZXA 5K20B 3DOMA 1YITS 5KT2A 5DQGA 3H5XA 3VHQA 2J0QD 2VV5A 3MZIA 3R3TA 4NYOA 4ERDA 3MOZA 5IQ6A 3DHWC 1JLFA 4OI2A 4EWTA 1BHNA 4IFYB 4OYWA 3LP1A 3HZGA 2YH0A 3OT9A 2O01C 4UT4A 1HR0F 4WU2A 3KG0A 3OVBA 4H4KA 3CDUA 5CYJA 4LF4F 3K2YA 3TAMB 4MH8A 5IS2A 1FEEA 2OPPB 1Z2ZA 3GZ7A 4A8SA 3K5OA 1N5YA 4HEA9 1FESA 2GZOA 2QFJA 5DQHA 4TY8B 2J0SD 2HQGA 2VG7A 3RGIA 3MM7B 2WVBA 4CT8A 1U26A 3Q8YA 5KG3A 3SV4A 4X4UA 1J5EF 5D15A 4J9RA 1VQYA 4ED8A 5KFLA 4ZJLA 3WBZA 1UW4A 2N3LA 1KTQA 4AT1B 4LF5F 1R0AB 2KZMA 1RADB 5HJXA 1TTHB 1FF2A 5I3QA 2CQ0A 2VBYA 2J8AA 3T5LA 3TRGA 2JOQA 1CJKA 1WUUA 3M30A 4PG8A 2OPQA 2BOPA 4NA1A 3G2XA 2MQMA 1U1PA 3BDEA 2EFVA 1JJHA 2ALZA 2J6UA 2XHCA 3LTOA 3IS9B 2GVZB 2Y1RI 4DU8A 2YWWA 3A4TA 2Z2MA 4ANDA 2IRUA 4IO1A 3KLGA 1RAEB 4DFKA 4XK8C 3O3LA 3ZNUA 2Q66A 4CZCA 1IR0A 1A9NB 4ZVRB 4ZVHA 2V4QA 1NHKL 2XI3A 4TLQA 2XHWA 3VQTA 2DCLA 1NJYA 4DR5J 1BQMA 1WSVA 4I64A 3JSMB 2VFUA 4C2MA 3B82A 1WF1A 4OI3A 4LR9A 3B54A 4UOCA 4LSNB 5IQQA 4NCGB 3RRHA 3QRRA 3MUTP 2GHVC 4IG3A 5K14B 4XTTA 1VJWA 2V8VA 4HT7A 2E1PA 2EVZA 2JRSA 5C42A 1NK5A 2NPIA 1OY6A 1C0UA 3BZQA 3LWLA 2A18A 3TW0A 1QUVA 2CJYB 1JLQA 3R9LA 2BOAA 3CD5A 3T5JA 1T03B 4RPFA 2X3DA 2FB0A 1MN7A 2KVQE 1R8CA 4K4XA 4LRBA 4O3SA 1C4CA 2DR5A 2H51B 1RSCA 2QRRA 4EYIB 1RT3A 2OSRA 4CDIA 3EZUA 4PZVA 4MKAA 1SIWB 2D69A 5A2QY 3W9IA 2PGCA 2DNGA 4QWBA 3POTB 4LSZB 4EFAC 5AJ3F 1JXEA 3F41A 4S0MA 2A10A 2XSFA 5H1SV 4A8OA 2OTJS 2KB2A 3M8QA 2F8EX 5H9EJ 2UVUA 2E1AA 1DQ8A 3MF5A 3IR7B 1Q5YA 3QT8A 4JI5F 1HHSA 3JYTB 3R5BA 1T95A 5LMUF 3OSNA 3I5AA 4KH0B 4BHQA 2B4VA 4RW7B 4N56A 6FDRA 2YWHA 4M95A 4X4NA 1UVKA 4A8XA 1P8GA 2HVHA 1YZ6A 2DGXA 3RRGA 1RISA 2AKWB 2VZ9A 3UCGA 2JZ5A 2U1AA 3EXYA 4B9UA 3R6GB 2NUHA 2ZOGA 2FHOB 4JI1F 4F3QA 2HQCA 3SZ2A 2XC9A 4Q8EA 1HR0J 3D9BA 5ETQA 1T9UA 3H7HB 4LUBA 1B7FA 5HVHA 3BGOP 1HQ2A 4LF4J 1FK9B 1FXRA 2FHMA 5A0YB 4LQ9A 1RT2A 1YIJS 4YB5A 1PCAA 2YNIA 4NCAA 4TN2A 3DGPA 2R2UA 2RDDA 2K2PA 3AB2B 4B17A 3L9ZA 3W2WB 3VTIA 1NXIA 2H5JB 4YR2A 2K3IA 1J5EJ 2JSXA 3NGDA 1HW9A 1UVIA 4I67A 5HVFA 3GCWP 3QRQA 3IRXB 3L7OA 4MYTA 3HD2A 3FBFA 4J9NA 2MKHA 4LF5J 1JLGB 1ZPWX 3DRYA 4M5JA 5BJRA 2G0JA 1RTIA 2J76E 4CO3A 1MMDA 4V1Ak 3ZC4A 1JMTA 3W62A 4C8NA 4I68A 4DQPA 3S01A 2DHXA 2LU2A 2BQUA 1HPZB 2FY1A 2C2DA 4RBUA 1M5PC 1U6BA 4GVBB 3CW2C 4QWAA 2CPDA 5C2GA 4FF3A 3H0PA 3M2RA 3UO0A 4RW9A 4TU8A 1ZBTA 1Z2LA 4YB6A 5HBMA 4FYXB 4WJBA 1HMVA 3QO9B 3OR2B 3L95X 2HIQA 2WZ1A 1U1MA 2WVDA 2MHEA 2BZ2A 2OEJA 4Y34A 5C24B 1WF0A 4C11B 3A13A 2DXFA 1JJCB 1N56A 4MK7A 3J80Y 4OZ5A 2VG5B 4NEZA 4ELTA 3MDFA 3J7ZT 2Z2YB 3IG1A 1KTVA 1FNMA 3EGWB 4PXBA 1NUEA 3MMAB 4DLEA 3IAM9 2BE2A 2ZZTA 1WOSA 1AT1B 3G8TA 3PX6A 3UDLA 3CD0A 3N6NA 3ONQA 3EYZA 3KLIB 3KWMA 1HBMB 3M1VA 1SUQA 1X4GA 1BE4A 1S6PA 2AEJA 4C8MA 2XCPA 2QLWA 2HBQB 5D0EA 1FDDA 4FP9A 2M2BA 4RU9A 1IR2A 2AJ4A 1U24A 3OV7A 4PR6A 1HYSA 2Q43A 2JEJA 4F8RA 3A8EA 5KFPA 4DR6F 3K17A 4J9VA 1S1WA 1M1KT 4AXJA 3CUNA 5T7LB 1T8EA 3Q2TC 2RQKA 1U09A 1C1BB 1IKYA 1VR6A 2QTWA 2OPSB 3DLJA 5CA5A 1OSCA 4AE5A 5B0DA 1EAYC 2AP6A 4ZDNA 1OPIA 4Y6IA 1GTHA 3VR1A 2NQPA 1FFGB 3IAS9 3PYFA 5EHHA 2RF2B 4NLUA 5KFFA 3MHYA 1RWNB 5AJ3J 3C3LA 1HI0P 3J81Y 2DBBA 1YRUA 2Z4PA 1T9WA 2YNFA 4IQXA 1H7XA 2LKZA 3DFEA 2R2RA 1KVJA 3A12A 5KFXA 2MSTA 3WZ0A 2MJUA 3KJNB 4B9NA 5BYSA 1QSSA 5D78A 4FPIA 2HWHA 2M88A 2RB7A 2XSJB 1SKUB 2ZDPA 3ENAA 3OXFA 4ZVEA 4JI5J 5HJYA 5LMUJ 2IM3A 5DM6Q 1JKHB 4TQRA 1EB0A 1VRUA 4FYWB 3LP0B 4ECUA 3HHLA 3HVRA 4L3NA 3WX8A 1LK5A 1KHVA 4RNNA 2VPXB 4OYXA 3I32A 4OYOA 7FD1A 4GC6A 2QV6A 4LF6F 3TQEA 4F0MA 4DPOA 3R2DJ 2A2CA 4K4SA 1NZ8A 3W5YA 2NLWA 2HFOA 4WKYA 2HHQA 1MNEA 2HZAA 1FCAA 2HLUA 3MFHA 4X4QA 4JI1J 4FXDA 1Y7PA 2AJ2A 4LRAA 1VLYA 1PAEX 2KTQA 1X5TA 4UOHA 1NJXA 3OTEA 5L1IA 1Y3JA 2HHWA 2QE5A 2C2KB 3R5DA 1TK0A 2QLXA 2KN4A 4JYAF 1F0XA 1X4DA 3Q8RB 1G6BA 2DR6A 4YHHF 1S1XA 2NXCA 1KVIA 3GFYA 5LMNF 2FUG9 3UR0A 4ZPCA 2BKOA 2IJRA 3I55S 3G4SS 5KOWA 2DIUA 2ZH1A 4IFYA 2CQPA 1FA0A 3D3BJ 2LA6A 1RYSA 3VF0B 2IMOA 3V4IB 3I0SB 4WP9A 3W5ZA 4DV1J 4NYPA 4O3OA 3BSOA 1IQTA 4OL8A 3M7VA 2DYAA 2H5EA 1VHIA 1WELA 5EGYA 4LRDA 3OW2R 4XPCA 2JH3A 3TAMA 1T7PA 3BO4A 2OPPA 1QSYA 2CZVC 2QZ8A 3HVTA 3SCKE 4C0BA 4C0OC 1NCLA 1G7CB 1U1OA 3Q89A 3MM7A 1CQNA 4DR3J 6AT1B 1FRXA 3PG9A 4IFVA 1XR7A 2ZOMA 1VLOA 1ZS6A 2J7WA 5SUHA 4NCBA 1TELA 4GO7X 4DPYA 3EDRB 1HI1A 2ASYA 1PC4A 3PYGA 5GMDA 4OV6A 4YUDA 5DGAA 3WDOA 3QLHA 5AE2A 1WEZA 3NS5A 3MAAB 5DZ7A 5GMKa 1FJGJ 4W90B 2MEWA 4U67Q 4U9RA 3HDSA 3PW7A 4DL3A 1C1CA 3MEEA 4O4RA 1G2EA 2HURA 4ZK7M 4RU2A 3W9HA 2ROEA 1NNDA 1RA7A 3AJ2A 2DB1A 5DDOC 2U2FA 4DL0C 3R5JB 5M2PA 2B56A 3IM8A 4WK1A 1RHJB 1H2TZ 4TY9A 1L3KA 4DX8H 1FDBA 2C2ZB 3PW0A 2C3YA 3ZTQA 4X65F 2R7RA 3CC4S 2R2TA 4ICLA 1HNXF 3JSMA 2ZUAA 1FVQA 2O5DA 2RUGA 4DR6J 2BQRA 1YI2S 1KBRA 2K3KA 3RB6A 4LSNA 4A8MP 4TVAB 2DRDA 3SCIE 5FD1A 2YQ1A 2F1FA 4USMA 4USUA 3MEKA 2VHGA 4OJHA 1B64A 4JOUA 4RKUC 3P96A 3KDNA 3PX0A 4WYLA 2KL8A 1KEKA 4J90A 4C0HA 1GT8A 5CZVA 1NH8A 4UQTA 4PCQA 4QYRA 3W9JA 1T05A 1HWKA 1K9MT 4DLGA 4QW9A 3BREA 5C7PA 3QATA 1K47A 2E1MC 3TX0A 5D6GA 2V69A 1VBZA 3MEDB 2IY5B 3IGVA 3JQMA 1Q82T 3AH6A 1VDHA 3BB5A 3MMBA 5J2QA 2BVZA 4AQYF 4C8YA 1FFWB 2I8EA 2BV3A 4X4VA 3AOCA 5K5MA 4LMZA 5THWA 3I5BA 3P5TL 4EMDA 2Y0SD 4LF6J 3MM8B 2WONB 3UVJB 3ICLA 1RLDA 4OYPA 4RNMA 5F8IA 2AX1A 3ZTOA 1XWLA 2KO1A 2HMIB 5KOXA 2VBXA 5IZHA 3PY8A 4TU7A 5ITHA 2QFIA 4USIA 1Q78A 1T9YA 3IBFB 2D74B 4RW7A 3K5MA 4JYAJ 2V0NA 2IYGA 4WZQA 2XEXA 2LXFA 3NBPB 4YHHJ 3TVZA 5LMNJ 4FNIA 3CCSS 3UN3A 5KFWA 4WCEQ 1UJ4A 2NR0A 5DQIA 3MOJB 4P72A 3Q8UA 3HSGA 2FJBB 1NDKA 1ZM3A 3VVUA 2CFXA 3DOLA 3PO5A 2IA0A 2HFSA 3PKYA 3GILA 2AF6A 1BQXA 2QA2A 3HI9A 4QIVA 3T9NA 3ZZUA 1Q1KA 1HBUB 1U47A 1I6JA 4OZLA 2ZD1B 2FJXA 3EJMA 3C8YA 2A0FB 1QAJA 1A7GE 2E7VA 1TUVA 2OEKA 1QE1A 2EW9A 1U8SA 2ALYB 4C3MA 4PWWA 3CJKB 1RXOB 2MTLA 2AU0A 3TX8A 7AT1B 4M5NA 2MZTA 3AAWB 3W63A 1MN9A 2V63A 1K1SA 2YKMA 4FYYB 5B0FA 3D28A 4CLFA 3TQ1A 2VC0A 2CNKB 2J5AA 4ZPVR 2M4MA 1WOOA 3TOQA 1BWEA 4HR2A 3D0GE 3TEGA 3FCVA 3FK4A 1FD2A 3HP6A 3S6EA 3OL6A 3TVYA 3MAHA 2R8JA 4FKYA 5JUMA 4A8KA 4KO0A 3EXCX 2OIHA 1RU1A 2DH8A 3GR1A 1LWCA 5DG8A 2J7UA 4NLTA 1U6ZA 1P9QC 1HPZA 3IN5A 2R4FA 3WC2A 2PFFB 1S4FA 2GVDB 2WOMB 4GVBA 5E3QA 4NYZA 3IMQJ 3KTQA 1RCXB 4CLLA 3V2UC 2HKEA 1YRXA 4ITSA 4AUKA 1F9HA 1P1LA 1MROA 1N36F 5D0GA 4FDFA 2DKOB 3DLHA 3BN7A 5C24A 1BWVA 2ERRA 1HWIA 2AYGA 4QWCA 4X65J 3DN9A 3R5AA 3CSKA 2VG5A 3D0HE 2IBKA 2MKJA 3PM9A 4EO6A 3DLGA 3UI3A 1SJ1A 3LA0A 3NS7B 5KG6A 4DSEA 4JV5F 1QDUB 2VC1A 3RBEA 1OY8A 3DKDA 2F4FA 1HBMA 2P9CA 3L09A 1RTZA 3LOUA 3RB4A 1YHQS 1KONA 4CLSA 1Q79A 3BM7A 2ZFHA 4Y2IA 4JV0A 1RABB 1KWMA 3KK1B 3U1NA 2VQFF 4PG7A 3QRPA 4Q2LA 2KM8C 2IJNA 1OQ3A 2V4JA 2PO4A 5SZTA 2BM1A 2VU5A 2UVRA 2UXDF 1IKXB 3HF5A 2RKIA 5L38A 3AOAA 3EGVA 2CYYA 2VF3A 2DGQA 2DEIA 1WJ9A 1WHXA 5LSLA 2QL7B 2YWKA 2DR8A 1MG7A 2PEBA 4E0DA 1GMWD 1RT6B 2VFSA 3PIPQ 1C1BA 2QIFA 3TVKA 4AQYJ 3O44A 4F4KA 2BANA 3FRYA 2J9CA 4ECSA 4IDKB 1KN6A 5BYQA 4UZCA 5KFNA 1O8BA 4U96A 2RF2A 2L08A 1D09B 4Y2MA 5IOLA 3RAXA 2HK2A 4DSJA 2LLZA 4ZPBA 4CLYA 1IN0A 2F9DA 2YTCA 1KHWA 2CJ9A 5CAAA 4CLWA 1LWFA 5T41A 3LP2B 2YWGA 2KG1A 5IFMA 2CJKA 2M8DB 2FZGB 1PBAA 4ZLLA 4FS2A 2ILYA 3LUYA 2CQIA 4DCPB 4TKTA 3M2VA 2IVFB 1JKHA 4FVMA 3ZXWA 2F40A 4DPUA 3GIMA 3LP0A 1SJQA 4BS2A 2MPUA 2FD2A 5L8RC 3QMQA 2CWXA 2UUWA 4ENOA 3CCZA 5F3ZA 1SH3A 1RGVA 2V9WA 3FSIA 5KFOA 3ZZ0A 2KDOA 2C1EB 2IFXA 3C16A 2DVIA 4O0IA 1N5SA 2HHSA 5JJBA 2KVIA 1RT5B 1JXLA 2BYCA 4FF1A 3CCRS 2X51A 3HCXA 2WSEC 1KQKA 1H3DA 4OV1A 4G1QB 3TANA 4G6VB 1S59A 1GAOA 1S48A 2AZ3A 3PJWA 3P3DA 4XO0A 2EBEA 4ZPAA 4LSLB 4OYMA 2WB4A 1RHMB 1T9VA 2F7VA 1B0TA 2R3VA 3J81U 1XR6A 4CLUA 2RRAA 4PXCA 1AUDA 2MKIA 1HL6A 3B8HA 4BBYA 1QAYA 5BXIA 1WTBA 1B70B 1PJ6A 3T1AA 2QX0A 5HP1B 4BC7A 4AXIA 4C3KA 1VOMA 3B6BA 4ER8A 4ED0A 1HA1A 4ZP7A 3TA0A 3H90A 5M2RA 4DS5A 1U0SA 1N48A 5EDWA 3ZZPA 2YKOA 4ATNA 1ITPA 3MM6A 1NK6A 5K8OA 1OY9A 3PR5B 2ZITA 5E3PA 4ZJOA 4DSFA 2ADCA 3QFHA 2FLNA 1H7WA 5IXUA 2HBZB 1AXQA 4ELUA 4LFBF 3KNGA 3GFXA 1DRZA 2HFVA 4ECVA 5GMEA 4F4WA 4WFNQ 2W9CA 1N36J 2RE1A 4M5DB 2D9PA 4O23A 2WVCA 1UVNA 3MR7A 5E0OA 3A8IA 