1NDPA

Adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adenosine 5'-diphosphate binding and the active site of nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 43
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1993-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1ndpA00
1NLKL 3L7UA 1NDKA 2AZ3A 5BXIA 1MN7A 1NDLA 2HVEA 4ANDA 1EHWA 2DXEA 3VGTA 4FKYA 4DI6A 1BUXA 3Q8YA 1WKJA 4O0NA 5CAAA 2B8PA 4UOFA 2BEFA 4S0MA 3NGRA 1NDPA 1XIQA 3VGVA 3ETMA 3JS9A 3EM1A 3ZTSA 1ZS6A 1JXVA 2VU5A 3EE3A 3NGTA 4FKXA 2AZ1A 1PAEX 1LEOA 4C6AA 3ENAA 3EVMA 4ENOA 3NGSA 1NHKL 1VYAA 5CABA 1S57A 2DYAA 3Q83A 3B54A 4F36A 3FBCA 2DXFA 3PRVA 3FBEA 3GP9A 3EJMA 4UOGA 3FBFA 5C7PA 3WX8A 1LWXA 1XQIA 3Q86A 2CWKA 3BBCA 3Q8VA 4EK2A 1NSPA 2BX6A 2B8QA 1NB2A 1HIYA 1W7WA 1BE4A 5IOLA 3VGSA 1S59A 1PKUA 3EVOA 3FCVA 3G2XA 3PJ9A 3BBBA 1UCNA 4W98A 4WBFA 1S5ZA 2NCKL 4F4AA 1MN9A 3ZTRA 3Q8UA 1NSQA 3VVUA 2HVDA 3BBFA 3DDIA 3NGUA 1WKLA 1F3FA 1B4SA 1HLWA 1F6TA 1U8WA 1BHNA 1NUEA 3BH7B 4ANEA 3FC9A 4CP5A 4KPCA 3B6BA 3VGUA 3ZTOA 4ANCA 3EVWA 3VVTA 4UOHA 3EICA 3Q89A 3ELHA 1B99A 3BH6B 3MPDA 4DUTA 1NSKL 1NDCA 2DXDA 3R9LA 3ZTQA 2DY9A 3FKBA 4HR2A 1K44A 1NPKA 1WKKA 1KDNA 1NCLA 2ZUAA 3FCWA 2HURA 1HHQA 3EMTA 3FBBA 3GPAA 4DZ6A 3ZTPA 3DKDA
chains in the Genus database with same CATH superfamily
4JYAJ 3PM9A 2YQ1A 5DDPC 3D1HA 4RW6B 1T11A 5FD1A 3M4XA 4X64F 3W9IA 1IWGA 4C8MA 2UXBJ 1YIJS 4FN5A 2RHQB 4GVBB 2VOPA 2MKHA 4OZ2A 2D3O1 1YHQS 3MAHA 2HFZA 1BWEA 4LRFA 4MYUA 3WDOA 2ZBIA 2UUBJ 2WVCA 4ELTA 5CAAA 2ACYA 4HHJA 2VJUA 4UOCA 5JXSA 3FZ2A 4NCGB 1HNVB 5KT5A 1ZTWA 4NXNF 4EBCA 2LEBA 3DI6B 1T94A 4K2JA 3DOLB 4TU8A 1OQ3A 3OTOJ 3CCES 2GIRA 3JS9A 1FDDA 4NLSA 4OLPA 3ZXWA 1QM9A 2J9EA 2V50A 3EWGA 2A10A 4NYOA 2HRUA 1VRQC 2OLWA 4WIIA 2BRLA 2DO4A 5THWA 2G2ZA 4PWDB 3B4MA 1TMMA 3PRBA 3MPWA 1S76D 4EUVA 1R0CB 4I6AA 2CQ1A 2CVIA 5IZHA 5KT3A 1YJWS 4NWBA 2G1DA 2JEFA 3TW0A 2GO9A 4ZPTR 1UJ6A 1JXEA 5HMXA 3AFGA 1L3TA 1JLBA 2OPSB 4F0HA 4DX7A 1BQXA 3R6LB 2CZ4A 1S0MA 4RW4B 2ASYA 2V34A 2LECA 3A1YG 3JYTB 1RGVA 4YMEA 4DV0F 1TK5A 1GMWA 4LIRA 1FNMA 4JI8J 4LF7F 3LANA 5C7PA 2EFOA 3GG1A 5HVHA 2CPHA 4JI6F 3T3FA 1DQ9A 1WDTA 2ZH9A 2CKWA 2FGOA 2OPQB 5M2PA 3OR1A 4DL6A 1U1RA 2RH3A 3E01B 2R9LA 3A12A 2FB0A 2XCAA 4KE5A 1NK0A 1VQ9S 1IKVB 1N0VC 4JI0J 2FHJA 3M1VA 1RT4A 1RTHA 3UCGA 1HQUB 1KKHA 5ITHA 4PXDA 1MWQA 3F0NA 4OX9J 4FZVA 1WEYA 1FX4A 3TA2A 2XO6A 1LK5A 1NRKA 5CD4H 2ZBPA 2A1BA 3LF0A 4WBFA 1X4FA 1LWEB 3LP2B 3AA9A 4NEYA 3IAM9 4BDPA 3LP0A 1H98A 2ZWPA 2QE5A 1TK8A 1LFWA 1CULA 3QSYB 1AROP 3O44A 4M5MA 4DV4F 2OIHA 1SKSA 2OMLA 3VAFA 1FT8A 1NUEA 2Q1LA 1TV6A 4ITSA 1WTBA 2EI5A 4BS2A 2XM3A 2J0XA 1RT1B 4CP5A 1DTQA 2V6AA 5HL7Q 5CYJA 3PIOQ 3KLHA 3EVWA 2G2OA 3VVTA 4GRSA 4UOHA 1B99A 3HJVA 1NSKL 1T95A 4AL6A 1UVLA 2ZNZA 1UEKA 3KXDA 5B0CA 3BR8A 3FCHA 1DZ5A 2LEAA 2F8HA 4Y34A 4CO0A 4X65J 2R8IA 4AL7A 4HR2A 1YBUA 2E5LF 4GKKJ 3M8WA 5H9FK 1M1HA 2XZDB 2HHQA 5A8WA 2R4FA 4GC7A 4J9OA 3AH6A 2NR0A 1WC0A 2R7UA 3KHHA 4NA1A 2CJAA 1OQ6A 4CWBA 1FK9A 1Q8LA 4WK3A 1KVKA 1C4CA 1MWYA 2GW8A 3OL6A 5CXTA 5RUBA 4ZVPB 3PEHA 5KFVA 3ZZYA 2NXJA 2I6WA 1WACA 3RGIA 1H73A 3WIUA 3ENVA 2QMUB 4D3GA 1QLNA 2GX8A 3CIMA 2V8DA 2YNFB 2CWXA 2E9ZA 1S4EA 1VJQA 1R6YA 3NWRA 4DZ6A 5GAGU 4B9VA 3VAGA 2QC3A 2RUGA 3KOAA 1UL3A 2XWYA 1RYRA 3PYEA 4ICLB 5BXIA 4HACA 3ZZZA 3LW5C 1F5CA 1N48A 2K1RB 2JL9A 2VBXA 3TX0A 1NJYA 3I56S 1FE0A 4N8OA 5D78A 3W2VA 4FXDA 5C42A 1U02A 4DV6J 1XC9A 4B9MA 3N28A 1Y3KA 2AGQA 4M5IA 1P27B 5HI7A 3N01A 1M5HA 3DM2B 4P52A 3FSIA 2N4DA 3UCUP 1M5OC 2DPIA 2ZH2A 3FQLA 1OSCA 1RT6A 4J9SA 1KTVA 3K59A 2X1GA 2PMHA 3M32B 3NS6A 2ZDPA 5FLXU 3HHLA 4QR0A 1NH7A 1QSYA 1RI7A 4DUYJ 5KFCA 3CCLS 4LF5J 3UW1A 4X4SA 1GXTA 1G7CB 3NCPA 3GIJA 2WVEA 1XMQJ 1HARA 1VBZA 1AT1B 4GKJF 2YY3A 1KFSA 4LF6F 4PRFA 2QSFA 2F5GA 2LMIA 3IRXB 1IN0A 1MG7A 3LPYA 4H4MB 5IV3A 2F65A 2HQIA 5LSOA 1G1XA 3KHRA 1MW7A 3NS7B 5HVFA 1GX5A 1N8RT 2IJRA 2HHVA 4JOUA 4LIWA 2QTWA 3ZO7A 4DCJB 1HFEL 3F56A 3IG1A 1FTRA 1F2GA 3Q83A 3TQEA 4YDDB 2JJ4D 3JTOA 1RTDB 3EXYA 3R5JB 4P75A 4B3RJ 3UVJA 2DXFA 3K5PA 1FO1A 4PG5A 4KJIA 1RAFB 3FBEA 2DPJA 2U2FA 4CLWA 3CCWA 2PEBA 3C16B 2VJVA 2MQLA 1UEUA 1BWVA 3DRSA 1YZ7A 3BYPA 4PQUA 3MCNA 1SVDA 4NE9C 2BM0A 1N5VA 4GVBA 2P9GA 3HF5A 3VZHA 3Q8VA 4HVZA 4NYZA 1HD0A 2VBWA 1U6FA 1Y4ZB 2ROEA 4B3SJ 1N4LA 3SCJE 2JRSA 4FYYB 2A6MA 3J80Y 3CVKA 1RZMA 2HAFA 2V8PA 3VGSA 3OLBA 2HFUA 4DUZJ 1UWBB 2EWHA 2XSFA 3G82A 2Y1JA 2MLXA 2Y3YA 4OZLA 3BBBA 5EWGA 4M5JA 4A48A 3R6GB 1XEZA 4NLXA 4NLUA 1WEZA 3D1OA 2IHR1 4NASA 1DURA 2PA8D 2C28A 3GJTB 3I5AA 1M1KT 1FFWB 3AJDA 1LW2B 4CO4A 1N36J 2B9XA 5LMUJ 2QA1A 2VASA 5K5MA 3D6TB 2NYHA 4PG8A 1GMUA 5A0YA 2VDIA 2MPUA 3GJRB 5KFMA 2XULA 4L3KA 3HMJG 5HO4A 4A8MP 2P5VA 2QL5B 3SSQA 4W92B 3ELHA 5E3AA 3BH6B 4MAKA 4RO0A 1R89A 1AUDA 4DFPA 1VC6A 3MGJA 1JLQB 2FJDB 3ONQA 4IOCQ 5DGAA 1EZZB 1C0UA 1YI2S 1NPKA 1ROFA 4TKTA 2GFFA 4DU7A 1KDNA 1FE4A 2MY7A 4ZKAA 4ID5A 3M30B 3KDNA 2BE2A 1Y0HA 5HN0A 2XNRA 2V8HA 1T8EA 1SQEA 1SQFA 2X1BA 2Z2LA 1KFDA 1X4GA 3AD8C 3BV8A 3DGPA 4IYQA 4USTA 3D2WA 1WWHA 5J2QB 3IWNC 2KTQA 4USUA 1TKXA 4LSLA 3M2UB 2BBEA 2BOAA 1UVMA 4ID5B 3CJRA 4P71A 1KLMB 3FGVA 4H4OB 2FLPA 1SKUB 2Y1RI 1ZZNA 3MEKA 4CT8A 2E1RA 3PY8A 2BKNA 1H6KX 4LSNA 3EZ5A 4EEYA 1MLAA 2A3JA 3BEGB 2NSBA 1S9FA 5KOWA 2QV6A 3HZGA 2LEPA 5D4LA 2XLIA 1S6QA 3D54A 1WELA 4DR5F 3VALA 2GAGC 2P6TA 4PXEA 5E3QA 2IJFA 1R3NA 1Z4UA 3BN7A 2F7VA 2Z0GA 3DU5A 5ETRA 5KFLA 4DV0J 3BREA 2XY7A 1AFJA 2AD9A 2ASLA 3H2UB 2MZSA 4YDXA 1SV5A 3IM9A 1EP4B 3MAQA 4F4XA 1JLGB 4FPRA 1RAAB 3FMBA 1YQHA 2PT0A 4LQ3A 3CO9A 3VF0B 1NJZA 4USVA 4BWMA 4B3SF 4L3NA 4ERDA 1X5PA 2HNZB 3EM1A 1ITPA 4QWAA 3UWTA 3K5LA 2HGLA 3MTKA 3UR3C 2C3OA 1ZBTA 3PHTA 3RYLA 5IS2A 3MUVP 2I2YA 1HWLA 3UI3A 4C6AA 1T9WA 2DH8A 2IYGA 2HZCA 1KOHA 1LFPA 2D7SA 1S1VB 5I3UB 3LWLA 3TAPA 1YLXA 1RWNB 5KAKA 3OSPA 3US5A 3T5KA 1B70B 2RDIA 1T9YA 1RBLA 1RP5A 3DHWC 4CLUA 2JFKA 5JMNA 4KKOB 3T9NA 1QVFR 5M2UA 4J90A 5J1EB 4NLOA 5J2NA 2WSFC 2N7YA 1AXQA 2RHSB 4ZVQB 2WW4A 1CSJA 3DLLQ 1HA1A 3GP9A 3AJ1A 1WUUA 2WAQD 3MMAA 