1NDPA

Adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
total genus 43
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndpA00
4ENOA 3Q8UA 1NDLA 5BXIA 3R9LA 3EE3A 2DXEA 1NDKA 3FCWA 3VGSA 1K44A 3VVUA 3FBEA 1MN9A 1F6TA 1U8WA 3PJ9A 1NSKL 3L7UA 1S57A 1HLWA 4DUTA 5CAAA 3ZTRA 4WBFA 1UCNA 1HIYA 3FCVA 1NB2A 4ANCA 3NGUA 1NHKL 2DXFA 2AZ3A 1HHQA 4ANDA 3ZTQA 1WKLA 3JS9A 3NGRA 2VU5A 5CABA 3Q8VA 3ELHA 2AZ1A 2HVEA 2HURA 3EVMA 1VYAA 3EICA 3ZTOA 4W98A 3DKDA 4CP5A 3GPAA 3NGTA 1NLKL 2DXDA 3FBFA 1PAEX 1S5ZA 4KPCA 3VGTA 1BHNA 3BBCA 3NGSA 1NSQA 1EHWA 3MPDA 3BH7B 3Q89A 4F36A 4HR2A 1NDPA 4UOHA 3VVTA 2DY9A 1BUXA 1S59A 4EK2A 3FBBA 4F4AA 3VGUA 4S0MA 1NCLA 3ETMA 3FKBA 1XIQA 5IOLA 1NSPA 1LEOA 3G2XA 3Q8YA 3VGVA 3EM1A 1BE4A 3BH6B 3EVOA 3EJMA 3BBBA 4C6AA 5C7PA 3GP9A 3ENAA 3FC9A 4O0NA 3BBFA 2B8PA 4UOFA 3ZTPA 3FBCA 1B99A 1KDNA 1JXVA 3Q86A 1WKKA 1MN7A 2ZUAA 4UOGA 3B54A 2BX6A 1XQIA 1ZS6A 3EMTA 1W7WA 1PKUA 3PRVA 1B4SA 3Q83A 4DZ6A 2BEFA 2B8QA 3ZTSA 3DDIA 1NPKA 1NUEA 4ANEA 3B6BA 2HVDA 2DYAA 1WKJA 2NCKL 4FKXA 3WX8A 4FKYA 3EVWA 2CWKA 1LWXA 1NDCA 4DI6A 1F3FA
chains in the Genus database with same CATH superfamily
5IT4A 3M8YA 4YY3J 4DL6A 3HCXA 1UL3A 1HNWF 3M9OB 2OIHA 1JK9B 1HI0P 2BJ3A 2V4RA 4NMXA 2PMHA 1FDAA 2G4BA 2VFVA 1JLEB 2V8VA 1LWEA 2DY1A 4JV2A 5DLFA 4OJGA 3LAMA 2B9WA 5KT5A 1VRUA 2V8HA 2HNYB 4K7QA 4ED6A 2A6MA 1FRMA 3WDOA 4Z7YA 1JJ4A 4DUYF 1JQGA 5E3PA 1DTQA 3OHBA 1KR4A 3ZZZA 2F40A 3SMZA 2ZKUA 3L7OA 1U47A 4ZVQB 3CCRS 4OYWA 2BANA 2YKMA 3CVKA 3DOLA 2GFFA 2YNHA 3CD0A 4DU8A 3G6XA 2GHVC 4LFAJ 3R5JB 1FDBA 2ZH2A 4YDDB 2VFRA 1FD2A 2PA8D 1PILA 1W7WA 4TVAB 4AUKA 3DYAA 3QPIA 2CQ2A 1R8AA 1O51A 3G86A 4L75A 3RYLA 3M2RA 3CDEA 3GSIA 2IRUA 1Q16B 4ZK7M 4LSLB 2BACA 2HNDA 2W25A 2F4VJ 2KZMA 4ZHRB 1DQ8A 5LXYA 2OP5A 3JS9A 3M2VB 1RA7A 4JI0F 1APSA 2K8GA 1KHVA 1R0AB 1Q8IA 1UWAA 5CYQA 4EEYA 2E44A 5HO4A 3NS7B 4DF4A 3BSAA 4DR4F 2MQNA 2KYXA 1VLYA 1IKVA 5KFOA 2HQCA 4Q43A 1VR6A 1VQ9S 3W8GA 1YBUA 2C42A 3LALA 4PWDA 4Y0FA 1RT3A 5C2GA 1AFIA 4WP8A 3BJYA 1TKZB 4YHHF 3NCQA 4RW8B 3V6DB 5B0CA 1TMJA 2NREA 1UVIA 1QAYA 2HAFA 2MYFA 2DO0A 3T1YF 5B0AA 4LFCF 3I0RB 1ZETA 3MMAA 3BGOP 1WHWA 2EWHA 4TLRA 5KFDA 2VFUA 4YB6A 3JYTB 1HW9A 1ZM9A 5DZ6A 3PV8A 3L3CA 4I2PB 4DSEA 4NXMJ 3OFHA 3UVJA 2FVSA 2DCLA 2ZC3A 2RHSB 4LUBA 4MYUA 4QZVB 2J9DE 1TK0A 5HMWA 5D6GA 1XNQJ 1X9SA 2G9OA 1GXLA 1TL3A 4FVMA 1CJTA 5KFTA 5H9FJ 4EYHB 4BS2A 5B09A 5CH7B 1NSQA 1HQEB 1ICEB 2L9NA 2HAIA 1K1QA 4X84A 4DPXA 1KQGB 4RNNA 5B0DA 1N4LA 1A0OB 3V81B 2OTJS 2KFNA 2MKIA 4DPYA 3AHPA 3MPYA 1H73A 3RBZA 3MR5A 4NLVA 1IN0A 3FJ2A 5AXKA 2HRYA 4O23A 1N52B 3M6VA 5M2PA 4QWDA 4Y2AA 2MGZB 3LUYA 1HNVB 2CZ4A 5KFUA 2OJ3A 2FHOB 2DXEA 4DSFA 1K44A 1UJ5A 2W8KA 4KQZA 3JAMY 4ZLPA 2CPYA 3OTBA 4EI2A 3NBPA 3PG9A 3AB2B 2HHWA 1Q4RA 2VG6A 4MAKA 2DBBA 3EGZA 5IQ6A 1RWKB 2O67A 3KYLA 2PDAA 2HS0A 2ZZMA 2B9EA 4QOTA 3G8TA 4K50A 4USJC 4QPXA 5L1JA 1KRPA 1F0XA 1JLFA 2AJ1A 2CA9A 4NLWA 3WC0A 4WIIA 3CJKB 3QIPB 5IC6B 2D74B 4Y2IA 4B9MA 4PQUB 2JLGA 4UOFA 1N33F 4OZ3A 2NXCA 1JXVA 1OQ6A 4C3MA 2Q1LA 2HQ3A 3OTDA 2W7PA 4JYAJ 4ITSA 3KKFA 2YX7A 2YH0A 2DHHA 2NCKL 2VPXB 3JTOA 1XC9A 3UCUP 5GAGI 5M2UA 4NYZA 3MEEA 4DN0A 5ETNA 5C42B 4X2BA 1H2VZ 3HSDA 3I96A 4ID5A 2LYVA 3HHLD 2E5GA 2CPEA 1N0UA 1BQMB 5KFHA 1DQAA 4ERDA 3PIOQ 4FVCA 3VAGA 4X66F 3I4PA 1XK8A 3W9JA 1YLXA 3N6NA 4C8MA 5I42B 3NKYA 4QR0A 1NLKL 4J9UE 3VAFA 3A3OB 2PN6A 4OYIA 1JLGB 2UVUA 1G4CA 2LVWA 2MJUA 3AQOA 3QWPA 2QMWA 2FHJA 4B08A 4S0MA 2W2NP 2G2ZA 3DGVA 5EWEA 4L74A 3ZFVA 3MUMP 2X1GA 4ECSA 2XHWA 4D3GA 1Q86T 1PC5A 2JEGA 1LW2A 1QAJA 2HS3A 2XO7A 4IOAQ 1N5QA 1RK8A 2MZTA 2FVQA 2E9RX 3RGIA 2A18A 4HHHA 2R8IA 5IT0A 1A6LA 3ISND 1WG4A 1VRTA 4NZ0A 2BABA 3PDNA 1BC6A 2FY1A 4F7VA 2XO6A 1F6TA 3GIJA 2H4YB 3HHNB 4YR0A 2GJFA 3M7VA 1RHJB 2BUNA 4KHPF 2I6WA 3MCNA 2CPFA 4ANDA 5ITHA 4LBHA 3DGPB 1TVRB 3Q8PB 4I68A 2J8SA 1KC8T 2H4WB 2DGOA 2EG1A 3CPWR 3KWMA 4ETZA 3IM8A 3I55S 4CO4A 4NRTA 1NXIA 4JI4J 4F4AA 3IG1A 2E5LJ 5AJ3J 2AP6A 5IOLA 1R43A 2NXEA 3O6QA 4OX9F 2K3IA 2EFVA 4USMA 4X65J 4LQ3A 5CZXA 2KDOA 4HTIA 4Z37A 2XLJA 5J2NA 4MMOA 4Q5VA 2BA9A 2H5IB 1NB7A 3M8PB 2FLLA 3F0NA 4RNFA 2N4CA 4ECVA 2JVRA 3DLGA 3KNGA 3OLBA 4UY8T 3D9BA 2HS4A 1G6BA 4RBUA 2VPZB 3MPWA 2V6AA 2V63A 4DV4F 2F3JA 3UE2A 1UAWA 3CWJA 5D8HB 4HDGA 4ES3A 3AA8A 1C0TA 2RU3A 1O5JA 1VC5A 2EG2A 3QJLA 2R8HA 2DNGA 1NHUA 1WF0A 4DX6A 4C11A 1RTIB 3TAMB 1RWNB 3M32B 3GV7B 4DMZA 4CLFA 1T05B 2QEXS 3MPDA 2ROGA 2CQDA 3DRRB 1IR0A 4BC7A 2A1BA 3PRBA 1GFWB 4M5HA 3VGVA 1EJ7L 3EVOA 2V4JA 5J1EB 2QZ8A 4LF2A 3DNCA 1UPMB 2CJYB 2RMLA 2DGVA 3R5AA 1PAUB 4LF6F 5DO2A 5KFCA 3MFIA 3B82A 4P6QA 3D1HA 1IKYB 5J1NA 2D69A 3ET6B 1F5CA 1DY3A 1GK8A 3DDIA 4QIGA 1KLNA 2R2SA 1RUSA 2UXDJ 3PFOA 5A8RA 1MW7A 5BR8J 3UNYA 3KJQB 1Y3KA 2J6UA 3C19A 3FUYA 3AJ1A 1YHQS 5E2QA 2QE5A 3QZ7A 3KJVB 3NNCA 1FTRA 4ZVSB 3OVAA 2YNIB 1V5IB 2XSJB 5HP1B 1S79A 1RT2A 3PO5A 4U9RA 2QN6B 1Y9OA 4KRWA 1LOUA 3TUIC 2CQIA 4IR9A 2C3YA 2ZD1A 3W60A 2XI3A 1XTZA 3VAHA 3G6VA 4DG1A 3DMJA 2XMAA 3UDLA 1Q8BA 1M90T 3DU5A 2NZCA 2HRUA 1QSLA 3QO9A 3I32A 1LK5A 3N01A 5K8NA 4UOGA 3Q2SC 5KG4A 3OT9A 3PW4A 5KFFA 3IR5B 3W66A 4KO0B 1U6BA 1EB0A 2CNOB 2RB7A 3IAM9 4DXLA 2LXFA 2VHGA 1S77D 2WHOA 5DDQC 2MZSA 4CTAB 5M2RA 5B0BA 1RTDA 1P9QC 2XHCA 3G96A 4OYBA 4Q8FA 2ZDPA 4MIBA 1FDNA 4CO5A 3K8WA 4OX7A 3IRXA 2B9XA 4J9PA 4PWUA 4UF4A 3ZO7A 1OIAA 4NOHA 2FJVA 3NGRA 5HLFB 4ZP7A 2IY5B 3LAKA 1FRLA 1RWWB 4OZNA 1HNXF 2V8GA 2R7WA 3FMBA 3H4DA 1JLEA 1YQHA 1RCXB 1KFSA 1YBTA 2CWXA 2HRTA 4HR2A 3DLLQ 3D6TB 1REVA 2HNYA 2B4OA 2WB1D 2AMCB 3EUNA 5KFJA 1MSWD 1WDDA 4MIAA 2XYHB 1SH2A 4QR2A 3PYFA 1OQ3A 4UY85 3TA0A 3W7BA 1TKTA 1J5OA 1N48A 3FK4A 1HYSB 5AE2A 1U8SA 2HHVA 1TV6B 1JB0C 1HA1A 3T6JA 5AE1A 4IOCQ 3PZPA 3HHKA 2IC3B 2Z56B 3FVYA 3QFWA 5F0WA 1EETB 3WX8A 1R6YA 1U26A 2IHR1 4XK8C 1RAGB 1UETA 1RDRA 2RRBA 3KLHA 4OZ1A 1X5SA 4P2XA 3F73A 1RYRA 1U1LA 1KTQA 2JH3A 1Q82T 4WK1A 2VICA 3QJJA 4RX6A 4A8WA 4AQYF 2DPJA 2FTRA 4IQXA 3T6BA 1CJVB 2H54B 2HFVA 2N7YA 4LSLA 2OMOA 5I3PA 2LXIA 2MKCA 1QAIA 4NCBA 2DD8S 4ILRA 4ZHRA 2HQDA 2E5IA 2IPOB 1X4AA 3H0PA 3M2VA 1TKDA 2W2MP 3PR4A 4CYUA 4FYVB 7FD1A 1U1MA 1IWGA 1R0AA 1N32F 1ZA2B 3H40A 4J37A 2M88A 5MAOA 2R7UA 4DR2F 3C15B 2K1RA 3PVXA 5C24B 2YWHA 2Q6CA 5LSRA 4B9LA 4F4YA 1PKUA 3M1VB 1U24A 1J2VA 4WXWA 1TKZA 2FLPA 3W63A 3Q8RB 4RW8A 5D77A 3V6DA 3TQ1A 1TUWA 1WG1A 1T9WA 3ETOA 3OTOJ 3ILJA 2AJ4A 2ZE2A 5THWA 3OFEA 5J2MA 2YPZA 4ELTA 4LF8F 1NRKA 2EFPA 1D1UA 2L08A 1O8BA 4NLPA 5E3RA 2E1CA 1Q95G 1G7CB 3THPA 2FZCB 5J2QB 2A0FB 4I2PA 1S99A 3AAWB 2HBZB 2HMIA 3QT8A 3JSMB 4J5OA 5HMXA 3T9ZA 4HEA9 1IKWB 3TVYA 1NO8A 2HVIA 4IFYB 5KG2A 3EDRB 1IR2A 1ZZNA 3PW5A 4V1Ak 4JV5J 1HQEA 3O3LA 3UFCX 2ZH1A 4ED3A 3R1LA 1ZM3A 2EEYA 4DL3A 1ZH5A 4DV6F 4NLRA 3Q83A 4N47A 5IZHA 4CI0B 3KHGA 2OAUA 2FVPA 3LP1B 4KGVB 1W26A 4P52A 2ZFHA 2DNNA 2HK2A 4TKTA 2AD9A 3K2YA 4X62J 2MZ1A 4O44B 4BHQA 2HKEA 1BQXA 2C1EB 2XY5A 2DRAA 2CYYA 3CCVS 3POTB 1LNQA 1C4AA 2EKYA 4DR6F 4JI2J 1DJ0A 1KD1T 2QFIA 1AUDA 2DR5A 4RWWA 4A48A 3MOJB 1HQUB 4DV1F 1GMVA 2V34A 5A8KA 3BEGB 3PACA 1FFWB 3VTIA 3KNAA 3QZ8A 2C2KB 2DHGA 3B4MA 2KKHA 4KSEB 5KAKA 5D4LA 3GIRA 3N6MA 2QLJB 3W5ZA 2I8EA 2XMKA 2CG4A 3HKZD 3NS6A 2APOA 2OKQA 3MEKA 3BR9A 2ATLA 1FFGB 3CJKA 3QIPA 1PYOB 2ATCB 3GYGA 2ZOGA 4KT0C 5GAHI 1IBKF 4NCGB 2HBRB 3TUJC 2RDDA 3W8PA 1BXNA 3KDOA 3NS5A 2RJZA 2ZH4A 3MR7A 2HBYB 1NSKL 1YVFA 2YKNB 5T14A 4I6AA 1SIWB 2ZBRA 4C9DA 2AEFA 2Z2MA 5C42A 5KFVA 2DCUB 3VALA 2I38A 1H2TZ 4ZVEA 1VQPS 1NHVA 1HHSA 2AYMA 3R6GB 5JVGQ 2G2YA 5D0EA 1VBXA 4LBIA 3M4XA 1JX4A 4K2XA 3ZZUA 1XNRJ 3NY0A 3JSRA 4FYWB 4ZVFA 4P71A 5I42A 1FFSB 1B7YB 4ZVTB 1VHFA 1RLCL 1JLGA 4IO1A 3QSYB 3MR6A 3BGUA 4LRFA 4N41A 1HL6A 2PGCA 3H4BA 2JEJA 1SPBP 4HACA 2BOAA 4ZPBA 2C2ZB 1H98A 4B9SA 5L9XA 2F5GA 3MCMA 2QLBB 3O44A 2PI5A 3VVUA 2LQJA 2MKSA 2MQQA 2UUTA 5KT4A 4ES1A 4PAAA 3CD5A 4TQSA 1X7VA 3HSZA 3A8EA 3D0GE 2VBZA 3CJ4A 2GCFA 1N88A 2CJQA 1ZAXA 3NLCA 2WVDA 3PTWA 4HHUA 1T03B 4EZ9A 4OIXA 4XO0A 4DWIA 2IA6A 1KOHA 1SL2A 2GNKA 2ZOMA 1NJZA 1T9VA 4DPOA 1WG5A 3IGVA 2JJ4D 1RWPB 4EBCA 2CKWA 5IM0B 1D09B 2MQPA 4I2QB 3KMSA 2GO8A 5KFQA 2P9GA 1ELOA 2DTJA 1YK9A 2ROPA 3E8OA 3W1YC 2D3OR 1SJ3P 1S6QB 1WSRA 1ZM2A 3DRYA 2V67A 5E3AA 4QPTA 1X4BA 3EGVA 3OXFA 3KK1B 2HK3A 1QUPA 1K0TA 4OX8A 1GH8A 4PABA 2UV8G 4J9SA 2FJAB 1UW4A 1FK9A 3LTOA 1FNXH 1NJXA 4X4UA 3CCLS 4DV0F 2GQ2A 2GX8A 1SUQA 2HHQA 5C5JA 2DVIA 2UXCJ 2HGLA 3G71S 2A6OA 4P9SA 4PG7A 4WFNQ 5D3GA 4DL2A 4M63A 1RT6A 1SJQA 1IQTA 3MPUB 3CJQA 2AX0A 2KZZA 3KLEB 1KWMA 3DI6A 1PYTA 5ETSA 4DV3F 4HLBA 2KT2A 4IH6A 1MNEA 1RTIA 2QA2A 1S0OA 2WONA 5F8MA 1PSDA 1T05A 1AW0A 5IC4B 1Q81T 2FB0A 1SXLA 3DRRA 2XMWA 3R2CJ 3S8SA 1UEVA 3OL7A 1T95A 2XBPA 2PO4A 3GYNA 1BGXT 2FGCA 5EUHA 2LDIA 2MMYA 4CLYA 4FF2A 4JP8A 3CF5Q 2WZ1A 1SVDA 2WOMB 2JZ5A 4ECQA 5BXIA 3R9LA 5H9EJ 3ET6A 3C6UB 1NK0A 1RHMB 1E6YB 1F5BA 2F8HA 1NK9A 3DRPA 5KFNA 1RTHB 1RWUA 4IYQA 2GMJA 2OI2A 3RAMA 5KTQA 5G0RA 1AZSB 3H25A 1YJWS 4JI5J 4Q0BB 4OHVA 2JWNA 4NRUA 4IR1A 1VQ6S 3GZ7A 1Y7PA 2N7CA 4HI1A 2R4FA 4RL1A 4LSNB 4B3SF 2VQFF 3FFIB 3FGVA 2KN4A 3IO1A 3PKYA 2LECA 1YJ7A 4U96A 1A9NB 2VA3A 4YFUA 3SQOP 1SJFA 4IRKA 1RHUB 2J0SD 3SI8A 1F9HA 1S1XB 3RAQA 2YX1A 5CYMB 1CC7A 1KDNA 2VDHA 3TRGA 5HQMA 3OTEA 1XMBA 5HBMA 1SI9A 4N5SA 3MWBA 4NMLA 4ZKAA 3MURP 1FCAA 1XR5A 2IVMA 2BMBA 2K06A 2DEIA 4IG0B 3GLJA 5KT3A 2XMTA 1WF2A 2QMUB 3A8JA 2Z4PA 3PFEA 2DJWA 4ZP8A 1UVJA 1UW9A 4ZJOA 2BYCA 2RILA 3AA9A 3VAIA 4KGXB 1L5UA 2UU9F 5F9NA 2R2TA 2FJWA 3GWCA 1M5PC 4H4OA 5KFXA 1SKRA 2BKOA 3W9HA 2HPUA 2N82B 4IH7A 2BM0A 2MHEA 1K9MT 1L3UA 3HHLC 4CLPA 5K14B 3HM9A 2NS1B 4DFJA 2VH7A 4DV5F 1RKJA 2A3JA 2DITA 4Y2KA 2FC9A 1FKAF 2FHJD 5IWAF 3Q86A 3J7YU 2D3ZA 5D4OA 3BSCA 2HQFA 3M6UA 1TZ0A 3BQ2A 2ADBA 2B3TB 1FX4A 5KFZA 1FDDA 2HFOA 5L8RC 2DHAA 1HNWJ 5B7WA 2HHHF 2BR0A 1SIZA 3Q24A 2VFTA 1F5AA 2WK4A 2JLEA 2DNPA 2K2PA 3OXGA 4RW7A 4ZLJA 3MEDB 5DDPC 1S72S 4B9TA 4NCAA 4CCHA 2Y1RI 1SQEA 3AD8C 4GC6A 1CEZA 4DV2F 4ZJLA 5ETTA 3RG6A 1EARA 2ERRA 4QYRA 4ZVOB 1P8GA 5KFSA 4DUYJ 5A6PA 1CJVA 4NLDA 2VQEF 1UVNA 3NCPA 1RAAB 4M5KA 3U1LA 3W5XA 2XGQA 2VB6A 1WTBA 4ECRA 2DNKA 4KH1B 1KLMB 2KO1A 4QW9A 2N3LA 3MZIA 4B17A 2O3DA 2XWYA 2VD3A 3FBCA 3C46A 3IR6B 4FXVA 2XNQA 3RUBL 2B43A 2UP1A 2IBOA 3C15A 5CYJA 3BV8A 3BB5A 2XULA 1J5EJ 2IA0A 2RAQA 4FKXA 5C24A 1RQ0A 2D3UA 1BWEA 4OV1A 2ZVSA 2U2FA 1KSPA 3M1VA 2CPDA 1GMUA 4C0HA 2DNQA 2IDLA 1HWJA 4GMKA 3OUYB 4TNOA 3TI0A 2LLZA 2RQCA 3KK2B 2Z2ZA 1ITPA 3OL6A 3PCOB 2VODA 2YNFA 5FJ4A 3R8YA 4P2MA 3M8WA 2YWEA 1WEXA 1KQKA 2C28A 2J9CA 2ZBCA 3H42A 2OEMA 4RZRA 4OYAA 3SFGA 2RT3A 