4Q0BB 1KVKA 1FXLA 1Y4ZB 3MCSA 3FBBA 5F0WA 2VA3A 2HVEA 1X0PA 5JVGQ 1VQ9S 3V6KA 4G65A 2LP4A 2RQMA 1ZOTA 2W4CA 1WEXA 1WWHA 4P9SA 4DR2F 3CGIA 3IC1A 4F0HA 1YJVA 3H8YA 4QPTA 4F67A 4JV5J 3RZAA 2P6SA 3QQCD 4ES2A 4ZKAA 2ZKTA 3MI7X 2LDYA 2B4OA 3V4MA 1V5VA 1DLOA 1HLWA 2XM3A 5A8KA 3NGUA 4G3IA 1VBXA 3CD6S 4B9LA 3LW5C 8RUCA 2AEMA 2UXDJ 3KLVA 2BUNA 2BKNA 3KLFA 4DZDA 2XO7A 2B8QA 1GTEA 3QSYB 4HVZA 1LW0A 2MYFA 3NRBA 1Y00A 1DQAA 1JK9B 2FZKB 2VKZG 1FRIA 2F63A 1QAIA 1M90T 3I87A 5ADZA 3V81A 1RWKB 3SSSA 2ROPA 1H73A 2FGOA 1N5TA 1L3TA 4FNHA 2L41A 3G6VA 3MPVA 4GKJF 3BEGB 1S79A 4NEYA 1ZM4A 2YNGA 4Y2AA 3PFEA 3MEDA 4MFBB 4DN0A 1C0TB 4L6V3 3WQPA 1CS4B 4P10A 4EI2A 1IKWB 2G2OA 1KFSA 1N33F 1RK8A 4IR9A 5JVHQ 2HQ3A 5KT7A 2ATLA 3ET6B 3W65A 1Q4RA 4F4ZA 4J37A 3MPWA 1YJRA 1VQLS 1LWEA 3PNIA 3BSCA 3AD8C 3U1MA 5EN1A 4ZHRB 5F8MA 1G1XA 2Q6BA 5HMZA 5E3CA 1WOPA 3J7YI 4P74A 3UDEA 3P6YC 2NUUG 1KFDA 1HBOB 2OKQA 4TYAA 5MLCV 2AMCB 4UZBA 1QLNA 2VONA 4CP5A 5KFRA 3RAQA 7FDRA 2X1GA 4JI0F 2RILA 5DG9A 1SV5B 2GV1A 3P4UB 5DDQC 2B43A 2MXYA 3C19A 3FCHA 4EU0A 2B4PA 1PYOB 2BRLA 4ECWA 2XMMA 4P7TA 3KG4A 3R8YA 4Q2MA 1RBOB 2IYIA 3G8QA 3H4DA 1FNOA 4F7VA 3PW4A 1KQGB 4KFBB 2ZWPA 2O3DA 2R8IA 3SFUA 3TARA 5DG7A 3PEJA 2EG2A 2C3MA 1FD8A 2ZD1A 5FIIA 2DHSA 3LANA 3MMCB 1OPZA 4WZMA 1NK8A 2C22A 1ZZFA 5EWEA 4PQUA 3QIPB 5KFHA 2AWZA 4QOTA 4HKQA 2HS0A 4DF4A 1NJZA 1U1NA 4LBIA 5KFCA 4LFBJ 5KFQA 4FXVA 2BM0A 1TKXA 4FF2A 1RUSA 2DEJA 2FLOA 4N7TA 1HNVB 3P45B 5C25A 2DGWA 4RJVA 3OHAA 4DUZF 3QWUA 4PWDA 1S5ZA 3UD4P 1HWJA 2XYHB 2W2NP 1Q53A 4C98A 1K0TA 3KJVA 3LGMA 3SI8A 1B0PA 3NCPA 1RTJA 2K06A 2ZJQQ 1HW8A 1KRPA 1XR5A 5E41A 2H1YA 1FDAA 1HNIB 2DNLA 4WK3A 2EKNA 3M9MB 1NAQA 4KB7A 3EVMA 1UWBB 3GB0A 4QIEA 1TMMA 3UW1A 3TAQA 2JWNA 2OJ3A 1K0VA 4FF4A 2KXHA 2ZJRQ 2BR0A 2ZC3A 3OXLA 5G0RB 1NSQA 1KSPA 3JTNA 4DL5A 2J9DE 1SH0A 4HL9A 3ISZA 3KYLA 3TP2A 1A0OB 3UE2A 2A1BA 1NPRA 1D3WA 3FFIA 5KFMA 2OSQA 1JLCB 1F3VA 3HXMA 1I94F 1RWWB 3DU5A 3QAEA 4PPDA 3IO1A 2XYPB 1CULA 4ZN3A 2G4BA 2VUGA 1RI7A 4F3MA 4DPTA 1VQMS 2COLA 1TL7A 3FNNA 1HQUB 4DN9A 2HRTA 1YQHA 2HHVA 3WX4A 5B0EA 4PAAA 2MB0B 3QPIA 3J7AN 3KK1A 4LR7A 1XMQF 2EBGA 4IG0A 1QTMA 9ATCB 1TU0B 4DSKA 2ZBPA 4NE9C 5LSRA 4CH1A 3MFIA 4GKJJ 2HBYB 3L4BC 3AHPA 1LFWA 4NOHA 2YNHB 2I2YA 1TKTB 4JBCA 3T5HA 4NLRA 4KGVB 3MGJA 2YKQA 1RT6A 4O44A 3SQOP 2XZWA 4HHHA 4U6PA 3KK3B 1N33J 4MIAA 3HHEA 2DNQA 2L9NA 4USVA 2HS3A 2PSZA 2IM0A 2DNRA 4IDKA 2DNHA 2HBRB 1SB6A 5E3AA 2G0IA 3GJQB 4RUCA 4OYIA 2BJ3A 3MM9A 1Q95G 4L74A 1R6YA 2MQLA 4NLVA 5KTQA 2CG8A 5JXSA 3H25A 1RT1B 2MGZB 3MTKA 1S0NA 3LP2A 2PI5A 1XC9A 1TR0A 5AE3A 2C2NA 5KT4A 2IA6A 2RS2A 4NLPA 2BQ3A 1EETB 4D3HA 3D66A 5A8RA 1UKUA 3R2CJ 4O0NA 2XY6A 1VQ8S 2DK2A 3THPA 1HKAA 2VQEF 4JI0J 4J9SA 2ZBQA 4QCLA 2BKPA 1T11A 2VH7A 3CMQA 4F4YA 1LXJA 3DM2B 3M8SA 4DUTA 4R5PA 3G87A 3FKBA 2DTJA 3GJTB 1JB0C 2W2QP 2V67A 2X7IA 5IC4B 1BGXT 5EX3A 2C3UA 3HVWA 2EFNA 5DJBA 5F3TA 2ADBA 3IBWA 3M8RA 1WI8A 4B9SA 4G1QA 1KNZA 2DCUB 3Q8PB 3UCUP 2CPEA 2I1RA 1L3UA 2W4PA 4DL7A 4ALZA 3SXLA 1WSRA 1URNA 3BO3A 2UVVA 1RKJA 4Q7AA 2ASDA 3QZ7A 4HH1A 3KK2B 3HFKA 3VGSA 3SFGA 1UEKA 1SJ4P 5ETMA 2AJQA 3QGIA 2MSSA 3D4JA 2V8PA 3HULA 4I7FA 1O51A 2XLJA 1N0UA 1LQ9A 1X4BA 5J1EB 1KC8T 2UV8A 1YTYA 4WTYA 1HFEL 3T41A 4QU6A 5K8NA 3R7SB 3E3XA 3N9UC 1UWAA 2KJWA 1SBRA 4DUZJ 1MU2A 5BR8F 3NKYA 3DI6B 1HBNA 2ZOFA 4QYZK 2HVIA 5E3RA 2AEFA 4NLYA 1KQSR 4JV2A 4GKKF 4XDCA 1N6QB 1R8BA 2AW0A 3VAIA 1VQPS 1SJFA 3CDAA 1I51B 1J5OB 3RW7A 3DLKA 3UCZP 1XMBA 4M5DA 1GMVA 4GMKA 1WORA 4OHZA 3W1YC 3MR6A 2ATCB 2MJNA 3WIUA 4Y3CA 2FQQB 1CJUB 1SQFA 1RBAA 3RBDA 2PD1A 4PPZA 1EKSA 1UPMB 1S0OA 2FJWA 1Y5NB 4H4MA 5J2NA 4AL5A 5DLFA 1L3SA 2RJZA 1HD1A 2GIFA 4B08A 5HSPA 1S1VB 1FJEB 1YBAA 4J9MA 3EM1A 1I1GA 2HGLA 4CRJA 1KLNA 2BACA 3R5CA 2AHOB 3W2VB 1XMQJ 3GJRB 1MSWD 3PV8A 1RA6A 2D41A 3QAUA 1RT4B 4X4RA 2B7BB 2M0GB 1O5JA 2LQ5A 1R0BG 4EYHB 2RU9A 5I3UA 3HHKA 4UY85 1E6YB 4CT9A 2IAJB 4ZCIA 1DTQB 4OX6A 5CCLA 3G82B 2UUAJ 1CC8A 5KAKA 3PRVA 4PXEA 3F0NA 2CQCA 5CHCB 1UMJA 5A6WA 2XMJA 3DMJB 1D0EA 4PUOA 5EWGA 4G1IA 4MT1A 5K9FA 2EFPA 2R42A 1W2IA 1XN9A 2CPHA 4NI2B 5D77A 3K5PA 3M2UB 5EUHA 3ZZYA 3CT9A 4HLBA 4M5IA 4F02A 3CC2S 3C15A 2WVFA 4WFXA 4KGKA 4L76A 3MPDA 4L72B 2VDIA 1U02A 1NBEB 2IC3A 4BCAA 2IRXA 3A3NB 3MMJA 1SVDA 1RT7A 2DY9A 4WE1A 1KR4A 4W4MA 3ET6A 4YR3A 4DPWA 2VQEJ 3JAMU 2K1RA 2PA8D 2XWXA 3OTBA 4IH5A 3MEGA 3K8VA 4C8ZA 2P9EA 4B3SF 3FMBA 2ASJA 1VI7A 4ZVSB 2F65A 3NMRA 2OP5A 1C2PA 3HZEA 1WD6A 3BGLA 1IVZA 2NCKL 2A3JA 2FY8A 4OYZA 1YWXA 5KFDA 4Y0FA 1GH8A 3HSDA 3UR3C 4IKAA 1H6KX 3VAJA 2NSBA 2ZE2A 1FKOB 2J7KA 3U27A 4HDHA 1FT8A 4IRDA 2AGQA 1S1TA 4RBTA 4CO1A 5IM0A 4RR5A 4K2XA 3PHEA 1TVRB 1YBTA 5CYQA 2KU7A 1VQNS 4J7CA 4WP3A 2HSEB 2DNKA 3SV3A 4U8YA 3GCXP 2WAQD 1VBYA 1NRKA 3OLBA 1JX4A 1RLCL 1IBCB 5BR8J 5AE1A 4BLGA 3RRKA 3HKZD 3NNHA 3QIPA 3AD9C 3WIVA 1X9MA 3MR2A 3S1TA 4GKKJ 4MJKA 2YY3A 3BKTA 3I9ZA 1LK7A 4DG1B 3H59A 2KXNB 4WBFA 1NB7A 4B02A 2W7OA 3K5NA 4YEAA 2JNJA 4ZVPB 2P5VA 4ZPDA 2J6SA 4F4XA 4DV4F 3N6LA 3KLHB 2NXNA 2R7TA 1HNVA 1IBKF 3TZYA 3DCAA 4X84A 2RQCA 3TJ8A 1NKEA 1GQEA 2XLIA 2FGCA 3BSAA 3IRWP 5IV3A 1H38A 3N5BA
chains in the Genus database with same CATH topology
5CAAA 1B99A 3FKBA 4FKXA 3VVTA 5C7PA 2BEFA 2DYAA 4UOFA 2AZ1A 1S57A 3FBEA 1LEOA 3ZTSA 4DZ6A 3DKDA 1NSQA 3B54A 3VGVA 3NGSA 4FKYA 3EE3A 1WKJA 1HIYA 1BUXA 4ANCA 1NSPA 4S0MA 2DY9A 3Q8VA 3Q8UA 1NSKL 3BH6B 2B8PA 3FBBA 2HVEA 2DXEA 3NGRA 5BXIA 1EHWA 1NCLA 2CWKA 1HHQA 1K44A 4F4AA 1NDPA 1NLKL 1UCNA 3ZTQA 2DXFA 1LWXA 1NDKA 3DDIA 3Q86A 3Q89A 3VVUA 1NDCA 4CP5A 2DXDA 3ETMA 3EICA 1PAEX 4DI6A 1BHNA 4ENOA 1NB2A 1XQIA 2ZUAA 4UOHA 1F3FA 1WKKA 2HVDA 1ZS6A 3ZTRA 5CABA 2VU5A 3B6BA 3G2XA 3NGTA 3R9LA 4KPCA 1NDLA 3PJ9A 3BH7B 3ZTPA 3EJMA 3VGTA 1NUEA 1PKUA 3BBCA 1S5ZA 3FBFA 3PRVA 3VGSA 3FC9A 3BBBA 1B4SA 1WKLA 2NCKL 3ZTOA 1F6TA 1MN7A 4EK2A 1HLWA 4ANDA 1JXVA 4WBFA 3NGUA 4O0NA 3FCWA 4UOGA 3ELHA 1W7WA 1MN9A 4ANEA 3BBFA 1VYAA 3JS9A 4W98A 3Q83A 3EVWA 3ENAA 4F36A 1U8WA 1BE4A 3FBCA 3EVOA 3EMTA 3VGUA 1S59A 5IOLA 4C6AA 2B8QA 1NHKL 1NPKA 3GPAA 2AZ3A 3GP9A 1XIQA 3EVMA 3Q8YA 2HURA 4HR2A 1KDNA 3L7UA 3MPDA 3WX8A 4DUTA 3EM1A 3FCVA 2BX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAA A;  1B99 A;  3FKB A;  4FKX A;  3VVT A;  5C7P A;  2BEF A;  2DYA A;  4UOF A;  2AZ1 A;  1S57 A;  3FBE A;  1LEO A;  3ZTS A;  4DZ6 A;  3DKD A;  1NSQ A;  3B54 A;  3VGV A;  3NGS A;  4FKY A;  3EE3 A;  1WKJ A;  1HIY A;  1BUX A;  4ANC A;  1NSP A;  4S0M A;  2DY9 A;  3Q8V A;  3Q8U A;  1NSK L;  3BH6 B;  2B8P A;  3FBB A;  2HVE A;  2DXE A;  3NGR A;  5BXI A;  1EHW A;  1NCL A;  2CWK A;  1HHQ A;  1K44 A;  4F4A A;  1NDP A;  1NLK L;  1UCN A;  3ZTQ A;  2DXF A;  1LWX A;  1NDK A;  3DDI A;  3Q86 A;  3Q89 A;  3VVU A;  1NDC A;  4CP5 A;  2DXD A;  3ETM A;  3EIC A;  1PAE X;  4DI6 A;  1BHN A;  4ENO A;  1NB2 A;  1XQI A;  2ZUA A;  4UOH A;  1F3F A;  1WKK A;  2HVD A;  1ZS6 A;  3ZTR A;  5CAB A;  2VU5 A;  3B6B A;  3G2X A;  3NGT A;  3R9L A;  4KPC A;  1NDL A;  3PJ9 A;  3BH7 B;  3ZTP A;  3EJM A;  3VGT A;  1NUE A;  1PKU A;  3BBC A;  1S5Z A;  3FBF A;  3PRV A;  3VGS A;  3FC9 A;  3BBB A;  1B4S A;  1WKL A;  2NCK L;  3ZTO A;  1F6T A;  1MN7 A;  4EK2 A;  1HLW A;  4AND A;  1JXV A;  4WBF A;  3NGU A;  4O0N A;  3FCW A;  4UOG A;  3ELH A;  1W7W A;  1MN9 A;  4ANE A;  3BBF A;  1VYA A;  3JS9 A;  4W98 A;  3Q83 A;  3EVW A;  3ENA A;  4F36 A;  1U8W A;  1BE4 A;  3FBC A;  3EVO A;  3EMT A;  3VGU A;  1S59 A;  5IOL A;  4C6A A;  2B8Q A;  1NHK L;  1NPK A;  3GPA A;  2AZ3 A;  3GP9 A;  1XIQ A;  3EVM A;  3Q8Y A;  2HUR A;  4HR2 A;  1KDN A;  3L7U A;  3MPD A;  3WX8 A;  4DUT A;  3EM1 A;  3FCV A;  2BX6 A; 
#chains in the Genus database with same CATH topology