2CXEA 2PMZD 2X7IA 2D1CA 1LV5A 2KZMA 1U1MA 2EBEA 2DO0A 1FDNA 2V8GA 2AJFE 2XMUA 2DIUA 3AOCA 1HBOB 4ZP6A 2Q43A 2VG5B 3W9HA 1IVZA 1S48A 3AB4B 3KJNB 3KJQB 1DQ8A 3BKTA 1Q81T 1H2TZ 2FHOB 4KIAA 3QLHA 2FTRA 4M5GA 4YY3J 3MUMP 1U1OA 3QQCD 3N9UC 3K8WA 2UVVA 3PIPQ 2M0GB 1S5ZA 4Q5VA 1Q7YT 1HQEA 4IRCA 4A4JA 3GJQB 3Q8UA 8ATCB 1BY9A 2VFVA 2OTJS 3G9CA 1UAWA 2B0GA 1LKZA 1JNRB 1R6VA 2MHEA 3W2WB 3TAQA 3LA0A 3QRPA 1FXLA 4CCHA 2JNJA 2YH0A 1EARA 4IH6A 4NX9A 3CPWR 4CIOA 2D3OR 5DG9A 1H38A 1WNEA 3KLGB 4NLRA 1UA0A 1EETA 2QGFB 3HO1A 1X9SA 4JBCA 2XMMA 2KFYA 2RQKA 3CJ4A 1M5PC 1TVRB 2C2DA 4D3HA 3OTBA 4JI2J 1FD8A 3IAS9 4CLZA 4X2BA 4NZ7A 4ECXA 2AP6A 2E29A 4F2RA 2KG0A 3ZTQA 3RZAA 1NPRA 2V68A 3MMBB 4C9DA 2C3UA 2V0NA 3I5CA 4LF5F 3SDEB 4NA2A 5FDLB 5AE2A 4RW7A 4EBEA 2Z2ZA 5KFZA 2M8DB 2ZUAA 3FCWA 1GEHA 3P96A 1REVA 4OX9F 3GFZA 1AUSL 4DR3J 5E3RA 4A8YA 2DNZA 1EJ7L 1GT8A 3SFGA 5D3GA 3ITHA 3E3XA 5AT1B 3DXBA 1SXLA 2ZHOA 2FC8A 3PNIA 1Q16B 3TO8A 3EMTA 1CJUB 1DLOB 2JDJA 3DHXA 4DV7J 2UUCJ 3GPAA 5T7LA 3PO5A 3A3OB 4P7TA 5DJBA 4HL9A 3MCSA 1Y11A 5D4OA 2OD6A 4NI2B 2HRYA 4GMKA 3UN2A 3CCUS 4LSZB 4NRTA 4TLRA 5AXKA 3E51A 1ZZFA 4W90B 2YKNB 5KT7A 1R0AA 2D3UA 4PXBA 2DHXA 7AT1B 1NB7A 5I3QA 3D4JA 1FDAA 5AE3A 3HSDA 4DI6A 1NPPA 3AODA 3OUYB 3WQPA 2VV5A 2KXHA 4ZHRA 1RHQB 5DLGA 5I4MA 1S7IA 3UN5A 5HJYA 4A8WA 2GQCA 2HWTA 2VPYB 2ILYA 3TOQA 3W61A 1CS4A 2QJ3A 3H25A 2GGPB 4J9RA 1RT7A 2E44A 4FBTA 5EDWA 3QO9B 2M70A 2IDLA 1YTYA 3ETMA 3N6LA 2FVSA 1A9NB 3P8BB 2R7OA 1AZSB 2R7WA 2IJNA 1S1TA 3QPIA 1OY9A 3A13A 3O2IA 1CVJA 1RAEB 1VQSA 2HBZB 4DR1F 2L9WA 3U1NA 3BDPA 3LP2A 3CD6S 4B08A 1S9GA 3I5BA 4K0KJ 1N5TA 5KG6A 3DLEB 3I4HX 3UCZP 4ILLA 3LP1B 1NHKL 1Y5LB 2J0SD 2J8AA 1ZM2A 4RZRA 3N5BA 1WORA 5ETNA 3UD5A 3CCMS 2ADBA 2KRRA 1SJ1A 5L9NA 2JVOA 2W9CB 2YX1A 3CSKA 5ETTA 2CA9A 3DXSX 1CC8A 4F8RA 4ZP7A 1IR0A 1RAHB 2OEJA 2EKYA 1EKRA 5HBMA 1KN6A 3CD0A 4I69A 2DH9A 2KB2A 2DISA 2UVWA 5ETLA 2ZZMA 1ELOA 4UOGA 2Q6BA 4KHPF 4RWXA 1T05A 1G4CA 1HNXJ 4AL5A 1XQIA 4LF1A 3SDEA 1PAUB 1RABB 2AF6A 2CWKA 5KG3A 4AT1B 5F9LA 2HFSA 1N34F 3PR4A 2CPZA 2N7CA 4KTQA 2HK3A 3CGIA 4GKJJ 1RWPB 4LFAJ 5IT0A 5HVGA 1RAJA 3CCJS 3RTVA 1NM2A 2V94A 4DL0C 2CIMA 2KN4A 5F9NA 3FK4A 1PKUA 2OPPA 4J91A 3R7SB 3VQSA 4DR3F 3FCVA 1KP6A 1RYSA 2OTLS 1E6YB 1VCTA 4DV2F 3MZIA 3KK2A 2JHEA 3ZTRA 1VMBA 4K2XA 2LQ9A 2OUGA 2HVDA 2BJEA 4KFBA 1YJRA 2DD8S 3K2YA 5A8RA 4F0MA 2WONB 3CCVS 1S1TB 3CMES 3VZIA 2JZ5A 2D74B 3GQCA 2IMOA 4JB8B 5KG4A 1WJ9A 4ZLJA 4C8KA 3W5ZA 2LFVA 4WYLA 1NKBA 2R7VA 1BQNA 1VGYA 3D0HE 1VS3A 3DLJA 4NCGA 4U96A 2R2SA 3EUNA 2QA4G 1HNZJ 2LP4A 2AJ2A 4JI5F 2EXUA 2I5JA 4LBPA 3TJ8A 3R5GA 3A3NB 4AFFA 4MKVA 4EI2A 2VQEF 2K7KA 2R8JA 5GADU 2W9AA 5A8KA 3TEGA 1TL7B 4QWBA 4IG0B 2I9SA 3FEXB 4DPXA 3FKBA 1SL2A 1R8CA 3R97A 1PYSB 3CDBA 2OP5A 3M8QB 4KHRA 2BR0A 2OH2A 1VLOA 1HBNA 3NCRA 1U6BA 2HVHA 3X1LB 2BE7D 1XR6A 3JB9k 4JI1J 2BANB 2LXIA 2NUUG 4F0KA 4OI6A 2IAJB 4M5DA 5KFQA 2IC3B 2HHUA 3M6VA 3KG0A 2YKMB 4OLOA 5J2NB 4YR3A 4QIEA 3CJKA 2MZ1A 4UZCA 5J1EA 3KLGA 2EG1A 2RJZA 3D3BJ 4A8QA 2CQ0A 1BQMA 3HKZD 5T14A 5A2QY 1FA0A 2LDIA 2O3DA 2PMWA 5J2PB 2CJBA 5LMUF 4DV3J 2GZOA 3TARA 4WU2A 2EFVA 2AJ1A 1I94F 4FXVA 2J9DE 1D9AA 3IRWP 1S6PA 1QE1A 3WHIA 3L7UA 4YN3B 4GC6A 4RJVA 5T41A 1SJRA 1MN7A 1WOSA 2HVEA 3FQKA 2AIRB 4FNIA 4IUFA 4IDKA 1LW0A 4U7UD 2DXEA 2MKIA 1K0VA 3FDSA 2VQFF 3QBCA 2EBGA 3PACA 2HNDB 3LGMA 4G1QB 2YNIB 2JC0A 2W25A 3UNGC 1FKPA 1HNXF 5KFPA 3V5RA 2Y1IA 1FCAA 3QT8A 4ILRA 3VQTA 3WZ0A 1LWFB 2WB1D 5F0UA 1NXIA 4BBYA 1BMQB 2DNNA 2IRYA 5B0EA 3RR8A 2R7RA 3CCTA 2Z8QA 3C6UB 5B09A 2CQHA 4FP9A 3NGKA 3L09A 2YX7A 1JXVA 4M8LA 1N36F 3NS5A 2HZAA 2VC0A 4B9NA 1PYOB 3DLBA 4P2XA 3EGWB 4RWWA 3TANA 5LJ5Y 2D3ZA 4RW8A 1PSDA 2MYFA 4ENOA 3W9JA 5BYSA 4WE1B 2PI4A 3DRRB 5BJRA 3BPSP 2KT3A 2JOQA 3DOKB 3UO0A 4ZVFA 1CS4B 3G96A 1U0HA 2V4JA 4EO8A 2W2MP 3KMSA 4DL3A 1M5SA 2VG5A 2BKPA 2PFFB 1RU2A 2HNDA 3JAMU 3DNCA 4DLEA 3CD7A 2ZZNA 3ZZPA 1S1UA 2LXUA 4OYMA 5C24B 4JV5J 1NJWA 4KV8A 1WEXA 1AB8A 1QDUB 2PDAA 4NA3A 1FERA 1HMVB 1V5VA 1S6PB 3R27A 2H65B 2OKQA 1QUVA 1U7LA 1UEVA 1NK7A 1VC0A 4F7VA 5BYRA 3T5HA 3A8JA 1P9YA 2Q3PA 3TUZC 2XS5A 2OAUA 1NKEA 2IVYA 3EGVA 1VRTB 1TUWA 2DB1A 2XMTA 1TP7A 2YWHA 3MMCA 4IG3B 5F0WA 2DK2A 5D4NA 4A8OA 3KLEB 2B43A 5JJBA 2DGOA 3BF4A 4BCAA 3TYTA 4YB5A 5AXNA 2BZ2A 1IR1A 4WPAA 2QFIA 2DRAA 4ED6A 2XYGB 2HHHF 2HPUA 1GFWB 1JLCA 2HS4A 1SL1A 2FLNA 4I2PA 3QJJA 3MOZA 3I9V9 4OJ1A 4F4WA 3IR5B 1U8WA 2HW3A 4JYAF 2DHHA 1N32F 3R5AA 1S0OA 4LUBA 2PI5A 1MWZA 1S4FA 3DRYA 3IBFB 4QZVB 4F26A 1JLGA 1LXNA 3FC9A 3ULHA 2AX1A 4EWTA 5HSPA 3HULA 5DZ7A 4KRWA 1YBTA 4DQIA 2OHDA 4ZCKA 3AT1B 3GIRA 3FZBA 2MMYA 3WC2A 1P9QC 1C4AA 2GVDB 2Y0BB 2NXEA 1V6HA 2XCPA 4OL8A 1K44A 2J0QD 5ETQA 3LTOA 4CLFA 5DM7Q 2HBRB 2HFOA 3RW6A 1CC7A 3C6TB 2KG1A 3K0JA 4K50A 1U2FA 1IKXB 2W8LA 4KV8B 4HH0A 1WI8A 5A6PA 1S1XB 2AEMA 2GJ2A 3QIDA 3VCDA 2ZH3A 2WZ1A 5IV4A 3JSMB 1IBLF 2CQIA 1DTTA 4DCOB 4K0KF 3OT9A 1PG5B 1QAYA 2A18A 2KHDA 5E5NA 1MROB 2N3OA 1T9UA 2W4PA 1U0HB 4E2FB 3CWJA 2LDYA 2XSJA 3BGOP 1SIWB 1XTZA 2FY8A 3KUGA 1M1GA 3IG1B 4RW9B 4DG1B 1VHFA 2LVWA 4I1TA 1TAQA 1S9EB 2IVMA 4ZPDA 5AJ3J 1FRMA 3KLIA 1RBAA 4H4MA 1O6XA 2HHWA 4URQU 3DFEA 1P1LA 3RAQA 1RKJA 2GHVC 5IWAF 2GC8A 4Q44A 3PHEA 4RNOA 4FYWB 2ABYA 4FF2A 3K17A 2ZH5A 2QRRA 3NGRA 3OR2A 3HI9A 4PWWA 1HW9A 2MQPA 3T1HF 4JI0F 5D6GA 1T0TV 3ZTSA 1IKYB 4USWA 3UDLA 3DM2A 2CRLA 1Z2LA 1X5OA 2CNNB 2VU5A 2PEHA 2Z56B 4TVAB 9ATCB 2V63A 4ZVUB 1FRLA 2B9YA 3C14A 1KQKA 1LEOA 2D9OA 2JEJA 3ENAA 4DPOA 1WHVA 2W01A 4OYAA 2RVJA 3LWMA 3ISZA 5CHCB 1KRPA 2YWGA 3QO9A 4A8KA 4YQWA 3OR2B 3QYYA 4UZBA 4HYKA 4OYPA 4IO9Q 2CDRB 5KFIA 4U7CA 1KSPA 3NOGA 3H2LA 4EZ6A 1FDBA 2Q6CA 2H9ZA 3EZUA 5L38A 3RRGA 3UN3A 4JI3J 3JAMY 4ZDNA 2L48A 1J5OA 2ROGA 2FQQB 2E7XA 3CDEA 4OHWA 4WFBQ 1B7FA 2IAJA 4M5DB 1XWLA 4YR0A 2BYCA 2H1YA 4OI4A 2BJ1A 4KGXB 4B9UA 4RNFA 2ZNYA 1J5EJ 4UTGA 9RUBA 4C98A 2IPOB 4GO7X 2F8EX 2OEMA 3IS9B 3N0VA 1V3RA 4RR5A 2J8SA 3PW2A 4ECQA 2DGSA 4K4UA 4TQRA 3FJ2A 4OI3A 4YHHF 3MEEB 5A2QU 2WOMA 2DCLA 2FZKB 2DNYA 2IBOA 2WBMA 4KGKA 4O3NA 1S59A 1DTTB 