3PY8A 4EK2A 4CNZA 2GVDB 5HVHA 1YIJS 2QV6A 3JSMA 1Y00A 4MTPA 4KGMA 4YHHJ 2AJ2A 1OPZA 4TY9A 3TEGA 1C2PA 1IXKA 1WC6A 3K59A 1R8PA 4R25A 1T02A 1WF1A 4LFCJ 2QYGA 1VQ5S 5LMUF 1K0VA 3P6YC 2BRKA 5KFRA 4Y2MA 3TZXA 3U1NA 2R9LA 2JL9A 5CHCB 1YX2A 4U6PA 2NZ4A 1KVJA 1B7FA 2DIUA 3LP1A 1NB2A 3I87A 1HPZA 5K8MA 1AYEA 5HJYA 4LFBJ 1AROP 2YQ1A 4MYTA 4EGLA 2QIFA 4NZ6A 4O44A 1VQ4S 1EQ0A 3M8QB 1FJGF 5F3TA 2VG7B 3POTA 2OPSB 4U8YA 4DSLA 2NSBA 3QQCD 7AT1B 1DTTA 4RNHA 4USWA 3FRZA 3DRSA 3D4JA 1N6QA 3AJ2A 2V9WA 2FZGB 3MM9B 1Q7YT 2MJNA 1FKPA 1HQUA 2L9WA 3GU0A 4I1TA 5ETQA 3RAXA 2MY7A 1PIEA 4DR7F 2QO3A 2ZWPA 3CGIA 3IS9A 1HARA 4C0OC 3PNIA 3B54A 2DGTA 2DISA 4L73A 4E0DA 2MKKA 3VR1A 2RQ4A 4HDHA 2WB4A 2QG9B 3Q0AA 2VV5A 3I5BA 4DF8A 2B5JB 3KLFB 5HATA 2HHPA 2IAJA 4O3SA 5F8LA 4J9QA 3UI3A 2KB2A 4NA1A 4CRJA 5LSLA 5HMZA 1UVMA 5ADZA 1ZA1B 5LJ5Y 1HNZF 2DB1A 2HLTA 2YKQA 3GJTB 2Y8WA 3K8VA 2GAHC 1FTCA 4C8NA 1EP4A 3KHHA 4WE1B 4ZA1A 2E5HA 2W4CA 1MWYA 5KFBA 2C2MB 4DFMA 3D5MA 3W62A 2MKHA 3Q2TC 1MMDA 4UQGA 5A0YB 3PW0A 4USIA 3BS9A 4O0NA 3NNAA 3V4IB 4DCOB 1B99A 2H51B 4M5DB 4K8RA 3G9CA 3IC1A 4K5SA 3L9ZA 4NLSA 1VQLS 1V3RA 2CPHA 4TXSA 3A4TA 3W3SA 2FHMA 5DDRC 4FKYA 1ACMB 1EKRA 4ZVUB 4LFAF 4F8RA 1NDCA 1RKIA 1FXRA 3J7YI 2RS2A 3D2WA 3BPDA 4LQ9A 1QUVA 2NQPA 2UVWA 1RYSA 3OJUA 1RAOA 3U27A 3PJXA 1S4EA 3AH6A 2O1PA 4X66J 4FYDA 1X4GA 5DLGA 3CCES 2N4DA 1RT4B 3J81Y 1SCJB 1XR7A 1PYSB 3FBFA 1PAEX 4CLUA 3QJPA 1MWZA 4Q45A 1I5OB 4TY8B 1RT1B 1SC1B 4NLTA 3GR1A 4URQU 4C98A 1DLOA 1S1UB 2GIFA 3EYZA 2I5JA 3DXSX 1WC3A 3C6TA 5KFLA 3M2UA 3MM8B 5C7PA 3M05A 4ZIVA 1R31A 5IM0A 3CSKA 4OFZA 1U4BA 2XCAA 4OHYA 3OL8A 2KH9A 4PPDA 4PUOB 1C1BA 2FJEB 1JLBA 4GKJJ 3EE3A 4DSIA 4PXEA 2YWGA 4OZLA 5GMDA 2M3DA 3DXBA 2EFQA 4A4JA 4QIEA 1CBKA 2V94A 1YJRA 4KHPJ 4TU8A 1EKSA 1JLQB 1G2EA 1GEHA 1X5OA 4B02A 3IA0A 3IBWA 1LWCB 1VS3A 5D4NA 2E5JA 3OVSA 5GADI 2E1PA 2GA7A 1ULRA 1P9YA 1RABB 3D7SB 1FE0A 1S9EB 5J1PA 4OX9J 4IQMA 2KXHA 1JNRB 1X0PA 4OJHA 1TUVA 3DN9A 2AJQA 1RACB 4DHVA 4GVLA 2IM1A 3NCRA 4BBYA 3WIUA 1YKWA 1R8CA 5T7LB 2ASLA 3MF5A 1S1TA 4YQWA 1FRHA 1RT5B 5ETKA 5HJXA 1NPKA 2MQLA 3QNWB 1NKEA 5HN0A 1RJJA 4G1IA 4KE5A 2M7SA 2F9JA 3GJSB 5HROB 2ZH6A 4XAKA 5LSOA 2AYEA 4DV4J 2CPZA 2UV8A 2CDRB 3U1MA 1UEUA 4Y28C 4DQPA 2X1AA 2VG5B 5I3UB 1PGZA 1CJKB 1X9MA 2EPIA 1IBLJ 1SL0A 3AJDA 5D0HA 2OTLS 3C6UA 3GIMA 1CG2A 3M8RA 2FD2A 1HBOB 3HVWA 4G1QB 2VJUA 1RAJA 1RP5A 3BH7B 3HVTB 2RE1A 2FYXA 4Y6IA 3P4UB 4J9RA 1U0SA 1RXOB 4N8OA 3UNGC 3UR3C 3BH6B 4EBEA 3N0VA 2H5EA 2BZ2A 4F0MA 3HT3A 1N56A 3MCOA 1RAHB 4HVZA 4F26A 1CS4B 3N79A 4CLZA 3SCIE 1ZPWX 5B08A 5FDLA 5A6WA 1WTFA 1GX6A 6FDRA 1DAXA 4LF1A 2HQIA 2K7JA 3NMRA 3MMCA 4QYZJ 3ENWA 3T41A 4YB5A 2DGXA 2PFDA 2HHXA 2OPQB 2NSCA 3LA0A 4ZN1A 2UUAJ 4RUAA 4F50A 5I4MA 4NXNJ 3KG4A 1U8WA 4XPEA 2YKAA 3TOQA 1P1LA 4JYAF 1PG5B 1AXQA 2F63A 4NE9C 3JQKA 1SC4B 4IG0A 4K4SA 2KFZA 1ZM4A 2BQRA 2OPPB 2BJEA 3CXCR 3I6PA 2FY8A 4HH0A 4FDFA 3F56A 4DSJA 3OV7A 2RH3A 3RB4A 1R8HA 3NGSA 5K8PA 2IYGA 4Y3CA 1PC4A 4QWBA 2J0XA 4XPCA 1OY6A 1Q78A 1XIQA 3QAUA 2AJFE 1JKHB 1YITS 4IKAA 1XBWA 2XM3A 2E1AA 3LP2B 1IM4A 2J5AA 2HVZA 1XQIA 5K14A 2D7SA 3QT6A 2EK1A 4HT7A 2ILZA 1R89A 1OS5A 1D9FA 2HNZB 1HI1A 3W65A 4BC9A 4DR5J 1P27B 3BSNA 5EWFA 2DRBA 5CA5A 4JI3J 1CULB 2MSTA 2FJBB 1CQNA 1DARA 2W4PA 1QAXA 4H54A 1T11A 2B4PA 2CQHA 2YQ0A 1HNXJ 4F0KA 1B0PA 1YTYA 4DCJB 1JJHA 4ZPVR 4RKUC 2MKJA 3MEDA 3I0SB 4Y2CA 3RU0A 4UOHA 3KXDA 2GAGC 1BUXA 1S59A 5D4PA 4RU2A 1QE1B 4GO5X 3BN4A 2ZJPQ 4M1KA 3CNQP 2Y1LB 1S0NA 3ITHB 4BCAA 4J9LA 3W2WB 4K2JA 3SDEA 2COLA 2Q79A 3CCJS 2X51A 2RKIB 2EFOA 3MM7A 4M5MA 4JI4F 3ZZRA 1CJUB 4ER8A 1W25A 5KFPA 4HHJA 2BVZA 5AJ3F 3CB4A 2E5LF 2I9SA 4PR6A 2YNGB 1MWQA 1TFWA 2OHDA 3RJMB 3D1OA 1ROFA 1B70B 4X65F 3EVWA 3D6HB 1RBLA 3IWLA 4X4RA 3MECB 2KRRA 1S49A 2OSRA 4IG3A 5KG6A 2LEBA 2GJ2A 3N5FA 4CO2A 4ED1A 4RW6A 1U2FA 4AQYJ 5FD1A 2GGPA 1R8BA 3I5CA 5D0RA 2M4MA 2OPRB 3L7PA 4GVBB 4PYDA 4F04B 3K5PA 1VIOA 3R27A 4JV1A 2PMZD 3JQJA 3US5A 1RAIB 4Z2XA 3KK2A 5JUMA 4RW4B 3ENVA 4ECZA 4O4GB 2Z58B 1N32J 2YKPA 1JLCB 3TNVA 2VKZG 1TP7A 3CMES 3SSSA 3A12A 3NRBA 3P96A 1RE1B 1LW0B 4EFAC 4YB1P 1Y10A 5B0GA 2HSEB 1HQ2A 3OD2A 2BE7D 2Y1IA 3MM6B 4MFBA 2GVDA 9RUBA 2NYHA 2CFXA 1VRQC 2IVFB 4AD6A 1WKKA 3HHDA 3OR2B 3CJ5A 1U1KA 2DH7A 3D28A 2BE2B 1NUEA 4ANEA 3X1LB 2DO4A 3FSYA 4I6WA 3HZGA 4DN9A 2X1BA 3BKFA 2MQMA 1V9OA 2UUCJ 3QLHB 3NGKA 1HBNA 1PJ5A 3J80Y 2HZVA 3BDPA 3PHTA 2J8AA 2AGOA 2BKPA 3UDEA 1S7HA 2UXDF 1FWLA 4NASA 5BR8F 2QTWA 2X3GA 3RRHA 4AT1B 2YX4A 1N5SA 2V69A 2BJDA 1S5ZA 2LEPA 4KFBB 1S1WB 2W2QP 3QGPA 2VG7A 2ZZNA 4DL7A 2AW0A 2ZH8A 5IT9Y 5DDOC 4ED2A 3DLEB 4LR7A 4KV8A 5IV4A 3BSOA 3BO3A 4F4XA 4LBPA 2JEFA 1RHRB 2ZITA 3MM5A 2JSXA 4DOZA 2SXLA 4MJKA 4L3NA 4DV6J 3ENQA 3QT7A 5GAEU 2QJ3A 2K3KA 4F3OA 2C3UA 1JMTA 4LR9A 2IVYA 4V19J 2AIRB 3K5OA 4WJBA 3HFVA 3A1YG 1RT7B 1IJEB 1RWVB 1SH0A 3OHAA 1KS2A 3HX9A 4M94A 5KFWA 1HMVB 3KLFA 2AGPA 1XEZA 4YMEA 2VBYA 2WRMA 3EICA 2N3OA 3UDCA 1NU4A 1K8AT 4ZMMA 4RBVA 4PZVA 5JMNA 1X5TA 4Q8EA 3IFEA 2B7CB 3KLGB 5J2PA 3LP0B 2KTQA 3RBXA 2RHQB 2RSQA 2ZM6F 3DLKB 5KT2A 3UR0A 1PCAA 1AA1B 2V2ZA 3FZ2A 2Q6BA 4GKKJ 4KC5A 3HPOA 3CCZA 2G1HA 1AT1B 4P2FA 3EGWB 2XEXA 4KR0B 4RUBA 1F9EB 3O1LA 1N5TA 2YKOA 1IBMF 4NI2A 1HD0A 4ED0A 3BZQA 1OY8A 1IBKJ 3LWLA 1H0HB 3D68A 2IMWP 5DQHA 1S6PA 4H4KC 3BYPA 3F44A 2FGOA 3QBCA 4P72A 3KLIA 1TL7A 1WKLA 1YBAA 4C0BA 5EX3A 4OI3A 4NLQA 2BJ9A 3GPAA 4DFKA 2BQUA 3PM9A 1VRUB 2HHUA 5C25A 4NL5A 1FRJA 2QL5B 1DTQB 4RPFA 4ECXA 1RWOB 1SKWA 5KG1A 3VCDA 4TN2A 3W2VB 4IFVA 1RT1A 4EMDA 1S7IA 4X4NA 2V0NA 3VAKA 3GSDA 2BANB 2ZHAA 3DOLB 2O01C 3HF5A 4ZPAA 1BMQB 1SB6A 2HQGA 3PO4A 4MT1A 2A2CA 3DYAB 1R0CB 4QJVA 2CWKA 4PG8A 1Q7LB 2AHOB 3T19A 4C8LA 1ZAWA 4EWTA 2IYIA 2V2KA 1QTNB 1NPRA 1UKUA 4PUOA 4QWEA 1HBMB 1S12A 3GV8B 3OTOF 3K7RA 3QGIA 4E8UA 4B9VA 2DNHA 1VQ7S 1SH3A 5DS7A 3NG8A 2Y3YA 2KJWA 3AODA 2OLWA 2UZAA 5CYQB 3CD7A 1FHTA 1D0EA 4RBTA 3AD9C 1VQOS 1WSVA 1YJ9S 1UA0A 2B7BB 2ZJQQ 2LU1A 2M52A 2W9CB 2XZWA 5CCLA 2F7VA 1VMBA 4OX6A 1O6XA 1QTMA 1UZDA 2XY6A 4EBDA 4PWDB 2BOPA 1GNKA 4J9KA 1RT3B 4HI2A 5IS2A 1S9EA 1P6TA 4M5NA 5KOXA 3P49B 3IMQJ 3SCJE 2J6TA 5K9FA 2EVZA 1NH8A 3JAMU 4C3KA 1KKHA 1GAOA 4ZJQA 3FNNA 4JV5F 3CJTA 3NGDA 5T7LA 3Q8UA 2R8KA 3CUNA 2GO9A 1RT5A 1XMOJ 1SBRA 3LQVA 1R3NA 4ZDNA 3D6MB 4AL6A 3DU6A 3MTKA 3C14B 4H4KA 3IWXA 3IBFB 5HROA 3UVJB 2DXFA 5E5NA 5JVHQ 2ACYA 4JUZA 1HNIA 1OMSA 2CVIA 1VFJA 2EBGA 2VG5A 2IMOA 5I3UA 1CJKA 2IFXA 1CJTB 4X62F 2ILYA 1VBYA 4PKDB 1NJIT 1HBOA 5ETPA 2ALYB 4G1QA 1U25A 3M8SA 3HFZB 2FLNA 2DGWA 4YS2A 1IKXB 3BO2A 3R5CA 2QRRA 2KM8C 3D1QA 1CS4A 4EUVA 2L48A 2ASDA 2ACMA 4ENOA 4O3RA 4DX5A 3K57A 3BM7A 3FCWA 5HQLA 1WOSA 5LOQA 4A8MP 1QDUB 1SKUB 2OPQA 4OI1A 1K73T 3NL0A 3R7BB 5AXNA 3SQGB 3NBPB 2MSSA 2FIUA 4Q2LA 3DLHA 3EVMA 1Z2ZA 3VHQA 4W98A 2WW8A 4A8SA 1JWWA 1TKXA 3UN3A 1J27A 2WBRA 3OL9A 1YSJA 5L1KA 4PYAA 5E3CA 1BY9A 1U1RA 4K4TA 2ROEA 4OLOA 1NCLA 3ETMA 3OXLA 2MKYA 1NSPA 5LMNJ 4Y34A 2P5VA 1RHQB 1TAQA 3EGNA 3CJ2A 2QX0A 3K17A 4Y65A 5KFKA 2ZC4A 1UTAA 2E7XA 3RBEA 3KMQA 3ZZOA 1VC0A 3G8SA 2R8GA 4FPRA 1M0SA 3OR1A 1VI7A 1JKHA 1UA1A 2W1BA 1NH7A 3JQMA 4KKOB 2XMMA 4TLQA 3UQSA 3LP2A 3CEDA 4QBUA 4DV7F 2ZHBA 4YR3A 3D0IE 3UD4P 1IBCB 4X4SA 1VQSA 1SV5B 3ZTRA 3FEZA 4F3MA 4OZ2A 4P7TA 1WC0A 2PI4A 5DRKA 1O0PA 1IR1A 1HHQA 3MAHA 3TZZA 4F4ZA 3I9V9 4CIOA 3LGMA 3MMJA 2XSFA 4CO1A 1VYAA 2UU9J 4CP5A 4X4QA 1TK8A 2AYBA 2IIHA 4KB7A 3QT5A 3E01B 1X8DA 2Z2YB 3PRDA 4F02A 2KL8A 1KOOA 4UW2A 4LJMA 3FKBA 1T9TA 2EC0A 2CPJA 4WFXA 4WIQA 3I0SA 4XDDA 2U1AA 4J9VA 4K0KF 1WORA 2P8IA 2RF2A 2E29A 2W2OP 1UFLA 3N9UC 1I1GA 5ETMA 3R1HA 2FPHX 3ITHA 3NWGA 1OY9A 3MHYA 3W2WA 3KG1A 1RTJA 4I56A 4WZQA 4CM2A 4B3TJ 2CQBA 2HHHJ 2JC1A 3CJSA 3V4MA 1U45A 3MMBA 4FF4A 1I94F 2OO4A 4URSA 2CJBA 4LF9J 1YRUA 2A10A 2OD4A 1M5KC 1SJ1A 4ECWA 2RRAA 1S10A 3E3XA 2VL1A 1S97A 4GVBA 3BGRA 2J76E 1NSAA 3RR8A 2GVZA 2UXCF 2KG0A 3ILOA 3MEGA 3DDNA 3IG1B 1X31C 1RGVA 4TQRA 4ALZA 5KFAA 2C2NA 2MQOA 3HZEA 4MK8A 1NKCA 2Z30B 3HSGA 2ZHOA 4IDKB 2ZH3A 1CLFA 5IXUA 2MQ8A 3MXHP 2B6AB 1A7GE 3MM6A 2R7TA 3B6BA 3EZUA 1IQZA 4ZCLA 3DLGB 4BLGA 4N7TA 2DGSA 4J9OA 3OR2A 1R7IA 1WDTA 4C8KA 3LPYA 2AF6A 3N28A 2BE2A 4LT6A 5KG3A 3KUGA 3H90A 1C0TB 2F8EX 2NR0A 2OD6A 2J9EA 2QC3A 2DHXA 1OJ4A 2XMJA 1N36F 3K5MA 3FZBA 4FS2A 5DQIA 2ZBPA 4WKYA 3P8BB 1UFWA 1TMMA 1HR0F 2GC8A 5KT7A 3R2DJ 2L41A 2NLWA 1UJ6A 3KLVA 4C8ZA 4AL5A 3GJRB 3LW5C 4DU7A 3D54A 1BE4A 1S1WA 2LXUA 1U48A 4C6AA 4P75A 3BGLA 2G2OA 5A2QY 3QRQA 2LU2A 4PG6A 4K4ZA 3UN5A 4USTA 2EFGA 4CNYA 2MEWA 1PJ7A 1WACA 1DURA 2G0IA 2V8DA 1WELA 3TWZA 4O3QA 1LWXA 4KYZA 3G87A 4X64J 1HHTP 1LWFB 3MFHA 4A8FA 5BYRA 3UD3P 1BQNB 2YWKA 3OFGA 1U1QA 5B0EA 3CT9A 1NPPA 3B78A 1B0TA 3C2PA 4M5LA 1EZZB 1DBDA 3T5LA 5KG0A 2B9YA 1H7XA 3AXKA 2CJAA 4CT8A 2MZJA 3D0HE 2QLFB 5E41A 2GQCA 1PBAA 4F67A 2ZD1B 3DFEA 5EHHA 2CRLA 2C3OA 2Q43A 4F3QA 4BWJA 3DMJB 5T41A 1VJQA 4DR7J 1OYEA 2ZOFA 3PW2A 4OZ0A 2DHSA 3CCTA 2ADCA 3I0RA 5CZVA 1WEZA 4K4WA 5L39A 4G3IA 1K1SA 2QL7B 4OYZA 3JYTA 1SJ4P 4OI4A 1B64A 1F60B 5DM7Q 1RTDB 5FIIA 2H9ZA 1FJCA 3VF0B 2MLYA 3PW7A 5GAGU 2KT5A 3HT0A 3EXYA 3PR5B 3E51A 2XLIA 3SCKE 5CAAA 2RQMA 1SKSA 1OPIA 1VJWA 3CTRA 2LA4A 3IRXB 2B0GA 3NXZA 2KVIA 4DDFA 4W4MA 1YJNS 2VBXA 5E3QA 3NGTA 3HJFA 5ETRA 3D3CJ 1FX2A 3PYDA 2DNZA 3D6FB 2QA1A 2JX2A 2E7WA 1U1OA 2F4FA 2DY9A 2JFDA 3V81A 2VF3A 4ZVHA 3C16B 1REVB 2QGFB 3ILLA 2DNRA 3EJMA 4NYPA 5DG7A 1TKTB 1J5OB 1RU2A 2XZTB 1T3OA 3WZ0A 2KI2A 2PD1A 4R0EA 2OEJA 4P74A 2WVCA 2L3MA 3H5XA 1HW8A 4O4RA 1RAEB 4MK9A 1QJHA 3W2VA 2MGZA 3N5BA 1ZYQA 4O3OA 1HNVA 3EXCX 4Q7AA 4EYIB 2W8LA 5A8WB 2NPFA 2R7XA 4KPYA 2AQ4A 2CQGA 4DPWA 3KLHB 1HD1A 4OHZA 1WOOA 4KJIA 1M1GA 1UWBB 1J5EF 2CQCA 4LF5F 2R7VA 1Q1KA 2FDNA 5MLCV 1UP1A 5CD4A 3OBIA 3GMGA 1HBUB 3B8HA 3O8WA 4ELUA 2OFHX 1CVJA 1HWUA 1N5VA 1FVQA 1HBMA 3TJ8A 2B56A 1EHWA 2CQPA 3Q89A 4DQIA 3A3NB 1HWIA 1H74A 3L09A 4CYUB 2MZQA 4WFZA 5F8GA 1E6VB 4PQUA 3V6HA 2YXLA 2ASYA 3IN5A 5IFMA 1F9FA 4WFBQ 2W9CA 2ZNYA 4W92B 2K1RB 3GFXA 2J0QD 1X60A 1MG7A 3ZZYA 1N8RT 1WC5A 2OGUA 4PPZA 3MTJA 4U95A 1RTZA 2MLZA 2C3MA 2RDIA 1BQMA 2ZE2B 3UWTA 3X3UA 5J2MB 1HIYA 4JI1F 1AB8A 9ATCB 2AZ3A 1FKOB 3TO8A 3C14A 1TELA 4DR3F 3VAMA 5DG9A 3BDEA 2HMIB 2CPIA 4MIWA 1YJTA 2D9OA 4TU9A 3RTVA 3IBCB 4LFBF 3OVBA 4IRDA 4H4MB 1S0MA 3H2LA 1RHKB 3GFHA 4JI7J 4LRAA 4UUWA 5KFEA 3TUZC 4DLEA 3C3LA 1U02A 4C97A 2RNEA 4ED4A 2W9AA 3LO3A 1URRA 1H6KX 4RLEA 5U47A 1B4SA 2DT9A 4PG5A 4L76A 3LH2S 4KY3A 5K8OA 2ALZA 2EXUA 4CLLA 3BKTA 2RVJA 1NK4A 5C2CA 1YZ6A 1SJRA 4OHWA 1IKXA 3OW2R 4NLOA 1GX5A 3VGSA 3HVAA 3KDNA 1TQLA 1M1KT 