 4IH6 A;  3M8W A;  2DIV A;  4CI0 B;  1F1B B;  1DZ5 A;  2VPY B;  3EDQ B;  3M6U A;  1VRT A;  2B5J B;  1GXL A;  3TUJ C;  1MLA A;  1NDP A;  5B09 A;  2E7W A;  1U2C A;  4RW4 B;  4ZLP A;  1AYE A;  2WB1 D;  4X66 F;  1VIX A;  1JLB A;  3C14 B;  2ZH2 A;  3VAK A;  5EX0 A;  2IVY A;  1KLM B;  2LEB A;  1S72 S;  2H5I B;  4OX8 A;  3KNA A;  1BQN B;  1UZH A;  1U0H A;  1WI6 A;  2KXF A;  3NAI A;  4P7V A;  3HM9 A;  5H9E K;  4W98 A;  4YB1 P;  5HLF B;  3W64 A;  1RU2 A;  4FPR A;  1WC3 A;  3SSQ A;  2P6T A;  3X1L B;  5HAO A;  3UNG C;  5BYR A;  5HO4 A;  4C6A A;  3GV8 B;  1X9W A;  2OUG A;  4F26 A;  2F4V F;  1SQG A;  1N5V A;  1FE4 A;  1UVJ A;  1R43 A;  4E98 A;  3R1L A;  1S57 A;  4IRC A;  5I4M A;  4RW6 A;  3H20 A;  4NLD A;  4IO9 Q;  1IR1 A;  2N7Y A;  4F4A A;  3DRX A;  4QJV A;  4M1K A;  1T94 A;  3CCV S;  1NK0 A;  3A3P B;  1NK7 A;  1IKV B;  1TKT A;  5AT1 B;  4HI2 A;  1WG5 A;  3CCE S;  3D1O A;  2Q6C A;  3EZO A;  1REV B;  2J9D A;  4DR4 F;  1BC6 A;  3JQK A;  3CCU S;  5AXK A;  3U02 A;  3H5Y A;  4EZ9 A;  5HN0 A;  2AYB A;  4AYB D;  2DT9 A;  1UJ6 A;  2VFT A;  4JI3 F;  1RWP B;  2B51 A;  4KHR A;  4KC5 A;  1HNW F;  4ANE A;  2B7C B;  2MLZ A;  4B3S J;  1X7V A;  1S6Q B;  1RT1 A;  4RW8 B;  3ILI A;  4E8U A;  4IUF A;  1YSJ A;  1R0C B;  4C8L A;  5GAH I;  1S4E A;  3TUP A;  2B6A A;  5D4O A;  2FC9 A;  2M52 A;  4ZN1 A;  4J9U E;  5F8L A;  3HX9 A;  2BX6 A;  1EET A;  2D7S A;  1ZM9 A;  2MY7 A;  3W5X A;  3V6J A;  3LAL A;  2DNZ A;  3Q8V A;  2Y9H A;  5LJ5 Y;  2C3P A;  3AXK A;  5ETL A;  2B9W A;  1HHQ A;  1ULR A;  3C6U B;  2KH9 A;  1UCN A;  2M8H A;  4CYU A;  2I9S A;  5IWA F;  3KOA A;  2BJ9 A;  3UFC X;  3KHH A;  2KT2 A;  2YKN A;  1H2V Z;  2VKR A;  1AZS A;  4KPC A;  4JUZ A;  3GLJ A;  5D4L A;  3J7Y U;  3BQ1 A;  1RHK B;  1U7L A;  1F6T A;  3KHG A;  1JLE B;  4YP3 A;  2ZZM A;  3BS9 A;  1LFP A;  2ZH5 A;  3J7Z 5;  1E6V B;  2OFH X;  3EMT A;  3JTO A;  4ZVO B;  1NO8 A;  5MAO A;  2P2C B;  3TI0 A;  2N4C A;  4M5L A;  1Q8B A;  4NZ0 A;  3M8P B;  2VOO A;  3F56 A;  3OFH A;  2UUC F;  3KK2 A;  4KKO B;  2UU9 F;  3D5M A;  3JXO A;  2E9R X;  3DRS B;  4ZVU B;  2FJA B;  1M5V C;  2HGN A;  4HTJ A;  2JEF A;  3NGS A;  1QUP A;  3IBC B;  1ICE B;  1LNQ A;  3ILJ A;  5D4N A;  4RZR A;  2KYZ A;  5J2P A;  3GTY X;  4DV4 J;  2IVM A;  1S1U A;  1JLF B;  4Q5V A;  2ZH7 A;  2GHP A;  3OVS A;  1IBK J;  3R7B B;  3N5F A;  3G6X A;  3LP1 B;  4C4W A;  2FVC A;  4OI0 A;  3GFH A;  3Q2S C;  1EP4 B;  3GIJ A;  3DI6 A;  1XNQ F;  4FZV A;  3BH7 B;  1Y11 A;  2CQB A;  3QT7 A;  3Q22 A;  3BBC A;  5A8W A;  1N6Q A;  1UVL A;  1TKD A;  4USK A;  1YKW A;  5D4P A;  3DOK A;  4ZS6 A;  1Q86 T;  1V3S A;  2ZWO A;  3LAM A;  1X5P A;  3THT A;  1M5S A;  2V8G A;  4OHV A;  2VG7 B;  4X66 J;  2R8K A;  2JDJ A;  3EPG A;  1X4C A;  1GX5 A;  2D3Z A;  2OH2 A;  2CVE A;  4J5O A;  2CPY A;  1QY7 A;  3FEX B;  4TLR A;  4DCJ B;  2OLW A;  4JI7 J;  2RS8 A;  4KY3 A;  2CQD A;  3BGR B;  3PFO A;  3SSR A;  3ENQ A;  3CIM A;  4NMX A;  4RUA A;  2X1A A;  1ZTT A;  4NML A;  4DV1 F;  3GFZ A;  3M30 B;  3DDI A;  5D3G A;  3HVA A;  2OPQ B;  2B4U A;  5FDL A;  1S1V A;  3CME S;  4MAK A;  2F4V J;  5M2U A;  1I3O B;  2G9O A;  6FD1 A;  1F9F A;  5HQ8 A;  1JLA A;  3NNA A;  3KLG B;  5ETR A;  2AGO A;  1RT4 A;  4WP8 A;  2VPZ B;  4K4U A;  3SMZ A;  3GV5 B;  3K5L A;  4DR3 F;  2EI5 A;  2E7X A;  2DPI A;  2W2P P;  1RAJ A;  3KXD A;  2XG8 A;  3BBF A;  4F0K A;  3TWZ A;  3US5 A;  1S77 D;  1E6Y A;  3OL7 A;  5CXT A;  1SL0 A;  1F5B A;  4ZVG A;  3PKM A;  3GPA A;  3QNW B;  3G82 A;  3M8Z A;  1S6O A;  2YX1 A;  2HGM A;  4DR4 J;  5CZX A;  4DS4 A;  4J9L A;  4I56 A;  4DV2 F;  3DMJ A;  2CXE A;  2H3E B;  3M05 A;  4J9O A;  1HAR A;  3CJR A;  4IG3 B;  4KE5 A;  4K0K F;  4JI3 J;  1HNW J;  2LQB A;  2Z0G A;  4LRC A;  1FJG F;  2BW7 A;  5C42 B;  3GJS B;  2J8S A;  2DHG A;  2YWE A;  1C0U B;  3A1Y G;  4P75 A;  3ZZT A;  1FKA F;  1B0V A;  2MHN A;  5CH7 B;  2YPY A;  2NPF A;  1JLQ B;  1NB2 A;  4H4O A;  1RTH A;  4B9M A;  2OI2 A;  1ELO A;  1WC6 A;  3E51 A;  3FZ2 A;  4MIW A;  2PI4 A;  4JI2 J;  4RWX A;  2LEC A;  4YS2 A;  4MKB A;  2FHK A;  3SDE A;  2NZ4 A;  1XJW B;  1R89 A;  1S7I A;  2DIT A;  3KUG A;  2JLF A;  1RAC B;  2VD3 A;  2A2D A;  4QR2 A;  4I0W A;  1IBM F;  3KLE B;  2RIJ A;  2AIR B;  5IWA J;  2E9T A;  3Q83 A;  1SPB P;  5FLX U;  3T19 A;  1VFJ A;  4E2F B;  4FBU A;  1WHY A;  5HQL A;  2RRN A;  2O1P A;  3IFE A;  2HAI A;  4OI1 A;  3NP5 A;  4ED7 A;  3OUY B;  2ZNZ A;  1XEZ A;  2VPW B;  4ETZ A;  5J2M A;  4ANC A;  4HT5 A;  2MKS A;  2DY1 A;  3AD7 C;  1AUS L;  2XS5 A;  4L3K A;  5L9X A;  3VZH A;  1RWU A;  1S9E A;  1X4F A;  2FVR A;  1KP6 A;  4ES1 A;  2UUC J;  3VAL A;  1X5O A;  3IWN C;  4NLO A;  4ZIW A;  2UU9 J;  1U1Q A;  2QYC A;  1Y0H A;  2I6W A;  4KHM A;  1TVR A;  1QVG R;  4WII A;  2E1R A;  4AL6 A;  1TL3 B;  3VGT A;  1CPZ A;  1CJT B;  1WAC A;  4KQZ A;  3CVK A;  3L3C A;  4OZ2 A;  2YKA A;  1RHU B;  2PMH A;  3GON A;  2ZBI A;  2CRL A;  1SKR A;  5CD4 H;  1NZA A;  3GWC A;  3I5C A;  1FRJ A;  3ZZR A;  3E01 B;  4PXD A;  2V2V A;  4DQR A;  1XNQ J;  1RWX B;  5E2Q A;  1SC1 B;  3QZ8 A;  1W2B R;  2BAB A;  3V6D A;  2AD9 A;  1YBU A;  2LXI A;  4URQ U;  4DG1 A;  3D68 A;  3D6T B;  5T14 A;  4R8U A;  2YNI B;  3PAC A;  4OHW A;  3DGP B;  3KHL A;  1EZZ B;  1NSK L;  3KLH A;  5DRK A;  3NAH A;  2DXE A;  3CE8 A;  4MK9 A;  3LGH A;  5GAG I;  3O1L A;  3H40 A;  2R2S A;  4JI8 F;  2GGP A;  3X3U A;  2RU3 A;  1IM6 A;  2XGP A;  1GFW B;  1FX2 A;  3EIC A;  4KHP F;  1YJN S;  2LQ8 A;  4O3R A;  2HHH F;  1EJ7 L;  4UTG A;  2WBR A;  2R8H A;  1VGY A;  4M5G A;  3I9V 9;  2W7P A;  2FVS A;  2B5J A;  1OIA A;  3BBB A;  3BPS P;  3I4P A;  2IM2 A;  4GC7 A;  5F9N A;  1MWZ A;  4RW4 A;  3HJV A;  2XYG B;  2D1C A;  4OZN A;  2GQQ A;  1LKZ A;  3CCQ S;  1KLM A;  3ILO A;  2XZD B;  5KT5 A;  3BR9 A;  4MKV A;  1BQN A;  3GSI A;  3ZZZ A;  3M2R B;  4RW9 B;  4WWS A;  2BBE A;  4TY8 A;  1HMV B;  4JP8 A;  3OLA A;  1PIE A;  2M5Y A;  4DL2 A;  4J9Q A;  4I4B A;  2HEK A;  1RKI A;  3G6Y A;  2QN6 B;  2RHQ B;  4RLE A;  3W3S A;  4ZP9 A;  1R7I A;  5HLF A;  3BGF A;  5KFT A;  5HAN A;  1TL1 B;  3SIP B;  2PE8 A;  4Y28 C;  1R0A A;  1YZ7 A;  3IG1 B;  4ETX A;  4Q43 A;  2CPJ A;  4ZIT A;  3BQ0 A;  3DLB A;  5AXL A;  2HVZ A;  3ZTR A;  2QMX A;  2GIR A;  4DV2 J;  4RBV A;  2BE2 B;  1ROF A;  4HHJ A;  4K0K J;  4KV8 B;  3PZP A;  2GJ2 A;  3M4X A;  4JI6 F;  4D3G A;  3UDC A;  3M1V B;  1SUQ B;  3N4W A;  1S0V A;  2DJW A;  4LF9 F;  5HRO B;  3QSI A;  2I38 A;  3IS9 A;  2MMY A;  2GIQ A;  2GVZ A;  1S6U A;  2FVQ A;  3RBX A;  2MZR A;  2HNY B;  3FEY B;  2C3O A;  3OR1 B;  1HYS B;  3VGU A;  3VAG A;  4WU3 A;  2DGT A;  2GJF A;  1REV A;  4WFZ A;  1VCT A;  3V6H A;  2R7Q A;  1UFL A;  2R7O A;  3NCQ A;  2LU1 A;  4ILL A;  3EUN A;  1IBM J;  3AQO A;  3WC0 A;  3DYA B;  4K50 A;  4RW8 A;  3T5K A;  2CWK A;  1K44 A;  1VBK A;  4KGM A;  4NCG A;  3CB4 A;  3RUB L;  3PEH A;  5K14 A;  4DL4 A;  2CNN B;  2H54 B;  2F8M A;  2CNL B;  4B3O B;  2YNF B;  1ZH5 A;  3NGT A;  4A8Q A;  4DOZ A;  2MZ1 A;  2V8H A;  2LVW A;  2QO3 A;  1Q8L A;  2ZC4 A;  3A3O B;  4M94 A;  1VHF A;  2VG6 B;  1T03 A;  2W4D A;  4DF8 A;  1U2R A;  3RYL A;  2RSQ A;  5JMN A;  2KFN A;  2HWT A;  3AY0 A;  3PHT A;  2BXJ A;  3BJY A;  3CJ4 A;  1EKR A;  1CSJ A;  3AB4 B;  5DLG A;  3RJM B;  2OPR B;  4UOF A;  2LMI A;  3FBE A;  3CWJ A;  4AFF A;  3ETO A;  3W60 A;  4K4W A;  3NS6 A;  2W9B B;  1YJ7 A;  4CO2 A;  2MY8 A;  3POT A;  4N8N A;  1A6L A;  3VV2 B;  3R27 A;  5K8P A;  2ZH9 A;  3Q86 A;  2XNQ A;  1FTR A;  4V19 J;  3I56 S;  3CDW A;  2DXD A;  4CTA B;  3N28 A;  3BN4 A;  4ID5 B;  1S1X B;  5ETP A;  1F5A A;  3F73 A;  1TK5 A;  4V19 X;  3CED A;  3JYT A;  5IT0 A;  3IM9 A;  4OMF G;  1EAR A;  4I6A A;  2QLJ B;  4ZCL A;  1REG X;  2XZT B;  1OSD A;  5ETV A;  1S9F A;  4PG5 A;  5A6P A;  5FJ4 A;  3D3C J;  4JI8 J;  3T9Z A;  4RNF A;  3QT5 A;  8ATC B;  2LQJ A;  2XQC A;  4KHP J;  2DO0 A;  2Y3Y A;  4AD6 A;  2HHH J;  2XI2 A;  2EC0 A;  4IOA Q;  1EP4 A;  2Y8Y A;  1V3Z A;  3KHR A;  3VCD A;  3ZO7 A;  2EEY A;  2CIM A;  2MQQ A;  2Y0B B;  4KSE B;  1VJQ A;  3KMS A;  4CLZ A;  2QMU B;  4P73 A;  4ZMM A;  1RAO A;  1JQG A;  3HVT B;  2KYX A;  1UPP A;  4DV0 F;  4IFV B;  1P1T A;  5KG7 A;  1FK9 A;  1Y10 A;  4ED3 A;  5A0Y A;  4U95 A;  4U7U D;  1KD1 T;  3NWG A;  5KG5 A;  2VIC A;  1YLX A;  2X1F A;  2V34 A;  3GIK A;  2RD5 C;  1MW7 A;  2YKP A;  5CAB A;  1PJ5 A;  2C2E A;  2HQI A;  1BXN A;  2XNR