1ZAXA 3CJSA 5KFFA 3HHLC 3PJ9A 3TWZA 1KLNA 3DGVA 5KFOA 1U2CA 4J9NA 2AHOB 2Z57B 4YFUA 3GV8B 3Q22A 3H59A 4OYXA 1RTJA 3NY0A 4QJVA 2IRXA 2YH1A 4DQPA 2POKA 3MM8B 1D09B 4LBIA 3IMQJ 3JTPA 5CYQB 1UVIA 3PVXA 3OFGA 1N54B 4NLVA 4K5RA 3R8YA 2BOPA 3KG1A 3LP0B 1VQMS 4R5PB 1VBYA 1TK0A 2EVZA 4FPIA 1QVGR 3FFIB 3BPDA 3UE2A 4CLSA 1HBUB 1SPBP 3C6UA 3TZZA 3FVYA 3VR1A 2J9DA 1VK8A 4RBUA 1PGZA 4DCPB 3PFOA 4MFBB 2VOOA 1CQNA 4K4TA 1FKPB 2HVIA 3C46A 5IQQA 1N34J 3G8QA 3AOBA 4Y2KA 5A0YB 4I2PB 3D9BA 5DM6Q 1JLCB 2DR9A 2W7PA 1RA6A 3D7SB 1NCLA 1W26A 1R27B 4DR2F 3HK2A 3NMRA 2AJQA 1H74A 3D28A 3OXFA 3S7RA 3O3LA 1PO6A 1GXLA 1QE1B 3P45B 4RW4A 1APSA 4PPZA 3I4PA 5KFXA 1HHQA 4NCBA 4LR7A 4DR6J 1C1BA 2RIJA 2V2VA 1J2VA 3LUYA 2E7WA 3P5BP 4FYVB 5DRKA 1HNWJ 1QAIA 3BGLA 2GV1A 5KT6A 1WC1A 2KT2A 4CLKA 2W9BB 2UXDJ 5A8WB 5SUHA 2BQUA 2MEWA 2B6AB 4ZPVR 2NUHA 1YRXA 1KNZA 3CCQS 5KFNA 4RUHA 1TL3B 2E9TA 4JV5F 1ZPWX 4NLWA 2YTCA 2KXFA 4ZLNA 2CQGA 1JLFA 3HFKA 3MFIA 2HK2A 1S99A 1BLUA 4ZIWA 2GVDA 5F8GA 1K8AT 2RRNA 3PYDA 1Q53A 2JEIA 2CAJA 1RK8A 2ERRA 1T03A 3MPUB 1S1WA 4CH0S 1S1VA 2HBQB 2V2KA 4O3OA 3N6MA 5I3UA 2I5JB 2RS8A 4KYZA 2VH7A 1WI6A 4WJBA 5K14A 1ZS6A 2C2KB 4ID8A 2AYGA 5HANA 4FKXA 2AEFA 3K89A 2VFRA 4OX7A 1IBMF 1QJHA 4CLYA 4DSLA 3BQ0A 4X66F 4QBUA 1EQMA 3CJ3A 2YKNA 3PDNA 6FDRA 4ELUA 2V8VA 3V6HA 4HH1A 4ZLPA 3NXZA 4OHXA 1HNZF 5HAOA 2KRBA 4DSIA 1LWFA 4H4KC 2WRMA 1LNQA 5T7LB 2O67A 2VPXB 2YPYA 2YKQA 3VAKA 1Z1ZA 4UY8T 1V5IB 2NZCA 1RWXB 2OPPB 1JB0C 1VQ4S 4G1QA 4NZ0A 4Q8FA 2AV5A 3H40A 3QJLA 2V69A 5EX0A 4B17A 2Y8WA 1JWWA 3OJUA 1VRTA 2G2YA 4TU7A 4K4VA 1WC3A 2WVDA 3CDWA 1SQGA 1XJWB 3EJMA 4Y2MA 5CYQA 5L46A 4QW9A 2MJNA 3GCWP 3JYTA 4LSNB 1ZA1B 4DN9A 1LWXA 3IO1A 4OZJA 3ENQA 3TZYA 4LF8F 2W2QP 3C15B 1XR7A 3ET6A 5CQGA 3R1LA 3EDRB 4EK2A 1U47A 4B9LA 5GMKa 4L72B 4M95A 1RBOB 3ZZUA 4LFCJ 4C3LA 1JJHA 5J2QA 2QN6B 5IOLA 2QLXA 3BSAA 3GMGA 5CYMB 3CJKB 4PEOA 2HNYB 2XI2A 3DRPA 1S6OA 4LF9F 4CO2A 1FK9B 5KFKA 1U25A 3N79A 5EWEA 2MB0B 3RB0A 2FHKA 2KVIA 1IQZA 4P2SA 3CE8A 3VAIA 3M8ZA 3LP1A 3M8QA 5KT4A 1SC3B 1XNRF 4KO0B 4KSEB 1HR0J 2Y8YA 2JVRA 1BHNA 4UY85 3NNCA 2BM1A 3C3LA 1WF2A 1SH2A 4U95A 2PA3A 3MF5A 1WSRA 3WX4A 4ECVA 5L39A 3HHNB 1P8GA 2RD5C 2KL8A 3BQ2A 5DGBA 1B0VA 1CJKB 3SQGB 2ASJA 1RHMB 1YJ7A 2DHSA 2R8GA 2DNQA 4KY3A 2DXDA 5IWAJ 3KMQA 4LF6J 2ZWOA 4PQAA 5F8MA 2WVBA 5DZ6A 2F1FA 3KJFB 4DPWA 4OI1A 3RBEA 1U6ZA 1LXJA 3C8YA 3DC2A 2LQBA 2WHOA 3QAEA 4C48A 3AAWB 1MU2A 1TUVA 2H5EA 2KYZA 2XMKA 4ATNA 2NPIA 3HM9A 3PG9A 1V3SA 5DLFA 4UUXA 1KTQA 4I0WA 1RQ0A 3ILJA 2B6AA 3M6WA 4YB7A 2R2RA 1SC6A 2UU9J 4IOAQ 1UWBA 2F3JA 3G82B 5BYQA 4LFBJ 4ZVSB 4XO0A 3TJAA 5I42B 5JUMA 2HKEA 2XMAA 3DYAB 5I42A 2BW2A 2RMLA 3VHQA 1F2HA 2HQFA 2XGQA 3SZ2A 1L3VA 5D3GB 2W9CA 2AZ3A 5K9FA 2X1AA 1WSVA 1WC4A 2CPFA 5J1NA 1Y5NB 1KQFB 1N88A 1EX8A 2XBPA 2GA7A 5B7WA 4NZ6A 3BJYA 4NXMJ 2GVZB 2B5JA 3M8RA 2KKHA 4LQ9A 1Q1KA 4DQQA 1HW8A 3BS9A 4JI4F 3G71S 3PX6A 2CNOB 2V4JB 4LF8J 1MSWD 4IG0A 2H51B 1FEEA 1Q4RA 2XO7A 1X9WA 2QT7A 5KFHA 4K8RA 2V2QA 2DGXA 4M5KA 2Z58B 3BGUA 1N52B 4WE1A 2P9CA 3KHGA 1CJKA 1BXNA 4P72A 2FLLA 4PXCA 3MWBA 3V4IB 3R2DJ 2DNOA 1VI7A 1GX6A 1EKSA 4FS2A 1RLDA 2VA2A 5DG7A 4Q0BA 1IBLJ 2DEJA 1TAUA 1GTEA 4QIFA 1VQ6S 1VBKA 4QYZJ 3OFEA 2CJ9A 4KO0A 2GHPA 1T3OA 4DR4J 4IRDA 2B4PA 3G8TA 5H9FJ 4FF1A 2DEIA 3I6PA 3DU6A 4RNMA 2CUYA 1OWXA 5IFMA 4ECSA 1VYAA 2KO1A 1DRZA 3HVTB 4OYOA 1Q78A 4WU3A 1RWMB 1X0PA 2LU1A 1HR0F 2CNKB 5IC6B 2HNYA 3DRPB 3HSGA 3MPYA 4PG4A 3EPIA 5CYMA 1KD1T 2R3VA 3LPEA 3T1YJ 1RWWB 4DS5A 3VTIA 3OUYA 3CEDA 4L6V3 2XGPA 2K3IA 1LW0B 5LMNF 1R8PA 2F63A 5F8LA 1BD6A 4P74A 2E9RX 1PBUA 3ZNUA 4OI2A 5LSRA 5GAHI 1TU0B 2K06A 1NZAA 2WW8A 2HQGA 2Z2YB 3BB5A 3V2UC 1IJFB 3M8SA 3PW5A 1IKWB 3KG4A 2V9KA 4R8UA 3RRKA 3THPA 4ECWA 2ZBCA 2A6OA 3IA0A 1BQMB 1RAGB 2VFUA 1JNZB 3SBMA 1JLQA 4DXLA 2KU7A 3H98A 3GV5B 2IVFB 4AUKA 4CO3A 2KXNB 4HTJA 4MIBA 3RBDA 1J5OB 1JMTA 3ITHB 2DNMA 3KK1A 2C2EA 3GYGA 2FLOA 4KKOA 1RAOA 2XZWA 4B02A 1K9MT 4DUYF 3GYXB 4NLQA 1ULRA 3BYRA 4N8NA 2RAQA 5E7OB 4QYZK 2HSEB 4QU6A 3VVUA 4O3RA 1JQGA 1LOUA 4DF8A 2G1HA 4ED7A 4ZP8A 1WKLA 2G0IA 2PC6A 1WF1A 2QL9B 3MXHP 1NHVA 4PG6A 4V1Ak 3JSYA 4XAKA 3BO2A 2B3TB 3OFHA 4DEZA 2W7AA 2UXDF 1VFJA 1UFWA 1PJ5A 3BH7B 4F3MA 5GAHU 1Q82T 4AE5A 1MMLA 4ZLLA 1AFIA 2DH7A 1FRXA 2VB6A 2PD1A 3CW2C 2GMJA 4KPCA 4WFAQ 4MKAA 4C0OC 2F4FA 2ZVSA 4ZN1A 3I55S 3RR7A 3EICA 4ZJOA 1RSCA 4QR2A 3ZZRA 5DDRC 2GGPA 1OPIA 2YQ0A 3R9LA 2N82B 2OJ3A 5B0GA 1JLFB 1VHIA 2NS1B 3Q2SC 4J7CA 1SUQB 5F8IA 1A0OB 3BM7A 4OZ3A 1SKRA 4YOEA 4OV1A 3AY0A 5K8OA 2VICA 4YHHJ 4Q2LA 4Y6IA 4RBVA 3IXQA 2VONA 2ILZA 2H54B 2CQPA 4KHMA 3B8HA 2C1EB 4RNHA 3IN5A 4N76A 4Q0BB 5BR8J 4MH8A 1B0PA 2ZDOA 3ISNC 2AU0A 3AXKA 1KOOA 4ZPCA 1U1KA 2K2PA 4P6QA 1RT5A 1HQUA 1X31C 2XSJB 4JP8A 4PKDB 1N5YB 2LXFA 2IM0A 2HIQA 4OHZA 3IR7B 4IRKA 1RTDA 1W2IA 2MKYA 3UNYA 5DQIA 1TKXB 4LSLB 3SI8A 2CQ4A 2J9CA 4AD6A 1YITS 1NK6A 2DT9A 1W25A 3AHPA 4OJGA 5L1LA 2XLKA 1Z2ZA 3KK1B 1NAQA 1RADB 2V5HG 3M8PA 2BXJA 2EK1A 1IWAA 3OQ2A 1Q86T 1HHSA 2FY1A 2BW7A 3RU0A 4A8FA 1UW4A 4DN0A 2OEKA 4YY3F 4KHPJ 1HD1A 1C0UB 1WKJA 4Y65A 1FRKA 4F02A 1K1SA 1KR4A 5C25B 2VODA 5KFDA 1KBRA 4LRBA 3KYLA 4LFCF 2L41A 1HBUA 2IC3A 1S9GB 2MSSA 1AA1B 1EIYB 3D1QA 4H54A 3MD3A 3QFWA 4WXOA 1U1LA 4DOZA 4K4XA 4LVOP 1WG5A 3T6BA 1SH3A 4DJBA 3EX7B 2R7QA 5C2GA 3THVA 2ZHAA 4PPDA 1LW2A 4B9TA 1VIXA 2NXCA 2E1MC 1R8HA 3MM5B 4HDHA 4LREA 3T5JA 4ILMA 1S57A 2YQ3A 4OZ0A 4Z2XA 3H4DA 4CTAB 5K14B 3TVYA 2V4RA 2C2RA 2MLYA 3TA0A 3UPFA 1UKUA 3JXOA 5KG5A 4KT0C 4WFNQ 3MR2A 3SCLE 5IT4A 1UTAA 3RJMB 4ED4A 2AKWB 4YP3A 3MEEA 3PKMA 2FJEB 2P6SA 3NG8A 4DX6A 3MMCB 4RKUC 4ZPBA 2VQEJ 2GIFA 2RNEA 3BN4A 3DLGA 3U02A 2WONA 4WZMA 1DJ0A 1SBRA 1NJXA 1RWUA 4NPOA 1PJ6A 2HVZA 1HMVA 2ALZA 1RAIB 2YNGA 3IBCB 3W62A 4IOBA 3BSCA 4PQUB 1Q7LB 3ISND 4WIQA 3AD7C 2OGUA 1NJIT 4ZJQA 3IWXA 2QLBB 4X4PA 3GV7B 4FDFA 2E5HA 3BGRB 4I64A 2E1CA 1KVIA 1UFKA 3KLHB 1C1BB 1UCNA 5D0RA 4JUZA 2NCKL 1MN9A 1YZ6A 2R7SA 1ZH5A 4WWSA 1ZM4A 5I3PA 4C8ZA 1VISA 4NLTA 1JJCB 3L9ZA 4ES3A 4JI7F 1T05B 1S6UA 1SIZA 3G8SA 4IR9A 5F8NA 