4CT9A 1MLAA 2HVHA 3UCZP 1X4HA 3VQSA 2ZEJA 3DGPA 1TVRA 3K5NA 4N56A 3K89A 1LFWA 2OUGA 4PG4A 2VZ9A 2G1DA 1WI8A 4QWCA 2HFNA 3JTNA 5H9FK 4ZPDA 1QSSA 5A76A 3O5TB 2ZH9A 1U49A 1VIXA 3H98A 1FI4A 3SQGA 3UO0A 3O2IA 4OYPA 3CC4S 4KAIA 1VHIA 2QT7A 5A8KB 3G6ES 1C0UB 2YH1A 1IJFB 4FN5A 3RBDA 4DL4A 2ABYA 2UVVA 4ICLB 3T5JA 4K4XA 3D67A 1NMEB 4UUXA 4C4WA 3FC9A 1IWAA 1BLUA 2BBEA 3HD1A 3AY0A 3M8PA 2HGNA 1MROB 2ZBIA 3BPSP 2ZWOA 3KFWX 1RWXB 3K0JA 1WD6A 4ZP9A 4ZIWA 4JB8B 4LVNP 3E2EA 2DR8A 3GCXP 1TK5A 3GB0A 5E0OA 3PJ9A 4QR1A 5H1SV 4XTTA 4KKOA 3JSYA 4WBFA 3D3BJ 2BV3A 4M95A 4OYMA 4ZITA 3ZZPA 1B3TA 1Q5VA 1U09A 3DLBA 4KH0B 3TAMA 2O5DA 4PXDA 2F65A 3M32A 4L3KA 1SV5A 3CO0P 2J9DA 5AXMA 3R6LB 3DHWC 3TX8A 1QVFR 4ZVGA 1FA0A 4YUDA 1M5OC 4UOCA 5J1EA 3E01A 3QWUA 2RRNA 3BBBA 4WP9A 3TW0A 4J7CA 2FJDB 3NWRA 1IKYA 2AU0A 2JC0A 3SV3A 4B3MF 4I7FB 1D3WA 2VJVA 3GJQB 2WVEA 4FNHA 1U1PA 4LRBA 4DX7A 2WTFA 1T94A 3I4HX 4ZLNA 3IWNC 5EN1A 2KRBA 3R5BA 4HACB 2OELA 2E66A 2UUBJ 2MB0B 4WXOA 4M5JA 3R7NB 4N76A 2UXBJ 3KJVA 4DS5A 2CZ9A 4ZVRB 4YP3A 4CO3A 3HMJG 3HULA 5E7OB 2YQ3A 2YNIA 2XSJA 1TL1B 5HP1A 5KFMA 4OQJA 5CABA 4TU7A 4GKJF 2JOQA 4DL0C 1QVGR 2AEJA 1JIHA 2WSEC 4OZ5A 1N34F 1WEYA 2YWWA 1PJ6A 4DSKA 3VGUA 4WF9Q 2FVCA 4DEZA 2HLUA 3C66A 3GCWP 3RZAA 1QSYA 1RAFB 3HHEA 1L3SA 4HL9A 2XCPA 2XTJP 4YR2A 2LFVA 3M8ZA 4R5PB 2XC9A 4I0WA 4KO0A 1FWPA 1JJ2R 1NK7A 4A8KA 4CTAA 2PT0A 1TU0B 3DDKA 4A8OA 2FLOA 5HANA 4DJBA 1M5HA 4IDKA 3ULHA 1T9XA 2PC6A 2J6SA 2G0CA 2BRLA 1FJ7A 2B6AA 3T1HF 3J7A1 3LANA 3VAJA 4PXCA 4X4OA 1FK9B 5HLFA 2WSFC 3CCUS 2KHCA 1TUGB 1RI7A 5RUBA 1Q0NA 1I3OB 1SUQB 3T5KA 3DC2A 3KJNB 3M30B 3KUHA 2DIVA 5F8JA 1FXLA 4P73A 5D3GB 1BHNA 2NPIA 1S0VA 4B3RJ 1RT6B 2VPYB 1IBLF 3THVA 3MUTP 3DI6B 1WC1A 3HKWA 4ZPWR 1HYSA 4EO6A 4TYBA 1FEEA 1U6ZA 2WONB 1TV6A 4JI6F 5G4DA 5BJRA 2QSFA 1HI8A 1DHMA 2HW3A 2IC3A 4IO9Q 3TARA 4DR1F 1RB0A 2CJ9A 1FESA 1QLNA 3PRVA 3EPIA 1U1NA 1JLAB 1EETA 5B0FA 1NBEB 2Y0SD 2R2UA 5HK4A 2DKOB 4MH8A 2BJ7A 2D3O1 3R7SB 4NEYA 3GTYX 3P45B 2VIHA 3L7UA 4LF7F 3CCWA 2IDEA 4CLKA 4CH0S 3DRPB 2X1FA 2CNNB 2UUAF 3UPFA 1U6FA 4A8QA 1XMQF 2DR9A 4CQ1A 2JRSA 5DJBA 5G0RB 4NXNF 1LWFA 2E1MC 4X4TA 1BQNA 1VBKA 3BGFA 4ES2A 1Y5IB 4OYXA 3OQ2A 3J81j 4LF4F 2HHSA 4EO8A 2ZZTA 2V2VA 3Q8YA 1G1XA 4JI8F 1DRZA 3TVZA 1T0TV 2HHTA 5L1IA 4QIVA 4MK7A 1Q8LA 4DPTA 3Q23A 3S01A 2LQBA 2FUG9 1MN7A 2VASA 4F4KA 1VCTA 4LIRA 2DK2A 1OWXA 2VDIA 5HBMB 3NAIA 4JI0J 4NPOA 1KQSR 4KGKA 1HFEL 4PXBA 5GAHU 2HZCA 4FYYB 2P9CA 2ZJRQ 4CH7A 3V5RA 4M5IA 4DR4J 5SZTA 1T7PA 3P3DA 1NHKL 5J2QA 4AL7A 1NK6A 1F3VA 3N6LA 1U0HB 3NMAA 1W2BR 3Q8VA 1F2HA 3ZZTA 1FNOA 4DR5F 3EPGA 2XYGB 1UFKA 1IKWA 3D66A 4JI3F 4WZMA 3AB4B 3QFHA 4IFYA 4H4OB 1N5YB 2HWHA 3T1YJ 1XWLA 3GE9A 1D9DA 2GIQA 4F2SA 3ADAC 1KEKA 2ZM6J 1KQFB 2HGMA 3MR2A 1R0BG 1OO0B 3H5YA 2Y0BB 2JDJA 3C16A 5K5MA 4QQBA 2KT3A 3AOCA 5KFYA 4C8YA 2H65B 4U8VA 3SYZA 4CWBA 1I6JA 2F9DA 1IBMJ 5HAOA 4RJVA 2PFFB 4ILLA 1VBZA 2GHPA 2CJXB 1NDKA 5K20B 4A46A 1MN9A 3PKMA 4KHMA 5A8WA 2DNOA 2Q66A 3IAS9 4NZ7A 4J90A 1X4FA 1OSCA 3I56S 4NA3A 4ELVA 1PBUA 4FPIA 4RW7B 3H20A 2Q3PA 2FVRA 2XLKA 1UWBA 2OFGX 4JOUA 5SUHA 3NP5A 2MZRA 2M8HA 1TFYA 1WHYA 1V5VA 3IM9A 1X9WA 4U7UD 1Y4ZB 1HBUA 4LVOP 3V6KA 2GW8A 3CMAS 1FJEB 4ZCIA 2VC1A 3JXOA 1FERA 4LR8A 1WC4A 3EDQB 4DUZF 1LKZA 4E98A 1LV5A 2Y9HA 4EZ6A 4OI0A 3W64A 1ZS6A 1CQMA 1E6VA 1EIYB 3T1AA 4DZ6A 2BEFA 3CDAA 3LWMA 3P5TL 3SSRA 4KGZB 5JXSA 3T3FA 1KTVA 4NCGA 1IVZA 2ZH5A 1URNA 4G65A 4YY3F 3SCLE 2YKNA 1MMNA 3R97A 2B4VA 1JNZB 3WQPA 4AE5A 4WTYA 3R5GA 4USVA 2EK6A 4YOEA 4DQQA 2XS5A 4MKVA 3AOBA 1WNEA 2EI5A 2YNFB 4RU9A 3HLUA 1F2GA 4F0HA 2UUCF 2M5YA 2CQ3A 4ZVPB 1N33J 2AJ0A 3G8QA 4YN3B 3C8YA 1Z4UA 1FKOA 2H1YA 1RADB 2MHNA 1S1VB 1NK8A 1AFJA 1LEOA 2AYGA 5ETOA 1NEEA 2X3DA 3HHLB 3TAQA 3NAHA 3TA1A 4H4MA 4ZPTR 2PEHA 5HQ8A 5EWGA 1Z2LA 1TTHB 1GMWA 3EWGA 3S1TA 3FSIA 2GMHA 5D15A 3TA2A 1WOPA 3M6XA 2FHKA 3KUEA 1WKJA 5LXRA 2DR7A 1REGX 1UVKA 1NZ8A 4UZBA 3VWSA 1NDLA 1Q5YA 3CCMS 3KTQA 5L46A 2W7AA 1S4FA 1SQGA 4P2SA 2PE8A 4FS1A 1KONA 3RW7A 2F4VF 5KT6A 4N77A 3L4BC 3GFYA 1HPZB 2AZ1A 2B4UA 2HURA 1OYDA 3FEYB 1T03A 3VV2B 1VQYA 3NEKA 2LQ5A 3BN7A 4K5RA 4LSZB 2MY8A 1DTTB 3A13A 5DGAA 2Z57B 4I2QA 3DRSB 1NK5A 2I0XA 1N6QB 2BJ8A 4URGA 4AXJA 4QU7A 1HWKA 2HBQB 3HVRA 2IJFA 2W9BB 1FKPB 3GR0A 2HFUA 1I51B 1U7LA 2P6TA 2Z0GA 1S6QA 1C0UA 2H48B 2VPWB 1LXNA 2GHWA 2YVSA 3G4SS 4ICLA 3IS9B 3KK1A 4G6VB 2OH2A 5F3ZA 4OL8A 2VOOA 2EBEA 3H2VE 2ASJA 1MROA 3BO4A 3RB0A 3AOAA 1UJ4A 4GKKF 5HI7A 4OI2A 1KVKA 3J81U 4NXMF 2IAJB 3CC7S 1UCNA 1M1HA 4C3LA 4DLGA 4FXWA 2WCXA 2ZNZA 2GJIA 5F0UA 3KK3B 1Z1ZA 1XNQF 2JLFA 1Y0HA 2C2OB 1NAQA 2BJ1A 3MOZA 3RB6A 3KLEA 2QA4G 1NZAA 1EP4B 3PJWA 2J0WA 1MMLA 1NDPA 1KNZA 2R7OA 5I3QA 2KJVA 4I6YA 2MPUA 4HH1A 2QL9B 2KYZA 4NX9A 4WPAA 5ETLA 4IRCA 2V5HG 1FE4A 5DG8A 3L95X 2B8PA 3FMWA 3H7HB 1TL4A 5F9LA 2Y8YA 4DPUA 3A8KA 5DGBA 3GIKA 6FD1A 2PSZA 2XB2D 1T8EA 4UTGA 2WOMA 4I7FA 1E6YA 4DV7J 4HYKA 1RTHA 4USUA 4E2FB 1HLWA 2VA2A 1ZZFA 3AFGA 4X4VA 5D0GA 1AZSA 4PCQA 1RWMB 1YGYA 4Q0BA 1OSDA 3I5AA 3HFKA 1S9GB 1N0VC 2KHDA 2EW9A 2DH8A 3R5DA 4LSNA 5AXLA 5FLXY 3FFIA 1TL1A 3HI9A 2XQCA 4LF6J 3FRYA 1VQ8S 2PIIA 3DOMB 4CDIA 3J7ZT 3K5LA 5LJ3Y 2UVRA 4Q2MA 1Y5NB 3J7AN 3CJRA 1G3OA 2EC2A 2H5JB 2RUGA 1DLOB 1VISA 3WC2A 1S1XA 2H3EB 2I5JB 2YY3A 4OYOA 4K0KJ 5CYMA 3RR7A 1IM6A 3C6TB 2CQ1A 3M2UB 1KN6A 2RD5C 3H5UA 3QAEA 1Y11A 2GIRA 3MR3A 3SV4A 2JFKA 2LDYA 4BDPA 4OJ1A 2LQ9A 4U7CA 4DS4A 4R5PA 1F3FA 1WWHA 2QMXA 2C2RA 5IV3A 2CPXA 4WKRA 1I94J 1C1BB 1JLBB 2WVBA 1B0VA 4P7VA 4ID8A 3LGNA 3NOGA 3DHXA 4I69A 2WSCC 2M70A 4USKA 1HWLA 1RBAA 3ZTOA 3DKDA 1XMOF 2WVFA 1M5VC 3THTA 2F1FA 3WBZA 4R8UB 1NJYA 3U02A 4UZCA 1JJCB 1EX8A 5FLXU 3OJSA 3QSIA 2V4QA 5CD4H 1RBOB 3M30A 1FRXA 2XGPA 4FXDA 2XWXA 2LMIA 4GRSA 1X0FA 1EQMA 1YRXA 3ZZ0A 2XNRA 5IQQA 1Y5LB 2OEKA 5F8IA 2Z2LA 2G0JA 3EZOA 3DM2B 2RIJA 2RUSA 1VQMS 1YJVA 3QGHA 1S1TB 3ZTSA 4Y00A 3KHLA 2E9ZA 2LP4A 2CZVC 4C7QA 4A47A 4B9UA 4B9NA 4PQAA 4XIUA 1JLAA 2Z8QA 5D78A 1GT8A 2W24A 2L9DA 2R2RA 2CXEA 1N36J 2DH9A 2WBMA 2IRXA 1KFDA 2IJNA 4ZS6A 2CDQA 2IBKA 1HR0J 1F1BB 4KPCA 1S6OA 2XI2A 3FEXB 2AWZA 4ED8A 5CCMA 1H3DA 4EU0A 2GV1A 1KLMA 3RB3A 4QW8A 3DOKB 1SQFA 1CSJA 4Q44A 3UW1A 5LL6d 3CO9A 8AT1B 4PEOA 3A8IA 4ZLLA 2BW2A 5FDLB 4FF1A 3CMQA 4LREA 3TZWA 3CC2S 3PX4A 4FBTA 5LMNF 3SBMA 3MMCB 2R7SA 2JHEA 2JVOA 2QSWA 2DNLA 2W7OA 4OHXA 5H9EK 3OUYA 4O3NA 1QY7A 2J7KA 3GYXB 2YPYA 3J7Z5 1WUUA 3WHIA 3GQCA 2WW4A 2P9EA 5L38A 2HFZA 2AT1B 3GG0A 4GO7X 4CZCA 3TVKA 3I9ZA 1K47A 2OSQA 2XMUA 3PYEA 1S48A 1CC8A 1FT8A 4ETXA 1GTHA 1XJWB 3KHRA 4DR2J 2NUHA 3GV5B 1GXTA 1U0HA 4RW9B 3SIPB 3F41A 2BQ3A 3M9NB 2ZH7A 2VUGA 5BYSA 1C1CB 1S6UA 1N5YA 2LEAA 2RU9A 3HXMA 1VK3A 4TYAA 4ZCKA 1SC6A 4HT5A 2CVEA 2NXJA 4LF8J 2DGQA 2BX6A 3HO1A 1M5SA 3B4DA 2AKWB 2HIQA 2F8MA 2CUYA 4A8YA 3H59A 3QMQA 3BQ0A 4W90B 1Q8KA 4RNMA 5CXTA 1KBRA 2XG8A 1QM9A 5EDWA 4B3TF 2DGUA 3M8QA 1MU2B 2V68A 4KBIA 2OPSA 3IGNA 1NJWA 4O3PA 2DPIA 2C2EA 3MM9A 3AT1B 4NEZA 5DM6Q 3BR8A 4LF9F 4R0JA 4CLSA 4YEAA 5F41A 2W2PP 3DRXA 5BYQA 2X7IA 3OPKA 3AD7C 3MAAB 3TZYA 3ISNC 4PRFA 4NWBA 3BBFA 3WX4A 1C4CA 3CJ8A 2HWIA 4F2RA 3CJ0A 5F8HA 2E7VA 2CIMA 3LGHA 2M9KA 3SDEB 2VFSA 3EMTA 3CIMA 3H2UB 3CJ3A 2DEJA 3MM7B 3QGGA 3DCAA 4ED7A 4DR6J 3BREA 2R3VA 3J80U 2RQKA 2B5JA 4B3OB 5KOWA 4ECTA 4IG3B 2FQQB 1S57A 4DV1J 3FCVA 1D8YA 1H7WA 4RW6B 4LF5J 2BXJA 3QIDA 3FSXA 2GGPB 3DLJA 3MI7X 1V3ZA 1YDLA 3OSPA 4MKAA 3G82B 4WE1A 1ZTWA 3U7JA 3CDBA 3OTCA 1RA6A 5IT9U 4D3HA 4DFPA 2DR6A 3ZNJ1 5HVFA 5GADU 2VONA 1FRKA 1RCOB 4OLPA 4WFAQ 5HL7Q 5A0YA 1UPPA 3V4IA 1SC3B 4WYLA 2I2YA 1S1VA 4J91A 4M5DA 2J7UA 3IR7B 4MFBB 2QA4S 2KU7A 3HHLA 4G1PA 4LIWA 2AX1A 2HYIB 2D9PA 8RUCA 3IRWP 2ZDOA 4XDCA 3JB9k 4L6V3 2UUWA 1LWEB 1D8ZA 2YBVA 2YWFA 3MCSA 2CQ4A 3TQEA 3OSNA 3CIZA 1HBNB 4JI1J 1HKAA 3KOAA 3NGUA 4MKYA 3Q8QB 1RT4A 1RISA 4K59A 1UEKA 3LF0A 4RUHA 1VC6A 4DR3J 1LQ9A 4I67A 2C22A 3KG0A 4X64F 4TY8A 2YKMB 4A8XA 1W2IA 2YNHB 3PHEA 1X4CA 2V9KA 3BKUA 1S1UA 3CCSS 1VGYA 3PXGa 3FBBA 4DQRA 3BF4A 2YTCA 1BD6A 2RS8A 3G2XA 3MM8A 4J9NA 3GG1A 3ZXWA 1VDHA 2VKRA 5CQGA 4NLYA 1VLOA 1T9YA 4KV8B 4O0IA 2ZBQA 3MM5B 3M2RB 2W9BA 3T9NA 2B8QA 3S6EA 2NUUG 1FWKA 2I1RA 2HVDA 2D1CA 2HNDB 2FJXA 2ZKTA 3IP0A 3TJ9A 1WHVA 2HFSA 3Q8SB 2O66A 3CCQS 4JV0A 3MD1A 2IRYA 4AYBD 1LXJA 1JLQA 4F4WA 2IJRA 2M0GB 1X4EA 2R7QA 3TANA 3HSJA 1LWCA 2VOPA 1IKVB 5LT5A 3GONA 3UDVA 3QRRA 1NNDA 3I31A 2R7RA 1UVLA 4L72B 1FVSA 2ZVIA 3AQPA 2XYPB 4K4VA 3KK3A 2D41A 3VVTA 2E1RA 3CD6S 4NLGA 1TR0A 4CO0A 3BQ1A 5J2PB 3RW6A 2NYIA 2EKNA 2XY7A 3CE8A 1DZ5A 2MTLA 3MGJA 3MMAB 4ZN3A 1L3VA 3PX0A 2IM3A 1CPZA 3MUVP 1FD8A 2CAJA 4QCLA 2BM1A 1UMJA 3FCHA 3HDSA 2ZUAA 4IH5A 3JTPA 1VQKS 1X5PA 2R8JA 4DV0J 2R42A 4NI2B 3IXQA 3MDFA 3GFZA 4X4PA 5DETA 3GIIA 4KIAA 1TL3B 2LKZA 2IM2A 1VOMA 3SSQA 1S6PB 3ZNUA 3ICLA 4RNOA 3CW2C 1YRTA 4DV3J 4AXIA 1FF2A 1WHXA 1VQNS 3KLIB 4OV6A 1TL7B 4JI2F 3TR5A 2HVEA 1P1TA 4ATNA 4HKQA 4OMFG 1RU1A 2BW7A 3VGTA 3HVTA 3H5SA 4M5GA 3BBCA 3HK2A 3P5BP 5GVQA 4ZPCA 1S9GA 5C25B 2V2QA 4QIWD 1T9UA 2GQQA 2QFJA 2HG4A 3DOMA 4LRCA 1Q79A 1LK7A 4QIFA 4IFVB 2ZUGA 3SEOA 4B3MJ 3GILA 4OI6A 5GAEI 4YB7A 2DNYA 1ZPVA 4DZDA 1KP6A 3MAQA 1R27B 1EAYC 4UQTA 1S76D 4AFFA 1FEHA 2W4DA 2VG6B 2KXNB 4NLXA 5HMYA 3TAPA 2V8PA 4BWMA 3Q22A 1TL5A 4FZVA 3PEJA 1ZTTA 4B3SJ 2VQFJ 8ATCB 2OPPA 4ILMA 3MPVA 3ZTQA 3WIVA 2KVQE 4FF3A 2CJKA 2PEBA 5AE3A 3TX0A 3ILIA 1LFPA 3UN2A 3PX6A 3M9MB 2DRDA 4WU3A 4DX8H 1YZ7A 1JLFB 4QWAA 4HTJA 1YI2S 2FC8A 3MD3A 3TEHB 1N34J 3NNHA 1RSCA 1XNRF 3H8YA 5EGYA 4DL5A 4OZJA 1FRIA 1KVIA 2CNKB 2OMLA 2CQ0A 4WP3A 2W01A 4R8UA 3TUPA 2K7KA 3M6WA 2JEIA 3VZHA 3BYRA 1RZMA 4ECYA 3TJAA 3VZIA 5GMEA 2B51A 1L3KA 3MEEB 4MKBA 2CG8A 4ID5B 2MXYA 4JI7F 5L9NA 2NXNA 4DQSA 2HNZA 1N54B 3DM2A 1JXEA 3T1HJ 1FNMA 1CULA 1X4DA 2GZOA 3PEHA 3LOUA 1Q53A 1GMWD 3W61A 1YJUA 5AT1B 1UZHA 2VBWA 1U2CA 2NXUA 4ZOSA 2VU5A 4NLUA 4FBUA 2KXFA 4ZCMA 4DCPB 4IOBA 2XS2A 4DBQA 1HNIB 3N4WA 4C8OA 5LM7E 2G13A 4DV5J 2PMWA 5F8NA 2LCWA 1GXUA 2CNLB 4F36A 4U67Q 4J9MA 1QE1A 5IWAJ 3CDWA 1LW2B 4CH1A 1DFDA 1U2RA 3QYYA 2HZAA 4JI6J 1L3TA 2IM0A 3LPEA 3FQLA 3QATA 2DNMA 2RKIA 1VRTB 1BWVA 2P2CB 1CJUA 3KJFB 4DR1J 5EX0A 3DOKA 2YNGA 1SL1A 4FNIA 1TAUA 2LA6A 3JSBA 4C2MA 3ONQA 3T5HA 3UCGA 3MECA 1GTEA 4KTQA 5HSPA 4DV2J 2JNJA 3RRKA 4IUFA 4Z7CA 4WFYA 1XR6A 4LF7J 2BDPA 2QYCA 3I82A 1KHWA 3TP2A 3CULA 3OFFA 2OPRA 1WI6A 2VQEJ 5KFIA 1DQ9A 5KFGA 2AV5A 1XMQJ 1V6HA 2AGQA 3ELHA 5HVGA 4C48A 3AXMA 2DXDA 4RW4A 1ZAVA 2GMLA 4O4GA 1TKXB 7FDRA 1JLCA 1QD1A 4LF4J 1Y3JA 4F25A 3VQTA 4WYWA 1LW0A 2XZDB 5J2NB 4JI8J 3ISZA 2BKNA 3TYTA 3EM1A 1YWXA 3FQKA 4RWXA 4RW9A 2P6SA 3SFUA 3ENAA 4M8LA 3ZTPA 1H2UX 3R3TA 5DZ7A 1T3NA 4CLWA 4WTOB 4U7UK 4K4UA 4QYZK 1H72C 4P10A 5KG5A 3RRGA 4QU6A 1C1CA 1S9FA 5E33A 2EFNA 3OR1B 5KG7A 3FDSA 3QLHA 4ED5A 4NYOA 4C11B 2KG1A 3FBEA 2C3PA 2BE9B 4RUCA 4GC7A 2MLXA 2POKA 2M2BA 3QRPA 4I4BA 4ANCA 4RR5A 1ZBTA 3SXLA 4PWWA 4NA2A 4WU2A 3G6YA 2A2DA 4JI5F 2UUBF 4KFBA 1YG0A 2UXBF 1NKBA 4JBCA 2V4JB 4RO0A 3PIPQ 5L1LA 2VC0A 2RDJA 1R6VA 4I64A 3ZC4A 2QLXA 2E9TA 1WJ9A 1MU2A 4V19X 2C2DA 4UT4A 5LMUJ 2HWTA 3DLEA 4LMZA 2J7WA 3K58A 5DQGA 2FZKB 5ETVA 2V50A 3EZ5A 2QLWA 1AUSL 3S7RA 1JXLA 1VK8A 2RF2B 3HP6A 1H38A 5A8RB 3W5YA 4N8NA 2KFYA 3MAAA 4LRDA 1V3SA 2HEKA 4ECUA 4OJ3A 2KM8B 4CM0A 4USHA 1GQEA 1RTJB 1RT7A 2HIYA 3W9IA 2Y1JA 1FO1A 1FJGJ 4YDXA 3CDUA 1XERA 3OLAA 4FYXB 1RT2B 4DUTA 1XN9A 3MMBB 1PO6A 1ZOTA 2XMVA 1HMVA 3SZ2A 4B3OA 4K4YA 2AEMA 1RLDA 3NOCA 4FP9A 1NM2A 1FXDA 3PYGA 5GMKa 4DG1B 4KHRA 3KLGA 3LP0A 5JJBA 3QO9B 3HD2A 4CLTA 2GS8A 3BGRB 3G82A 2LQ8A 3DLKA 5A2QU 3HJVA 4ZP6A 4WCEQ 2GVZB 1IUJA 3EX7B 2MDAA 3MEGB 2PA3A 3GP9A 4DUZJ 2XS7A 4B3RF 3A3PB 3V6JA 4WK3A 6AT1B 2WAQD 1D9AA 1HNZJ 2CADA 3UD5A 2DYAA 3V2UC 2M8DB 4WWSA 4DI6A