A;  3THV A;  3W8P A;  3O8W A;  3M32 B;  2ZVI A;  3BGR A;  2XO6 A;  1FER A;  1UEU A;  3LPY A;  4UQG A;  3W2W A;  1TKZ B;  3BDP A;  3PXG a;  5F8J A;  1B4S A;  3FGV A;  1HD0 A;  3QLH B;  4EK2 A;  2QGF B;  5LOQ A;  3IRX A;  1SL1 A;  2CNO B;  4OLP A;  1JLG A;  1V6H A;  2RNE A;  1C1C B;  3MEE B;  4K4Z A;  5J1N A;  2L9D A;  1TMJ A;  3MD3 A;  4XAK A;  4NA2 A;  3BPD A;  4CO0 A;  4LF1 A;  4CLK A;  1F60 B;  1KDN A;  1S49 A;  4FN5 A;  4I2P B;  4J9P A;  3PW2 A;  4JI6 J;  2YH1 A;  1ZA2 B;  1N88 A;  4PG4 A;  4LF9 J;  1WKJ A;  1BUX A;  3KJF B;  1JNR B;  2RT3 A;  5GAE I;  1X4A A;  4ICL B;  3OSP A;  3QO9 A;  4KAI A;  2VDH A;  3OR2 A;  4LJM A;  3DRR B;  2AQ4 A;  3GYN A;  5J1P A;  4DV7 F;  2C2O B;  1O0P A;  4DQI A;  1N32 F;  4ZA1 A;  1XTZ A;  4C11 A;  3OVA A;  2DR9 A;  3MWB A;  2XS2 A;  1VQ6 S;  1RCO B;  4X62 F;  3CC7 S;  3AOB A;  2RQ4 A;  1JJ2 R;  3MMA A;  3BV8 A;  4OYB A;  3D54 A;  3TUI C;  2ZH3 A;  4KGZ B;  1AFJ A;  1U1R A;  1JIH A;  4BWJ A;  2A6M A;  3KLI A;  1T05 B;  1FO1 A;  1RZM A;  4EZ6 A;  3BO2 A;  4NRT A;  3L7U A;  3E8O A;  4BDP A;  1HQE B;  2XB2 D;  3RR7 A;  3PYE A;  2AYM A;  3MMB B;  5J2Q B;  2WSC C;  3KLE A;  2MKC A;  4AL7 A;  3VZI A;  3DXB A;  2V5H G;  3SCL E;  4P2X A;  2O66 A;  1S0M A;  4ZLJ A;  3FSX A;  3D0I E;  5GAH U;  5K8M A;  2AJ0 A;  5B0B A;  2JFK A;  8AT1 B;  4YN3 B;  1NJI T;  5T7L A;  1TFW A;  5ETN A;  3O5T B;  1N0V C;  1AFI A;  5DO2 A;  2OFG X;  3B78 A;  2OPS A;  4WXW A;  3OUY A;  3QWP A;  5E7O B;  1F5C A;  1W25 A;  2Z2L A;  2CQH A;  4OI6 A;  1UAW A;  1S97 A;  3H2U B;  3W66 A;  4CQ1 A;  4X4S A;  1FWP A;  4WXO A;  2HG4 A;  3HJF A;  4HYK A;  1FXD A;  3LH2 S;  1NU4 A;  3KMQ A;  1QD1 A;  4ID8 A;  1PYT A;  4QU7 A;  3PRB A;  2XSJ A;  2MQ8 A;  5CYM B;  3SYZ A;  1TL3 A;  4CH0 S;  2VIH A;  2V8D A;  2ZHO A;  1CJT A;  3CXC R;  3ADA C;  4O3P A;  2CPX A;  3S8S A;  1RB0 A;  2L48 A;  4NXM F;  1V5I B;  4RX6 A;  1SKW A;  3HHN B;  1EIY B;  4RNH A;  2D3U A;  1YK9 A;  3QGH A;  3MCO A;  2G0C A;  5AXN A;  4TYB A;  3DOL B;  3H42 A;  4OZ1 A;  3E01 A;  1WTF A;  5D0H A;  1HHT P;  1EX8 A;  1LWX A;  4B9T A;  1FFS B;  3ETM A;  4J91 A;  2VOD A;  1WNE A;  1XQI A;  4F2S A;  3DGV A;  3HK2 A;  4FS1 A;  2F3J A;  1NHV A;  2ZEJ A;  1RBL A;  3UN2 A;  2ILZ A;  4USH A;  4KPY A;  1QE1 B;  3I31 A;  2B9E A;  2G1H A;  4DV0 J;  2BDP A;  2DGV A;  2YKM B;  3PR4 A;  4B9V A;  4WFB Q;  1UJ5 A;  2DO4 A;  1GMW A;  4GRS A;  1VQS A;  1NM2 A;  5HMY A;  4FYD A;  2WHO A;  1WF2 A;  3NNC A;  3DDN A;  3PO4 A;  1DTT B;  1ZZN A;  1CBK A;  5F9L A;  4KO0 B;  3UN5 A;  2P9G A;  2XMT A;  1M1G A;  3V4I A;  2YQ3 A;  3I0S A;  4ZP6 A;  3OL9 A;  2SXL A;  2LQ9 A;  2P8I A;  1LWC B;  2HQD A;  3CJT A;  2EFO A;  1MMN A;  1OO0 B;  5LT5 A;  2F5G A;  2WTF A;  1TL4 A;  2GX8 A;  4MKY A;  2ZH8 A;  2OD6 A;  2CQ4 A;  4LBP A;  1J2V A;  4DV5 F;  2XUL A;  1ACM B;  4Y00 A;  4UUX A;  2PMZ D;  3MR3 A;  4LFA F;  3BYP A;  1MRO B;  4DBQ A;  4FVC A;  3M9O B;  1PJ7 A;  1TUG B;  1TL1 A;  3FJ2 A;  1S12 A;  4PRF A;  1CQM A;  3G96 A;  4M5H A;  4K4T A;  2VJU A;  2LEA A;  3NLC A;  2GO8 A;  3DLG B;  2AJF E;  3TR5 A;  4DV7 J;  1N32 J;  3HSJ A;  3HHL D;  2NSC A;  4MMO A;  4X62 J;  1GEH A;  4K4Y A;  4BC9 A;  2DNY A;  4KV8 A;  1IXK A;  3MAA A;  2QA4 G;  3NY0 A;  1NKC A;  5HL7 Q;  1R8A A;  3RB3 A;  1SC4 B;  5B0G A;  3G6E S;  5KFK A;  2NS1 B;  2XMA A;  5HRO A;  3JTP A;  2MDA A;  4LVO P;  4QW8 A;  2A6O A;  2JC1 A;  1PGZ A;  3DC2 A;  5KFI A;  1NSP A;  1Y5L B;  3OFF A;  2HNY A;  3CCJ S;  2V4J B;  1K73 T;  3OR1 A;  1QTN B;  2QEX S;  2RKI B;  1ZET A;  1TFY A;  2UP1 A;  2JX2 A;  2CJX B;  1O6X A;  4NXN F;  2FIU A;  2DNM A;  2QC3 A;  4P71 A;  2IM1 A;  3JAM Y;  2FHJ A;  4BWM A;  3T6B A;  2UXC F;  2WRM A;  1JNZ B;  5HVG A;  4YFU A;  5B08 A;  3DYA A;  3PX4 A;  1LV5 A;  2FJD B;  4TNO A;  2BAN B;  4YDX A;  2GC8 A;  1UVM A;  1GXT A;  5HMX A;  2FTR A;  1M1H A;  5HAT A;  5CCM A;  4IRK A;  4B3O A;  2MZQ A;  1P9Y A;  4OZ0 A;  5IT9 U;  1XMO F;  1LWF B;  2E5I A;  2IHR 1;  2ZZN A;  4DFP A;  3QYY A;  2FDN A;  1S7H A;  3H4B A;  3OTO F;  2LXU A;  2VG6 A;  2QMW A;  1D9F A;  1SJ3 P;  2IPO B;  4DUY F;  3M2V B;  2CAJ A;  2XMU A;  2HWI A;  4CLP A;  4DEZ A;  5IT4 A;  2E66 A;  1H72 C;  1AW0 A;  3NEK A;  1NDC A;  4KRW A;  1VMB A;  4C8O A;  2XY7 A;  2UV8 G;  3TJ9 A;  1D1U A;  4OIX A;  4ECZ A;  4U8V A;  3WHI A;  2OPR A;  2KFY A;  4NXM J;  3CJ8 A;  4DR7 F;  3CJ0 A;  2QYG A;  3C16 B;  2W9B A;  3I0R B;  5KT3 A;  2Q1L A;  1PYS B;  4FBT A;  3NCR A;  3MM8 A;  2WON A;  3UVJ A;  2H9Z A;  1M5H A;  4FXW A;  2EC2 A;  2CQ2 A;  3FCW A;  1DAR A;  3H2L A;  4Y65 A;  4CTA A;  5KG1 A;  5KG0 A;  3ZZO A;  4ID5 A;  3JQJ A;  2HMI A;  5D8H B;  3GQC A;  2JL9 A;  2FZC B;  1R31 A;  2CQ3 A;  4LF8 F;  5KFB A;  4KBI A;  4K4V A;  4EUV A;  4TU9 A;  4DJB A;  3OHB A;  4GO5 X;  5DDR C;  4LRF A;  3D7S B;  3PYD A;  4P2F A;  4XDD A;  3NBP A;  3EGN A;  2MKK A;  4PEO A;  2V6A A;  4ZCM A;  4O3Q A;  5I42 B;  1TP7 A;  3C6T B;  4QIW D;  4UUW A;  1DUR A;  1S10 A;  2E5L F;  2R8G A;  1TV6 B;  4LT6 A;  4PYA A;  5KT6 A;  1HWU A;  2KM8 B;  3M9N B;  3Q23 A;  3UD3 P;  3MM6 B;  4C48 A;  4N76 A;  2HK3 A;  9RUB A;  1X9S A;  3MCN A;  1WC4 A;  4CWB A;  1HBU A;  5IV4 A;  1I5O B;  2VL1 A;  1YJT A;  5GAG U;  4UOG A;  2KI2 A;  3G8S A;  1VYA A;  2QSW A;  3QGG A;  4F36 A;  3CJK A;  1BY9 A;  3MUV P;  4DV5 J;  2DHA A;  3OTD A;  3QJJ A;  2W9C B;  3M32 A;  4LFA J;  4LF2 A;  1YGY A;  4OYA A;  1TKZ A;  3E2E A;  2IDL A;  2E5H A;  4Z2X A;  3AOD A;  4USW A;  3RTV A;  4K8R A;  2MZJ A;  5EWF A;  5HMW A;  1D9A A;  1UP1 A;  5KFZ A;  1ZA1 B;  2VJV A;  4EO8 A;  1QM9 A;  3H98 A;  5KFV A;  1OYD A;  1RWM B;  3OFG A;  4ZIV A;  3TO8 A;  2HNZ B;  4ZOS A;  2L3M A;  3CUL A;  2FJE B;  4I2P A;  1EQ0 A;  3W8G A;  2H4W B;  3P8B B;  2VBZ A;  3JB9 k;  1APS A;  4JB8 B;  5L46 A;  2GVD A;  2WOM A;  1DLO B;  4A8F A;  1DBD A;  5A8K B;  1UFW A;  3QBC A;  4NL5 A;  4CNZ A;  2RVJ A;  3IGN A;  1FWL A;  2M70 A;  2GNK A;  3AJ1 A;  3DRR A;  3RG6 A;  2J0X A;  1NK4 A;  2RML A;  3KLF B;  2WVE A;  4OLO A;  2JEI A;  3D2W A;  5KG2 A;  2KKH A;  1S9G B;  1YJ9 S;  1G3O A;  4NXN J;  3EVO A;  2E29 A;  2RRB A;  3ITH B;  3R6L B;  2QA4 S;  1LW0 B;  4K5R A;  2MQO A;  2JJ4 D;  3IR6 B;  2UVW A;  4WF9 Q;  1QSL A;  2D9O A;  2UXC J;  2VB6 A;  2DNO A;  1TAU A;  2GW8 A;  4ECX A;  2HAF A;  3V81 B;  2ZM6 F;  2ZDO A;  3OTC A;  2F8H A;  1B99 A;  4HI1 A;  5F0U A;  1R3N A;  1X60 A;  1FTC A;  3FRZ A;  3DNC A;  3ISN C;  2VBW A;  3CJ5 A;  2F9J A;  4W92 B;  3NGR A;  4LRE A;  2V2Q A;  3FDS A;  3KDO A;  1NKB A;  1XMO J;  2VOP A;  3MPY A;  3IXQ A;  4A8W A;  4ZVT B;  5KFG A;  2YNG B;  1HQE A;  2HVD A;  3OTO J;  2EWH A;  4NZ6 A;  3EGZ A;  4CM2 A;  2BE7 D;  4IOC Q;  4DUY J;  1Q16 B;  2XWY A;  4USJ C;  5B0C A;  1D8Y A;  1T9X A;  3HKW A;  4OI4 A;  3RB0 A;  5LJ3 Y;  3IP0 A;  1IKX A;  4PYD A;  1RP5 A;  3V5R A;  1WKL A;  1NH7 A;  4QR1 A;  4DXL A;  2E1C A;  3PTW A;  2LA4 A;  5CD4 A;  2QSF A;  3QJL A;  2XTJ P;  1LWE B;  1TQL A;  2UUB F;  2MKY A;  1SIZ A;  4EEY A;  4IH7 A;  4M5K A;  2UUA F;  1WG1 A;  4QPX A;  3KFW X;  1SI9 A;  4DR7 J;  1VC0 A;  2BJ1 A;  4DQQ A;  2IDE A;  2QLF B;  1DQ9 A;  1VQ5 S;  4C8K A;  5ETK A;  2BJD A;  1YG0 A;  4ZVF A;  1ZAX A;  4YR0 A;  1CC7 A;  2PMW A;  3Q0A A;  1EQM A;  3G9C A;  1EHW A;  2ABY A;  4CO4 A;  2KG0 A;  5CYM A;  2HRU A;  4LF8 J;  1FRH A;  2PN6 A;  2CJB A;  3CPW R;  2G13 A;  2DRA A;  4DI6 A;  4OJG A;  1XK8 A;  4KR0 B;  2N4D A;  2EK1 A;  4IYQ A;  3R1H A;  1UL3 A;  2IRY A;  3C2P A;  2LDI A;  1PBU A;  4ZPW R;  4KTQ A;  4UF4 A;  3G71 S;  3MEC B;  3TZW A;  2AGP A;  4OQJ A;  3ELH A;  5A2Q U;  2E5L J;  3BYR A;  1BLU A;  3LF0 A;  4QQB A;  1N52 B;  3GR0 A;  4Z37 A;  1RT5 A;  2W25 A;  2DH9 A;  2ZBR A;  3T3F A;  5HQM A;  2JLE A;  3CJ2 A;  1NPK A;  3GP9 A;  3H5U A;  2UUT A;  4PQU B;  3CMA S;  1FVS A;  1PG5 B;  1UFK A;  3BGU A;  3BKF A;  2N3O A;  1RAF B;  2KHC A;  3CIZ A;  2MLY A;  1RQ0 A;  3EE3 A;  1PIL A;  4LSL A;  3C46 A;  