4FF3A 2ZOGA 2MQOA 5KFGA 4CO5A 1U1NA 2UUAJ 1N5SA 2BJ9A 2OI2A 2GMLA 2YVSA 4L73A 3DDNA 2HFNA 4FVCA 5EN1A 3ZTOA 2WK4A 4WKYA 4J9LA 3J81U 1Q5VA 3CB4A 3OL7A 1FKOB 5IM0A 2AX0A 4IKAA 1UVJA 1D3WA 1YJNS 4FNHA 3K5MA 2MSTA 3AJ2A 3OV7A 1RCOB 2AJ4A 3M05A 3E01A 3RUBL 3DLEA 4NEZA 2M8HA 1YKWA 3FFIA 4PZVA 1CBKA 3GFYA 3TVZA 4P10A 3GSIA 5KFAA 4YS2A 4C2MA 1S6QB 2W24A 3GR0A 4PYDA 3MUTP 1W2BR 1S12A 1GNKA 3H5SA 2RQ4A 3J7ZT 2XMJA 4KGMA 1AZSA 3P49B 4FS1A 5F41A 5IT9U 4RW9A 4E0DA 2J7UA 5MAOA 1L5UA 3NOCA 1RISA 2FVCA 4DR7J 2RKIB 3H5YA 3NNAA 2AQ4A 1JLBB 2ZITA 2V9WA 1NEEA 2FZGB 2G4BA 2KJVA 2EFQA 3UDCA 2Z2MA 4K4ZA 2M2BA 4LVNP 3JSMA 3CULA 1NLKL 2AGPA 1S1XA 4Z7CA 3M30A 1Q79A 3J81Y 3Q8RB 1ACMB 1VQLS 3NL0A 2B4UA 5G0RB 3MMAB 3SSSA 2NPFA 2VKZG 2C22A 4PWDA 1NBEB 2BANA 1EQ0A 2Y9HA 1R0BG 3P6YC 1YBAA 2W9BA 2ZJRQ 3RB6A 4HHHA 2ZM6J 3DLGB 2FJXA 4N77A 1NK5A 1BUXA 5LXRA 1MNEA 3Q8YA 1RWKB 2C3PA 2FVRA 4O0NA 4B9SA 1K1QA 4Y28C 3J7A1 1TL7A 3H7HB 5A8KB 2FJWA 4L76A 1WOOA 2ZH4A 1FXDA 1OO0B 3H4BA 1HBMB 5G4DA 4ALZA 3GILA 2HS3A 3W64A 4DV5J 3VV2B 4M5HA 2X3DA 4ZVEA 2NSCA 3MM6B 1EAYC 1U1QA 2G9OA 4BHQA 3WIVA 4NRUA 4DL2A 1HI8A 1ZETA 4OYWA 4LFBF 3CCZA 4W4MA 1CQMA 3JSRA 1YK9A 2YX4A 4ETZA 4F50A 1QD1A 4ZVHA 5CCMA 3EVMA 2HHHJ 2HMIB 1XNQF 2F8MA 5KG7A 5L8RC 3LALA 4WFXA 3MM9A 4DSKA 1HL6A 2L08A 4USIA 4DX8H 4JI2F 5HMYA 1D8YA 1A6LA 2DNPA 3FBCA 2QYCA 1IKYA 2OPRB 1U09A 1FRHA 1Y5IB 3IBWA 4IO1A 3W63A 1VOMA 3L3CA 2NXNA 1H72C 1B7YB 1ZM9A 2G0CA 3CMQA 4XK8C 3PYFA 4IG3A 5KFSA 1NKCA 1IBKJ 3L7PA 1NSAA 3AD9C 2JX2A 5HROB 4ZPAA 4R5PA 4X4NA 4ES1A 3OVSA 2VUGA 1YGYA 3M7VA 4J9QA 2R8KA 3G4SS 2ZKTA 4KR0B 1N5QA 1FNXH 3W2WA 4JI1F 2F4VF 3M2VB 3Q86A 4ICLA 2BABA 3W8GA 1R7IA 2KVQE 5E3CA 4X64J 1IM6A 3GONA 4AXIA 2LA6A 3R7BB 5CH7B 1S9EA 3C16A 3GIKA 1HIYA 4RL1A 3G6XA 2J6SA 2ZOMA 4I68A 4OFZA 2CPIA 1WG4A 2UUBF 1XBWA 2C2NA 3QZ7A 4TLQA 2RUSA 2WOMB 4P73A 4UQGA 3J7YI 3CJTA 3G6VA 1FWKA 3IWLA 1GQEA 1B64A 1YJVA 3HHLD 4M63A 1JLAA 2VG6A 3IM8A 3U1LA 3U1MA 4I4BA 2VKRA 3PKYA 2KFZA 1X7VA 2EPIA 2YKAA 4RW8B 2QLJB 2C2MB 3QT5A 2V4QA 4C7QA 4R25A 3TX8A 5CCLA 2QFJA 3HLUA 1N33F 4WYWA 1FTCA 1IKXA 5LSLA 2IA6A 3DRXA 3PRDA 3T1YF 3AB2B 3NLCA 2ZH6A 3S6EA 4DSEA 2O01C 3H42A 3ILOA 5EUHA 3KJVA 1OY8A 1XK8A 4OQJA 3JQKA 1JIHA 3SSRA 4NLYA 1JJ2R 1P6TA 3HHLB 1YVFA 1NDCA 3I31A 1JKHA 3L4BC 4USKA 3RRHA 1ZYQA 2PN6A 1NZ8A 4UF4A 2DY9A 4I67A 2DBBA 3NEKA 4OMFG 1R8BA 1RE1B 2BKOA 2CQ3A 3DN9A 3J7AN 2ZH7A 3OL9A 3QJPA 3I0SB 2DNKA 1K47A 1G6BA 2QIFA 3W2VB 3D68A 2JLEA 3MPVA 4U9RA 4DBQA 3CDAA 2W1BA 5DQGA 3E2EA 2PGCA 1U1PA 1U24A 3NAIA 2DNGA 1JK9B 2HNZA 4PABA 4UQTA 4AXJA 1SJ4P 3B4DA 3Q2TC 1HWJA 1S0VA 4PR6A 2ATLA 4F4KA 1HYSB 3TVKA 2CPYA 3MEGB 3TRGA 1EP4A 4CYUB 2YWFA 2HHPA 1CJTB 1IM4A 2AT1B 5L1KA 3PYGA 2HWHA 4OHYA 4CM0A 1WHXA 2YKMA 3MCOA 4U8VA 4C3KA 2W8KA 3CUNA 4LF4F 4PUOB 1M90T 3AQOA 4EBDA 1SCJB 2P9EA 4K59A 2YBVA 4J9UE 2N4CA 2HAIA 3GR1A 4U7UK 3OXGA 1JKHB 2E66A 1OYDA 3VGTA 4DG1A 2N3LA 2UXCJ 3W1YC 5KFTA 1T3NA 5AXLA 5LM7E 1VQ7S 1YJ9S 1RHRB 5EX3A 3G87A 1KLMA 3FEYB 1RTZA 4H4OA 4ZN3A 4N56A 1RXOB 1J5EF 4K4SA 5C24A 3OL8A 3JQJA 3HD2A 4ES2A 2D41A 1MROA 5LJ3Y 2MTLA 6AT1B 3VGVA 4TQSA 1T7PA 1S7HA 2A0FB 4LT6A 2DHGA 5F3ZA 4DV1J 4RU2A 1CLFA 1Y10A 3RBXA 2J6UA 5BR8F 1RT3B 2FHJD 1H7XA 5EWFA 1I1GA 3DOKA 3EE3A 4GO5X 4I2QB 4X4UA 1SH0A 4OJ3A 2AZ1A 1TV6B 4MTPA 5LXYA 2RT3A 3C6TA 4OYIA 2GQQA 5LT5A 3MD1A 2BQRA 4LR8A 2GAHC 1WHWA 3NBPA 3I82A 3O6QA 4DZDA 2DR5A 3G86A 1QTMA 3W8PA 2J6TA 4JI5J 2ZUGA 1MMNA 3SEOA 5CABA 1TKDA 4CNYA 4C0BA 1RT6B 1Y9OA 1NH8A 2XMWA 4V19X 4F3OA 1FD2A 2M3DA 1O0PA 3H8YA 3U7JA 3LOUA 4LR9A 3CJ0A 4HEA9 4WP3A 4CM2A 3HVRA 1SI9A 3M2VA 3HZEA 5C2CA 4BC9A 3P4UB 1X4CA 1E6VA 2JSXA 1TFYA 2GJIA 2OPQA 4USMA 3BSOA 1HBOA 4QWEA 1FHTA 2B5JB 2CFXA 1FVSA 1UJ4A 3NRBA 4I7FB 1S79A 2QA2A 2F40A 3HXMA 2DR8A 3R5CA 1G2EA 3RB3A 1RWVB 2H48B 2B56A 2DKOB 2MKSA 3KNGA 2BX6A 4IDKB 4QIVA 4RBTA 2E1AA 2I8EA 4MK9A 4A47A 4CNZA 1WC5A 4J9PA 2UVUA 2IYIA 2OSRA 3CIZA 3R5BA 4C8OA 4YUDA 3HT3A 4B3OA 3PX4A 1I3OB 4DV3F 4B3TJ 2BJ7A 2MKCA 3Q24A 4C8LA 2HQCA 1IQTA 1I6JA 1ZAVA 4G1PA 3R1HA 2I0XA 2Y1LB 1UVNA 4ZP9A 1UJ5A 3R2CJ 3MOJB 1OSDA 4NCAA 2EG2A 2R42A 1F6TA 4G3IA 3HSJA 2MZJA 3OTEA 2ZD1A 3CD5A 3PZPA 2HBYB 5CZVA 4USHA 1UWAA 4ZA1A 3UFCX 2YKPA 4F67A 3HHDA 1TMJA 1Q8BA 1F5BA 1REGX 5E3PA 3RW7A 5E2QA 1O8BA 4CH1A 1KC8T 4K4WA 2IDEA 3UVJB 4NMXA 2DNLA 3DI6A 3Q89A 4EMDA 4WZQA 2L9DA 1HNVA 2M9KA 3QMQA 1WOPA 4NYPA 3HPOA 5K8PA 3MDFA 4QQBA 3GIIA 3MTJA 4ED1A 4Y3CA 5JVGQ 2DR7A 2R7XA 2CVEA 3P5TL 4J37A 1FF2A 3S1TA 3W60A 1FWLA 1H7WA 2HWIA 4ZS6A 4N47A 3T6JA 3PJWA 4A46A 4URGA 4G65A 5GMEA 4CO1A 1FVQA 5C5JA 2GNKA 4HT5A 1PC5A 4WKRA 4WTOB 4OX8A 1FJ7A 4I56A 5HMZA 2RKIA 3PO4A 4IQMA 3DMJB 4OJHA 2ZJQQ 3QGIA 4DHVA 4J9MA 1RKIA 2IBKA 1VQNS 1RDRA 4OHVA 3SV3A 1E6YA 2X3GA 2CQ2A 3UD3P 3FNNA 4MT1A 4JI3F 1XNQJ 2XHCA 2ZBRA 4C8NA 1VBXA 1FESA 4O0IA 4J9VA 1TKZA 4QR1A 4QW8A 3KNAA 2MGZB 2FJBB 5GADI 2LYVA 2R2UA 1I94J 2R7TA 3SCIE 3JSBA 3CCRS 2LQ8A 2KFNA 5CZXA 1T02A 3FSYA 2EKNA 4DL7A 2GO8A 4QWCA 3C15A 3ET6B 4FKYA 4HTIA 4ETXA 2DVIA 3GZ7A 4LRAA 3MMBA 2AYEA 5J2PA 1UP1A 3LAMA 3MR7A 1U26A 1FKAF 3U27A 2B8PA 4IH5A 1LWCB 4S0MA 2W2OP 2JWNA 2RQCA 4MIWA 2XMVA 3WBZA 1TVRA 4RUCA 2PO4A 3FEZA 3MAAA 5KFRA 4J5OA 4DDFA 1B0TA 2B4OA 2HG4A 2CG4A 4U67Q 1SL0A 5E33A 4K4YA 3D5MA 3LH2S 3NGTA 1WDDA 4OX6A 1HBNB 3PJXA 2EC0A 1NU4A 1U2RA 2JFDA 2M88A 4CLTA 1S97A 2XQCA 2ZH8A 2H4WB 5IXUA 2ZBQA 4DLGA 2FIUA 1LK7A 2IFXA 3CC2S 1VQYA 1UA1A 3SV4A 1XNRJ 1V9OA 3B54A 3QRRA 5SZTA 4F36A 3HCXA 2XC9A 1XMQF 1DTQB 3TQ1A 1RT1A 2YNGB 3DDKA 3CO0P 1F9EB 1H2VZ 1S1WB 2JLFA 4Q7AA 4GVLA 1R8AA 1T03B 5GVQA 2QLWA 1VQKS 2D69A 1ZOTA 2FUG9 4ED3A 5DS7A 4IFYA 5HQMA 2DIVA 4LJMA 3IGNA 1FJGJ 1TKTB 4RW6A 3TNVA 4LRCA 1T9XA 1CULB 1DBDA 3QIPA 4Z7YA 5HP1B 2X1FA 5AJ3F 4RUBA 4WCEQ 5J1PA 1UPMB 5ADZA 2CADA 2RB7A 4HLBA 3OTOF 3KK2B 4KB7A 1R0AB 2XYHB 5F8HA 4HDGA 3GB0A 2W4CA 4DV5F 4CTAA 3V6JA 4DR7F 2EC2A 3TAMA 3JTNA 3OD2A 2LU2A 2GIQA 2V67A 1RA7A 1O51A 1XN9A 4K7QA 2CQBA 2HQDA 1C1CB 4OZ5A 4DPYA 4ECTA 3P3DA 1FJEB 1G3OA 1IKVA 1CJUA 1DLOA 4W98A 