chains in the Genus database with same CATH topology
4ENOA 3Q8UA 1NDLA 5BXIA 3R9LA 3EE3A 2DXEA 1NDKA 3FCWA 3VGSA 1K44A 3VVUA 3FBEA 1MN9A 1F6TA 1U8WA 3PJ9A 1NSKL 3L7UA 1S57A 1HLWA 4DUTA 5CAAA 3ZTRA 4WBFA 1UCNA 1HIYA 3FCVA 1NB2A 4ANCA 3NGUA 1NHKL 2DXFA 2AZ3A 1HHQA 4ANDA 3ZTQA 1WKLA 3JS9A 3NGRA 2VU5A 5CABA 3Q8VA 3ELHA 2AZ1A 2HVEA 2HURA 3EVMA 1VYAA 3EICA 3ZTOA 4W98A 3DKDA 4CP5A 3GPAA 3NGTA 1NLKL 2DXDA 3FBFA 1PAEX 1S5ZA 4KPCA 3VGTA 1BHNA 3BBCA 3NGSA 1NSQA 1EHWA 3MPDA 3BH7B 3Q89A 4F36A 4HR2A 1NDPA 4UOHA 3VVTA 2DY9A 1BUXA 1S59A 4EK2A 3FBBA 4F4AA 3VGUA 4S0MA 1NCLA 3ETMA 3FKBA 1XIQA 5IOLA 1NSPA 1LEOA 3G2XA 3Q8YA 3VGVA 3EM1A 1BE4A 3BH6B 3EVOA 3EJMA 3BBBA 4C6AA 5C7PA 3GP9A 3ENAA 3FC9A 4O0NA 3BBFA 2B8PA 4UOFA 3ZTPA 3FBCA 1B99A 1KDNA 1JXVA 3Q86A 1WKKA 1MN7A 2ZUAA 4UOGA 3B54A 2BX6A 1XQIA 1ZS6A 3EMTA 1W7WA 1PKUA 3PRVA 1B4SA 3Q83A 4DZ6A 2BEFA 2B8QA 3ZTSA 3DDIA 1NPKA 1NUEA 4ANEA 3B6BA 2HVDA 2DYAA 1WKJA 2NCKL 4FKXA 3WX8A 4FKYA 3EVWA 2CWKA 1LWXA 1NDCA 4DI6A 1F3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENO A;  3Q8U A;  1NDL A;  5BXI A;  3R9L A;  3EE3 A;  2DXE A;  1NDK A;  3FCW A;  3VGS A;  1K44 A;  3VVU A;  3FBE A;  1MN9 A;  1F6T A;  1U8W A;  3PJ9 A;  1NSK L;  3L7U A;  1S57 A;  1HLW A;  4DUT A;  5CAA A;  3ZTR A;  4WBF A;  1UCN A;  1HIY A;  3FCV A;  1NB2 A;  4ANC A;  3NGU A;  1NHK L;  2DXF A;  2AZ3 A;  1HHQ A;  4AND A;  3ZTQ A;  1WKL A;  3JS9 A;  3NGR A;  2VU5 A;  5CAB A;  3Q8V A;  3ELH A;  2AZ1 A;  2HVE A;  2HUR A;  3EVM A;  1VYA A;  3EIC A;  3ZTO A;  4W98 A;  3DKD A;  4CP5 A;  3GPA A;  3NGT A;  1NLK L;  2DXD A;  3FBF A;  1PAE X;  1S5Z A;  4KPC A;  3VGT A;  1BHN A;  3BBC A;  3NGS A;  1NSQ A;  1EHW A;  3MPD A;  3BH7 B;  3Q89 A;  4F36 A;  4HR2 A;  1NDP A;  4UOH A;  3VVT A;  2DY9 A;  1BUX A;  1S59 A;  4EK2 A;  3FBB A;  4F4A A;  3VGU A;  4S0M A;  1NCL A;  3ETM A;  3FKB A;  1XIQ A;  5IOL A;  1NSP A;  1LEO A;  3G2X A;  3Q8Y A;  3VGV A;  3EM1 A;  1BE4 A;  3BH6 B;  3EVO A;  3EJM A;  3BBB A;  4C6A A;  5C7P A;  3GP9 A;  3ENA A;  3FC9 A;  4O0N A;  3BBF A;  2B8P A;  4UOF A;  3ZTP A;  3FBC A;  1B99 A;  1KDN A;  1JXV A;  3Q86 A;  1WKK A;  1MN7 A;  2ZUA A;  4UOG A;  3B54 A;  2BX6 A;  1XQI A;  1ZS6 A;  3EMT A;  1W7W A;  1PKU A;  3PRV A;  1B4S A;  3Q83 A;  4DZ6 A;  2BEF A;  2B8Q A;  3ZTS A;  3DDI A;  1NPK A;  1NUE A;  4ANE A;  3B6B A;  2HVD A;  2DYA A;  1WKJ A;  2NCK L;  4FKX A;  3WX8 A;  4FKY A;  3EVW A;  2CWK A;  1LWX A;  1NDC A;  4DI6 A;  1F3F A; 
#chains in the Genus database with same CATH topology
 5IT4 A;  3M8Y A;  4YY3 J;  4DL6 A;  3HCX A;  1UL3 A;  1HNW F;  3M9O B;  2OIH A;  1JK9 B;  1HI0 P;  2BJ3 A;  2V4R A;  4NMX A;  2PMH A;  1FDA A;  2G4B A;  2VFV A;  1JLE B;  2V8V A;  1LWE A;  2DY1 A;  4JV2 A;  5DLF A;  4OJG A;  3LAM A;  2B9W A;  5KT5 A;  1VRU A;  2V8H A;  2HNY B;  4K7Q A;  4ED6 A;  2A6M A;  1FRM A;  3WDO A;  4Z7Y A;  1JJ4 A;  4DUY F;  1JQG A;  5E3P A;  1DTQ A;  3OHB A;  1KR4 A;  3ZZZ A;  2F40 A;  3SMZ A;  2ZKU A;  3L7O A;  1U47 A;  4ZVQ B;  3CCR S;  4OYW A;  2BAN A;  2YKM A;  3CVK A;  3DOL A;  2GFF A;  2YNH A;  3CD0 A;  4DU8 A;  3G6X A;  2GHV C;  4LFA J;  3R5J B;  1FDB A;  2ZH2 A;  4YDD B;  2VFR A;  1FD2 A;  2PA8 D;  1PIL A;  1W7W A;  4TVA B;  4AUK A;  3DYA A;  3QPI A;  2CQ2 A;  1R8A A;  1O51 A;  3G86 A;  4L75 A;  3RYL A;  3M2R A;  3CDE A;  3GSI A;  2IRU A;  1Q16 B;  4ZK7 M;  4LSL B;  2BAC A;  2HND A;  2W25 A;  2F4V J;  2KZM A;  4ZHR B;  1DQ8 A;  5LXY A;  2OP5 A;  3JS9 A;  3M2V B;  1RA7 A;  4JI0 F;  1APS A;  2K8G A;  1KHV A;  1R0A B;  1Q8I A;  1UWA A;  5CYQ A;  4EEY A;  2E44 A;  5HO4 A;  3NS7 B;  4DF4 A;  3BSA A;  4DR4 F;  2MQN A;  2KYX A;  1VLY A;  1IKV A;  5KFO A;  2HQC A;  4Q43 A;  1VR6 A;  1VQ9 S;  3W8G A;  1YBU A;  2C42 A;  3LAL A;  4PWD A;  4Y0F A;  1RT3 A;  5C2G A;  1AFI A;  4WP8 A;  3BJY A;  1TKZ B;  4YHH F;  3NCQ A;  4RW8 B;  3V6D B;  5B0C A;  1TMJ A;  2NRE A;  1UVI A;  1QAY A;  2HAF A;  2MYF A;  2DO0 A;  3T1Y F;  5B0A A;  4LFC F;  3I0R B;  1ZET A;  3MMA A;  3BGO P;  1WHW A;  2EWH A;  4TLR A;  5KFD A;  2VFU A;  4YB6 A;  3JYT B;  1HW9 A;  1ZM9 A;  5DZ6 A;  3PV8 A;  3L3C A;  4I2P B;  4DSE A;  4NXM J;  3OFH A;  3UVJ A;  2FVS A;  2DCL A;  2ZC3 A;  2RHS B;  4LUB A;  4MYU A;  4QZV B;  2J9D E;  1TK0 A;  5HMW A;  5D6G A;  1XNQ J;  1X9S A;  2G9O A;  1GXL A;  1TL3 A;  4FVM A;  1CJT A;  5KFT A;  5H9F J;  4EYH B;  4BS2 A;  5B09 A;  5CH7 B;  1NSQ A;  1HQE B;  1ICE B;  2L9N A;  2HAI A;  1K1Q A;  4X84 A;  4DPX A;  1KQG B;  4RNN A;  5B0D A;  1N4L A;  1A0O B;  3V81 B;  2OTJ S;  2KFN A;  2MKI A;  4DPY A;  3AHP A;  3MPY A;  1H73 A;  3RBZ A;  3MR5 A;  4NLV A;  1IN0 A;  3FJ2 A;  5AXK A;  2HRY A;  4O23 A;  1N52 B;  3M6V A;  5M2P A;  4QWD A;  4Y2A A;  2MGZ B;  3LUY A;  1HNV B;  2CZ4 A;  5KFU A;  2OJ3 A;  2FHO B;  2DXE A;  4DSF A;  1K44 A;  1UJ5 A;  2W8K A;  4KQZ A;  3JAM Y;  4ZLP A;  2CPY A;  3OTB A;  4EI2 A;  3NBP A;  3PG9 A;  3AB2 B;  2HHW A;  1Q4R A;  2VG6 A;  4MAK A;  2DBB A;  3EGZ A;  5IQ6 A;  1RWK B;  2O67 A;  3KYL A;  2PDA A;  2HS0 A;  2ZZM A;  2B9E A;  4QOT A;  3G8T A;  4K50 A;  4USJ C;  4QPX A;  5L1J A;  1KRP A;  1F0X A;  1JLF A;  2AJ1 A;  2CA9 A;  4NLW A;  3WC0 A;  4WII A;  3CJK B;  3QIP B;  5IC6 B;  2D74 B;  4Y2I A;  4B9M A;  4PQU B;  2JLG A;  4UOF A;  1N33 F;  4OZ3 A;  2NXC A;  1JXV A;  1OQ6 A;  4C3M A;  2Q1L A;  2HQ3 A;  3OTD A;  2W7P A;  4JYA J;  4ITS A;  3KKF A;  2YX7 A;  2YH0 A;  2DHH A;  2NCK L;  2VPX B;  3JTO A;  1XC9 A;  3UCU P;  5GAG I;  5M2U A;  4NYZ A;  3MEE A;  4DN0 A;  5ETN A;  5C42 B;  4X2B A;  1H2V Z;  3HSD A;  3I96 A;  4ID5 A;  2LYV A;  3HHL D;  2E5G A;  2CPE A;  1N0U A;  1BQM B;  5KFH A;  1DQA A;  4ERD A;  3PIO Q;  4FVC A;  3VAG A;  4X66 F;  3I4P A;  1XK8 A;  3W9J A;  1YLX A;  3N6N A;  4C8M A;  5I42 B;  3NKY A;  4QR0 A;  1NLK L;  4J9U E;  3VAF A;  3A3O B;  2PN6 A;  4OYI A;  1JLG B;  2UVU A;  1G4C A;  2LVW A;  2MJU A;  3AQO A;  3QWP A;  2QMW A;  2FHJ A;  4B08 A;  4S0M A;  2W2N P;  2G2Z A;  3DGV A;  5EWE A;  4L74 A;  3ZFV A;  3MUM P;  2X1G A;  4ECS A;  2XHW A;  4D3G A;  1Q86 T;  1PC5 A;  2JEG A;  1LW2 A;  1QAJ A;  2HS3 A;  2XO7 A;  4IOA Q;  1N5Q A;  1RK8 A;  2MZT A;  2FVQ A;  2E9R X;  3RGI A;  2A18 A;  4HHH A;  2R8I A;  5IT0 A;  1A6L A;  3ISN D;  1WG4 A;  1VRT A;  4NZ0 A;  2BAB A;  3PDN A;  1BC6 A;  2FY1 A;  4F7V A;  2XO6 A;  1F6T A;  3GIJ A;  2H4Y B;  3HHN B;  4YR0 A;  2GJF A;  3M7V A;  1RHJ B;  2BUN A;  4KHP F;  2I6W A;  3MCN A;  2CPF A;  4AND A;  5ITH A;  4LBH A;  3DGP B;  1TVR B;  3Q8P B;  4I68 A;  2J8S A;  1KC8 T;  2H4W B;  2DGO A;  2EG1 A;  3CPW R;  3KWM A;  4ETZ A;  3IM8 A;  3I55 S;  4CO4 A;  4NRT A;  1NXI A;  4JI4 J;  4F4A A;  3IG1 A;  2E5L J;  5AJ3 J;  2AP6 A;  5IOL A;  1R43 A;  2NXE A;  3O6Q A;  4OX9 F;  2K3I A;  2EFV A;  4USM A;  4X65 J;  4LQ3 A;  5CZX A;  2KDO A;  4HTI A;  4Z37 A;  2XLJ A;  5J2N A;  4MMO A;  4Q5V A;  2BA9 A;  2H5I B;  1NB7 A;  3M8P B;  2FLL A;  3F0N A;  4RNF A;  2N4C A;  4ECV A;  2JVR A;  3DLG A;  3KNG A;  3OLB A;  4UY8 T;  3D9B A;  2HS4 A;  1G6B A;  4RBU A;  2VPZ B;  3MPW A;  2V6A A;  2V63 A;  4DV4 F;  2F3J A;  3UE2 A;  1UAW A;  3CWJ A;  5D8H B;  4HDG A;  4ES3 A;  3AA8 A;  1C0T A;  2RU3 A;  1O5J A;  1VC5 A;  2EG2 A;  3QJL A;  2R8H A;  2DNG A;  1NHU A;  1WF0 A;  4DX6 A;  4C11 A;  1RTI B;  3TAM B;  1RWN B;  3M32 B;  3GV7 B;  4DMZ A;  4CLF A;  1T05 B;  2QEX S;  3MPD A;  2ROG A;  2CQD A;  3DRR B;  1IR0 A;  4BC7 A;  2A1B A;  3PRB A;  1GFW B;  4M5H A;  3VGV A;  1EJ7 L;  3EVO A;  2V4J A;  5J1E B;  2QZ8 A;  4LF2 A;  3DNC A;  1UPM B;  2CJY B;  2RML A;  2DGV A;  3R5A A;  1PAU B;  4LF6 F;  5DO2 A;  5KFC A;  3MFI A;  3B82 A;  4P6Q A;  3D1H A;  1IKY B;  5J1N A;  2D69 A;  3ET6 B;  1F5C A;  1DY3 A;  1GK8 A;  3DDI A;  4QIG A;  1KLN A;  2R2S A;  1RUS A;  2UXD J;  3PFO A;  5A8R A;  1MW7 A;  5BR8 J;  3UNY A;  3KJQ B;  1Y3K A;  2J6U A;  3C19 A;  3FUY A;  3AJ1 A;  1YHQ S;  5E2Q A;  2QE5 A;  3QZ7 A;  3KJV B;  3NNC A;  1FTR A;  4ZVS B;  3OVA A;  2YNI B;  1V5I B;  2XSJ B;  5HP1 B;  1S79 A;  1RT2 A;  3PO5 A;  4U9R A;  2QN6 B;  1Y9O A;  4KRW A;  1LOU A;  3TUI C;  2CQI A;  4IR9 A;  2C3Y A;  2ZD1 A;  3W60 A;  2XI3 A;  1XTZ A;  3VAH A;  3G6V A;  4DG1 A;  3DMJ A;  2XMA A;  3UDL A;  1Q8B A;  1M90 T;  3DU5 A;  2NZC A;  2HRU A;  1QSL A;  3QO9 A;  3I32 A;  1LK5 A;  3N01 A;  5K8N A;  4UOG A;  3Q2S C;  5KG4 A;  3OT9 A;  3PW4 A;  5KFF A;  3IR5 B;  3W66 A;  4KO0 B;  1U6B A;  1EB0 A;  2CNO B;  2RB7 A;  3IAM 9;  4DXL A;  2LXF A;  2VHG A;  1S77 D;  2WHO A;  5DDQ C;  2MZS A;  4CTA B;  5M2R A;  5B0B A;  1RTD A;  1P9Q C;  2XHC A;  3G96 A;  4OYB A;  4Q8F A;  2ZDP A;  4MIB A;  1FDN A;  4CO5 A;  3K8W A;  4OX7 A;  3IRX A;  2B9X A;  4J9P A;  4PWU A;  4UF4 A;  3ZO7 A;  1OIA A;  4NOH A;  2FJV A;  3NGR A;  5HLF B;  4ZP7 A;  2IY5 B;  3LAK A;  1FRL A;  1RWW B;  4OZN A;  1HNX F;  2V8G A;  2R7W A;  3FMB A;  3H4D A;  1JLE A;  1YQH A;  1RCX B;  1KFS A;  1YBT A;  2CWX A;  2HRT A;  4HR2 A;  3DLL Q;  3D6T B;  1REV A;  2HNY A;  2B4O A;  2WB1 D;  2AMC B;  3EUN A;  5KFJ A;  1MSW D;  1WDD A;  4MIA A;  2XYH B;  1SH2 A;  4QR2 A;  3PYF A;  1OQ3 A;  4UY8 5;  3TA0 A;  3W7B A;  1TKT A;  1J5O A;  1N48 A;  3FK4 A;  1HYS B;  5AE2 A;  1U8S A;  2HHV A;  1TV6 B;  1JB0 C;  1HA1 A;  3T6J A;  5AE1 