2HW3 A;  1UW9 A;  1TKX B;  1OS5 A;  1R27 B;  2K8G A;  2HND B;  5KFE A;  5B0A A;  2LYV A;  3IA0 A;  1DTT A;  1IWA A;  1NME B;  2HPU A;  5C25 B;  1KOH A;  2Z56 B;  2OMO A;  1IQZ A;  4B3R F;  3TUZ C;  4PWD B;  2QLB B;  1SH2 A;  1FNX H;  1PSD A;  1SC6 A;  5KG4 A;  1SCJ B;  5HP1 A;  3CO9 A;  3KJV B;  1Z1Z A;  1RTJ B;  2BJE A;  2PA3 A;  1WG4 A;  4CM0 A;  1X8D A;  1W26 A;  1R8H A;  3CNQ P;  1VC5 A;  2H4Y B;  2MQP A;  3MTJ A;  1JJ4 A;  1U4B A;  2VFV A;  5DET A;  4ELV A;  2WW8 A;  3MXH P;  2OAU A;  3SEO A;  2DNP A;  3ZNJ 1;  3FEZ A;  3B4D A;  3TYT A;  1ZYQ A;  2J6T A;  1HNX J;  5DS7 A;  2Y1I A;  4O4G B;  3NMA A;  2CZ4 A;  2HFN A;  4FYV B;  3FFI B;  2EXU A;  2I5J B;  3NOC A;  3D1H A;  4M5M A;  4N77 A;  4Q0B A;  2YQ0 A;  2DPJ A;  2YX7 A;  1H74 A;  1CUL B;  3N0V A;  2ZM6 J;  1WKK A;  2L9W A;  1TL7 B;  1IJF B;  2APO A;  1R6V A;  4F3O A;  1PKU A;  5GAE U;  4IG0 B;  2DGU A;  2MLX A;  1C4A A;  4L75 A;  1NSA A;  4RO0 A;  2GAG C;  1ZAW A;  4DU7 A;  2KRR A;  3SQG B;  1UEV A;  3IWL A;  4CCH A;  4ILM A;  2J0W A;  3FVY A;  3OD2 A;  4O44 B;  2DHH A;  2OML A;  1BD6 A;  2JLG A;  5L1J A;  5F8H A;  2CAD A;  4DZ6 A;  5FLX Y;  3D1Q A;  4Z7Y A;  5DM7 Q;  3J80 U;  1CLF A;  1QJH A;  4MTP A;  1FE0 A;  3A8J A;  2N82 B;  1RAH B;  3MM9 B;  4CO5 A;  1FEH A;  2UUB J;  4IOB A;  4Q45 A;  3M6V A;  4N47 A;  4N41 A;  4KYZ A;  1SKS A;  5GAD I;  3CTR A;  4OX9 F;  5LM7 E;  1T9T A;  4QBU A;  3QID A;  3U7J A;  3J81 j;  3K8W A;  4CNY A;  5A8R B;  3LAK A;  3CJS A;  3VAH A;  2CA9 A;  1OMS A;  2ACY A;  3OJU A;  4WIQ A;  4I2Q B;  1T02 A;  3GMG A;  4MFB A;  2V2Z A;  1C0T A;  4X4P A;  1SL2 A;  4I69 A;  2FPH X;  2UXB F;  1CS4 A;  4RL1 A;  1IKW A;  3HD1 A;  4A46 A;  4QR0 A;  4R5P B;  4H4K C;  3M6X A;  1HNZ F;  2MQN A;  3MCM A;  2Z57 B;  3I0R A;  3Q24 A;  4YME A;  3MAQ A;  1FKP B;  1U48 A;  4NZ7 A;  2KZZ A;  3R97 A;  2K7J A;  1KQF B;  1RDR A;  4DX6 A;  1Q81 T;  2XMW A;  4DMZ A;  1DJ0 A;  1WEY A;  2HS4 A;  2V68 A;  1Q8K A;  4ZHR A;  3JSY A;  3FSY A;  4MIB A;  3DLE B;  1IBL F;  1HBO A;  2FC8 A;  3Q8S B;  2IJF A;  2BRK A;  2W1B A;  3HT0 A;  4LIR A;  1CEZ A;  2OD4 A;  2QL9 B;  1IJE B;  1MWQ A;  1SV5 A;  5I42 A;  2XMK A;  2HQF A;  3C6T A;  4I7F B;  1MML A;  2FHJ D;  5DZ6 A;  1V3R A;  1JXV A;  2M9K A;  5E33 A;  3MPU B;  1U1K A;  1TV6 A;  2BW2 A;  3OPK A;  4B3R J;  3DU6 A;  2YBV A;  4WFA Q;  4ED6 A;  4IQM A;  4XIU A;  1LW2 B;  4KFB A;  1MU2 B;  2CQG A;  2R7U A;  1HBN B;  3CJQ A;  1Y5I B;  3K89 A;  3D6F B;  2GAH C;  2GQC A;  1QAX A;  2FJV A;  2Z2Z A;  2K7K A;  3MMC A;  3LO3 A;  1R8P A;  2BA9 A;  3A8K A;  1LXN A;  4OJ1 A;  4DHV A;  1Q0N A;  3DLK B;  4P6Q A;  2GML A;  2OEL A;  2RDI A;  3AA9 A;  2V94 A;  1M5O C;  5B7W A;  1RWO B;  1ZPV A;  1WHV A;  3AJD A;  4DX7 A;  4WFY A;  2DGS A;  1IUJ A;  3K58 A;  2PC6 A;  1F2G A;  3HMJ G;  4LVN P;  3BF4 A;  1U45 A;  4ECQ A;  4RUB A;  3QJP A;  4H4M B;  1TAQ A;  5J2N B;  1K1Q A;  2JFD A;  1SJR A;  2R9L A;  1XBW A;  3O6Q A;  2HNZ A;  4QIF A;  1SQE A;  3QT6 A;  2WK4 A;  4EBC A;  1IM4 A;  2JVO A;  3LPE A;  1VQ4 S;  3PIO Q;  3G86 A;  5L1L A;  1VS3 A;  4F25 A;  3M6W A;  2EFQ A;  2CQ1 A;  3GSD A;  3MUR P;  3UD5 A;  1H98 A;  4URS A;  5IC6 B;  2VQF J;  3SBM A;  1DFD A;  3CF5 Q;  3DRP B;  4YOE A;  1HNI A;  1DY3 A;  1RWV B;  2ZVS A;  3OBI A;  2RH3 A;  3ZTS A;  1UWB A;  3AQP A;  3HT3 A;  4LR8 A;  5C2C A;  1VC6 A;  1UET A;  1N5Q A;  1S9G A;  2PII A;  4P2S A;  5I3U B;  3ITH A;  1ZAV A;  5G0R A;  4CIO A;  4OJ3 A;  1SXL A;  2XBP A;  3R5G A;  1FRM A;  1T0T V;  2CVI A;  2W2O P;  2N7C A;  4JI7 F;  4DR1 F;  1K8A T;  1RAG B;  2ZHA A;  5H9F K;  4R0E A;  2CDR B;  1RTD B;  2Y1J A;  1PC5 A;  1B7Y B;  2C28 A;  4X4O A;  1GK8 A;  4ZCK A;  4F04 B;  1JLC A;  1NDL A;  4PUO B;  1VK8 A;  5L1K A;  2EPI A;  1ARO P;  1VIS A;  3EX7 B;  2BMB A;  1WC5 A;  4DDF A;  3N01 A;  3J7A 1;  4OHX A;  3K59 A;  2PT0 A;  1HQU A;  5C5J A;  2CPI A;  1J27 A;  3MM5 B;  2D3O R;  1NJW A;  3C15 B;  2B3T B;  4OX9 J;  1G4C A;  2GO9 A;  3VAM A;  3OJS A;  2IC3 B;  3JSB A;  2MZS A;  2KRB A;  4KT0 C;  4NPO A;  2HLT A;  1CJV B;  1RT7 B;  3GYX B;  2JEG A;  4WE1 B;  1URR A;  2ZH6 A;  2E5G A;  2YNH A;  1RAA B;  2ZHB A;  2CJQ A;  3DXS X;  4CLT A;  3GII A;  1HIY A;  5F8G A;  3HPO A;  3GU0 A;  2K1R B;  2UXB J;  2OHD A;  3MEG B;  1X4E A;  3NG8 A;  1Z4U A;  3KK3 A;  3BSN A;  3C66 A;  5F41 A;  2M3D A;  3MUM P;  2BE9 B;  1HNZ J;  4P52 A;  3RW6 A;  1RAI B;  3W7B A;  3F44 A;  2D3O 1;  2RUS A;  1LOU A;  4B3M F;  5KFU A;  3CCM S;  2EK6 A;  2CJA A;  5A76 A;  4G1P A;  2MGZ A;  1N8R T;  1X5S A;  1DHM A;  1RE1 B;  4YY3 F;  4EBD A;  3I82 A;  2B9Y A;  4DV6 F;  2ZE2 B;  2HHU A;  1F9E B;  1T3O A;  4B3T F;  5HI7 A;  3UDV A;  2JVR A;  2Z30 B;  3JS9 A;  1JWW A;  1IBL J;  2XLK A;  4RWW A;  4JI2 F;  1S1T B;  1YRT A;  5IM0 B;  2HFZ A;  4NLS A;  5ETO A;  1Q5V A;  3K57 A;  1RHR B;  5CYQ B;  3OQ2 A;  4YB7 A;  4DSI A;  3MEC A;  2J9E A;  3DM2 A;  2WSF C;  1ZTW A;  2C2R A;  2B9X A;  5CQG A;  4PWU A;  3CD7 A;  3R7N B;  3FZB A;  1L3V A;  3VAF A;  3GG0 A;  2V2K A;  2KT3 A;  1KS2 A;  3TEH B;  1FHT A;  4NLQ A;  1IWG A;  2QA1 A;  2Y1L B;  3N6M A;  2AV5 A;  4NA3 A;  3GE9 A;  4MYU A;  4PKD B;  2JC0 A;  3N79 A;  2GFF A;  4DCO B;  2W9A A;  2ZNY A;  2XMV A;  1NPP A;  2X1B A;  2HND A;  2AT1 B;  4HAC B;  4K7Q A;  2ROG A;  5H9F J;  3CO0 P;  1VRQ C;  4U7U K;  4ILR A;  4P2M A;  2H65 B;  5RUB A;  1CVJ A;  4DX5 A;  2B0G A;  4OZ3 A;  3T1H F;  3PW5 A;  3DOM B;  1Y9O A;  1Q7L B;  2M7S A;  2XGQ A;  1H0H B;  1X0F A;  2E44 A;  2PFD A;  5J1E A;  2HYI B;  1UA0 A;  2G2Z A;  1U1L A;  1VRT B;  4DR2 J;  4ECT A;  1FJ7 A;  1Q7Y T;  2CZ9 A;  2HIY A;  4NRU A;  1T3N A;  3CDB A;  3HHD A;  1TL5 A;  3KJQ B;  2NXJ A;  3Q8Q B;  3K0J A;  2NYI A;  1JLB B;  2HHP A;  4NWB A;  4A4J A;  4I1T A;  4Q44 A;  3HO1 A;  2DGO A;  1V9O A;  1U25 A;  3RU0 A;  3DLL Q;  1OWX A;  1N34 F;  2O67 A;  1N5Y B;  3HFZ B;  4A47 A;  2KHD A;  1U0H B;  4LBH A;  4LIW A;  2NXU A;  2KJV A;  3IWX A;  1J5O A;  4O4G A;  2W2M P;  2R7X A;  3ZTP A;  4UST A;  2AYE A;  2HZV A;  4XPE A;  2UZA A;  2DRB A;  2OO4 A;  3FMW A;  1TZ0 A;  3ZFV A;  2I5J A;  4M63 A;  2CG4 A;  3TA2 A;  1CJU A;  2Y8W A;  4L73 A;  3ENW A;  2POK A;  3EVW A;  2QL5 B;  2XY5 A;  4DR1 J;  1FWK A;  3PJX A;  2W8K A;  2W24 A;  5U47 A;  2OTL S;  4ED2 A;  2GMH A;  4K5S A;  4N5S A;  4RW6 B;  4PQA A;  2WCX A;  1CJK B;  4PAB A;  2BJ8 A;  4HHU A;  4DL6 A;  3M8Y A;  3L7P A;  4F50 A;  1FJC A;  3ULH A;  4R0J A;  2CKW A;  3HHL C;  4EGL A;  1HI8 A;  3SQG A;  4ZJQ A;  2GCF A;  3W2V A;  2GHW A;  1KOO A;  4LFC F;  1QVF R;  3KUE A;  5ETS A;  4I6W A;  3QFW A;  2RHS B;  4X64 F;  3JSR A;  3T1Y F;  1KKH A;  3GG1 A;  1VQO S;  3KUH A;  1HWL A;  3BQ2 A;  3I6P A;  4UW2 A;  3ISN D;  2YXL A;  5L39 A;  3TA1 A;  2G1D A;  2IAJ A;  1BQM B;  1B3T A;  4A48 A;  3TNV A;  2W01 A;  1DTQ A;  4ED4 A;  1D9D A;  4NLW A;  2DD8 S;  1N54 B;  4OX7 A;  2GS8 A;  1U6F A;  1S99 A;  2B6A B;  4OHY A;  4WKR A;  5DGB A;  4DFJ A;  3O2I A;  2EKY A;  4B3M J;  4DV3 F;  1WDT A;  1FRL A;  4NI2 A;  4DWI A;  2Q3P A;  3M2U A;  4ZVQ B;  4U7C A;  4O3N A;  4YY3 J;  1GMU A;  2Z8Q A;  2W8L A;  3AA8 A;  1BMQ B;  2AZ1 A;  4I2Q A;  5KFS A;  1GXU A;  4DV6 J;  1NK9 A;  1LEO A;  3PDN A;  1M0S A;  3IR5 B;  3CCL S;  2CUY A;  4B3T J;  1VK3 A;  4CYU B;  2KFZ A;  5HK4 A;  3HFV A;  4OZJ A;  5F8N A;  1M5K C;  2YKN B;  2V50 A;  4YQW A;  2LFV A;  2ACM A;  4WTO B;  1FRK A;  2R7W A;  1AZS B;  3GIR A;  3VWS A;  2EFG A;  3B4M A;  1FKP A;  1F3F A;  4NX9 A;  2YPZ A;  4GVL A;  2JHE A;  3CJ3 A;  1RT3 B;  2ASL A;  3FC9 A;  2LCW A;  2GA7 A;  4EBE A;  4WYW A;  3TZZ A;  5E5N A;  5KFA A;  2CDQ A;  2HFU A;  1YVF A;  4LQ3 A;  3AT1 B;  2WW4 A;  3FQL A;  3DLE A;  4C7Q A;  2HHT A;  1AB8 A;  2DIS A;  4JV1 A;  4I6Y A;  3UQS A;  4R25 A;  3M8Q B;  1YJW S;  4JI4 F;  4KJI A;  4Y2C A;  4N8O A;  5LSO A;  4F2R A;  4Y2K A;  1FKO A;  1GNK A;  4IR1 A;  5J2P B;  3BR8 A;  2C2M B;  2C42 A;  4URG A;  1S1U B;  1CG2 A;  5L9N