1YDLA 2CNLB 4P2FA 5DG8A 1HHTP 3J81j 3J7Z5 1OS5A 4DL4A 5LL6d 2XY5A 1B4SA 3OFFA 4DR5J 3FRZA 3QSIA 1REVB 4DPTA 3AXMA 1KEKA 4YB1P 4IQXA 2RF2A 3MHYA 3ZNJ1 5HBMB 5L9XA 2IM3A 1QAXA 1PYTA 1FEHA 3W3SA 3B6BA 3VGUA 3W5YA 1CPZA 2K3KA 3RBZA 3FSXA 3I0RB 4XDCA 4YEAA 1SJ3P 3KTQA 4ZOSA 2QEXS 4JI4J 1VC5A 2MZQA 2YWWA 3GJSB 2ADCA 2RF2B 2FD2A 3GYNA 2MZTA 3EYZA 4OYZA 4WXWA 2O5DA 3IC1A 1EETB 4I7FA 2Z4PA 3ENWA 5KFBA 1FRJA 3C66A 4EYIB 1XMOF 4N7TA 4FVMA 4QIWD 1U4BA 1U49A 2VL1A 2DCUB 5A6WA 1I5OB 3GTYX 1X5TA 4HACB 1L3UA 1WG1A 3Q8PB 1D9FA 3GE9A 2NZ4A 2YNHB 4ECYA 1OMSA 2C2ZB 1RT7B 4IFVB 3PW7A 1ZA2B 1HQEB 4KGVB 4DF4A 2B7BB 2CPXA 1WTFA 2JC1A 4NMLA 4O44A 2FVQA 1DFDA 2QMWA 2YWEA 4Y2IA 1IBKF 2CQDA 3TUIC 3ZZTA 1TL4A 1FWPA 3RG6A 2CJYB 5E41A 5L1IA 3V4MA 3OW2R 2YXLA 2BE2B 2OMOA 3HKWA 3WC0A 2DGVA 1NDLA 1VIOA 3QNWB 4XPEA 1P1TA 4ED8A 2BQ3A 1L3SA 2GMHA 4Q8EA 1UMJA 3HHKA 1FX2A 2HIYA 3IS9A 4I2QA 2ZEJA 3HP6A 1HPZB 2P8IA 4QOTA 4QPTA 4HI2A 4WK1A 2KDOA 3KK3A 4RPFA 1PC4A 1QY7A 1QSLA 4UOFA 4P9SA 5F8JA 1NK8A 4LF9J 5K8MA 4ZCLA 2ZFHA 1HI1A 4F2SA 4Q43A 2B51A 2FVPA 3O5TB 2J0WA 1SJFA 2K7JA 3HX9A 3GWCA 2IMWP 2MQMA 5B0AA 4DS4A 1DARA 4RW7B 4C97A 2CQCA 3H90A 4B3TF 2XLJA 2BA9A 3QGHA 1VK3A 1NHUA 2BV3A 2QLFB 2UV8A 2W7OA 3VAMA 4CLPA 4OIXA 5CA5A 3C14B 2ZVIA 2FYXA 1H3DA 4WP9A 3T41A 4LMZA 3POTA 2W4DA 2DYAA 2HFVA 3BGFA 2MQQA 3QZ8A 5ETSA 2LLZA 3MM7B 4LF4J 3MI7X 2GS8A 2J7WA 3H5XA 4DL5A 1NMEB 1YJTA 3D67A 5HLFA 2AYBA 1Y00A 2PSZA 4M5NA 1HPZA 3SIPB 3GG0A 3I32A 3GU0A 4BLGA 3GIMA 3VAHA 4DV7F 3M8YA 1RT4B 1RTHB 3OXLA 3TR5A 1C2PA 3BR9A 1OIAA 2BE9B 2WVFA 1GK8A 1SV5B 2CDQA 2HLTA 2OFHX 3HJFA 2FZCB 3WX8A 3ETOA 1C0TB 4DR2J 3TZWA 1U45A 1H0HB 2EFGA 2Z30B 2MJUA 2I38A 4DWIA 3L7OA 2FHMA 3RAXA 2JEGA 1NSPA 3HFVA 1HQ2A 2CPDA 2XNQA 3W7BA 2Q66A 4XDDA 5FLXY 2ROPA 5HMWA 3KKFA 4DV1F 2BMBA 3VAJA 2AJ0A 4FF4A 3NNHA 1KVJA 3HVTA 2HEKA 1D0EA 3KUEA 5KFWA 4O3SA 1M0SA 2WB4A 2VHGA 2RDDA 3CC7S 3QLHB 1ZPVA 3NBPB 4YR2A 4WP8A 3KDOA 2FJVA 2XHWA 4ZMMA 1DHMA 3M2UA 4KGZB 3M2RB 3LO3A 3MFHA 3O8WA 2H4YB 2I1RA 2GJFA 2HS0A 3BBFA 3DDIA 4UW2A 4RUAA 1UVKA 3MEDA 4F04B 3PEJA 4NXMF 3A8IA 4CQ1A 4CI0B 2ZE2A 4B3RF 2PFDA 4EZ9A 2RRBA 2YWKA 2CJXB 3I0RA 2CPJA 5J2MB 5MLCV 3ILLA 3I96A 4WF9Q 1SB6A 4X62F 1JLEA 2UV8G 4QIGA 2OD4A 3V6DA 3GSDA 1GH8A 4O3PA 3DOLA 4DUTA 2GVZA 4TYBA 2AYMA 2YPZA 3PFEA 2AMCB 3TUJC 3C2PA 4DPUA 2W2PP 4X66J 2ZH1A 4X4QA 4WFYA 3MR3A 1X5SA 1U48A 2NLWA 1PJ7A 2Q79A 4XPCA 3Q23A 3BO3A 2QO3A 4ED0A 2UUTA 3DYAA 4KQZA 4IH7A 1N0UA 2KH9A 2E5JA 3MEGA 4MMOA 5D0EA 1C1CA 3K5OA 4TYAA 4CZCA 4TU9A 4KBIA 1KS2A 3TAMB 2AW0A 2EFPA 5HK4A 4DQRA 1V3ZA 3HVWA 3PTWA 2BDPA 1PILA 3FBBA 3MM7A 3QFHA 4NLPA 5KOXA 3K58A 3T5LA 3QRQA 1AW0A 1X4AA 2KZZA 3V6KA 4DV2J 3QIPB 3N4WA 2QA4S 5HP1A 1NDKA 3LQVA 4O4GA 3PX0A 2M5YA 1E6VB 2QMXA 2P2CB 2VDHA 3EDQB 3QGPA 4R0EA 5HJXA 2JLGA 2NREA 3QWPA 4LFAF 1FJGF 1CJVA 2E7VA 3ICLA 3DRSB 5D4PA 2CZVC 4PCQA 3IFEA 1GXUA 2BEFA 3D0GE 1VRUA 2DHAA 3OTCA 4NOHA 1NDPA 3PR5B 3OVBA 3SQOP 2UUWA 3KUHA 3LGNA 3KK3B 1L3KA 1HI0P 3NGDA 3ADAC 3TZXA 2HHSA 1VQ5S 4Y0FA 4L74A 2BRKA 1GMWD 3QWUA 2M7SA 3DRRA 4G6VB 3SFUA 3UDEA 1URNA 1RT3A 1N33J 3CDUA 4RNNA 2DR6A 3MAAB 3W65A 1T9VA 4F3QA 1LWCA 4C11B 2BACA 3A8KA 2W2NP 3D6FB 3IRXA 4KH0B 4MIAA 4OV6A 2KJWA 3M9OB 2UU9F 1RT2A 3SXLA 4UUWA 4MK8A 3CT9A 1DY3A 1NK9A 1WF0A 2GHWA 2UUCF 4L75A 1RHKB 3ZZOA 3M1VB 4CLLA 1LQ9A 3T1AA 3BDEA 1TL1A 4WTYA 2B4VA 4Q2MA 5D0HA 4J9KA 4X62J 3ILIA 3SYZA 4DFKA 5KT2A 3PV8A 4ELVA 4FYXB 2EW9A 2YNIA 3A3PB 5HROA 2MGZA 2FDNA 4EYHB 1TKZB 1KHWA 4F25A 2ACMA 1UZHA 3SMZA 1JX4A 3R3TA 2VPZB 3BKFA 2H3EB 2OPRA 2K1RA 2VFTA 4I6WA 4MJKA 2UZAA 5F3TA 4CYUA 4HKQA 2J76E 2ASDA 1XMOJ 2NQPA 3DMJA 2VIHA 3A8EA 3KLVA 4KH1B 2VA3A 1QTNB 4U6PA 3GFXA 3HHEA 2XTJP 2ZHBA 1HWKA 2YNFA 2BUNA 4OZ1A 5HATA 4JV0A 4F4AA 7FDRA 1NSQA 1VR6A 1D8ZA 3NCQA 2LKZA 1RHJB 3MECB 5ETVA 1HLWA 2IY5B 1KWMA 2VQFJ 5LOQA 4E98A 4C8YA 1QUPA 3G6ES 4TNOA 3TI0A 1N6QB 1UETA 2YKOA 4DR4F 3HSZA 4Z37A 4ANEA 2LA4A 3DOMA 4XIUA 3UR0A 2F9JA 4UT4A 5H9EK 2DNRA 3UDVA 4ANCA 2UXBF 1QAJA 4ED2A 3RAMA 3KFWX 3CTRA 4P7VA 3R7NB 3D66A 3CJ2A 1TL3A 2ZM6F 2DGQA 4TY8A 5KG2A 2XWXA 2ZD1B 3J7YU 1RTIA 3DLKA 1GTHA 1UPPA 2WTFA 1B3TA 2GCFA 1BQNB 1WHYA 1NNDA 2ZJPQ 4DX5A 4MKBA 3F44A 1JLAB 3HDSA 1TKTA 4JI6J 4PYAA 2PE8A 1KHVA 2HURA 4PG7A 4QCLA 2RU9A 4KFBB 5A8RB 4B3OB 1AYEA 4OYBA 1LWEA 2CZ9A 2A2DA 1UZDA 3M32A 3QT7A 4ZVGA 4EGLA 4NXNJ 3MMJA 3NKYA 3ZZ0A 2XI3A 5DO2A 3K57A 4OI0A 3RB4A 3LGHA 5LMNJ 2KI2A 2DGUA 3MM5A 1S10A 4ECUA 1IJEB 5H9EJ 3I87A 3GLJA 3TA1A 5C42B 1X4BA 3X3UA 2O66A 4YB6A 5DQHA 3T9ZA 1M5KC 2BJ3A 3OR1B 1XMBA 4O3QA 3CCSS 4M94A 3EZOA 4MFBA 3T19A 5IT9Y 6FD1A 1F5AA 1F1BB 2VBYA 2GQ2A 3K5NA 4A8SA 5EGYA 2DTJA 3MURP 1RT2B 3G6YA 5KFUA 2UVRA 3HD1A 2IA0A 4K5SA 2G13A 1VLYA 3F41A 3KHLA 4CRJA 1R31A 3POTB 3FMWA 1XIQA 5M2RA 2WSEC 1FNOA 3LAKA 3MM9B 2X51A 2CG8A 1U0SA 1VQ8S 2VG7A 3PXGa 1PIEA 2OPSA 4FXWA 3BZQA 1EB0A 1ZTTA 2FGCA 3M6XA 1D1UA 2BVZA 2K8GA 3MM8A 3TEHB 2RRAA 2ATCB 1YJUA 4GKKF 2ZE2B 1RTJB 4QYRA 5U47A 1KONA 2QG9B 4LF2A 1RHUB 1RTIB 1X4HA 3DLKB 3R5DA 4IR1A 1N32J 3H5UA 4Y00A 2QZ8A 3E8OA 4ZVTB 1K73T 2B7CB 1D9DA 4BWJA 3ZFVA 1HBMA 2OFGX 3CJ5A 3M2RA 3EPGA 2DY1A 4ZIVA 1YWXA 1FXRA 5ETPA 2ALYB 1NK4A 4EO6A 1TUGB 2MHNA 2MLZA 5ETMA 2CJKA 2HHXA 2RQMA 2QX0A 2ZKUA 1F3VA 1VQPS 3B78A 3DOMB 1RT5B 1N5YA 3Q8SB 3CF5Q 3HVAA 2XY6A 4QU7A 2VFSA 5B0FA 1M5VC 4X4TA 5G0RA 2EFNA 4KAIA 4ZHRB 5DDOC 3MECA 2AWZA 1IR2A 4PUOA 4X4RA 2PIIA 1YG0A 1XR5A 1F9FA 3OLAA 2LQJA 2CJQA 1RU1A 2FC9A 3QAUA 4DV6F 3THTA 1F60B 1F0XA 4AQYJ 3AQPA 1NB2A 2VPWB 4IFYB 4ZPWR 2UP1A 1HYSA 4IFVA 4NI2A 1I51B 3S8SA 4X4VA 1NO8A 4G1IA 4DV4J 1GMVA 3VWSA 5GAEU 3G2XA 3BO4A 4DR1J 2AGOA 4NLGA 1BC6A 2VBZA 3UQSA 4OZNA 8AT1B 5KFEA 4PAAA 1YRUA 1R43A 3IP0A 5B0DA 2E1PA 1ZM3A 3I0SA 4HI1A 5JVHQ 2HZVA 1F3FA 2DITA 4NL5A 5A76A 4QPXA 2D9PA 4RLEA 2XZTB 5ETKA 2MY8A 2XB2D 4KC5A 2LQ5A 2VZ9A 3B82A 3H2VE 2CPEA 3I9ZA 5FDLA 2J7KA 2E5IA 1X4EA 2IM2A 3OBIA 1U8SA 4ZITA 3V6DB 1FKOA 5IM0B 2C3MA 1JXLA 4C4WA 1YSJA 2M52A 2A2CA 2C3YA 3T1HJ 1BGXT 4TY9A 3V81A 1S77D 5J2MA 1TQLA 