A;  4IOC Q;  3PZP A;  3HHK A;  2IC3 B;  2Z56 B;  3FVY A;  3QFW A;  5F0W A;  1EET B;  3WX8 A;  1R6Y A;  1U26 A;  2IHR 1;  4XK8 C;  1RAG B;  1UET A;  1RDR A;  2RRB A;  3KLH A;  4OZ1 A;  1X5S A;  4P2X A;  3F73 A;  1RYR A;  1U1L A;  1KTQ A;  2JH3 A;  1Q82 T;  4WK1 A;  2VIC A;  3QJJ A;  4RX6 A;  4A8W A;  4AQY F;  2DPJ A;  2FTR A;  4IQX A;  3T6B A;  1CJV B;  2H54 B;  2HFV A;  2N7Y A;  4LSL A;  2OMO A;  5I3P A;  2LXI A;  2MKC A;  1QAI A;  4NCB A;  2DD8 S;  4ILR A;  4ZHR A;  2HQD A;  2E5I A;  2IPO B;  1X4A A;  3H0P A;  3M2V A;  1TKD A;  2W2M P;  3PR4 A;  4CYU A;  4FYV B;  7FD1 A;  1U1M A;  1IWG A;  1R0A A;  1N32 F;  1ZA2 B;  3H40 A;  4J37 A;  2M88 A;  5MAO A;  2R7U A;  4DR2 F;  3C15 B;  2K1R A;  3PVX A;  5C24 B;  2YWH A;  2Q6C A;  5LSR A;  4B9L A;  4F4Y A;  1PKU A;  3M1V B;  1U24 A;  1J2V A;  4WXW A;  1TKZ A;  2FLP A;  3W63 A;  3Q8R B;  4RW8 A;  5D77 A;  3V6D A;  3TQ1 A;  1TUW A;  1WG1 A;  1T9W A;  3ETO A;  3OTO J;  3ILJ A;  2AJ4 A;  2ZE2 A;  5THW A;  3OFE A;  5J2M A;  2YPZ A;  4ELT A;  4LF8 F;  1NRK A;  2EFP A;  1D1U A;  2L08 A;  1O8B A;  4NLP A;  5E3R A;  2E1C A;  1Q95 G;  1G7C B;  3THP A;  2FZC B;  5J2Q B;  2A0F B;  4I2P A;  1S99 A;  3AAW B;  2HBZ B;  2HMI A;  3QT8 A;  3JSM B;  4J5O A;  5HMX A;  3T9Z A;  4HEA 9;  1IKW B;  3TVY A;  1NO8 A;  2HVI A;  4IFY B;  5KG2 A;  3EDR B;  1IR2 A;  1ZZN A;  3PW5 A;  4V1A k;  4JV5 J;  1HQE A;  3O3L A;  3UFC X;  2ZH1 A;  4ED3 A;  3R1L A;  1ZM3 A;  2EEY A;  4DL3 A;  1ZH5 A;  4DV6 F;  4NLR A;  3Q83 A;  4N47 A;  5IZH A;  4CI0 B;  3KHG A;  2OAU A;  2FVP A;  3LP1 B;  4KGV B;  1W26 A;  4P52 A;  2ZFH A;  2DNN A;  2HK2 A;  4TKT A;  2AD9 A;  3K2Y A;  4X62 J;  2MZ1 A;  4O44 B;  4BHQ A;  2HKE A;  1BQX A;  2C1E B;  2XY5 A;  2DRA A;  2CYY A;  3CCV S;  3POT B;  1LNQ A;  1C4A A;  2EKY A;  4DR6 F;  4JI2 J;  1DJ0 A;  1KD1 T;  2QFI A;  1AUD A;  2DR5 A;  4RWW A;  4A48 A;  3MOJ B;  1HQU B;  4DV1 F;  1GMV A;  2V34 A;  5A8K A;  3BEG B;  3PAC A;  1FFW B;  3VTI A;  3KNA A;  3QZ8 A;  2C2K B;  2DHG A;  3B4M A;  2KKH A;  4KSE B;  5KAK A;  5D4L A;  3GIR A;  3N6M A;  2QLJ B;  3W5Z A;  2I8E A;  2XMK A;  2CG4 A;  3HKZ D;  3NS6 A;  2APO A;  2OKQ A;  3MEK A;  3BR9 A;  2ATL A;  1FFG B;  3CJK A;  3QIP A;  1PYO B;  2ATC B;  3GYG A;  2ZOG A;  4KT0 C;  5GAH I;  1IBK F;  4NCG B;  2HBR B;  3TUJ C;  2RDD A;  3W8P A;  1BXN A;  3KDO A;  3NS5 A;  2RJZ A;  2ZH4 A;  3MR7 A;  2HBY B;  1NSK L;  1YVF A;  2YKN B;  5T14 A;  4I6A A;  1SIW B;  2ZBR A;  4C9D A;  2AEF A;  2Z2M A;  5C42 A;  5KFV A;  2DCU B;  3VAL A;  2I38 A;  1H2T Z;  4ZVE A;  1VQP S;  1NHV A;  1HHS A;  2AYM A;  3R6G B;  5JVG Q;  2G2Y A;  5D0E A;  1VBX A;  4LBI A;  3M4X A;  1JX4 A;  4K2X A;  3ZZU A;  1XNR J;  3NY0 A;  3JSR A;  4FYW B;  4ZVF A;  4P71 A;  5I42 A;  1FFS B;  1B7Y B;  4ZVT B;  1VHF A;  1RLC L;  1JLG A;  4IO1 A;  3QSY B;  3MR6 A;  3BGU A;  4LRF A;  4N41 A;  1HL6 A;  2PGC A;  3H4B A;  2JEJ A;  1SPB P;  4HAC A;  2BOA A;  4ZPB A;  2C2Z B;  1H98 A;  4B9S A;  5L9X A;  2F5G A;  3MCM A;  2QLB B;  3O44 A;  2PI5 A;  3VVU A;  2LQJ A;  2MKS A;  2MQQ A;  2UUT A;  5KT4 A;  4ES1 A;  4PAA A;  3CD5 A;  4TQS A;  1X7V A;  3HSZ A;  3A8E A;  3D0G E;  2VBZ A;  3CJ4 A;  2GCF A;  1N88 A;  2CJQ A;  1ZAX A;  3NLC A;  2WVD A;  3PTW A;  4HHU A;  1T03 B;  4EZ9 A;  4OIX A;  4XO0 A;  4DWI A;  2IA6 A;  1KOH A;  1SL2 A;  2GNK A;  2ZOM A;  1NJZ A;  1T9V A;  4DPO A;  1WG5 A;  3IGV A;  2JJ4 D;  1RWP B;  4EBC A;  2CKW A;  5IM0 B;  1D09 B;  2MQP A;  4I2Q B;  3KMS A;  2GO8 A;  5KFQ A;  2P9G A;  1ELO A;  2DTJ A;  1YK9 A;  2ROP A;  3E8O A;  3W1Y C;  2D3O R;  1SJ3 P;  1S6Q B;  1WSR A;  1ZM2 A;  3DRY A;  2V67 A;  5E3A A;  4QPT A;  1X4B A;  3EGV A;  3OXF A;  3KK1 B;  2HK3 A;  1QUP A;  1K0T A;  4OX8 A;  1GH8 A;  4PAB A;  2UV8 G;  4J9S A;  2FJA B;  1UW4 A;  1FK9 A;  3LTO A;  1FNX H;  1NJX A;  4X4U A;  3CCL S;  4DV0 F;  2GQ2 A;  2GX8 A;  1SUQ A;  2HHQ A;  5C5J A;  2DVI A;  2UXC J;  2HGL A;  3G71 S;  2A6O A;  4P9S A;  4PG7 A;  4WFN Q;  5D3G A;  4DL2 A;  4M63 A;  1RT6 A;  1SJQ A;  1IQT A;  3MPU B;  3CJQ A;  2AX0 A;  2KZZ A;  3KLE B;  1KWM A;  3DI6 A;  1PYT A;  5ETS A;  4DV3 F;  4HLB A;  2KT2 A;  4IH6 A;  1MNE A;  1RTI A;  2QA2 A;  1S0O A;  2WON A;  5F8M A;  1PSD A;  1T05 A;  1AW0 A;  5IC4 B;  1Q81 T;  2FB0 A;  1SXL A;  3DRR A;  2XMW A;  3R2C J;  3S8S A;  1UEV A;  3OL7 A;  1T95 A;  2XBP A;  2PO4 A;  3GYN A;  1BGX T;  2FGC A;  5EUH A;  2LDI A;  2MMY A;  4CLY A;  4FF2 A;  4JP8 A;  3CF5 Q;  2WZ1 A;  1SVD A;  2WOM B;  2JZ5 A;  4ECQ A;  5BXI A;  3R9L A;  5H9E J;  3ET6 A;  3C6U B;  1NK0 A;  1RHM B;  1E6Y B;  1F5B A;  2F8H A;  1NK9 A;  3DRP A;  5KFN A;  1RTH B;  1RWU A;  4IYQ A;  2GMJ A;  2OI2 A;  3RAM A;  5KTQ A;  5G0R A;  1AZS B;  3H25 A;  1YJW S;  4JI5 J;  4Q0B B;  4OHV A;  2JWN A;  4NRU A;  4IR1 A;  1VQ6 S;  3GZ7 A;  1Y7P A;  2N7C A;  4HI1 A;  2R4F A;  4RL1 A;  4LSN B;  4B3S F;  2VQF F;  3FFI B;  3FGV A;  2KN4 A;  3IO1 A;  3PKY A;  2LEC A;  1YJ7 A;  4U96 A;  1A9N B;  2VA3 A;  4YFU A;  3SQO P;  1SJF A;  4IRK A;  1RHU B;  2J0S D;  3SI8 A;  1F9H A;  1S1X B;  3RAQ A;  2YX1 A;  5CYM B;  1CC7 A;  1KDN A;  2VDH A;  3TRG A;  5HQM A;  3OTE A;  1XMB A;  5HBM A;  1SI9 A;  4N5S A;  3MWB A;  4NML A;  4ZKA A;  3MUR P;  1FCA A;  1XR5 A;  2IVM A;  2BMB A;  2K06 A;  2DEI A;  4IG0 B;  3GLJ A;  5KT3 A;  2XMT A;  1WF2 A;  2QMU B;  3A8J A;  2Z4P A;  3PFE A;  2DJW A;  4ZP8 A;  1UVJ A;  1UW9 A;  4ZJO A;  2BYC A;  2RIL A;  3AA9 A;  3VAI A;  4KGX B;  1L5U A;  2UU9 F;  5F9N A;  2R2T A;  2FJW A;  3GWC A;  1M5P C;  4H4O A;  5KFX A;  1SKR A;  2BKO A;  3W9H A;  2HPU A;  2N82 B;  4IH7 A;  2BM0 A;  2MHE A;  1K9M T;  1L3U A;  3HHL C;  4CLP A;  5K14 B;  3HM9 A;  2NS1 B;  4DFJ A;  2VH7 A;  4DV5 F;  1RKJ A;  2A3J A;  2DIT A;  4Y2K A;  2FC9 A;  1FKA F;  2FHJ D;  5IWA F;  3Q86 A;  3J7Y U;  2D3Z A;  5D4O A;  3BSC A;  2HQF A;  3M6U A;  1TZ0 A;  3BQ2 A;  2ADB A;  2B3T B;  1FX4 A;  5KFZ A;  1FDD A;  2HFO A;  5L8R C;  2DHA A;  1HNW J;  5B7W A;  2HHH F;  2BR0 A;  1SIZ A;  3Q24 A;  2VFT A;  1F5A A;  2WK4 A;  2JLE A;  2DNP A;  2K2P A;  3OXG A;  4RW7 A;  4ZLJ A;  3MED B;  5DDP C;  1S72 S;  4B9T A;  4NCA A;  4CCH A;  2Y1R I;  1SQE A;  3AD8 C;  4GC6 A;  1CEZ A;  4DV2 F;  4ZJL A;  5ETT A;  3RG6 A;  1EAR A;  2ERR A;  4QYR A;  4ZVO B;  1P8G A;  5KFS A;  4DUY J;  5A6P A;  1CJV A;  4NLD A;  2VQE F;  1UVN A;  3NCP A;  1RAA B;  4M5K A;  3U1L A;  3W5X A;  2XGQ A;  2VB6 A;  1WTB A;  4ECR A;  2DNK A;  4KH1 B;  1KLM B;  2KO1 A;  4QW9 A;  2N3L A;  3MZI A;  4B17 A;  2O3D A;  2XWY A;  2VD3 A;  3FBC A;  3C46 A;  3IR6 B;  4FXV A;  2XNQ A;  3RUB L;  2B43 A;  2UP1 A;  2IBO A;  3C15 A;  5CYJ A;  3BV8 A;  3BB5 A;  2XUL A;  1J5E J;  2IA0 A;  2RAQ A;  4FKX A;  5C24 A;  1RQ0 A;  2D3U A;  1BWE A;  4OV1 A;  2ZVS A;  2U2F A;  1KSP A;  3M1V A;  2CPD A;  1GMU A;  4C0H A;  2DNQ A;  2IDL A;  1HWJ A;  4GMK A;  3OUY B;  4TNO A;  3TI0 A;  2LLZ A;  2RQC A;  3KK2 B;  2Z2Z A;  1ITP A;  3OL6 A;  3PCO B;  2VOD A;  2YNF A;  5FJ4 A;  3R8Y A;  4P2M A;  3M8W A;  2YWE A;  1WEX A;  1KQK A;  2C28 A;  2J9C A;  2ZBC A;  3H42 A;  2OEM A;  4RZR A;  4OYA A;  3SFG A;  2RT3 A;  3PY8 A;  4EK2 A;  4CNZ A;  2GVD B;  5HVH A;  1YIJ S;  2QV6 A;  3JSM A;  1Y00 A;  4MTP A;  4KGM A;  4YHH J;  2AJ2 A;  1OPZ A;  4TY9 A;  3TEG A;  1C2P A;  1IXK A;  1WC6 A;  3K59 A;  1R8P A;  4R25 A;  1T02 A;  1WF1 A;  4LFC J;  2QYG A;  1VQ5 S;  5LMU F;  1K0V A;  3P6Y C;  2BRK A;  5KFR A;  4Y2M A;  3TZX A;  3U1N A;  2R9L A;  2JL9 A;  5CHC B;  1YX2 A;  4U6P A;  2NZ4 A;  1KVJ A;  1B7F A;  2DIU A;  3LP1 A;  1NB2 A;  3I87 A;  1HPZ A;  5K8M A;  1AYE A;  5HJY A;  4LFB J;  1ARO P;  2YQ1 A;  4MYT A;  4EGL A;  2QIF A;  4NZ6 A;  4O44 A;  1VQ4 S;  1EQ0 A;  3M8Q B;  1FJG F;  5F3T A;  2VG7 B;  3POT A;  2OPS B;  4U8Y A;  4DSL A;  2NSB A;  3QQC D;  7AT1 B;  1DTT A;  4RNH A;  4USW A;  3FRZ A;  3DRS A;  3D4J A;  1N6Q A;  3AJ2 A;  2V9W A;  2FZG B;  3MM9 B;  1Q7Y T;  2MJN A;  1FKP A;  1HQU A;  2L9W A;  3GU0 A;  4I1T A;  5ETQ A;  3RAX A;  2MY7 A;  1PIE A;  4DR7 F;  2QO3 A;  2ZWP A;  3CGI A;  3IS9 A;  1HAR A;  4C0O C;  3PNI A;  3B54 A;  2DGT A;  2DIS A;  4L73 A;  4E0D A;  2MKK A;  3VR1 A;  2RQ4 A;  4HDH A;  2WB4 A;  2QG9 B;  3Q0A A;  2VV5 A;  3I5B A;  4DF8 A;  2B5J B;  3KLF B;  5HAT A;  2HHP A;  2IAJ A;  4O3S A;  5F8L A;  4J9Q A;  3UI3 A;  2KB2 A;  4NA1 A;  4CRJ A;  5LSL A;  5HMZ A;  1UVM A;  5ADZ A;  1ZA1 B;  5LJ5 Y;  1HNZ F;  2DB1 A;  2HLT A;  2YKQ A;  3GJT B;  2Y8W A;  3K8V A;  2GAH C;  1FTC A;  4C8N A;  1EP4 A;  3KHH A;  4WE1 B;  4ZA1 A;  2E5H A;  2W4C A;  1MWY A;  5KFB A;  2C2M B;  4DFM A;  3D5M A;  3W62 A;  2MKH A;  3Q2T C;  1MMD A;  4UQG A;  5A0Y B;  3PW0 A;  4USI A;  3BS9 A;  4O0N A;  3NNA A;  3V4I B;  4DCO B;  1B99 A;  2H51 B;  4M5D B;  4K8R A;  3G9C A;  3IC1 A;  4K5S A;  3L9Z A;  4NLS A;  1VQL S;  1V3R A;  2CPH A;  4TXS A;  3A4T A;  3W3S A;  2FHM A;  5DDR C;  4FKY A;  1ACM B;  1EKR A;  4ZVU B;  4LFA F;  4F8R A;  1NDC A;  1RKI A;  1FXR A;  3J7Y I;  2RS2 A;  3D2W A;  3BPD A;  4LQ9 A;  1QUV A;  2NQP A;  2UVW A;  1RYS A;  3OJU A;  1RAO A;  3U27 A;  3PJX A;  1S4E A;  3AH6 A;  2O1P A;  4X66 J;  4FYD A;  1X4G A;  5DLG A;  3CCE S;  2N4D A;  1RT4 B;  3J81 Y;  1SCJ B;  1XR7 A;  1PYS B;  3FBF A;  1PAE X;  4CLU A;  3QJP A;  1MWZ A;  4Q45 A;  1I5O B;  4TY8 B;  1RT1 B;  1SC1 B;  4NLT A;  3GR1 A;  4URQ U;  4C98 A;  1DLO A;  1S1U B;  2GIF A;  3EYZ A;  2I5J A;  3DXS X;  1WC3 A;  3C6T A;  5KFL A;  3M2U A;  3MM8 B;  5C7P A;  3M05 A;  4ZIV A;  1R31 A;  5IM0 A;  3CSK A;  4OFZ A;  1U4B A;  2XCA A;  4OHY A;  3OL8 A;  2KH9 A;  4PPD A;  4PUO B;  1C1B A;  2FJE B;  1JLB A;  4GKJ J;  3EE3 A;  4DSI A;  4PXE A;  2YWG A;  4OZL A;  5GMD A;  2M3D A;  3DXB A;  2EFQ A;  4A4J A;  4QIE A;  1CBK A;  2V94 A;  1YJR A;  4KHP J;  4TU8 A;  1EKS A;  1JLQ B;  1G2E A;  1GEH A;  1X5O A;  4B02 A;  3IA0 A;  3IBW A;  1LWC B;  1VS3 A;  5D4N A;  2E5J A;  3OVS A;  5GAD I;  2E1P A;  2GA7 A;  1ULR A;  1P9Y A;  1RAB B;  3D7S B;  1FE0 A;  1S9E B;  5J1P A;  4OX9 J;  4IQM A;  2KXH A;  1JNR B;  1X0P A;  4OJH A;  1TUV A;  3DN9 A;  2AJQ A;  1RAC B;  4DHV A;  4GVL A;  2IM1 A;  3NCR A;  4BBY A;  3WIU A;  1YKW A;  1R8C A;  5T7L B;  2ASL A;  3MF5 A;  1S1T A;  4YQW A;  1FRH A;  1RT5 B;  5ETK A;  5HJX A;  1NPK A;  2MQL A;  3QNW B;  1NKE A;  5HN0 A;  1RJJ A;  4G1I A;  4KE5 A;  2M7S A;  2F9J A;  3GJS B;  5HRO B;  2ZH6 A;  