A;  3MR5 A;  2NZC A;  1TK8 A;  4QZV B;  4QWE A;  3VGV A;  2VAS A;  3NXZ A;  2YX4 A;  2R7S A;  1WC1 A;  1UTA A;  3I4H X;  3T1H J;  2R7V A;  1P6T A;  3H5S A;  5LXY A;  1LW2 A;  2VFR A;  2V4R A;  3H2V E;  4HH0 A;  5G4D A;  1XNR F;  3AFG A;  2XS7 A;  5A8W B;  4LF7 F;  5LL6 d;  4ES3 A;  2GQ2 A;  2QT7 A;  3DOK B;  1WHW A;  3LGN A;  2E9Z A;  3SCJ E;  3MD1 A;  3W61 A;  2EG1 A;  3EWG A;  2QG9 B;  4ECR A;  2ZUG A;  1TUW A;  3KKF A;  1YJU A;  2GMJ A;  1RT2 B;  2BJ7 A;  4NLG A;  1N34 J;  1UA1 A;  2W7A A;  1WC0 A;  1ZM2 A;  3RAM A;  2Z58 B;  3FBC A;  4ZLN A;  4A8Y A;  2OGU A;  1Y3K A;  5I3P A;  1YDL A;  3ENV A;  3KG1 A;  1NHU A;  4PG6 A;  5D0R A;  1I94 J;  3QGP A;  3GV7 B;  5D3G B;  3NWR A;  5FDL B;  1D8Z A;  2LEP A;  2B8P A;  2DNN A;  2RAQ A;  3BKU A;  5DDP C;  3UNY A;  1RTI B;  3T6J A;  4NLX A;  3U1L A;  2HRY A;  1JLA B;  2GJI A;  2QJ3 A;  3DRP A;  4RNO A;  3D6H B;  2Q79 A;  4WPA A;  2V9K A;  1NEE A;  1L5U A;  3C14 A;  1YX2 A;  1OYE A;  1RHQ B;  3FQK A;  2FLP A;  3OL8 A;  4YDD B;  2NXE A;  5HBM B;  4LFC J;  3D67 A;  1W7W A;  4QWD A;  1OJ4 A;  3K7R A;  4CH7 A;  4X2B A;  4X64 J;  1U8W A;  3T1Y J;  2FVP A;  3TJA A;  1FDN A;  3AXM A;  1RTD A;  3I96 A;  1H2U X;  1Q8I A;  1P27 B;  1XER A;  2CPF A;  2IBO A;  1UZD A;  2AJ1 A;  4C9D A;  2E5J A;  4FKX A;  3NOG A;  2BEF A;  3OXG A;  1U49 A;  2IMW P;  5KFJ A;  5IT9 Y;  1AA1 B;  1VQ7 S;  3MM5 A;  4OFZ A;  3CDE A;  1SC3 B;  3OFE A;  4MK8 A;  3NL0 A;  4HTI A;  3VQS A;  4ZPT R;  4DV3 J;  1RJJ A;  1NLK L;  4H4O B;  1RTH B;  1VQK S;  1RYR A;  4ECY A;  2KT5 A;  3S7R A;  1CJV A;  1S6P B;  2FLL A;  1N4L A;  2G2Y A;  3DDK A;  3SDE B;  1IKV A;  4KGX B;  3EPI A;  4DR5 F;  4DPX A;  4QYZ J;  1FI4 A;  2H48 B;  5AXM A;  3FUY A;  3ILL A;  3P5B P;  3UWT A;  4K59 A;  3LQV A;  3D6M B;  2ZKU A;  2ZH4 A;  2ZBC A;  3HLU A;  5ETT A;  1S1W B;  2FYX A;  5GVQ A;  1X31 C;  4KH1 B;  5GAD U;  4KIA A;  1DAX A;  1F2H A;  1IKY B;  4TQS A;  3EZ5 A;  3PCO B;  4HDG A;  1S6Q A;  1XIQ A;  5LXR A;  2IIH A;  3PVX A;  2HZC A;  5J2M B;  2NRE A;  2HHX A;  1S76 D;  3VVT A;  2DR7 A;  4ED5 A;  3TAP A;  1S9E B;  3DHX A;  3BH6 B;  4NAS A;  3UPF A;  4JI4 J;  2OEM A;  2CPZ A;  4C97 A;  4X4T A;  3P49 B;  2YVS A;  2PDA A;  3CCT A;  4K2J A;  3C6U A;  1PAU B;  1U2F A;  4RUH A;  3RR8 A;  3LWM A;  1VRU B;  1WDD A;  3PJ9 A;  4J9K A;  3HHL B;  4H54 A;  1VIO A;  3GYG A;  1PO6 A;  3NGK A;  4Q8F A;  5KFY A;  2YWF A;  4QIG A;  1GX6 A;  2X3G A;  3PRD A;  2RDJ A;  2VA2 A;  2I0X A;  3RBZ A;  1JLE A;  4DQS A;  2NYH A;  1XNR J;  3V6D B;  3CCW A;  4DFM A;  3HSZ A;  2AX0 A;  4LF7 J;  4DSL A;  4R8U B;  2XCA A;  2PEH A;  2WBM A;  1E6V A;  2DH7 A;  4C3L A;  1OQ6 A;  4UY8 T;  4Z7C A;  4HAC A;  4TXS A;  3M8P A;  2ZJP Q;  4KKO A;  1FX4 A;  4M8L A;  3DRS A;  1MWY A;  1X4H A;  4ZP8 A;  4ED1 A;  2GGP B;  3TZX A;  5K20 B;  3DOM A;  1YIT S;  5KT2 A;  5DQG A;  3H5X A;  3VHQ A;  2J0Q D;  2VV5 A;  3MZI A;  3R3T A;  4NYO A;  4ERD A;  3MOZ A;  5IQ6 A;  3DHW C;  1JLF A;  4OI2 A;  4EWT A;  1BHN A;  4IFY B;  4OYW A;  3LP1 A;  3HZG A;  2YH0 A;  3OT9 A;  2O01 C;  4UT4 A;  1HR0 F;  4WU2 A;  3KG0 A;  3OVB A;  4H4K A;  3CDU A;  5CYJ A;  4LF4 F;  3K2Y A;  3TAM B;  4MH8 A;  5IS2 A;  1FEE A;  2OPP B;  1Z2Z A;  3GZ7 A;  4A8S A;  3K5O A;  1N5Y A;  4HEA 9;  1FES A;  2GZO A;  2QFJ A;  5DQH A;  4TY8 B;  2J0S D;  2HQG A;  2VG7 A;  3RGI A;  3MM7 B;  2WVB A;  4CT8 A;  1U26 A;  3Q8Y A;  5KG3 A;  3SV4 A;  4X4U A;  1J5E F;  5D15 A;  4J9R A;  1VQY A;  4ED8 A;  5KFL A;  4ZJL A;  3WBZ A;  1UW4 A;  2N3L A;  1KTQ A;  4AT1 B;  4LF5 F;  1R0A B;  2KZM A;  1RAD B;  5HJX A;  1TTH B;  1FF2 A;  5I3Q A;  2CQ0 A;  2VBY A;  2J8A A;  3T5L A;  3TRG A;  2JOQ A;  1CJK A;  1WUU A;  3M30 A;  4PG8 A;  2OPQ A;  2BOP A;  4NA1 A;  3G2X A;  2MQM A;  1U1P A;  3BDE A;  2EFV A;  1JJH A;  2ALZ A;  2J6U A;  2XHC A;  3LTO A;  3IS9 B;  2GVZ B;  2Y1R I;  4DU8 A;  2YWW A;  3A4T A;  2Z2M A;  4AND A;  2IRU A;  4IO1 A;  3KLG A;  1RAE B;  4DFK A;  4XK8 C;  3O3L A;  3ZNU A;  2Q66 A;  4CZC A;  1IR0 A;  1A9N B;  4ZVR B;  4ZVH A;  2V4Q A;  1NHK L;  2XI3 A;  4TLQ A;  2XHW A;  3VQT A;  2DCL A;  1NJY A;  4DR5 J;  1BQM A;  1WSV A;  4I64 A;  3JSM B;  2VFU A;  4C2M A;  3B82 A;  1WF1 A;  4OI3 A;  4LR9 A;  3B54 A;  4UOC A;  4LSN B;  5IQQ A;  4NCG B;  3RRH A;  3QRR A;  3MUT P;  2GHV C;  4IG3 A;  5K14 B;  4XTT A;  1VJW A;  2V8V A;  4HT7 A;  2E1P A;  2EVZ A;  2JRS A;  5C42 A;  1NK5 A;  2NPI A;  1OY6 A;  1C0U A;  3BZQ A;  3LWL A;  2A18 A;  3TW0 A;  1QUV A;  2CJY B;  1JLQ A;  3R9L A;  2BOA A;  3CD5 A;  3T5J A;  1T03 B;  4RPF A;  2X3D A;  2FB0 A;  1MN7 A;  2KVQ E;  1R8C A;  4K4X A;  4LRB A;  4O3S A;  1C4C A;  2DR5 A;  2H51 B;  1RSC A;  2QRR A;  4EYI B;  1RT3 A;  2OSR A;  4CDI A;  3EZU A;  4PZV A;  4MKA A;  1SIW B;  2D69 A;  5A2Q Y;  3W9I A;  2PGC A;  2DNG A;  4QWB A;  3POT B;  4LSZ B;  4EFA C;  5AJ3 F;  1JXE A;  3F41 A;  4S0M A;  2A10 A;  2XSF A;  5H1S V;  4A8O A;  2OTJ S;  2KB2 A;  3M8Q A;  2F8E X;  5H9E J;  2UVU A;  2E1A A;  1DQ8 A;  3MF5 A;  3IR7 B;  1Q5Y A;  3QT8 A;  4JI5 F;  1HHS A;  3JYT B;  3R5B A;  1T95 A;  5LMU F;  3OSN A;  3I5A A;  4KH0 B;  4BHQ A;  2B4V A;  4RW7 B;  4N56 A;  6FDR A;  2YWH A;  4M95 A;  4X4N A;  1UVK A;  4A8X A;  1P8G A;  2HVH A;  1YZ6 A;  2DGX A;  3RRG A;  1RIS A;  2AKW B;  2VZ9 A;  3UCG A;  2JZ5 A;  2U1A A;  3EXY A;  4B9U A;  3R6G B;  2NUH A;  2ZOG A;  2FHO B;  4JI1 F;  4F3Q A;  2HQC A;  3SZ2 A;  2XC9 A;  4Q8E A;  1HR0 J;  3D9B A;  5ETQ A;  1T9U A;  3H7H B;  4LUB A;  1B7F A;  5HVH A;  3BGO P;  1HQ2 A;  4LF4 J;  1FK9 B;  1FXR A;  2FHM A;  5A0Y B;  4LQ9 A;  1RT2 A;  1YIJ S;  4YB5 A;  1PCA A;  2YNI A;  4NCA A;  4TN2 A;  3DGP A;  2R2U A;  2RDD A;  2K2P A;  3AB2 B;  4B17 A;  3L9Z A;  3W2W B;  3VTI A;  1NXI A;  2H5J B;  4YR2 A;  2K3I A;  1J5E J;  2JSX A;  3NGD A;  1HW9 A;  1UVI A;  4I67 A;  5HVF A;  3GCW P;  3QRQ A;  3IRX B;  3L7O A;  4MYT A;  3HD2 A;  3FBF A;  4J9N A;  2MKH A;  4LF5 J;  1JLG B;  1ZPW X;  3DRY A;  4M5J A;  5BJR A;  2G0J A;  1RTI A;  2J76 E;  4CO3 A;  1MMD A;  4V1A k;  3ZC4 A;  1JMT A;  3W62 A;  4C8N A;  4I68 A;  4DQP A;  3S01 A;  2DHX A;  2LU2 A;  2BQU A;  1HPZ B;  2FY1 A;  2C2D A;  4RBU A;  1M5P C;  1U6B A;  4GVB B;  3CW2 C;  4QWA A;  2CPD A;  5C2G A;  4FF3 A;  3H0P A;  3M2R A;  3UO0 A;  4RW9 A;  4TU8 A;  1ZBT A;  1Z2L A;  4YB6 A;  5HBM A;  4FYX B;  4WJB A;  1HMV A;  3QO9 B;  3OR2 B;  3L95 X;  2HIQ A;  2WZ1 A;  1U1M A;  2WVD A;  2MHE A;  2BZ2 A;  2OEJ A;  4Y34 A;  5C24 B;  1WF0 A;  4C11 B;  3A13 A;  2DXF A;  1JJC B;  1N56 A;  4MK7 A;  3J80 Y;  4OZ5 A;  2VG5 B;  4NEZ A;  4ELT A;  3MDF A;  3J7Z T;  2Z2Y B;  3IG1 A;  1KTV A;  1FNM A;  3EGW B;  4PXB A;  1NUE A;  3MMA B;  4DLE A;  3IAM 9;  2BE2 A;  2ZZT A;  1WOS A;  1AT1 B;  3G8T A;  3PX6 A;  3UDL A;  3CD0 A;  3N6N A;  3ONQ A;  3EYZ A;  3KLI B;  3KWM A;  1HBM B;  3M1V A;  1SUQ A;  1X4G A;  1BE4 A;  1S6P A;  2AEJ A;  4C8M A;  2XCP A;  2QLW A;  2HBQ B;  5D0E A;  1FDD A;  4FP9 A;  2M2B A;  4RU9 A;  1IR2 A;  2AJ4 A;  1U24 A;  3OV7 A;  4PR6 A;  1HYS A;  2Q43 A;  2JEJ A;  4F8R A;  3A8E A;  5KFP A;  4DR6 F;  3K17 A;  4J9V A;  1S1W A;  1M1K T;  4AXJ A;  3CUN A;  5T7L B;  1T8E A;  3Q2T C;  2RQK A;  1U09 A;  1C1B B;  1IKY A;  1VR6 A;  2QTW A;  2OPS B;  3DLJ A;  5CA5 A;  1OSC A;  4AE5 A;  5B0D A;  1EAY C;  2AP6 A;  4ZDN A;  1OPI A;  4Y6I A;  1GTH A;  3VR1 A;  2NQP A;  1FFG B;  3IAS 9;  3PYF A;  5EHH A;  2RF2 B;  4NLU A;  5KFF A;  3MHY A;  1RWN B;  5AJ3 J;  3C3L A;  1HI0 P;  3J81 Y;  2DBB A;  1YRU A;  2Z4P A;  1T9W A;  2YNF A;  4IQX A;  1H7X A;  2LKZ A;  3DFE A;  2R2R A;  1KVJ A;  3A12 A;  5KFX A;  2MST A;  3WZ0 A;  2MJU A;  3KJN B;  4B9N A;  5BYS A;  1QSS A;  5D78 A;  4FPI A;  2HWH A;  2M88 A;  2RB7 A;  2XSJ B;  1SKU B;  2ZDP A;  3ENA A;  3OXF A;  4ZVE A;  4JI5 J;  5HJY A;  5LMU J;  2IM3 A;  5DM6 Q;  1JKH B;  4TQR A;  1EB0 A;  1VRU A;  4FYW B;  3LP0 B;  4ECU A;  3HHL A;  3HVR A;  4L3N A;  3WX8 A;  1LK5 A;  1KHV A;  4RNN A;  