1VDHA 2MKKA 2R8HA 3HT0A 2QL7B 5HQLA 2QSWA 3KLIB 4BC7A 4EFAC 2DGTA 1HNIA 4H4KA 4WFZA 3OHAA 2F9DA 5GAEI 2BJDA 3M8PB 4HHUA 2IIHA 4PWUA 3SCKE 5KG0A 3ZC4A 4R8UB 2IM1A 1WKKA 3M9NB 4DSFA 1WC6A 2OO4A 3O1LA 2E5GA 1JJ4A 2Y0SD 1Y7PA 3CJ8A 5FIIA 4DFJA 4C0HA 4MKYA 4URSA 1RLCL 1OJ4A 1RUSA 1TL5A 1TZ0A 2B9WA 2JH3A 1IXKA 3FRYA 4M5LA 3MR5A 5GMDA 1CG2A 2APOA 3GCXP 2C2OB 8RUCA 2XS7A 3JQMA 3H0PA 3MCMA 5B08A 1X4DA 4ED5A 2RU3A 5D8HB 1CJVB 4F4YA 2YNHA 2R2TA 3H20A 4MYTA 5D0GA 1FFSB 2H5JB 4Y2AA 2XG8A 4RU9A 1SUQA 3IGVA 3KLFB 3PW0A 3TJ9A 1F9HA 2NXUA 1RACB 4ANDA 1EHWA 4EU0A 4ZK7M 3CJQA 3DCAA 2MQNA 4O4GB 1K0TA 3NMAA 4ZCMA 3OVAA 3N5FA 1Q8IA 1TELA 4CDIA 2OSQA 3K8VA 5DDQC 2UUAF 3IR6B 4ER8A 4X65F 2VC1A 4O23A 2DGWA 2E5LJ 1VQOS 1HWIA 3AA8A 4TY8B 1VJWA 1S49A 1OY6A 5AXMA 3BQ1A 1RWOB 5D15A 1ICEB 1Q95G 5IC4B 4AQYF 2HMIA 4V19J 2RILA 5KFJA 4TXSA 1Q0NA 2MKJA 1UFLA 4JI7J 4TN2A 2MZRA 2EEYA 4B3MJ 2NYIA 1YX2A 2VF3A 1Y3JA 4ZJLA 5ETOA 3PW4A 4KPYA 2MDAA 1PAEX 1HKAA 3MM6A 3QGGA 1N6QA 1S72S 3OHBA 4R0JA 4LRDA 1ZAWA 2RE1A 4CT9A 1S0NA 5FJ4A 4C3MA 5K8NA 3EGNA 3NGSA 1GAOA 1T9TA 2VD3A 2COLA 3GFHA 3L95X 2HLUA 1PCAA 1O5JA 5IQ6A 3KLEA 3D3CJ 1CJTA 2WCXA 3D6HB 3C19A 2MQ8A 5KFYA 5C25A 4DQSA 2ZZTA 1JLEB 4DMZA 5K20B 3J80U 2RSQA 3CMAS 5EHHA 3PRVA 1OYEA 2KT5A 1J27A 1IKWA 1Q8KA 1KQGB 3F73A 4M1KA 4P2MA 4ECZA 1N56A 5L1JA 1YRTA 2EK6A 1X60A 1X0FA 1SKWA 3M9MB 3CC4S 1DAXA 1IUJA 3DLHA 1HNWF 2HRTA 2LCWA 1X9MA 1FRIA 1OPZA 3FBFA 4MK7A 1RJJA 2FPHX 3OPKA 2XYPB 3MEDB 1MU2B 2WBRA 1S1UB 4LBHA 5D77A 2O1PA 3N6NA 5E0OA 4U8YA 3BBCA 2KM8C 4XTTA 3TP2A 1XERA 2HGMA 3D0IE 3KLFA 2B8QA 1RCXB 4O44B 5AE1A 1KQSR 1TL1B 1W7WA 2G0JA 1TR0A 1QSSA 4ZVRB 1BE4A 4DR6F 1FI4A 4RX6A 1MMDA 3MR6A 3SQGA 2RDJA 4N41A 2V2ZA 1TFWA 2J5AA 1WD6A 3EVOA 3OTDA 1RB0A 3CNQP 4O4RA 2XEXA 2ZC3A 4Q45A 3KJVB 4DFMA 1FJCA 2DJWA 3EXCX 4E8UA 1HWUA 3DGPB 1SJQA 3NGUA 4C11A 1X8DA 1SC1B 2ZOFA 2IRUA 3AOAA 5DETA 1C0TA 1IBCB 5KG1A 1IBMJ 3Q0AA 3QATA 3V4IA 2UXCF 1TTHB 2DRBA 1CEZA 5H1SV 4DSJA 3NP5A 1UW9A 2DRDA 4A8XA 2VG6B 1FFGB 3W5XA 1H2UX 2SXLA 2KHCA 2VG7B 4QWDA 5GAGI 5HLFB 4X84A 4Y2CA 2MXYA 2KYXA 1HNIB 2HYIB 3D6MB 2WSCC 4JV1A 3EGZA 2U1AA 4USJC 4AYBD 4JI8F 2BJ8A 4LF7J 3MPDA 4NLDA 1VRUB 3NAHA 4I6YA 3BSNA 1URRA 3Q8QB 2AEJA 5HQ8A 1PBAA 3V81B 4JV2A 3HFZB 3K7RA 2CYYA 1DQAA 3TUPA 3W66A 5CD4A 4ZVOB 3S01A 5B0BA 3M6UA 3CXCR 1Q5YA 3NWGA 3OJSA 4DUZF 1A7GE 2C42A 2RS2A 2F4VJ 2HHTA 2KM8B 2HGNA 2L9NA 4X4OA 2XS2A 3OSNA 4HT7A 3UD4P 3FUYA 4B3MF 3BGRA 2L3MA 4FBUA 5KTQA 3PCOB 4ECRA 3KWMA 3A4TA 2HQ3A 2OELA 4F4ZA 2FJAB 4CH7A 3BKUA 2H5IB 2B9EA 4ZCIA 2QYGA 2DNHA 4N5SA 3QT6A 3ZTPA 4DU8A 3DKDA 7FD1A 1SC4B 4FYDA 2ZC4A 2M4MA
chains in the Genus database with same CATH topology
1NLKL 3L7UA 1NDKA 2AZ3A 5BXIA 1MN7A 1NDLA 2HVEA 4ANDA 1EHWA 2DXEA 3VGTA 4FKYA 4DI6A 1BUXA 3Q8YA 1WKJA 4O0NA 5CAAA 2B8PA 4UOFA 2BEFA 4S0MA 3NGRA 1NDPA 1XIQA 3VGVA 3ETMA 3JS9A 3EM1A 3ZTSA 1ZS6A 1JXVA 2VU5A 3EE3A 3NGTA 4FKXA 2AZ1A 1PAEX 1LEOA 4C6AA 3ENAA 3EVMA 4ENOA 3NGSA 1NHKL 1VYAA 5CABA 1S57A 2DYAA 3Q83A 3B54A 4F36A 3FBCA 2DXFA 3PRVA 3FBEA 3GP9A 3EJMA 4UOGA 3FBFA 5C7PA 3WX8A 1LWXA 1XQIA 3Q86A 2CWKA 3BBCA 3Q8VA 4EK2A 1NSPA 2BX6A 2B8QA 1NB2A 1HIYA 1W7WA 1BE4A 5IOLA 3VGSA 1S59A 1PKUA 3EVOA 3FCVA 3G2XA 3PJ9A 3BBBA 1UCNA 4W98A 4WBFA 1S5ZA 2NCKL 4F4AA 1MN9A 3ZTRA 3Q8UA 1NSQA 3VVUA 2HVDA 3BBFA 3DDIA 3NGUA 1WKLA 1F3FA 1B4SA 1HLWA 1F6TA 1U8WA 1BHNA 1NUEA 3BH7B 4ANEA 3FC9A 4CP5A 4KPCA 3B6BA 3VGUA 3ZTOA 4ANCA 3EVWA 3VVTA 4UOHA 3EICA 3Q89A 3ELHA 1B99A 3BH6B 3MPDA 4DUTA 1NSKL 1NDCA 2DXDA 3R9LA 3ZTQA 2DY9A 3FKBA 4HR2A 1K44A 1NPKA 1WKKA 1KDNA 1NCLA 2ZUAA 3FCWA 2HURA 1HHQA 3EMTA 3FBBA 3GPAA 4DZ6A 3ZTPA 3DKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLK L;  3L7U A;  1NDK A;  2AZ3 A;  5BXI A;  1MN7 A;  1NDL A;  2HVE A;  4AND A;  1EHW A;  2DXE A;  3VGT A;  4FKY A;  4DI6 A;  1BUX A;  3Q8Y A;  1WKJ A;  4O0N A;  5CAA A;  2B8P A;  4UOF A;  2BEF A;  4S0M A;  3NGR A;  1NDP A;  1XIQ A;  3VGV A;  3ETM A;  3JS9 A;  3EM1 A;  3ZTS A;  1ZS6 A;  1JXV A;  2VU5 A;  3EE3 A;  3NGT A;  4FKX A;  2AZ1 A;  1PAE X;  1LEO A;  4C6A A;  3ENA A;  3EVM A;  4ENO A;  3NGS A;  1NHK L;  1VYA A;  5CAB A;  1S57 A;  2DYA A;  3Q83 A;  3B54 A;  4F36 A;  3FBC A;  2DXF A;  3PRV A;  3FBE A;  3GP9 A;  3EJM A;  4UOG A;  3FBF A;  5C7P A;  3WX8 A;  1LWX A;  1XQI A;  3Q86 A;  2CWK A;  3BBC A;  3Q8V A;  4EK2 A;  1NSP A;  2BX6 A;  2B8Q A;  1NB2 A;  1HIY A;  1W7W A;  1BE4 A;  5IOL A;  3VGS A;  1S59 A;  1PKU A;  3EVO A;  3FCV A;  3G2X A;  3PJ9 A;  3BBB A;  1UCN A;  4W98 A;  4WBF A;  1S5Z A;  2NCK L;  4F4A A;  1MN9 A;  3ZTR A;  3Q8U A;  1NSQ A;  3VVU A;  2HVD A;  3BBF A;  3DDI A;  3NGU A;  1WKL A;  1F3F A;  1B4S A;  1HLW A;  1F6T A;  1U8W A;  1BHN A;  1NUE A;  3BH7 B;  4ANE A;  3FC9 A;  4CP5 A;  4KPC A;  3B6B A;  3VGU A;  3ZTO A;  4ANC A;  3EVW A;  3VVT A;  4UOH A;  3EIC A;  3Q89 A;  3ELH A;  1B99 A;  3BH6 B;  3MPD A;  4DUT A;  1NSK L;  1NDC A;  2DXD A;  3R9L A;  3ZTQ A;  2DY9 A;  3FKB A;  4HR2 A;  1K44 A;  1NPK A;  1WKK A;  1KDN A;  1NCL A;  2ZUA A;  3FCW A;  2HUR A;  1HHQ A;  3EMT A;  3FBB A;  3GPA A;  4DZ6 A;  3ZTP A;  3DKD A; 
#chains in the Genus database with same CATH topology