4XAK A;  5LSO A;  2AYE A;  4DV4 J;  2CPZ A;  2UV8 A;  2CDR B;  3U1M A;  1UEU A;  4Y28 C;  4DQP A;  2X1A A;  2VG5 B;  5I3U B;  1PGZ A;  1CJK B;  1X9M A;  2EPI A;  1IBL J;  1SL0 A;  3AJD A;  5D0H A;  2OTL S;  3C6U A;  3GIM A;  1CG2 A;  3M8R A;  2FD2 A;  1HBO B;  3HVW A;  4G1Q B;  2VJU A;  1RAJ A;  1RP5 A;  3BH7 B;  3HVT B;  2RE1 A;  2FYX A;  4Y6I A;  3P4U B;  4J9R A;  1U0S A;  1RXO B;  4N8O A;  3UNG C;  3UR3 C;  3BH6 B;  4EBE A;  3N0V A;  2H5E A;  2BZ2 A;  4F0M A;  3HT3 A;  1N56 A;  3MCO A;  1RAH B;  4HVZ A;  4F26 A;  1CS4 B;  3N79 A;  4CLZ A;  3SCI E;  1ZPW X;  5B08 A;  5FDL A;  5A6W A;  1WTF A;  1GX6 A;  6FDR A;  1DAX A;  4LF1 A;  2HQI A;  2K7J A;  3NMR A;  3MMC A;  4QYZ J;  3ENW A;  3T41 A;  4YB5 A;  2DGX A;  2PFD A;  2HHX A;  2OPQ B;  2NSC A;  3LA0 A;  4ZN1 A;  2UUA J;  4RUA A;  4F50 A;  5I4M A;  4NXN J;  3KG4 A;  1U8W A;  4XPE A;  2YKA A;  3TOQ A;  1P1L A;  4JYA F;  1PG5 B;  1AXQ A;  2F63 A;  4NE9 C;  3JQK A;  1SC4 B;  4IG0 A;  4K4S A;  2KFZ A;  1ZM4 A;  2BQR A;  2OPP B;  2BJE A;  3CXC R;  3I6P A;  2FY8 A;  4HH0 A;  4FDF A;  3F56 A;  4DSJ A;  3OV7 A;  2RH3 A;  3RB4 A;  1R8H A;  3NGS A;  5K8P A;  2IYG A;  4Y3C A;  1PC4 A;  4QWB A;  2J0X A;  4XPC A;  1OY6 A;  1Q78 A;  1XIQ A;  3QAU A;  2AJF E;  1JKH B;  1YIT S;  4IKA A;  1XBW A;  2XM3 A;  2E1A A;  3LP2 B;  1IM4 A;  2J5A A;  2HVZ A;  1XQI A;  5K14 A;  2D7S A;  3QT6 A;  2EK1 A;  4HT7 A;  2ILZ A;  1R89 A;  1OS5 A;  1D9F A;  2HNZ B;  1HI1 A;  3W65 A;  4BC9 A;  4DR5 J;  1P27 B;  3BSN A;  5EWF A;  2DRB A;  5CA5 A;  4JI3 J;  1CUL B;  2MST A;  2FJB B;  1CQN A;  1DAR A;  2W4P A;  1QAX A;  4H54 A;  1T11 A;  2B4P A;  2CQH A;  2YQ0 A;  1HNX J;  4F0K A;  1B0P A;  1YTY A;  4DCJ B;  1JJH A;  4ZPV R;  4RKU C;  2MKJ A;  3MED A;  3I0S B;  4Y2C A;  3RU0 A;  4UOH A;  3KXD A;  2GAG C;  1BUX A;  1S59 A;  5D4P A;  4RU2 A;  1QE1 B;  4GO5 X;  3BN4 A;  2ZJP Q;  4M1K A;  3CNQ P;  2Y1L B;  1S0N A;  3ITH B;  4BCA A;  4J9L A;  3W2W B;  4K2J A;  3SDE A;  2COL A;  2Q79 A;  3CCJ S;  2X51 A;  2RKI B;  2EFO A;  3MM7 A;  4M5M A;  4JI4 F;  3ZZR A;  1CJU B;  4ER8 A;  1W25 A;  5KFP A;  4HHJ A;  2BVZ A;  5AJ3 F;  3CB4 A;  2E5L F;  2I9S A;  4PR6 A;  2YNG B;  1MWQ A;  1TFW A;  2OHD A;  3RJM B;  3D1O A;  1ROF A;  1B70 B;  4X65 F;  3EVW A;  3D6H B;  1RBL A;  3IWL A;  4X4R A;  3MEC B;  2KRR A;  1S49 A;  2OSR A;  4IG3 A;  5KG6 A;  2LEB A;  2GJ2 A;  3N5F A;  4CO2 A;  4ED1 A;  4RW6 A;  1U2F A;  4AQY J;  5FD1 A;  2GGP A;  1R8B A;  3I5C A;  5D0R A;  2M4M A;  2OPR B;  3L7P A;  4GVB B;  4PYD A;  4F04 B;  3K5P A;  1VIO A;  3R27 A;  4JV1 A;  2PMZ D;  3JQJ A;  3US5 A;  1RAI B;  4Z2X A;  3KK2 A;  5JUM A;  4RW4 B;  3ENV A;  4ECZ A;  4O4G B;  2Z58 B;  1N32 J;  2YKP A;  1JLC B;  3TNV A;  2VKZ G;  1TP7 A;  3CME S;  3SSS A;  3A12 A;  3NRB A;  3P96 A;  1RE1 B;  1LW0 B;  4EFA C;  4YB1 P;  1Y10 A;  5B0G A;  2HSE B;  1HQ2 A;  3OD2 A;  2BE7 D;  2Y1I A;  3MM6 B;  4MFB A;  2GVD A;  9RUB A;  2NYH A;  2CFX A;  1VRQ C;  2IVF B;  4AD6 A;  1WKK A;  3HHD A;  3OR2 B;  3CJ5 A;  1U1K A;  2DH7 A;  3D28 A;  2BE2 B;  1NUE A;  4ANE A;  3X1L B;  2DO4 A;  3FSY A;  4I6W A;  3HZG A;  4DN9 A;  2X1B A;  3BKF A;  2MQM A;  1V9O A;  2UUC J;  3QLH B;  3NGK A;  1HBN A;  1PJ5 A;  3J80 Y;  2HZV A;  3BDP A;  3PHT A;  2J8A A;  2AGO A;  2BKP A;  3UDE A;  1S7H A;  2UXD F;  1FWL A;  4NAS A;  5BR8 F;  2QTW A;  2X3G A;  3RRH A;  4AT1 B;  2YX4 A;  1N5S A;  2V69 A;  2BJD A;  1S5Z A;  2LEP A;  4KFB B;  1S1W B;  2W2Q P;  3QGP A;  2VG7 A;  2ZZN A;  4DL7 A;  2AW0 A;  2ZH8 A;  5IT9 Y;  5DDO C;  4ED2 A;  3DLE B;  4LR7 A;  4KV8 A;  5IV4 A;  3BSO A;  3BO3 A;  4F4X A;  4LBP A;  2JEF A;  1RHR B;  2ZIT A;  3MM5 A;  2JSX A;  4DOZ A;  2SXL A;  4MJK A;  4L3N A;  4DV6 J;  3ENQ A;  3QT7 A;  5GAE U;  2QJ3 A;  2K3K A;  4F3O A;  2C3U A;  1JMT A;  4LR9 A;  2IVY A;  4V19 J;  2AIR B;  3K5O A;  4WJB A;  3HFV A;  3A1Y G;  1RT7 B;  1IJE B;  1RWV B;  1SH0 A;  3OHA A;  1KS2 A;  3HX9 A;  4M94 A;  5KFW A;  1HMV B;  3KLF A;  2AGP A;  1XEZ A;  4YME A;  2VBY A;  2WRM A;  3EIC A;  2N3O A;  3UDC A;  1NU4 A;  1K8A T;  4ZMM A;  4RBV A;  4PZV A;  5JMN A;  1X5T A;  4Q8E A;  3IFE A;  2B7C B;  3KLG B;  5J2P A;  3LP0 B;  2KTQ A;  3RBX A;  2RHQ B;  2RSQ A;  2ZM6 F;  3DLK B;  5KT2 A;  3UR0 A;  1PCA A;  1AA1 B;  2V2Z A;  3FZ2 A;  2Q6B A;  4GKK J;  4KC5 A;  3HPO A;  3CCZ A;  2G1H A;  1AT1 B;  4P2F A;  3EGW B;  2XEX A;  4KR0 B;  4RUB A;  1F9E B;  3O1L A;  1N5T A;  2YKO A;  1IBM F;  4NI2 A;  1HD0 A;  4ED0 A;  3BZQ A;  1OY8 A;  1IBK J;  3LWL A;  1H0H B;  3D68 A;  2IMW P;  5DQH A;  1S6P A;  4H4K C;  3BYP A;  3F44 A;  2FGO A;  3QBC A;  4P72 A;  3KLI A;  1TL7 A;  1WKL A;  1YBA A;  4C0B A;  5EX3 A;  4OI3 A;  4NLQ A;  2BJ9 A;  3GPA A;  4DFK A;  2BQU A;  3PM9 A;  1VRU B;  2HHU A;  5C25 A;  4NL5 A;  1FRJ A;  2QL5 B;  1DTQ B;  4RPF A;  4ECX A;  1RWO B;  1SKW A;  5KG1 A;  3VCD A;  4TN2 A;  3W2V B;  4IFV A;  1RT1 A;  4EMD A;  1S7I A;  4X4N A;  2V0N A;  3VAK A;  3GSD A;  2BAN B;  2ZHA A;  3DOL B;  2O01 C;  3HF5 A;  4ZPA A;  1BMQ B;  1SB6 A;  2HQG A;  3PO4 A;  4MT1 A;  2A2C A;  3DYA B;  1R0C B;  4QJV A;  2CWK A;  4PG8 A;  1Q7L B;  2AHO B;  3T19 A;  4C8L A;  1ZAW A;  4EWT A;  2IYI A;  2V2K A;  1QTN B;  1NPR A;  1UKU A;  4PUO A;  4QWE A;  1HBM B;  1S12 A;  3GV8 B;  3OTO F;  3K7R A;  3QGI A;  4E8U A;  4B9V A;  2DNH A;  1VQ7 S;  1SH3 A;  5DS7 A;  3NG8 A;  2Y3Y A;  2KJW A;  3AOD A;  2OLW A;  2UZA A;  5CYQ B;  3CD7 A;  1FHT A;  1D0E A;  4RBT A;  3AD9 C;  1VQO S;  1WSV A;  1YJ9 S;  1UA0 A;  2B7B B;  2ZJQ Q;  2LU1 A;  2M52 A;  2W9C B;  2XZW A;  5CCL A;  2F7V A;  1VMB A;  4OX6 A;  1O6X A;  1QTM A;  1UZD A;  2XY6 A;  4EBD A;  4PWD B;  2BOP A;  1GNK A;  4J9K A;  1RT3 B;  4HI2 A;  5IS2 A;  1S9E A;  1P6T A;  4M5N A;  5KOX A;  3P49 B;  3IMQ J;  3SCJ E;  2J6T A;  5K9F A;  2EVZ A;  1NH8 A;  3JAM U;  4C3K A;  1KKH A;  1GAO A;  4ZJQ A;  3FNN A;  4JV5 F;  3CJT A;  3NGD A;  5T7L A;  3Q8U A;  2R8K A;  3CUN A;  2GO9 A;  1RT5 A;  1XMO J;  1SBR A;  3LQV A;  1R3N A;  4ZDN A;  3D6M B;  4AL6 A;  3DU6 A;  3MTK A;  3C14 B;  4H4K A;  3IWX A;  3IBF B;  5HRO A;  3UVJ B;  2DXF A;  5E5N A;  5JVH Q;  2ACY A;  4JUZ A;  1HNI A;  1OMS A;  2CVI A;  1VFJ A;  2EBG A;  2VG5 A;  2IMO A;  5I3U A;  1CJK A;  2IFX A;  1CJT B;  4X62 F;  2ILY A;  1VBY A;  4PKD B;  1NJI T;  1HBO A;  5ETP A;  2ALY B;  4G1Q A;  1U25 A;  3M8S A;  3HFZ B;  2FLN A;  2DGW A;  4YS2 A;  1IKX B;  3BO2 A;  3R5C A;  2QRR A;  2KM8 C;  3D1Q A;  1CS4 A;  4EUV A;  2L48 A;  2ASD A;  2ACM A;  4ENO A;  4O3R A;  4DX5 A;  3K57 A;  3BM7 A;  3FCW A;  5HQL A;  1WOS A;  5LOQ A;  4A8M P;  1QDU B;  1SKU B;  2OPQ A;  4OI1 A;  1K73 T;  3NL0 A;  3R7B B;  5AXN A;  3SQG B;  3NBP B;  2MSS A;  2FIU A;  4Q2L A;  3DLH A;  3EVM A;  1Z2Z A;  3VHQ A;  4W98 A;  2WW8 A;  4A8S A;  1JWW A;  1TKX A;  3UN3 A;  1J27 A;  2WBR A;  3OL9 A;  1YSJ A;  5L1K A;  4PYA A;  5E3C A;  1BY9 A;  1U1R A;  4K4T A;  2ROE A;  4OLO A;  1NCL A;  3ETM A;  3OXL A;  2MKY A;  1NSP A;  5LMN J;  4Y34 A;  2P5V A;  1RHQ B;  1TAQ A;  3EGN A;  3CJ2 A;  2QX0 A;  3K17 A;  4Y65 A;  5KFK A;  2ZC4 A;  1UTA A;  2E7X A;  3RBE A;  3KMQ A;  3ZZO A;  1VC0 A;  3G8S A;  2R8G A;  4FPR A;  1M0S A;  3OR1 A;  1VI7 A;  1JKH A;  1UA1 A;  2W1B A;  1NH7 A;  3JQM A;  4KKO B;  2XMM A;  4TLQ A;  3UQS A;  3LP2 A;  3CED A;  4QBU A;  4DV7 F;  2ZHB A;  4YR3 A;  3D0I E;  3UD4 P;  1IBC B;  4X4S A;  1VQS A;  1SV5 B;  3ZTR A;  3FEZ A;  4F3M A;  4OZ2 A;  4P7T A;  1WC0 A;  2PI4 A;  5DRK A;  1O0P A;  1IR1 A;  1HHQ A;  3MAH A;  3TZZ A;  4F4Z A;  3I9V 9;  4CIO A;  3LGM A;  3MMJ A;  2XSF A;  4CO1 A;  1VYA A;  2UU9 J;  4CP5 A;  4X4Q A;  1TK8 A;  2AYB A;  2IIH A;  4KB7 A;  3QT5 A;  3E01 B;  1X8D A;  2Z2Y B;  3PRD A;  4F02 A;  2KL8 A;  1KOO A;  4UW2 A;  4LJM A;  3FKB A;  1T9T A;  2EC0 A;  2CPJ A;  4WFX A;  4WIQ A;  3I0S A;  4XDD A;  2U1A A;  4J9V A;  4K0K F;  1WOR A;  2P8I A;  2RF2 A;  2E29 A;  2W2O P;  1UFL A;  3N9U C;  1I1G A;  5ETM A;  3R1H A;  2FPH X;  3ITH A;  3NWG A;  1OY9 A;  3MHY A;  3W2W A;  3KG1 A;  1RTJ A;  4I56 A;  4WZQ A;  4CM2 A;  4B3T J;  2CQB A;  2HHH J;  2JC1 A;  3CJS A;  3V4M A;  1U45 A;  3MMB A;  4FF4 A;  1I94 F;  2OO4 A;  4URS A;  2CJB A;  4LF9 J;  1YRU A;  2A10 A;  2OD4 A;  1M5K C;  1SJ1 A;  4ECW A;  2RRA A;  1S10 A;  3E3X A;  2VL1 A;  1S97 A;  4GVB A;  3BGR A;  2J76 E;  1NSA A;  3RR8 A;  2GVZ A;  2UXC F;  2KG0 A;  3ILO A;  3MEG A;  3DDN A;  3IG1 B;  1X31 C;  1RGV A;  4TQR A;  4ALZ A;  5KFA A;  2C2N A;  2MQO A;  3HZE A;  4MK8 A;  1NKC A;  2Z30 B;  3HSG A;  2ZHO A;  4IDK B;  2ZH3 A;  1CLF A;  5IXU A;  2MQ8 A;  3MXH P;  2B6A B;  1A7G E;  3MM6 A;  2R7T A;  3B6B A;  3EZU A;  1IQZ A;  4ZCL A;  3DLG B;  4BLG A;  4N7T A;  2DGS A;  4J9O A;  3OR2 A;  1R7I A;  1WDT A;  4C8K A;  3LPY A;  2AF6 A;  3N28 A;  2BE2 A;  4LT6 A;  5KG3 A;  3KUG A;  3H90 A;  1C0T B;  2F8E X;  2NR0 A;  2OD6 A;  2J9E A;  2QC3 A;  2DHX A;  1OJ4 A;  2XMJ A;  1N36 F;  3K5M A;  3FZB A;  4FS2 A;  5DQI A;  2ZBP A;  4WKY A;  3P8B B;  1UFW A;  1TMM A;  1HR0 F;  2GC8 A;  5KT7 A;  3R2D J;  2L41 A;  2NLW A;  1UJ6 A;  3KLV A;  4C8Z A;  4AL5 A;  3GJR B;  3LW5 C;  4DU7 A;  3D54 A;  1BE4 A;  1S1W A;  2LXU A;  1U48 A;  4C6A A;  4P75 A;  3BGL A;  2G2O A;  5A2Q Y;  3QRQ A;  2LU2 A;  4PG6 A;  4K4Z A;  3UN5 A;  4UST A;  2EFG A;  4CNY A;  2MEW A;  1PJ7 A;  1WAC A;  1DUR A;  2G0I A;  2V8D A;  1WEL A;  3TWZ A;  4O3Q A;  1LWX A;  4KYZ A;  3G87 A;  4X64 J;  1HHT P;  1LWF B;  3MFH A;  4A8F A;  5BYR A;  3UD3 P;  1BQN B;  2YWK A;  3OFG A;  1U1Q A;  5B0E A;  3CT9 A;  1NPP A;  3B78 A;  1B0T A;  3C2P A;  4M5L A;  1EZZ B;  1DBD A;  3T5L A;  5KG0 A;  2B9Y A;  1H7X A;  3AXK A;  2CJA A;  4CT8 A;  2MZJ A;  3D0H E;  2QLF B;  5E41 A;  2GQC A;  1PBA A;  4F67 A;  2ZD1 B;  3DFE A;  5EHH A;  2CRL A;  2C3O A;  2Q43 A;  4F3Q A;  4BWJ A;  3DMJ B;  5T41 A;  1VJQ A;  4DR7 J;  1OYE A;  2ZOF A;  3PW2 A;  4OZ0 A;  2DHS A;  3CCT A;  2ADC A;  3I0R A;  5CZV A;  1WEZ A;  4K4W A;  5L39 A;  4G3I A;  1K1S A;  2QL7 B;  4OYZ A;  3JYT A;  1SJ4 P;  4OI4 A;  1B64 A;  1F60 B;  5DM7 Q;  1RTD B;  5FII A;  2H9Z A;  1FJC A;  3VF0 B;  2MLY A;  3PW7 A;  5GAG U;  2KT5 A;  3HT0 A;  3EXY A;  3PR5 B;  3E51 A;  2XLI A;  3SCK E;  5CAA A;  2RQM A;  1SKS A;  1OPI A;  1VJW A;  3CTR A;  2LA4 A;  3IRX B;  2B0G A;  3NXZ A;  2KVI A;  4DDF A;  4W4M A;  1YJN S;  2VBX A;  5E3Q A;  3NGT A;  3HJF A;  5ETR