2VPX B;  4OYX A;  3I32 A;  4OYO A;  7FD1 A;  4GC6 A;  2QV6 A;  4LF6 F;  3TQE A;  4F0M A;  4DPO A;  3R2D J;  2A2C A;  4K4S A;  1NZ8 A;  3W5Y A;  2NLW A;  2HFO A;  4WKY A;  2HHQ A;  1MNE A;  2HZA A;  1FCA A;  2HLU A;  3MFH A;  4X4Q A;  4JI1 J;  4FXD A;  1Y7P A;  2AJ2 A;  4LRA A;  1VLY A;  1PAE X;  2KTQ A;  1X5T A;  4UOH A;  1NJX A;  3OTE A;  5L1I A;  1Y3J A;  2HHW A;  2QE5 A;  2C2K B;  3R5D A;  1TK0 A;  2QLX A;  2KN4 A;  4JYA F;  1F0X A;  1X4D A;  3Q8R B;  1G6B A;  2DR6 A;  4YHH F;  1S1X A;  2NXC A;  1KVI A;  3GFY A;  5LMN F;  2FUG 9;  3UR0 A;  4ZPC A;  2BKO A;  2IJR A;  3I55 S;  3G4S S;  5KOW A;  2DIU A;  2ZH1 A;  4IFY A;  2CQP A;  1FA0 A;  3D3B J;  2LA6 A;  1RYS A;  3VF0 B;  2IMO A;  3V4I B;  3I0S B;  4WP9 A;  3W5Z A;  4DV1 J;  4NYP A;  4O3O A;  3BSO A;  1IQT A;  4OL8 A;  3M7V A;  2DYA A;  2H5E A;  1VHI A;  1WEL A;  5EGY A;  4LRD A;  3OW2 R;  4XPC A;  2JH3 A;  3TAM A;  1T7P A;  3BO4 A;  2OPP A;  1QSY A;  2CZV C;  2QZ8 A;  3HVT A;  3SCK E;  4C0B A;  4C0O C;  1NCL A;  1G7C B;  1U1O A;  3Q89 A;  3MM7 A;  1CQN A;  4DR3 J;  6AT1 B;  1FRX A;  3PG9 A;  4IFV A;  1XR7 A;  2ZOM A;  1VLO A;  1ZS6 A;  2J7W A;  5SUH A;  4NCB A;  1TEL A;  4GO7 X;  4DPY A;  3EDR B;  1HI1 A;  2ASY A;  1PC4 A;  3PYG A;  5GMD A;  4OV6 A;  4YUD A;  5DGA A;  3WDO A;  3QLH A;  5AE2 A;  1WEZ A;  3NS5 A;  3MAA B;  5DZ7 A;  5GMK a;  1FJG J;  4W90 B;  2MEW A;  4U67 Q;  4U9R A;  3HDS A;  3PW7 A;  4DL3 A;  1C1C A;  3MEE A;  4O4R A;  1G2E A;  2HUR A;  4ZK7 M;  4RU2 A;  3W9H A;  2ROE A;  1NND A;  1RA7 A;  3AJ2 A;  2DB1 A;  5DDO C;  2U2F A;  4DL0 C;  3R5J B;  5M2P A;  2B56 A;  3IM8 A;  4WK1 A;  1RHJ B;  1H2T Z;  4TY9 A;  1L3K A;  4DX8 H;  1FDB A;  2C2Z B;  3PW0 A;  2C3Y A;  3ZTQ A;  4X65 F;  2R7R A;  3CC4 S;  2R2T A;  4ICL A;  1HNX F;  3JSM A;  2ZUA A;  1FVQ A;  2O5D A;  2RUG A;  4DR6 J;  2BQR A;  1YI2 S;  1KBR A;  2K3K A;  3RB6 A;  4LSN A;  4A8M P;  4TVA B;  2DRD A;  3SCI E;  5FD1 A;  2YQ1 A;  2F1F A;  4USM A;  4USU A;  3MEK A;  2VHG A;  4OJH A;  1B64 A;  4JOU A;  4RKU C;  3P96 A;  3KDN A;  3PX0 A;  4WYL A;  2KL8 A;  1KEK A;  4J90 A;  4C0H A;  1GT8 A;  5CZV A;  1NH8 A;  4UQT A;  4PCQ A;  4QYR A;  3W9J A;  1T05 A;  1HWK A;  1K9M T;  4DLG A;  4QW9 A;  3BRE A;  5C7P A;  3QAT A;  1K47 A;  2E1M C;  3TX0 A;  5D6G A;  2V69 A;  1VBZ A;  3MED B;  2IY5 B;  3IGV A;  3JQM A;  1Q82 T;  3AH6 A;  1VDH A;  3BB5 A;  3MMB A;  5J2Q A;  2BVZ A;  4AQY F;  4C8Y A;  1FFW B;  2I8E A;  2BV3 A;  4X4V A;  3AOC A;  5K5M A;  4LMZ A;  5THW A;  3I5B A;  3P5T L;  4EMD A;  2Y0S D;  4LF6 J;  3MM8 B;  2WON B;  3UVJ B;  3ICL A;  1RLD A;  4OYP A;  4RNM A;  5F8I A;  2AX1 A;  3ZTO A;  1XWL A;  2KO1 A;  2HMI B;  5KOX A;  2VBX A;  5IZH A;  3PY8 A;  4TU7 A;  5ITH A;  2QFI A;  4USI A;  1Q78 A;  1T9Y A;  3IBF B;  2D74 B;  4RW7 A;  3K5M A;  4JYA J;  2V0N A;  2IYG A;  4WZQ A;  2XEX A;  2LXF A;  3NBP B;  4YHH J;  3TVZ A;  5LMN J;  4FNI A;  3CCS S;  3UN3 A;  5KFW A;  4WCE Q;  1UJ4 A;  2NR0 A;  5DQI A;  3MOJ B;  4P72 A;  3Q8U A;  3HSG A;  2FJB B;  1NDK A;  1ZM3 A;  3VVU A;  2CFX A;  3DOL A;  3PO5 A;  2IA0 A;  2HFS A;  3PKY A;  3GIL A;  2AF6 A;  1BQX A;  2QA2 A;  3HI9 A;  4QIV A;  3T9N A;  3ZZU A;  1Q1K A;  1HBU B;  1U47 A;  1I6J A;  4OZL A;  2ZD1 B;  2FJX A;  3EJM A;  3C8Y A;  2A0F B;  1QAJ A;  1A7G E;  2E7V A;  1TUV A;  2OEK A;  1QE1 A;  2EW9 A;  1U8S A;  2ALY B;  4C3M A;  4PWW A;  3CJK B;  1RXO B;  2MTL A;  2AU0 A;  3TX8 A;  7AT1 B;  4M5N A;  2MZT A;  3AAW B;  3W63 A;  1MN9 A;  2V63 A;  1K1S A;  2YKM A;  4FYY B;  5B0F A;  3D28 A;  4CLF A;  3TQ1 A;  2VC0 A;  2CNK B;  2J5A A;  4ZPV R;  2M4M A;  1WOO A;  3TOQ A;  1BWE A;  4HR2 A;  3D0G E;  3TEG A;  3FCV A;  3FK4 A;  1FD2 A;  3HP6 A;  3S6E A;  3OL6 A;  3TVY A;  3MAH A;  2R8J A;  4FKY A;  5JUM A;  4A8K A;  4KO0 A;  3EXC X;  2OIH A;  1RU1 A;  2DH8 A;  3GR1 A;  1LWC A;  5DG8 A;  2J7U A;  4NLT A;  1U6Z A;  1P9Q C;  1HPZ A;  3IN5 A;  2R4F A;  3WC2 A;  2PFF B;  1S4F A;  2GVD B;  2WOM B;  4GVB A;  5E3Q A;  4NYZ A;  3IMQ J;  3KTQ A;  1RCX B;  4CLL A;  3V2U C;  2HKE A;  1YRX A;  4ITS A;  4AUK A;  1F9H A;  1P1L A;  1MRO A;  1N36 F;  5D0G A;  4FDF A;  2DKO B;  3DLH A;  3BN7 A;  5C24 A;  1BWV A;  2ERR A;  1HWI A;  2AYG A;  4QWC A;  4X65 J;  3DN9 A;  3R5A A;  3CSK A;  2VG5 A;  3D0H E;  2IBK A;  2MKJ A;  3PM9 A;  4EO6 A;  3DLG A;  3UI3 A;  1SJ1 A;  3LA0 A;  3NS7 B;  5KG6 A;  4DSE A;  4JV5 F;  1QDU B;  2VC1 A;  3RBE A;  1OY8 A;  3DKD A;  2F4F A;  1HBM A;  2P9C A;  3L09 A;  1RTZ A;  3LOU A;  3RB4 A;  1YHQ S;  1KON A;  4CLS A;  1Q79 A;  3BM7 A;  2ZFH A;  4Y2I A;  4JV0 A;  1RAB B;  1KWM A;  3KK1 B;  3U1N A;  2VQF F;  4PG7 A;  3QRP A;  4Q2L A;  2KM8 C;  2IJN A;  1OQ3 A;  2V4J A;  2PO4 A;  5SZT A;  2BM1 A;  2VU5 A;  2UVR A;  2UXD F;  1IKX B;  3HF5 A;  2RKI A;  5L38 A;  3AOA A;  3EGV A;  2CYY A;  2VF3 A;  2DGQ A;  2DEI A;  1WJ9 A;  1WHX A;  5LSL A;  2QL7 B;  2YWK A;  2DR8 A;  1MG7 A;  2PEB A;  4E0D A;  1GMW D;  1RT6 B;  2VFS A;  3PIP Q;  1C1B A;  2QIF A;  3TVK A;  4AQY J;  3O44 A;  4F4K A;  2BAN A;  3FRY A;  2J9C A;  4ECS A;  4IDK B;  1KN6 A;  5BYQ A;  4UZC A;  5KFN A;  1O8B A;  4U96 A;  2RF2 A;  2L08 A;  1D09 B;  4Y2M A;  5IOL A;  3RAX A;  2HK2 A;  4DSJ A;  2LLZ A;  4ZPB A;  4CLY A;  1IN0 A;  2F9D A;  2YTC A;  1KHW A;  2CJ9 A;  5CAA A;  4CLW A;  1LWF A;  5T41 A;  3LP2 B;  2YWG A;  2KG1 A;  5IFM A;  2CJK A;  2M8D B;  2FZG B;  1PBA A;  4ZLL A;  4FS2 A;  2ILY A;  3LUY A;  2CQI A;  4DCP B;  4TKT A;  3M2V A;  2IVF B;  1JKH A;  4FVM A;  3ZXW A;  2F40 A;  4DPU A;  3GIM A;  3LP0 A;  1SJQ A;  4BS2 A;  2MPU A;  2FD2 A;  5L8R C;  3QMQ A;  2CWX A;  2UUW A;  4ENO A;  3CCZ A;  5F3Z A;  1SH3 A;  1RGV A;  2V9W A;  3FSI A;  5KFO A;  3ZZ0 A;  2KDO A;  2C1E B;  2IFX A;  3C16 A;  2DVI A;  4O0I A;  1N5S A;  2HHS A;  5JJB A;  2KVI A;  1RT5 B;  1JXL A;  2BYC A;  4FF1 A;  3CCR S;  2X51 A;  3HCX A;  2WSE C;  1KQK A;  1H3D A;  4OV1 A;  4G1Q B;  3TAN A;  4G6V B;  1S59 A;  1GAO A;  1S48 A;  2AZ3 A;  3PJW A;  3P3D A;  4XO0 A;  2EBE A;  4ZPA A;  4LSL B;  4OYM A;  2WB4 A;  1RHM B;  1T9V A;  2F7V A;  1B0T A;  2R3V A;  3J81 U;  1XR6 A;  4CLU A;  2RRA A;  4PXC A;  1AUD A;  2MKI A;  1HL6 A;  3B8H A;  4BBY A;  1QAY A;  5BXI A;  1WTB A;  1B70 B;  1PJ6 A;  3T1A A;  2QX0 A;  5HP1 B;  4BC7 A;  4AXI A;  4C3K A;  1VOM A;  3B6B A;  4ER8 A;  4ED0 A;  1HA1 A;  4ZP7 A;  3TA0 A;  3H90 A;  5M2R A;  4DS5 A;  1U0S A;  1N48 A;  5EDW A;  3ZZP A;  2YKO A;  4ATN A;  1ITP A;  3MM6 A;  1NK6 A;  5K8O A;  1OY9 A;  3PR5 B;  2ZIT A;  5E3P A;  4ZJO A;  4DSF A;  2ADC A;  3QFH A;  2FLN A;  1H7W A;  5IXU A;  2HBZ B;  1AXQ A;  4ELU A;  4LFB F;  3KNG A;  3GFX A;  1DRZ A;  2HFV A;  4ECV A;  5GME A;  4F4W A;  4WFN Q;  2W9C A;  1N36 J;  2RE1 A;  4M5D B;  2D9P A;  4O23 A;  2WVC A;  1UVN A;  3MR7 A;  5E0O A;  3A8I A;  4Q0B B;  1KVK A;  1FXL A;  1Y4Z B;  3MCS A;  3FBB A;  5F0W A;  2VA3 A;  2HVE A;  1X0P A;  5JVG Q;  1VQ9 S;  3V6K A;  4G65 A;  2LP4 A;  2RQM A;  1ZOT A;  2W4C A;  1WEX A;  1WWH A;  4P9S A;  4DR2 F;  3CGI A;  3IC1 A;  4F0H A;  1YJV A;  3H8Y A;  4QPT A;  4F67 A;  4JV5 J;  3RZA A;  2P6S A;  3QQC D;  4ES2 A;  4ZKA A;  2ZKT A;  3MI7 X;  2LDY A;  2B4O A;  3V4M A;  1V5V A;  1DLO A;  1HLW A;  2XM3 A;  5A8K A;  3NGU A;  4G3I A;  1VBX A;  3CD6 S;  4B9L A;  3LW5 C;  8RUC A;  2AEM A;  2UXD J;  3KLV A;  2BUN A;  2BKN A;  3KLF A;  4DZD A;  2XO7 A;  2B8Q A;  1GTE A;  3QSY B;  4HVZ A;  1LW0 A;  2MYF A;  3NRB A;  1Y00 A;  1DQA A;  1JK9 B;  2FZK B;  2VKZ G;  1FRI A;  2F63 A;  1QAI A;  1M90 T;  3I87 A;  5ADZ A;  3V81 A;  1RWK B;  3SSS A;  2ROP A;  1H73 A;  2FGO A;  1N5T A;  1L3T A;  4FNH A;  2L41 A;  3G6V A;  3MPV A;  4GKJ F;  3BEG B;  1S79 A;  4NEY A;  1ZM4 A;  2YNG A;  4Y2A A;  3PFE A;  3MED A;  4MFB B;  4DN0 A;  1C0T B;  4L6V 3;  3WQP A;  1CS4 B;  4P10 A;  4EI2 A;  1IKW B;  2G2O A;  1KFS A;  1N33 F;  1RK8 A;  4IR9 A;  5JVH Q;  2HQ3 A;  5KT7 A;  2ATL A;  3ET6 B;  3W65 A;  1Q4R A;  4F4Z A;  4J37 A;  