 4JYA J;  3PM9 A;  2YQ1 A;  5DDP C;  3D1H A;  4RW6 B;  1T11 A;  5FD1 A;  3M4X A;  4X64 F;  3W9I A;  1IWG A;  4C8M A;  2UXB J;  1YIJ S;  4FN5 A;  2RHQ B;  4GVB B;  2VOP A;  2MKH A;  4OZ2 A;  2D3O 1;  1YHQ S;  3MAH A;  2HFZ A;  1BWE A;  4LRF A;  4MYU A;  3WDO A;  2ZBI A;  2UUB J;  2WVC A;  4ELT A;  5CAA A;  2ACY A;  4HHJ A;  2VJU A;  4UOC A;  5JXS A;  3FZ2 A;  4NCG B;  1HNV B;  5KT5 A;  1ZTW A;  4NXN F;  4EBC A;  2LEB A;  3DI6 B;  1T94 A;  4K2J A;  3DOL B;  4TU8 A;  1OQ3 A;  3OTO J;  3CCE S;  2GIR A;  3JS9 A;  1FDD A;  4NLS A;  4OLP A;  3ZXW A;  1QM9 A;  2J9E A;  2V50 A;  3EWG A;  2A10 A;  4NYO A;  2HRU A;  1VRQ C;  2OLW A;  4WII A;  2BRL A;  2DO4 A;  5THW A;  2G2Z A;  4PWD B;  3B4M A;  1TMM A;  3PRB A;  3MPW A;  1S76 D;  4EUV A;  1R0C B;  4I6A A;  2CQ1 A;  2CVI A;  5IZH A;  5KT3 A;  1YJW S;  4NWB A;  2G1D A;  2JEF A;  3TW0 A;  2GO9 A;  4ZPT R;  1UJ6 A;  1JXE A;  5HMX A;  3AFG A;  1L3T A;  1JLB A;  2OPS B;  4F0H A;  4DX7 A;  1BQX A;  3R6L B;  2CZ4 A;  1S0M A;  4RW4 B;  2ASY A;  2V34 A;  2LEC A;  3A1Y G;  3JYT B;  1RGV A;  4YME A;  4DV0 F;  1TK5 A;  1GMW A;  4LIR A;  1FNM A;  4JI8 J;  4LF7 F;  3LAN A;  5C7P A;  2EFO A;  3GG1 A;  5HVH A;  2CPH A;  4JI6 F;  3T3F A;  1DQ9 A;  1WDT A;  2ZH9 A;  2CKW A;  2FGO A;  2OPQ B;  5M2P A;  3OR1 A;  4DL6 A;  1U1R A;  2RH3 A;  3E01 B;  2R9L A;  3A12 A;  2FB0 A;  2XCA A;  4KE5 A;  1NK0 A;  1VQ9 S;  1IKV B;  1N0V C;  4JI0 J;  2FHJ A;  3M1V A;  1RT4 A;  1RTH A;  3UCG A;  1HQU B;  1KKH A;  5ITH A;  4PXD A;  1MWQ A;  3F0N A;  4OX9 J;  4FZV A;  1WEY A;  1FX4 A;  3TA2 A;  2XO6 A;  1LK5 A;  1NRK A;  5CD4 H;  2ZBP A;  2A1B A;  3LF0 A;  4WBF A;  1X4F A;  1LWE B;  3LP2 B;  3AA9 A;  4NEY A;  3IAM 9;  4BDP A;  3LP0 A;  1H98 A;  2ZWP A;  2QE5 A;  1TK8 A;  1LFW A;  1CUL A;  3QSY B;  1ARO P;  3O44 A;  4M5M A;  4DV4 F;  2OIH A;  1SKS A;  2OML A;  3VAF A;  1FT8 A;  1NUE A;  2Q1L A;  1TV6 A;  4ITS A;  1WTB A;  2EI5 A;  4BS2 A;  2XM3 A;  2J0X A;  1RT1 B;  4CP5 A;  1DTQ A;  2V6A A;  5HL7 Q;  5CYJ A;  3PIO Q;  3KLH A;  3EVW A;  2G2O A;  3VVT A;  4GRS A;  4UOH A;  1B99 A;  3HJV A;  1NSK L;  1T95 A;  4AL6 A;  1UVL A;  2ZNZ A;  1UEK A;  3KXD A;  5B0C A;  3BR8 A;  3FCH A;  1DZ5 A;  2LEA A;  2F8H A;  4Y34 A;  4CO0 A;  4X65 J;  2R8I A;  4AL7 A;  4HR2 A;  1YBU A;  2E5L F;  4GKK J;  3M8W A;  5H9F K;  1M1H A;  2XZD B;  2HHQ A;  5A8W A;  2R4F A;  4GC7 A;  4J9O A;  3AH6 A;  2NR0 A;  1WC0 A;  2R7U A;  3KHH A;  4NA1 A;  2CJA A;  1OQ6 A;  4CWB A;  1FK9 A;  1Q8L A;  4WK3 A;  1KVK A;  1C4C A;  1MWY A;  2GW8 A;  3OL6 A;  5CXT A;  5RUB A;  4ZVP B;  3PEH A;  5KFV A;  3ZZY A;  2NXJ A;  2I6W A;  1WAC A;  3RGI A;  1H73 A;  3WIU A;  3ENV A;  2QMU B;  4D3G A;  1QLN A;  2GX8 A;  3CIM A;  2V8D A;  2YNF B;  2CWX A;  2E9Z A;  1S4E A;  1VJQ A;  1R6Y A;  3NWR A;  4DZ6 A;  5GAG U;  4B9V A;  3VAG A;  2QC3 A;  2RUG A;  3KOA A;  1UL3 A;  2XWY A;  1RYR A;  3PYE A;  4ICL B;  5BXI A;  4HAC A;  3ZZZ A;  3LW5 C;  1F5C A;  1N48 A;  2K1R B;  2JL9 A;  2VBX A;  3TX0 A;  1NJY A;  3I56 S;  1FE0 A;  4N8O A;  5D78 A;  3W2V A;  4FXD A;  5C42 A;  1U02 A;  4DV6 J;  1XC9 A;  4B9M A;  3N28 A;  1Y3K A;  2AGQ A;  4M5I A;  1P27 B;  5HI7 A;  3N01 A;  1M5H A;  3DM2 B;  4P52 A;  3FSI A;  2N4D A;  3UCU P;  1M5O C;  2DPI A;  2ZH2 A;  3FQL A;  1OSC A;  1RT6 A;  4J9S A;  1KTV A;  3K59 A;  2X1G A;  2PMH A;  3M32 B;  3NS6 A;  2ZDP A;  5FLX U;  3HHL A;  4QR0 A;  1NH7 A;  1QSY A;  1RI7 A;  4DUY J;  5KFC A;  3CCL S;  4LF5 J;  3UW1 A;  4X4S A;  1GXT A;  1G7C B;  3NCP A;  3GIJ A;  2WVE A;  1XMQ J;  1HAR A;  1VBZ A;  1AT1 B;  4GKJ F;  2YY3 A;  1KFS A;  4LF6 F;  4PRF A;  2QSF A;  2F5G A;  2LMI A;  3IRX B;  1IN0 A;  1MG7 A;  3LPY A;  4H4M B;  5IV3 A;  2F65 A;  2HQI A;  5LSO A;  1G1X A;  3KHR A;  1MW7 A;  3NS7 B;  5HVF A;  1GX5 A;  1N8R T;  2IJR A;  2HHV A;  4JOU A;  4LIW A;  2QTW A;  3ZO7 A;  4DCJ B;  1HFE L;  3F56 A;  3IG1 A;  1FTR A;  1F2G A;  3Q83 A;  3TQE A;  4YDD B;  2JJ4 D;  3JTO A;  1RTD B;  3EXY A;  3R5J B;  4P75 A;  4B3R J;  3UVJ A;  2DXF A;  3K5P A;  1FO1 A;  4PG5 A;  4KJI A;  1RAF B;  3FBE A;  2DPJ A;  2U2F A;  4CLW A;  3CCW A;  2PEB A;  3C16 B;  2VJV A;  2MQL A;  1UEU A;  1BWV A;  3DRS A;  1YZ7 A;  3BYP A;  4PQU A;  3MCN A;  1SVD A;  4NE9 C;  2BM0 A;  1N5V A;  4GVB A;  2P9G A;  3HF5 A;  3VZH A;  3Q8V A;  4HVZ A;  4NYZ A;  1HD0 A;  2VBW A;  1U6F A;  1Y4Z B;  2ROE A;  4B3S J;  1N4L A;  3SCJ E;  2JRS A;  4FYY B;  2A6M A;  3J80 Y;  3CVK A;  1RZM A;  2HAF A;  2V8P A;  3VGS A;  3OLB A;  2HFU A;  4DUZ J;  1UWB B;  2EWH A;  2XSF A;  3G82 A;  2Y1J A;  2MLX A;  2Y3Y A;  4OZL A;  3BBB A;  5EWG A;  4M5J A;  4A48 A;  3R6G B;  1XEZ A;  4NLX A;  4NLU A;  1WEZ A;  3D1O A;  2IHR 1;  4NAS A;  1DUR A;  2PA8 D;  2C28 A;  3GJT B;  3I5A A;  1M1K T;  1FFW B;  3AJD A;  1LW2 B;  4CO4 A;  1N36 J;  2B9X A;  5LMU J;  2QA1 A;  2VAS A;  5K5M A;  3D6T B;  2NYH A;  4PG8 A;  1GMU A;  5A0Y A;  2VDI A;  2MPU A;  3GJR B;  5KFM A;  2XUL A;  4L3K A;  3HMJ G;  5HO4 A;  4A8M P;  2P5V A;  2QL5 B;  3SSQ A;  4W92 B;  3ELH A;  5E3A A;  3BH6 B;  4MAK A;  4RO0 A;  1R89 A;  1AUD A;  4DFP A;  1VC6 A;  3MGJ A;  1JLQ B;  2FJD B;  3ONQ A;  4IOC Q;  5DGA A;  1EZZ B;  1C0U A;  1YI2 S;  1NPK A;  1ROF A;  4TKT A;  2GFF A;  4DU7 A;  1KDN A;  1FE4 A;  2MY7 A;  4ZKA A;  4ID5 A;  3M30 B;  3KDN A;  2BE2 A;  1Y0H A;  5HN0 A;  2XNR A;  2V8H A;  1T8E A;  1SQE A;  1SQF A;  2X1B A;  2Z2L A;  1KFD A;  1X4G A;  3AD8 C;  3BV8 A;  3DGP A;  4IYQ A;  4UST A;  3D2W A;  1WWH A;  5J2Q B;  3IWN C;  2KTQ A;  4USU A;  1TKX A;  4LSL A;  3M2U B;  2BBE A;  2BOA A;  1UVM A;  4ID5 B;  3CJR A;  4P71 A;  1KLM B;  3FGV A;  4H4O B;  2FLP A;  1SKU B;  2Y1R I;  1ZZN A;  3MEK A;  4CT8 A;  2E1R A;  3PY8 A;  2BKN A;  1H6K X;  4LSN A;  3EZ5 A;  4EEY A;  1MLA A;  2A3J A;  3BEG B;  2NSB A;  1S9F A;  5KOW A;  2QV6 A;  3HZG A;  2LEP A;  5D4L A;  2XLI A;  1S6Q A;  3D54 A;  1WEL A;  4DR5 F;  3VAL A;  2GAG C;  2P6T A;  4PXE A;  5E3Q A;  2IJF A;  1R3N A;  1Z4U A;  3BN7 A;  2F7V A;  2Z0G A;  3DU5 A;  5ETR A;  5KFL A;  4DV0 J;  3BRE A;  2XY7 A;  1AFJ A;  2AD9 A;  2ASL A;  3H2U B;  2MZS A;  4YDX A;  1SV5 A;  3IM9 A;  1EP4 B;  3MAQ A;  4F4X A;  1JLG B;  4FPR A;  1RAA B;  3FMB A;  1YQH A;  2PT0 A;  4LQ3 A;  3CO9 A;  3VF0 B;  1NJZ A;  4USV A;  4BWM A;  4B3S F;  4L3N A;  4ERD A;  1X5P A;  2HNZ B;  3EM1 A;  1ITP A;  4QWA A;  3UWT A;  3K5L A;  2HGL A;  3MTK A;  3UR3 C;  2C3O A;  1ZBT A;  3PHT A;  3RYL A;  5IS2 A;  3MUV P;  2I2Y A;  1HWL A;  3UI3 A;  4C6A A;  1T9W A;  2DH8 A;  2IYG A;  2HZC A;  1KOH A;  1LFP A;  2D7S A;  1S1V B;  5I3U B;  3LWL A;  3TAP A;  1YLX A;  1RWN B;  5KAK A;  3OSP A;  3US5 A;  3T5K A;  1B70 B;  2RDI A;  1T9Y A;  1RBL A;  1RP5 A;  3DHW C;  4CLU A;  2JFK A;  5JMN A;  4KKO B;  