A;  3D3C J;  1FX2 A;  3PYD A;  2DNZ A;  3D6F B;  2QA1 A;  2JX2 A;  2E7W A;  1U1O A;  2F4F A;  2DY9 A;  2JFD A;  3V81 A;  2VF3 A;  4ZVH A;  3C16 B;  1REV B;  2QGF B;  3ILL A;  2DNR A;  3EJM A;  4NYP A;  5DG7 A;  1TKT B;  1J5O B;  1RU2 A;  2XZT B;  1T3O A;  3WZ0 A;  2KI2 A;  2PD1 A;  4R0E A;  2OEJ A;  4P74 A;  2WVC A;  2L3M A;  3H5X A;  1HW8 A;  4O4R A;  1RAE B;  4MK9 A;  1QJH A;  3W2V A;  2MGZ A;  3N5B A;  1ZYQ A;  4O3O A;  1HNV A;  3EXC X;  4Q7A A;  4EYI B;  2W8L A;  5A8W B;  2NPF A;  2R7X A;  4KPY A;  2AQ4 A;  2CQG A;  4DPW A;  3KLH B;  1HD1 A;  4OHZ A;  1WOO A;  4KJI A;  1M1G A;  1UWB B;  1J5E F;  2CQC A;  4LF5 F;  2R7V A;  1Q1K A;  2FDN A;  5MLC V;  1UP1 A;  5CD4 A;  3OBI A;  3GMG A;  1HBU B;  3B8H A;  3O8W A;  4ELU A;  2OFH X;  1CVJ A;  1HWU A;  1N5V A;  1FVQ A;  1HBM A;  3TJ8 A;  2B56 A;  1EHW A;  2CQP A;  3Q89 A;  4DQI A;  3A3N B;  1HWI A;  1H74 A;  3L09 A;  4CYU B;  2MZQ A;  4WFZ A;  5F8G A;  1E6V B;  4PQU A;  3V6H A;  2YXL A;  2ASY A;  3IN5 A;  5IFM A;  1F9F A;  4WFB Q;  2W9C A;  2ZNY A;  4W92 B;  2K1R B;  3GFX A;  2J0Q D;  1X60 A;  1MG7 A;  3ZZY A;  1N8R T;  1WC5 A;  2OGU A;  4PPZ A;  3MTJ A;  4U95 A;  1RTZ A;  2MLZ A;  2C3M A;  2RDI A;  1BQM A;  2ZE2 B;  3UWT A;  3X3U A;  5J2M B;  1HIY A;  4JI1 F;  1AB8 A;  9ATC B;  2AZ3 A;  1FKO B;  3TO8 A;  3C14 A;  1TEL A;  4DR3 F;  3VAM A;  5DG9 A;  3BDE A;  2HMI B;  2CPI A;  4MIW A;  1YJT A;  2D9O A;  4TU9 A;  3RTV A;  3IBC B;  4LFB F;  3OVB A;  4IRD A;  4H4M B;  1S0M A;  3H2L A;  1RHK B;  3GFH A;  4JI7 J;  4LRA A;  4UUW A;  5KFE A;  3TUZ C;  4DLE A;  3C3L A;  1U02 A;  4C97 A;  2RNE A;  4ED4 A;  2W9A A;  3LO3 A;  1URR A;  1H6K X;  4RLE A;  5U47 A;  1B4S A;  2DT9 A;  4PG5 A;  4L76 A;  3LH2 S;  4KY3 A;  5K8O A;  2ALZ A;  2EXU A;  4CLL A;  3BKT A;  2RVJ A;  1NK4 A;  5C2C A;  1YZ6 A;  1SJR A;  4OHW A;  1IKX A;  3OW2 R;  4NLO A;  1GX5 A;  3VGS A;  3HVA A;  3KDN A;  1TQL A;  1M1K T;  4CT9 A;  1MLA A;  2HVH A;  3UCZ P;  1X4H A;  3VQS A;  2ZEJ A;  3DGP A;  1TVR A;  3K5N A;  4N56 A;  3K89 A;  1LFW A;  2OUG A;  4PG4 A;  2VZ9 A;  2G1D A;  1WI8 A;  4QWC A;  2HFN A;  3JTN A;  5H9F K;  4ZPD A;  1QSS A;  5A76 A;  3O5T B;  2ZH9 A;  1U49 A;  1VIX A;  3H98 A;  1FI4 A;  3SQG A;  3UO0 A;  3O2I A;  4OYP A;  3CC4 S;  4KAI A;  1VHI A;  2QT7 A;  5A8K B;  3G6E S;  1C0U B;  2YH1 A;  1IJF B;  4FN5 A;  3RBD A;  4DL4 A;  2ABY A;  2UVV A;  4ICL B;  3T5J A;  4K4X A;  3D67 A;  1NME B;  4UUX A;  4C4W A;  3FC9 A;  1IWA A;  1BLU A;  2BBE A;  3HD1 A;  3AY0 A;  3M8P A;  2HGN A;  1MRO B;  2ZBI A;  3BPS P;  2ZWO A;  3KFW X;  1RWX B;  3K0J A;  1WD6 A;  4ZP9 A;  4ZIW A;  4JB8 B;  4LVN P;  3E2E A;  2DR8 A;  3GCX P;  1TK5 A;  3GB0 A;  5E0O A;  3PJ9 A;  4QR1 A;  5H1S V;  4XTT A;  4KKO A;  3JSY A;  4WBF A;  3D3B J;  2BV3 A;  4M95 A;  4OYM A;  4ZIT A;  3ZZP A;  1B3T A;  1Q5V A;  1U09 A;  3DLB A;  4KH0 B;  3TAM A;  2O5D A;  4PXD A;  2F65 A;  3M32 A;  4L3K A;  1SV5 A;  3CO0 P;  2J9D A;  5AXM A;  3R6L B;  3DHW C;  3TX8 A;  1QVF R;  4ZVG A;  1FA0 A;  4YUD A;  1M5O C;  4UOC A;  5J1E A;  3E01 A;  3QWU A;  2RRN A;  3BBB A;  4WP9 A;  3TW0 A;  4J7C A;  2FJD B;  3NWR A;  1IKY A;  2AU0 A;  2JC0 A;  3SV3 A;  4B3M F;  4I7F B;  1D3W A;  2VJV A;  3GJQ B;  2WVE A;  4FNH A;  1U1P A;  4LRB A;  4DX7 A;  2WTF A;  1T94 A;  3I4H X;  4ZLN A;  3IWN C;  5EN1 A;  2KRB A;  3R5B A;  4HAC B;  2OEL A;  2E66 A;  2UUB J;  2MB0 B;  4WXO A;  4M5J A;  3R7N B;  4N76 A;  2UXB J;  3KJV A;  4DS5 A;  2CZ9 A;  4ZVR B;  4YP3 A;  4CO3 A;  3HMJ G;  3HUL A;  5E7O B;  2YQ3 A;  2YNI A;  2XSJ A;  1TL1 B;  5HP1 A;  5KFM A;  4OQJ A;  5CAB A;  4TU7 A;  4GKJ F;  2JOQ A;  4DL0 C;  1QVG R;  2AEJ A;  1JIH A;  2WSE C;  4OZ5 A;  1N34 F;  1WEY A;  2YWW A;  1PJ6 A;  4DSK A;  3VGU A;  4WF9 Q;  2FVC A;  4DEZ A;  2HLU A;  3C66 A;  3GCW P;  3RZA A;  1QSY A;  1RAF B;  3HHE A;  1L3S A;  4HL9 A;  2XCP A;  2XTJ P;  4YR2 A;  2LFV A;  3M8Z A;  4R5P B;  2XC9 A;  4I0W A;  4KO0 A;  1FWP A;  1JJ2 R;  1NK7 A;  4A8K A;  4CTA A;  2PT0 A;  1TU0 B;  3DDK A;  4A8O A;  2FLO A;  5HAN A;  4DJB A;  1M5H A;  4IDK A;  3ULH A;  1T9X A;  2PC6 A;  2J6S A;  2G0C A;  2BRL A;  1FJ7 A;  2B6A A;  3T1H F;  3J7A 1;  3LAN A;  3VAJ A;  4PXC A;  4X4O A;  1FK9 B;  5HLF A;  2WSF C;  3CCU S;  2KHC A;  1TUG B;  1RI7 A;  5RUB A;  1Q0N A;  1I3O B;  1SUQ B;  3T5K A;  3DC2 A;  3KJN B;  3M30 B;  3KUH A;  2DIV A;  5F8J A;  1FXL A;  4P73 A;  5D3G B;  1BHN A;  2NPI A;  1S0V A;  4B3R J;  1RT6 B;  2VPY B;  1IBL F;  3THV A;  3MUT P;  3DI6 B;  1WC1 A;  3HKW A;  4ZPW R;  1HYS A;  4EO6 A;  4TYB A;  1FEE A;  1U6Z A;  2WON B;  1TV6 A;  4JI6 F;  5G4D A;  5BJR A;  2QSF A;  1HI8 A;  1DHM A;  2HW3 A;  2IC3 A;  4IO9 Q;  3TAR A;  4DR1 F;  1RB0 A;  2CJ9 A;  1FES A;  1QLN A;  3PRV A;  3EPI A;  1U1N A;  1JLA B;  1EET A;  5B0F A;  1NBE B;  2Y0S D;  2R2U A;  5HK4 A;  2DKO B;  4MH8 A;  2BJ7 A;  2D3O 1;  3R7S B;  4NEY A;  3GTY X;  3P45 B;  2VIH A;  3L7U A;  4LF7 F;  3CCW A;  2IDE A;  4CLK A;  4CH0 S;  3DRP B;  2X1F A;  2CNN B;  2UUA F;  3UPF A;  1U6F A;  4A8Q A;  1XMQ F;  2DR9 A;  4CQ1 A;  2JRS A;  5DJB A;  5G0R B;  4NXN F;  1LWF A;  2E1M C;  4X4T A;  1BQN A;  1VBK A;  3BGF A;  4ES2 A;  1Y5I B;  4OYX A;  3OQ2 A;  3J81 j;  4LF4 F;  2HHS A;  4EO8 A;  2ZZT A;  2V2V A;  3Q8Y A;  1G1X A;  4JI8 F;  1DRZ A;  3TVZ A;  1T0T V;  2HHT A;  5L1I A;  4QIV A;  4MK7 A;  1Q8L A;  4DPT A;  3Q23 A;  3S01 A;  2LQB A;  2FUG 9;  1MN7 A;  2VAS A;  4F4K A;  1VCT A;  4LIR A;  2DK2 A;  1OWX A;  2VDI A;  5HBM B;  3NAI A;  4JI0 J;  4NPO A;  1KQS R;  4KGK A;  1HFE L;  4PXB A;  5GAH U;  2HZC A;  4FYY B;  2P9C A;  2ZJR Q;  4CH7 A;  3V5R A;  4M5I A;  4DR4 J;  5SZT A;  1T7P A;  3P3D A;  1NHK L;  5J2Q A;  4AL7 A;  1NK6 A;  1F3V A;  3N6L A;  1U0H B;  3NMA A;  1W2B R;  3Q8V A;  1F2H A;  3ZZT A;  1FNO A;  4DR5 F;  3EPG A;  2XYG B;  1UFK A;  1IKW A;  3D66 A;  4JI3 F;  4WZM A;  3AB4 B;  3QFH A;  4IFY A;  4H4O B;  1N5Y B;  2HWH A;  3T1Y J;  1XWL A;  3GE9 A;  1D9D A;  2GIQ A;  4F2S A;  3ADA C;  1KEK A;  2ZM6 J;  1KQF B;  2HGM A;  3MR2 A;  1R0B G;  1OO0 B;  3H5Y A;  2Y0B B;  2JDJ A;  3C16 A;  5K5M A;  4QQB A;  2KT3 A;  3AOC A;  5KFY A;  4C8Y A;  2H65 B;  4U8V A;  3SYZ A;  4CWB A;  1I6J A;  2F9D A;  1IBM J;  5HAO A;  4RJV A;  2PFF B;  4ILL A;  1VBZ A;  2GHP A;  2CJX B;  1NDK A;  5K20 B;  4A46 A;  1MN9 A;  3PKM A;  4KHM A;  5A8W A;  2DNO A;  2Q66 A;  3IAS 9;  4NZ7 A;  4J90 A;  1X4F A;  1OSC A;  3I56 S;  4NA3 A;  4ELV A;  1PBU A;  4FPI A;  4RW7 B;  3H20 A;  2Q3P A;  2FVR A;  2XLK A;  1UWB A;  2OFG X;  4JOU A;  5SUH A;  3NP5 A;  2MZR A;  2M8H A;  1TFY A;  1WHY A;  1V5V A;  3IM9 A;  1X9W A;  4U7U D;  1Y4Z B;  1HBU A;  4LVO P;  3V6K A;  2GW8 A;  3CMA S;  1FJE B;  4ZCI A;  2VC1 A;  3JXO A;  1FER A;  4LR8 A;  1WC4 A;  3EDQ B;  4DUZ F;  1LKZ A;  4E98 A;  1LV5 A;  2Y9H A;  4EZ6 A;  4OI0 A;  3W64 A;  1ZS6 A;  1CQM A;  1E6V A;  1EIY B;  3T1A A;  4DZ6 A;  2BEF A;  3CDA A;  3LWM A;  3P5T L;  3SSR A;  4KGZ B;  5JXS A;  3T3F A;  1KTV A;  4NCG A;  1IVZ A;  2ZH5 A;  1URN A;  4G65 A;  4YY3 F;  3SCL E;  2YKN A;  1MMN A;  3R97 A;  2B4V A;  1JNZ B;  3WQP A;  4AE5 A;  4WTY A;  3R5G A;  4USV A;  2EK6 A;  4YOE A;  4DQQ A;  2XS5 A;  4MKV A;  3AOB A;  1WNE A;  2EI5 A;  2YNF B;  4RU9 A;  3HLU A;  1F2G A;  4F0H A;  2UUC F;  2M5Y A;  2CQ3 A;  4ZVP B;  1N33 J;  2AJ0 A;  3G8Q A;  4YN3 B;  3C8Y A;  1Z4U A;  1FKO A;  2H1Y A;  1RAD B;  2MHN A;  1S1V B;  1NK8 A;  1AFJ A;  1LEO A;  2AYG A;  5ETO A;  1NEE A;  2X3D A;  3HHL B;  3TAQ A;  3NAH A;  3TA1 A;  4H4M A;  4ZPT R;  2PEH A;  5HQ8 A;  5EWG A;  1Z2L A;  1TTH B;  1GMW A;  3EWG A;  3S1T A;  3FSI A;  2GMH A;  5D15 A;  3TA2 A;  1WOP A;  3M6X A;  2FHK A;  3KUE A;  1WKJ A;  5LXR A;  2DR7 A;  1REG X;  1UVK A;  1NZ8 A;  4UZB A;  3VWS A;  1NDL A;  1Q5Y A;  3CCM S;  3KTQ A;  5L46 A;  2W7A A;  1S4F A;  1SQG A;  4P2S A;  2PE8 A;  4FS1 A;  1KON A;  3RW7 A;  2F4V F;  5KT6 A;  4N77 A;  3L4B C;  3GFY A;  1HPZ B;  2AZ1 A;  2B4U A;  2HUR A;  1OYD A;  3FEY B;  1T03 A;  3VV2 B;  1VQY A;  3NEK A;  2LQ5 A;  3BN7 A;  4K5R A;  4LSZ B;  2MY8 A;  1DTT B;  3A13 A;  5DGA A;  2Z57 B;  4I2Q A;  3DRS B;  1NK5 A;  2I0X A;  1N6Q B;  2BJ8 A;  4URG A;  4AXJ A;  4QU7 A;  1HWK A;  2HBQ B;  3HVR A;  2IJF A;  2W9B B;  1FKP B;  3GR0 A;  2HFU A;  1I51 B;  1U7L A;  2P6T A;  2Z0G A;  1S6Q A;  1C0U A;  2H48 B;  2VPW B;  1LXN A;  2GHW A;  2YVS A;  3G4S S;  4ICL A;  3IS9 B;  3KK1 A;  4G6V B;  2OH2 A;  5F3Z A;  4OL8 A;  2VOO A;  2EBE A;  3H2V E;  2ASJ A;  1MRO A;  3BO4 A;  3RB0 A;  3AOA A;  1UJ4 A;  4GKK F;  5HI7 A;  4OI2 A;  1KVK A;  3J81 U;  4NXM F;  2IAJ B;  3CC7 S;  1UCN A;  1M1H A;  4C3L A;  4DLG A;  4FXW A;  2WCX A;  2ZNZ A;  2GJI A;  5F0U A;  3KK3 B;  1Z1Z A;  1XNQ F;  2JLF A;  1Y0H A;  2C2O B;  1NAQ A;  2BJ1 A;  3MOZ A;  3RB6 A;  3KLE A;  2QA4 G;  1NZA A;  1EP4 B;  3PJW A;  2J0W A;  1MML A;  1NDP A;  1KNZ A;  2R7O A;  5I3Q A;  2KJV A;  4I6Y A;  2MPU A;  4HH1 A;  2QL9 B;  2KYZ A;  4NX9 A;  4WPA A;  5ETL A;  4IRC A;  2V5H G;  1FE4 A;  5DG8 A;  3L95 X;  2B8P A;  3FMW A;  3H7H B;  1TL4 A;  5F9L A;  2Y8Y A;  4DPU A;  3A8K A;  5DGB A;  3GIK A;  6FD1 A;  2PSZ A;  2XB2 D;  1T8E A;  4UTG A;  2WOM A;  4I7F A;  1E6Y A;  4DV7 J;  4HYK A;  1RTH A;  4USU A;  4E2F B;  1HLW A;  2VA2 A;  1ZZF A;  3AFG A;  4X4V A;  5D0G A;  1AZS A;  4PCQ A;  1RWM B;  1YGY A;  4Q0B A;  1OSD A;  3I5A A;  3HFK A;  1S9G B;  1N0V C;  2KHD A;  2EW9 A;  2DH8 A;  3R5D A;  4LSN A;  5AXL A;  5FLX Y;  3FFI A;  1TL1 A;  3HI9 A;  2XQC A;  4LF6 J;  3FRY A;  1VQ8 S;  2PII A;  3DOM B;  4CDI A;  3J7Z T;  3K5L A;  5LJ3 Y;  2UVR A;  4Q2M A;  1Y5N B;  3J7A N;  3CJR A;  1G3O A;  2EC2 A;  2H5J B;  2RUG A;  1DLO B;  1VIS A;  3WC2 A;  1S1X A;  2H3E B;  2I5J B;  2YY3 A;  4OYO A;  4K0K J;  5CYM A;  3RR7 A;  1IM6 A;  3C6T B;  2CQ1 A;  3M2U B;  1KN6 A;  2RD5 C;  3H5U A;  3QAE A;  1Y11 A;  2GIR A;  3MR3 A;  3SV4 A;  2JFK A;  2LDY A;  4BDP A;  4OJ1 A;  2LQ9 A;  4U7C A;  4DS4 A;  4R5P A;  1F3F A;  1WWH A;  2QMX A;  2C2R A;  5IV3 A;  2CPX A;  4WKR A;  1I94 J;  1C1B B;  1JLB B;  2WVB A;  1B0V A;  4P7V A;  4ID8 A;  3LGN A;  3NOG A;  3DHX A;  4I69 A;  2WSC C;  2M70 A;  4USK A;  1HWL A;  1RBA A;  3ZTO A;  3DKD A;  1XMO F;  2WVF A;  1M5V C;  3THT A;  2F1F A;  3WBZ A;  4R8U B;  1NJY A;  3U02 A;  4UZC A;  1JJC B;  1EX8 A;  5FLX U;  3OJS A;  3QSI A;  2V4Q A;  5CD4 H;  1RBO B;  