3MPW A;  1YJR A;  1VQL S;  1LWE A;  3PNI A;  3BSC A;  3AD8 C;  3U1M A;  5EN1 A;  4ZHR B;  5F8M A;  1G1X A;  2Q6B A;  5HMZ A;  5E3C A;  1WOP A;  3J7Y I;  4P74 A;  3UDE A;  3P6Y C;  2NUU G;  1KFD A;  1HBO B;  2OKQ A;  4TYA A;  5MLC V;  2AMC B;  4UZB A;  1QLN A;  2VON A;  4CP5 A;  5KFR A;  3RAQ A;  7FDR A;  2X1G A;  4JI0 F;  2RIL A;  5DG9 A;  1SV5 B;  2GV1 A;  3P4U B;  5DDQ C;  2B43 A;  2MXY A;  3C19 A;  3FCH A;  4EU0 A;  2B4P A;  1PYO B;  2BRL A;  4ECW A;  2XMM A;  4P7T A;  3KG4 A;  3R8Y A;  4Q2M A;  1RBO B;  2IYI A;  3G8Q A;  3H4D A;  1FNO A;  4F7V A;  3PW4 A;  1KQG B;  4KFB B;  2ZWP A;  2O3D A;  2R8I A;  3SFU A;  3TAR A;  5DG7 A;  3PEJ A;  2EG2 A;  2C3M A;  1FD8 A;  2ZD1 A;  5FII A;  2DHS A;  3LAN A;  3MMC B;  1OPZ A;  4WZM A;  1NK8 A;  2C22 A;  1ZZF A;  5EWE A;  4PQU A;  3QIP B;  5KFH A;  2AWZ A;  4QOT A;  4HKQ A;  2HS0 A;  4DF4 A;  1NJZ A;  1U1N A;  4LBI A;  5KFC A;  4LFB J;  5KFQ A;  4FXV A;  2BM0 A;  1TKX A;  4FF2 A;  1RUS A;  2DEJ A;  2FLO A;  4N7T A;  1HNV B;  3P45 B;  5C25 A;  2DGW A;  4RJV A;  3OHA A;  4DUZ F;  3QWU A;  4PWD A;  1S5Z A;  3UD4 P;  1HWJ A;  2XYH B;  2W2N P;  1Q53 A;  4C98 A;  1K0T A;  3KJV A;  3LGM A;  3SI8 A;  1B0P A;  3NCP A;  1RTJ A;  2K06 A;  2ZJQ Q;  1HW8 A;  1KRP A;  1XR5 A;  5E41 A;  2H1Y A;  1FDA A;  1HNI B;  2DNL A;  4WK3 A;  2EKN A;  3M9M B;  1NAQ A;  4KB7 A;  3EVM A;  1UWB B;  3GB0 A;  4QIE A;  1TMM A;  3UW1 A;  3TAQ A;  2JWN A;  2OJ3 A;  1K0V A;  4FF4 A;  2KXH A;  2ZJR Q;  2BR0 A;  2ZC3 A;  3OXL A;  5G0R B;  1NSQ A;  1KSP A;  3JTN A;  4DL5 A;  2J9D E;  1SH0 A;  4HL9 A;  3ISZ A;  3KYL A;  3TP2 A;  1A0O B;  3UE2 A;  2A1B A;  1NPR A;  1D3W A;  3FFI A;  5KFM A;  2OSQ A;  1JLC B;  1F3V A;  3HXM A;  1I94 F;  1RWW B;  3DU5 A;  3QAE A;  4PPD A;  3IO1 A;  2XYP B;  1CUL A;  4ZN3 A;  2G4B A;  2VUG A;  1RI7 A;  4F3M A;  4DPT A;  1VQM S;  2COL A;  1TL7 A;  3FNN A;  1HQU B;  4DN9 A;  2HRT A;  1YQH A;  2HHV A;  3WX4 A;  5B0E A;  4PAA A;  2MB0 B;  3QPI A;  3J7A N;  3KK1 A;  4LR7 A;  1XMQ F;  2EBG A;  4IG0 A;  1QTM A;  9ATC B;  1TU0 B;  4DSK A;  2ZBP A;  4NE9 C;  5LSR A;  4CH1 A;  3MFI A;  4GKJ J;  2HBY B;  3L4B C;  3AHP A;  1LFW A;  4NOH A;  2YNH B;  2I2Y A;  1TKT B;  4JBC A;  3T5H A;  4NLR A;  4KGV B;  3MGJ A;  2YKQ A;  1RT6 A;  4O44 A;  3SQO P;  2XZW A;  4HHH A;  4U6P A;  3KK3 B;  1N33 J;  4MIA A;  3HHE A;  2DNQ A;  2L9N A;  4USV A;  2HS3 A;  2PSZ A;  2IM0 A;  2DNR A;  4IDK A;  2DNH A;  2HBR B;  1SB6 A;  5E3A A;  2G0I A;  3GJQ B;  4RUC A;  4OYI A;  2BJ3 A;  3MM9 A;  1Q95 G;  4L74 A;  1R6Y A;  2MQL A;  4NLV A;  5KTQ A;  2CG8 A;  5JXS A;  3H25 A;  1RT1 B;  2MGZ B;  3MTK A;  1S0N A;  3LP2 A;  2PI5 A;  1XC9 A;  1TR0 A;  5AE3 A;  2C2N A;  5KT4 A;  2IA6 A;  2RS2 A;  4NLP A;  2BQ3 A;  1EET B;  4D3H A;  3D66 A;  5A8R A;  1UKU A;  3R2C J;  4O0N A;  2XY6 A;  1VQ8 S;  2DK2 A;  3THP A;  1HKA A;  2VQE F;  4JI0 J;  4J9S A;  2ZBQ A;  4QCL A;  2BKP A;  1T11 A;  2VH7 A;  3CMQ A;  4F4Y A;  1LXJ A;  3DM2 B;  3M8S A;  4DUT A;  4R5P A;  3G87 A;  3FKB A;  2DTJ A;  3GJT B;  1JB0 C;  2W2Q P;  2V67 A;  2X7I A;  5IC4 B;  1BGX T;  5EX3 A;  2C3U A;  3HVW A;  2EFN A;  5DJB A;  5F3T A;  2ADB A;  3IBW A;  3M8R A;  1WI8 A;  4B9S A;  4G1Q A;  1KNZ A;  2DCU B;  3Q8P B;  3UCU P;  2CPE A;  2I1R A;  1L3U A;  2W4P A;  4DL7 A;  4ALZ A;  3SXL A;  1WSR A;  1URN A;  3BO3 A;  2UVV A;  1RKJ A;  4Q7A A;  2ASD A;  3QZ7 A;  4HH1 A;  3KK2 B;  3HFK A;  3VGS A;  3SFG A;  1UEK A;  1SJ4 P;  5ETM A;  2AJQ A;  3QGI A;  2MSS A;  3D4J A;  2V8P A;  3HUL A;  4I7F A;  1O51 A;  2XLJ A;  1N0U A;  1LQ9 A;  1X4B A;  5J1E B;  1KC8 T;  2UV8 A;  1YTY A;  4WTY A;  1HFE L;  3T41 A;  4QU6 A;  5K8N A;  3R7S B;  3E3X A;  3N9U C;  1UWA A;  2KJW A;  1SBR A;  4DUZ J;  1MU2 A;  5BR8 F;  3NKY A;  3DI6 B;  1HBN A;  2ZOF A;  4QYZ K;  2HVI A;  5E3R A;  2AEF A;  4NLY A;  1KQS R;  4JV2 A;  4GKK F;  4XDC A;  1N6Q B;  1R8B A;  2AW0 A;  3VAI A;  1VQP S;  1SJF A;  3CDA A;  1I51 B;  1J5O B;  3RW7 A;  3DLK A;  3UCZ P;  1XMB A;  4M5D A;  1GMV A;  4GMK A;  1WOR A;  4OHZ A;  3W1Y C;  3MR6 A;  2ATC B;  2MJN A;  3WIU A;  4Y3C A;  2FQQ B;  1CJU B;  1SQF A;  1RBA A;  3RBD A;  2PD1 A;  4PPZ A;  1EKS A;  1UPM B;  1S0O A;  2FJW A;  1Y5N B;  4H4M A;  5J2N A;  4AL5 A;  5DLF A;  1L3S A;  2RJZ A;  1HD1 A;  2GIF A;  4B08 A;  5HSP A;  1S1V B;  1FJE B;  1YBA A;  4J9M A;  3EM1 A;  1I1G A;  2HGL A;  4CRJ A;  1KLN A;  2BAC A;  3R5C A;  2AHO B;  3W2V B;  1XMQ J;  3GJR B;  1MSW D;  3PV8 A;  1RA6 A;  2D41 A;  3QAU A;  1RT4 B;  4X4R A;  2B7B B;  2M0G B;  1O5J A;  2LQ5 A;  1R0B G;  4EYH B;  2RU9 A;  5I3U A;  3HHK A;  4UY8 5;  1E6Y B;  4CT9 A;  2IAJ B;  4ZCI A;  1DTQ B;  4OX6 A;  5CCL A;  3G82 B;  2UUA J;  1CC8 A;  5KAK A;  3PRV A;  4PXE A;  3F0N A;  2CQC A;  5CHC B;  1UMJ A;  5A6W A;  2XMJ A;  3DMJ B;  1D0E A;  4PUO A;  5EWG A;  4G1I A;  4MT1 A;  5K9F A;  2EFP A;  2R42 A;  1W2I A;  1XN9 A;  2CPH A;  4NI2 B;  5D77 A;  3K5P A;  3M2U B;  5EUH A;  3ZZY A;  3CT9 A;  4HLB A;  4M5I A;  4F02 A;  3CC2 S;  3C15 A;  2WVF A;  4WFX A;  4KGK A;  4L76 A;  3MPD A;  4L72 B;  2VDI A;  1U02 A;  1NBE B;  2IC3 A;  4BCA A;  2IRX A;  3A3N B;  3MMJ A;  1SVD A;  1RT7 A;  2DY9 A;  4WE1 A;  1KR4 A;  4W4M A;  3ET6 A;  4YR3 A;  4DPW A;  2VQE J;  3JAM U;  2K1R A;  2PA8 D;  2XWX A;  3OTB A;  4IH5 A;  3MEG A;  3K8V A;  4C8Z A;  2P9E A;  4B3S F;  3FMB A;  2ASJ A;  1VI7 A;  4ZVS B;  2F65 A;  3NMR A;  2OP5 A;  1C2P A;  3HZE A;  1WD6 A;  3BGL A;  1IVZ A;  2NCK L;  2A3J A;  2FY8 A;  4OYZ A;  1YWX A;  5KFD A;  4Y0F A;  1GH8 A;  3HSD A;  3UR3 C;  4IKA A;  1H6K X;  3VAJ A;  2NSB A;  2ZE2 A;  1FKO B;  2J7K A;  3U27 A;  4HDH A;  1FT8 A;  4IRD A;  2AGQ A;  1S1T A;  4RBT A;  4CO1 A;  5IM0 A;  4RR5 A;  4K2X A;  3PHE A;  1TVR B;  1YBT A;  5CYQ A;  2KU7 A;  1VQN S;  4J7C A;  4WP3 A;  2HSE B;  2DNK A;  3SV3 A;  4U8Y A;  3GCX P;  2WAQ D;  1VBY A;  1NRK A;  3OLB A;  1JX4 A;  1RLC L;  1IBC B;  5BR8 J;  5AE1 A;  4BLG A;  3RRK A;  3HKZ D;  3NNH A;  3QIP A;  3AD9 C;  3WIV A;  1X9M A;  3MR2 A;  3S1T A;  4GKK J;  4MJK A;  2YY3 A;  3BKT A;  3I9Z A;  1LK7 A;  4DG1 B;  3H59 A;  2KXN B;  4WBF A;  1NB7 A;  4B02 A;  2W7O A;  3K5N A;  4YEA A;  2JNJ A;  4ZVP B;  2P5V A;  4ZPD A;  2J6S A;  4F4X A;  4DV4 F;  3N6L A;  3KLH B;  2NXN A;  2R7T A;  1HNV A;  1IBK F;  3TZY A;  3DCA A;  4X84 A;  2RQC A;  3TJ8 A;  1NKE A;  1GQE A;  2XLI A;  2FGC A;  3BSA A;  3IRW P;  5IV3 A;  1H38 A;  3N5B A; 
#chains in the Genus database with same CATH homology
 5CAA A;  1B99 A;  3FKB A;  4FKX A;  3VVT A;  5C7P A;  2BEF A;  2DYA A;  4UOF A;  2AZ1 A;  1S57 A;  3FBE A;  1LEO A;  3ZTS A;  4DZ6 A;  3DKD A;  1NSQ A;  3B54 A;  3VGV A;  3NGS A;  4FKY A;  3EE3 A;  1WKJ A;  1HIY A;  1BUX A;  4ANC A;  1NSP A;  4S0M A;  2DY9 A;  3Q8V A;  3Q8U A;  1NSK L;  3BH6 B;  2B8P A;  3FBB A;  2HVE A;  2DXE A;  3NGR A;  5BXI A;  1EHW A;  1NCL A;  2CWK A;  1HHQ A;  1K44 A;  4F4A A;  1NDP A;  1NLK L;  1UCN A;  3ZTQ A;  2DXF A;  1LWX A;  1NDK A;  3DDI A;  3Q86 A;  3Q89 A;  3VVU A;  1NDC A;  4CP5 A;  2DXD A;  3ETM A;  3EIC A;  1PAE X;  4DI6 A;  1BHN A;  4ENO A;  1NB2 A;  1XQI A;  2ZUA A;  4UOH A;  1F3F A;  1WKK A;  2HVD A;  1ZS6 A;  3ZTR A;  5CAB A;  2VU5 A;  3B6B A;  3G2X A;  3NGT A;  3R9L A;  4KPC A;  1NDL A;  3PJ9 A;  3BH7 B;  3ZTP A;  3EJM A;  3VGT A;  1NUE A;  1PKU A;  3BBC A;  1S5Z A;  3FBF A;  3PRV A;  3VGS A;  3FC9 A;  3BBB A;  1B4S A;  1WKL A;  2NCK L;  3ZTO A;  1F6T A;  1MN7 A;  4EK2 A;  1HLW A;  4AND A;  1JXV A;  4WBF A;  3NGU A;  4O0N A;  3FCW A;  4UOG A;  3ELH A;  1W7W A;  1MN9 A;  4ANE A;  3BBF A;  1VYA A;  3JS9 A;  4W98 A;  3Q83 A;  3EVW A;  3ENA A;  4F36 A;  1U8W A;  1BE4 A;  3FBC A;  3EVO A;  3EMT A;  3VGU A;  1S59 A;  5IOL A;  4C6A A;  2B8Q A;  1NHK L;  1NPK A;  3GPA A;  2AZ3 A;  3GP9 A;  1XIQ A;  3EVM A;  3Q8Y A;  2HUR A;  4HR2 A;  1KDN A;  3L7U A;  3MPD A;  3WX8 A;  4DUT A;  3EM1 A;  3FCV A;  2BX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...