3M30 A;  1FRX A;  2XGP A;  4FXD A;  2XWX A;  2LMI A;  4GRS A;  1X0F A;  1EQM A;  1YRX A;  3ZZ0 A;  2XNR A;  5IQQ A;  1Y5L B;  2OEK A;  5F8I A;  2Z2L A;  2G0J A;  3EZO A;  3DM2 B;  2RIJ A;  2RUS A;  1VQM S;  1YJV A;  3QGH A;  1S1T B;  3ZTS A;  4Y00 A;  3KHL A;  2E9Z A;  2LP4 A;  2CZV C;  4C7Q A;  4A47 A;  4B9U A;  4B9N A;  4PQA A;  4XIU A;  1JLA A;  2Z8Q A;  5D78 A;  1GT8 A;  2W24 A;  2L9D A;  2R2R A;  2CXE A;  1N36 J;  2DH9 A;  2WBM A;  2IRX A;  1KFD A;  2IJN A;  4ZS6 A;  2CDQ A;  2IBK A;  1HR0 J;  1F1B B;  4KPC A;  1S6O A;  2XI2 A;  3FEX B;  2AWZ A;  4ED8 A;  5CCM A;  1H3D A;  4EU0 A;  2GV1 A;  1KLM A;  3RB3 A;  4QW8 A;  3DOK B;  1SQF A;  1CSJ A;  4Q44 A;  3UW1 A;  5LL6 d;  3CO9 A;  8AT1 B;  4PEO A;  3A8I A;  4ZLL A;  2BW2 A;  5FDL B;  4FF1 A;  3CMQ A;  4LRE A;  3TZW A;  3CC2 S;  3PX4 A;  4FBT A;  5LMN F;  3SBM A;  3MMC B;  2R7S A;  2JHE A;  2JVO A;  2QSW A;  2DNL A;  2W7O A;  4OHX A;  5H9E K;  3OUY A;  4O3N A;  1QY7 A;  2J7K A;  3GYX B;  2YPY A;  3J7Z 5;  1WUU A;  3WHI A;  3GQC A;  2WW4 A;  2P9E A;  5L38 A;  2HFZ A;  2AT1 B;  3GG0 A;  4GO7 X;  4CZC A;  3TVK A;  3I9Z A;  1K47 A;  2OSQ A;  2XMU A;  3PYE A;  1S48 A;  1CC8 A;  1FT8 A;  4ETX A;  1GTH A;  1XJW B;  3KHR A;  4DR2 J;  2NUH A;  3GV5 B;  1GXT A;  1U0H A;  4RW9 B;  3SIP B;  3F41 A;  2BQ3 A;  3M9N B;  2ZH7 A;  2VUG A;  5BYS A;  1C1C B;  1S6U A;  1N5Y A;  2LEA A;  2RU9 A;  3HXM A;  1VK3 A;  4TYA A;  4ZCK A;  1SC6 A;  4HT5 A;  2CVE A;  2NXJ A;  4LF8 J;  2DGQ A;  2BX6 A;  3HO1 A;  1M5S A;  3B4D A;  2AKW B;  2HIQ A;  2F8M A;  2CUY A;  4A8Y A;  3H59 A;  3QMQ A;  3BQ0 A;  4W90 B;  1Q8K A;  4RNM A;  5CXT A;  1KBR A;  2XG8 A;  1QM9 A;  5EDW A;  4B3T F;  2DGU A;  3M8Q A;  1MU2 B;  2V68 A;  4KBI A;  2OPS A;  3IGN A;  1NJW A;  4O3P A;  2DPI A;  2C2E A;  3MM9 A;  3AT1 B;  4NEZ A;  5DM6 Q;  3BR8 A;  4LF9 F;  4R0J A;  4CLS A;  4YEA A;  5F41 A;  2W2P P;  3DRX A;  5BYQ A;  2X7I A;  3OPK A;  3AD7 C;  3MAA B;  3TZY A;  3ISN C;  4PRF A;  4NWB A;  3BBF A;  3WX4 A;  1C4C A;  3CJ8 A;  2HWI A;  4F2R A;  3CJ0 A;  5F8H A;  2E7V A;  2CIM A;  3LGH A;  2M9K A;  3SDE B;  2VFS A;  3EMT A;  3CIM A;  3H2U B;  3CJ3 A;  2DEJ A;  3MM7 B;  3QGG A;  3DCA A;  4ED7 A;  4DR6 J;  3BRE A;  2R3V A;  3J80 U;  2RQK A;  2B5J A;  4B3O B;  5KOW A;  4ECT A;  4IG3 B;  2FQQ B;  1S57 A;  4DV1 J;  3FCV A;  1D8Y A;  1H7W A;  4RW6 B;  4LF5 J;  2BXJ A;  3QID A;  3FSX A;  2GGP B;  3DLJ A;  3MI7 X;  1V3Z A;  1YDL A;  3OSP A;  4MKA A;  3G82 B;  4WE1 A;  1ZTW A;  3U7J A;  3CDB A;  3OTC A;  1RA6 A;  5IT9 U;  4D3H A;  4DFP A;  2DR6 A;  3ZNJ 1;  5HVF A;  5GAD U;  2VON A;  1FRK A;  1RCO B;  4OLP A;  4WFA Q;  5HL7 Q;  5A0Y A;  1UPP A;  3V4I A;  1SC3 B;  4WYL A;  2I2Y A;  1S1V A;  4J91 A;  4M5D A;  2J7U A;  3IR7 B;  4MFB B;  2QA4 S;  2KU7 A;  3HHL A;  4G1P A;  4LIW A;  2AX1 A;  2HYI B;  2D9P A;  8RUC A;  3IRW P;  2ZDO A;  4XDC A;  3JB9 k;  4L6V 3;  2UUW A;  1LWE B;  1D8Z A;  2YBV A;  2YWF A;  3MCS A;  2CQ4 A;  3TQE A;  3OSN A;  3CIZ A;  1HBN B;  4JI1 J;  1HKA A;  3KOA A;  3NGU A;  4MKY A;  3Q8Q B;  1RT4 A;  1RIS A;  4K59 A;  1UEK A;  3LF0 A;  4RUH A;  1VC6 A;  4DR3 J;  1LQ9 A;  4I67 A;  2C22 A;  3KG0 A;  4X64 F;  4TY8 A;  2YKM B;  4A8X A;  1W2I A;  2YNH B;  3PHE A;  1X4C A;  2V9K A;  3BKU A;  1S1U A;  3CCS S;  1VGY A;  3PXG a;  3FBB A;  4DQR A;  3BF4 A;  2YTC A;  1BD6 A;  2RS8 A;  3G2X A;  3MM8 A;  4J9N A;  3GG1 A;  3ZXW A;  1VDH A;  2VKR A;  5CQG A;  4NLY A;  1VLO A;  1T9Y A;  4KV8 B;  4O0I A;  2ZBQ A;  3MM5 B;  3M2R B;  2W9B A;  3T9N A;  2B8Q A;  3S6E A;  2NUU G;  1FWK A;  2I1R A;  2HVD A;  2D1C A;  2HND B;  2FJX A;  2ZKT A;  3IP0 A;  3TJ9 A;  1WHV A;  2HFS A;  3Q8S B;  2O66 A;  3CCQ S;  4JV0 A;  3MD1 A;  2IRY A;  4AYB D;  1LXJ A;  1JLQ A;  4F4W A;  2IJR A;  2M0G B;  1X4E A;  2R7Q A;  3TAN A;  3HSJ A;  1LWC A;  2VOP A;  1IKV B;  5LT5 A;  3GON A;  3UDV A;  3QRR A;  1NND A;  3I31 A;  2R7R A;  1UVL A;  4L72 B;  1FVS A;  2ZVI A;  3AQP A;  2XYP B;  4K4V A;  3KK3 A;  2D41 A;  3VVT A;  2E1R A;  3CD6 S;  4NLG A;  1TR0 A;  4CO0 A;  3BQ1 A;  5J2P B;  3RW6 A;  2NYI A;  2EKN A;  2XY7 A;  3CE8 A;  1DZ5 A;  2MTL A;  3MGJ A;  3MMA B;  4ZN3 A;  1L3V A;  3PX0 A;  2IM3 A;  1CPZ A;  3MUV P;  1FD8 A;  2CAJ A;  4QCL A;  2BM1 A;  1UMJ A;  3FCH A;  3HDS A;  2ZUA A;  4IH5 A;  3JTP A;  1VQK S;  1X5P A;  2R8J A;  4DV0 J;  2R42 A;  4NI2 B;  3IXQ A;  3MDF A;  3GFZ A;  4X4P A;  5DET A;  3GII A;  4KIA A;  1TL3 B;  2LKZ A;  2IM2 A;  1VOM A;  3SSQ A;  1S6P B;  3ZNU A;  3ICL A;  4RNO A;  3CW2 C;  1YRT A;  4DV3 J;  4AXI A;  1FF2 A;  1WHX A;  1VQN S;  3KLI B;  4OV6 A;  1TL7 B;  4JI2 F;  3TR5 A;  2HVE A;  1P1T A;  4ATN A;  4HKQ A;  4OMF G;  1RU1 A;  2BW7 A;  3VGT A;  3HVT A;  3H5S A;  4M5G A;  3BBC A;  3HK2 A;  3P5B P;  5GVQ A;  4ZPC A;  1S9G A;  5C25 B;  2V2Q A;  4QIW D;  1T9U A;  2GQQ A;  2QFJ A;  2HG4 A;  3DOM A;  4LRC A;  1Q79 A;  1LK7 A;  4QIF A;  4IFV B;  2ZUG A;  3SEO A;  4B3M J;  3GIL A;  4OI6 A;  5GAE I;  4YB7 A;  2DNY A;  1ZPV A;  4DZD A;  1KP6 A;  3MAQ A;  1R27 B;  1EAY C;  4UQT A;  1S76 D;  4AFF A;  1FEH A;  2W4D A;  2VG6 B;  2KXN B;  4NLX A;  5HMY A;  3TAP A;  2V8P A;  4BWM A;  3Q22 A;  1TL5 A;  4FZV A;  3PEJ A;  1ZTT A;  4B3S J;  2VQF J;  8ATC B;  2OPP A;  4ILM A;  3MPV A;  3ZTQ A;  3WIV A;  2KVQ E;  4FF3 A;  2CJK A;  2PEB A;  5AE3 A;  3TX0 A;  3ILI A;  1LFP A;  3UN2 A;  3PX6 A;  3M9M B;  2DRD A;  4WU3 A;  4DX8 H;  1YZ7 A;  1JLF B;  4QWA A;  4HTJ A;  1YI2 S;  2FC8 A;  3MD3 A;  3TEH B;  1N34 J;  3NNH A;  1RSC A;  1XNR F;  3H8Y A;  5EGY A;  4DL5 A;  4OZJ A;  1FRI A;  1KVI A;  2CNK B;  2OML A;  2CQ0 A;  4WP3 A;  2W01 A;  4R8U A;  3TUP A;  2K7K A;  3M6W A;  2JEI A;  3VZH A;  3BYR A;  1RZM A;  4ECY A;  3TJA A;  3VZI A;  5GME A;  2B51 A;  1L3K A;  3MEE B;  4MKB A;  2CG8 A;  4ID5 B;  2MXY A;  4JI7 F;  5L9N A;  2NXN A;  4DQS A;  2HNZ A;  1N54 B;  3DM2 A;  1JXE A;  3T1H J;  1FNM A;  1CUL A;  1X4D A;  2GZO A;  3PEH A;  3LOU A;  1Q53 A;  1GMW D;  3W61 A;  1YJU A;  5AT1 B;  1UZH A;  2VBW A;  1U2C A;  2NXU A;  4ZOS A;  2VU5 A;  4NLU A;  4FBU A;  2KXF A;  4ZCM A;  4DCP B;  4IOB A;  2XS2 A;  4DBQ A;  1HNI B;  3N4W A;  4C8O A;  5LM7 E;  2G13 A;  4DV5 J;  2PMW A;  5F8N A;  2LCW A;  1GXU A;  2CNL B;  4F36 A;  4U67 Q;  4J9M A;  1QE1 A;  5IWA J;  3CDW A;  1LW2 B;  4CH1 A;  1DFD A;  1U2R A;  3QYY A;  2HZA A;  4JI6 J;  1L3T A;  2IM0 A;  3LPE A;  3FQL A;  3QAT A;  2DNM A;  2RKI A;  1VRT B;  1BWV A;  2P2C B;  1CJU A;  3KJF B;  4DR1 J;  5EX0 A;  3DOK A;  2YNG A;  1SL1 A;  4FNI A;  1TAU A;  2LA6 A;  3JSB A;  4C2M A;  3ONQ A;  3T5H A;  3UCG A;  3MEC A;  1GTE A;  4KTQ A;  5HSP A;  4DV2 J;  2JNJ A;  3RRK A;  4IUF A;  4Z7C A;  4WFY A;  1XR6 A;  4LF7 J;  2BDP A;  2QYC A;  3I82 A;  1KHW A;  3TP2 A;  3CUL A;  3OFF A;  2OPR A;  1WI6 A;  2VQE J;  5KFI A;  1DQ9 A;  5KFG A;  2AV5 A;  1XMQ J;  1V6H A;  2AGQ A;  3ELH A;  5HVG A;  4C48 A;  3AXM A;  2DXD A;  4RW4 A;  1ZAV A;  2GML A;  4O4G A;  1TKX B;  7FDR A;  1JLC A;  1QD1 A;  4LF4 J;  1Y3J A;  4F25 A;  3VQT A;  4WYW A;  1LW0 A;  2XZD B;  5J2N B;  4JI8 J;  3ISZ A;  2BKN A;  3TYT A;  3EM1 A;  1YWX A;  3FQK A;  4RWX A;  4RW9 A;  2P6S A;  3SFU A;  3ENA A;  4M8L A;  3ZTP A;  1H2U X;  3R3T A;  5DZ7 A;  1T3N A;  4CLW A;  4WTO B;  4U7U K;  4K4U A;  4QYZ K;  1H72 C;  4P10 A;  5KG5 A;  3RRG A;  4QU6 A;  1C1C A;  1S9F A;  5E33 A;  2EFN A;  3OR1 B;  5KG7 A;  3FDS A;  3QLH A;  4ED5 A;  4NYO A;  4C11 B;  2KG1 A;  3FBE A;  2C3P A;  2BE9 B;  4RUC A;  4GC7 A;  2MLX A;  2POK A;  2M2B A;  3QRP A;  4I4B A;  4ANC A;  4RR5 A;  1ZBT A;  3SXL A;  4PWW A;  4NA2 A;  4WU2 A;  3G6Y A;  2A2D A;  4JI5 F;  2UUB F;  4KFB A;  1YG0 A;  2UXB F;  1NKB A;  4JBC A;  2V4J B;  4RO0 A;  3PIP Q;  5L1L A;  2VC0 A;  2RDJ A;  1R6V A;  4I64 A;  3ZC4 A;  2QLX A;  2E9T A;  1WJ9 A;  1MU2 A;  4V19 X;  2C2D A;  4UT4 A;  5LMU J;  2HWT A;  3DLE A;  4LMZ A;  2J7W A;  3K58 A;  5DQG A;  2FZK B;  5ETV A;  2V50 A;  3EZ5 A;  2QLW A;  1AUS L;  3S7R A;  1JXL A;  1VK8 A;  2RF2 B;  3HP6 A;  1H38 A;  5A8R B;  3W5Y A;  4N8N A;  2KFY A;  3MAA A;  4LRD A;  1V3S A;  2HEK A;  4ECU A;  4OJ3 A;  2KM8 B;  4CM0 A;  4USH A;  1GQE A;  1RTJ B;  1RT7 A;  2HIY A;  3W9I A;  2Y1J A;  1FO1 A;  1FJG J;  4YDX A;  3CDU A;  1XER A;  3OLA A;  4FYX B;  1RT2 B;  4DUT A;  1XN9 A;  3MMB B;  1PO6 A;  1ZOT A;  2XMV A;  1HMV A;  3SZ2 A;  4B3O A;  4K4Y A;  2AEM A;  1RLD A;  3NOC A;  4FP9 A;  1NM2 A;  1FXD A;  3PYG A;  5GMK a;  4DG1 B;  4KHR A;  3KLG A;  3LP0 A;  5JJB A;  3QO9 B;  3HD2 A;  4CLT A;  2GS8 A;  3BGR B;  3G82 A;  2LQ8 A;  3DLK A;  5A2Q U;  3HJV A;  4ZP6 A;  4WCE Q;  2GVZ B;  1IUJ A;  3EX7 B;  2MDA A;  3MEG B;  2PA3 A;  3GP9 A;  4DUZ J;  2XS7 A;  4B3R F;  3A3P B;  3V6J A;  4WK3 A;  6AT1 B;  2WAQ D;  1D9A A;  1HNZ J;  2CAD A;  3UD5 A;  2DYA A;  3V2U C;  2M8D B;  4WWS A;  4DI6 A; 
#chains in the Genus database with same CATH homology
 4ENO A;  3Q8U A;  1NDL A;  5BXI A;  3R9L A;  3EE3 A;  2DXE A;  1NDK A;  3FCW A;  3VGS A;  1K44 A;  3VVU A;  3FBE A;  1MN9 A;  1F6T A;  1U8W A;  3PJ9 A;  1NSK L;  3L7U A;  1S57 A;  1HLW A;  4DUT A;  5CAA A;  3ZTR A;  4WBF A;  1UCN A;  1HIY A;  3FCV A;  1NB2 A;  4ANC A;  3NGU A;  1NHK L;  2DXF A;  2AZ3 A;  1HHQ A;  4AND A;  3ZTQ A;  1WKL A;  3JS9 A;  3NGR A;  2VU5 A;  5CAB A;  3Q8V A;  3ELH A;  2AZ1 A;  2HVE A;  2HUR A;  3EVM A;  1VYA A;  3EIC A;  3ZTO A;  4W98 A;  3DKD A;  4CP5 A;  3GPA A;  3NGT A;  1NLK L;  2DXD A;  3FBF A;  1PAE X;  1S5Z A;  4KPC A;  3VGT A;  1BHN A;  3BBC A;  3NGS A;  1NSQ A;  1EHW A;  3MPD A;  3BH7 B;  3Q89 A;  4F36 A;  4HR2 A;  1NDP A;  4UOH A;  3VVT A;  2DY9 A;  1BUX A;  1S59 A;  4EK2 A;  3FBB A;  4F4A A;  3VGU A;  4S0M A;  1NCL A;  3ETM A;  3FKB A;  1XIQ A;  5IOL A;  1NSP A;  1LEO A;  3G2X A;  3Q8Y A;  3VGV A;  3EM1 A;  1BE4 A;  3BH6 B;  3EVO A;  3EJM A;  3BBB A;  4C6A A;  5C7P A;  3GP9 A;  3ENA A;  3FC9 A;  4O0N A;  3BBF A;  2B8P A;  4UOF A;  3ZTP A;  3FBC A;  1B99 A;  1KDN A;  1JXV A;  3Q86 A;  1WKK A;  1MN7 A;  2ZUA A;  4UOG A;  3B54 A;  2BX6 A;  1XQI A;  1ZS6 A;  3EMT A;  1W7W A;  1PKU A;  3PRV A;  1B4S A;  3Q83 A;  4DZ6 A;  2BEF A;  2B8Q A;  3ZTS A;  3DDI A;  1NPK A;  1NUE A;  4ANE A;  3B6B A;  2HVD A;  2DYA A;  1WKJ A;  2NCK L;  4FKX A;  3WX8 A;  4FKY A;  3EVW A;  2CWK A;  1LWX A;  1NDC A;  4DI6 A;  1F3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...