3T9N A;  1QVF R;  5M2U A;  4J90 A;  5J1E B;  4NLO A;  5J2N A;  2WSF C;  2N7Y A;  1AXQ A;  2RHS B;  4ZVQ B;  2WW4 A;  1CSJ A;  3DLL Q;  1HA1 A;  3GP9 A;  3AJ1 A;  1WUU A;  2WAQ D;  3MMA A;  2CXE A;  2PMZ D;  2X7I A;  2D1C A;  1LV5 A;  2KZM A;  1U1M A;  2EBE A;  2DO0 A;  1FDN A;  2V8G A;  2AJF E;  2XMU A;  2DIU A;  3AOC A;  1HBO B;  4ZP6 A;  2Q43 A;  2VG5 B;  3W9H A;  1IVZ A;  1S48 A;  3AB4 B;  3KJN B;  3KJQ B;  1DQ8 A;  3BKT A;  1Q81 T;  1H2T Z;  2FHO B;  4KIA A;  3QLH A;  2FTR A;  4M5G A;  4YY3 J;  3MUM P;  1U1O A;  3QQC D;  3N9U C;  3K8W A;  2UVV A;  3PIP Q;  2M0G B;  1S5Z A;  4Q5V A;  1Q7Y T;  1HQE A;  4IRC A;  4A4J A;  3GJQ B;  3Q8U A;  8ATC B;  1BY9 A;  2VFV A;  2OTJ S;  3G9C A;  1UAW A;  2B0G A;  1LKZ A;  1JNR B;  1R6V A;  2MHE A;  3W2W B;  3TAQ A;  3LA0 A;  3QRP A;  1FXL A;  4CCH A;  2JNJ A;  2YH0 A;  1EAR A;  4IH6 A;  4NX9 A;  3CPW R;  4CIO A;  2D3O R;  5DG9 A;  1H38 A;  1WNE A;  3KLG B;  4NLR A;  1UA0 A;  1EET A;  2QGF B;  3HO1 A;  1X9S A;  4JBC A;  2XMM A;  2KFY A;  2RQK A;  3CJ4 A;  1M5P C;  1TVR B;  2C2D A;  4D3H A;  3OTB A;  4JI2 J;  1FD8 A;  3IAS 9;  4CLZ A;  4X2B A;  4NZ7 A;  4ECX A;  2AP6 A;  2E29 A;  4F2R A;  2KG0 A;  3ZTQ A;  3RZA A;  1NPR A;  2V68 A;  3MMB B;  4C9D A;  2C3U A;  2V0N A;  3I5C A;  4LF5 F;  3SDE B;  4NA2 A;  5FDL B;  5AE2 A;  4RW7 A;  4EBE A;  2Z2Z A;  5KFZ A;  2M8D B;  2ZUA A;  3FCW A;  1GEH A;  3P96 A;  1REV A;  4OX9 F;  3GFZ A;  1AUS L;  4DR3 J;  5E3R A;  4A8Y A;  2DNZ A;  1EJ7 L;  1GT8 A;  3SFG A;  5D3G A;  3ITH A;  3E3X A;  5AT1 B;  3DXB A;  1SXL A;  2ZHO A;  2FC8 A;  3PNI A;  1Q16 B;  3TO8 A;  3EMT A;  1CJU B;  1DLO B;  2JDJ A;  3DHX A;  4DV7 J;  2UUC J;  3GPA A;  5T7L A;  3PO5 A;  3A3O B;  4P7T A;  5DJB A;  4HL9 A;  3MCS A;  1Y11 A;  5D4O A;  2OD6 A;  4NI2 B;  2HRY A;  4GMK A;  3UN2 A;  3CCU S;  4LSZ B;  4NRT A;  4TLR A;  5AXK A;  3E51 A;  1ZZF A;  4W90 B;  2YKN B;  5KT7 A;  1R0A A;  2D3U A;  4PXB A;  2DHX A;  7AT1 B;  1NB7 A;  5I3Q A;  3D4J A;  1FDA A;  5AE3 A;  3HSD A;  4DI6 A;  1NPP A;  3AOD A;  3OUY B;  3WQP A;  2VV5 A;  2KXH A;  4ZHR A;  1RHQ B;  5DLG A;  5I4M A;  1S7I A;  3UN5 A;  5HJY A;  4A8W A;  2GQC A;  2HWT A;  2VPY B;  2ILY A;  3TOQ A;  3W61 A;  1CS4 A;  2QJ3 A;  3H25 A;  2GGP B;  4J9R A;  1RT7 A;  2E44 A;  4FBT A;  5EDW A;  3QO9 B;  2M70 A;  2IDL A;  1YTY A;  3ETM A;  3N6L A;  2FVS A;  1A9N B;  3P8B B;  2R7O A;  1AZS B;  2R7W A;  2IJN A;  1S1T A;  3QPI A;  1OY9 A;  3A13 A;  3O2I A;  1CVJ A;  1RAE B;  1VQS A;  2HBZ B;  4DR1 F;  2L9W A;  3U1N A;  3BDP A;  3LP2 A;  3CD6 S;  4B08 A;  1S9G A;  3I5B A;  4K0K J;  1N5T A;  5KG6 A;  3DLE B;  3I4H X;  3UCZ P;  4ILL A;  3LP1 B;  1NHK L;  1Y5L B;  2J0S D;  2J8A A;  1ZM2 A;  4RZR A;  3N5B A;  1WOR A;  5ETN A;  3UD5 A;  3CCM S;  2ADB A;  2KRR A;  1SJ1 A;  5L9N A;  2JVO A;  2W9C B;  2YX1 A;  3CSK A;  5ETT A;  2CA9 A;  3DXS X;  1CC8 A;  4F8R A;  4ZP7 A;  1IR0 A;  1RAH B;  2OEJ A;  2EKY A;  1EKR A;  5HBM A;  1KN6 A;  3CD0 A;  4I69 A;  2DH9 A;  2KB2 A;  2DIS A;  2UVW A;  5ETL A;  2ZZM A;  1ELO A;  4UOG A;  2Q6B A;  4KHP F;  4RWX A;  1T05 A;  1G4C A;  1HNX J;  4AL5 A;  1XQI A;  4LF1 A;  3SDE A;  1PAU B;  1RAB B;  2AF6 A;  2CWK A;  5KG3 A;  4AT1 B;  5F9L A;  2HFS A;  1N34 F;  3PR4 A;  2CPZ A;  2N7C A;  4KTQ A;  2HK3 A;  3CGI A;  4GKJ J;  1RWP B;  4LFA J;  5IT0 A;  5HVG A;  1RAJ A;  3CCJ S;  3RTV A;  1NM2 A;  2V94 A;  4DL0 C;  2CIM A;  2KN4 A;  5F9N A;  3FK4 A;  1PKU A;  2OPP A;  4J91 A;  3R7S B;  3VQS A;  4DR3 F;  3FCV A;  1KP6 A;  1RYS A;  2OTL S;  1E6Y B;  1VCT A;  4DV2 F;  3MZI A;  3KK2 A;  2JHE A;  3ZTR A;  1VMB A;  4K2X A;  2LQ9 A;  2OUG A;  2HVD A;  2BJE A;  4KFB A;  1YJR A;  2DD8 S;  3K2Y A;  5A8R A;  4F0M A;  2WON B;  3CCV S;  1S1T B;  3CME S;  3VZI A;  2JZ5 A;  2D74 B;  3GQC A;  2IMO A;  4JB8 B;  5KG4 A;  1WJ9 A;  4ZLJ A;  4C8K A;  3W5Z A;  2LFV A;  4WYL A;  1NKB A;  2R7V A;  1BQN A;  1VGY A;  3D0H E;  1VS3 A;  3DLJ A;  4NCG A;  4U96 A;  2R2S A;  3EUN A;  2QA4 G;  1HNZ J;  2LP4 A;  2AJ2 A;  4JI5 F;  2EXU A;  2I5J A;  4LBP A;  3TJ8 A;  3R5G A;  3A3N B;  4AFF A;  4MKV A;  4EI2 A;  2VQE F;  2K7K A;  2R8J A;  5GAD U;  2W9A A;  5A8K A;  3TEG A;  1TL7 B;  4QWB A;  4IG0 B;  2I9S A;  3FEX B;  4DPX A;  3FKB A;  1SL2 A;  1R8C A;  3R97 A;  1PYS B;  3CDB A;  2OP5 A;  3M8Q B;  4KHR A;  2BR0 A;  2OH2 A;  1VLO A;  1HBN A;  3NCR A;  1U6B A;  2HVH A;  3X1L B;  2BE7 D;  1XR6 A;  3JB9 k;  4JI1 J;  2BAN B;  2LXI A;  2NUU G;  4F0K A;  4OI6 A;  2IAJ B;  4M5D A;  5KFQ A;  2IC3 B;  2HHU A;  3M6V A;  3KG0 A;  2YKM B;  4OLO A;  5J2N B;  4YR3 A;  4QIE A;  3CJK A;  2MZ1 A;  4UZC A;  5J1E A;  3KLG A;  2EG1 A;  2RJZ A;  3D3B J;  4A8Q A;  2CQ0 A;  1BQM A;  3HKZ D;  5T14 A;  5A2Q Y;  1FA0 A;  2LDI A;  2O3D A;  2PMW A;  5J2P B;  2CJB A;  5LMU F;  4DV3 J;  2GZO A;  3TAR A;  4WU2 A;  2EFV A;  2AJ1 A;  1I94 F;  4FXV A;  2J9D E;  1D9A A;  3IRW P;  1S6P A;  1QE1 A;  3WHI A;  3L7U A;  4YN3 B;  4GC6 A;  4RJV A;  5T41 A;  1SJR A;  1MN7 A;  1WOS A;  2HVE A;  3FQK A;  2AIR B;  4FNI A;  4IUF A;  4IDK A;  1LW0 A;  4U7U D;  2DXE A;  2MKI A;  1K0V A;  3FDS A;  2VQF F;  3QBC A;  2EBG A;  3PAC A;  2HND B;  3LGM A;  4G1Q B;  2YNI B;  2JC0 A;  2W25 A;  3UNG C;  1FKP A;  1HNX F;  5KFP A;  3V5R A;  2Y1I A;  1FCA A;  3QT8 A;  4ILR A;  3VQT A;  3WZ0 A;  1LWF B;  2WB1 D;  5F0U A;  1NXI A;  4BBY A;  1BMQ B;  2DNN A;  2IRY A;  5B0E A;  3RR8 A;  2R7R A;  3CCT A;  2Z8Q A;  3C6U B;  5B09 A;  2CQH A;  4FP9 A;  3NGK A;  3L09 A;  2YX7 A;  1JXV A;  4M8L A;  1N36 F;  3NS5 A;  2HZA A;  2VC0 A;  4B9N A;  1PYO B;  3DLB A;  4P2X A;  3EGW B;  4RWW A;  3TAN A;  5LJ5 Y;  2D3Z A;  4RW8 A;  1PSD A;  2MYF A;  4ENO A;  3W9J A;  5BYS A;  4WE1 B;  2PI4 A;  3DRR B;  5BJR A;  3BPS P;  2KT3 A;  2JOQ A;  3DOK B;  3UO0 A;  4ZVF A;  1CS4 B;  3G96 A;  1U0H A;  2V4J A;  4EO8 A;  2W2M P;  3KMS A;  4DL3 A;  1M5S A;  2VG5 A;  2BKP A;  2PFF B;  1RU2 A;  2HND A;  3JAM U;  3DNC A;  4DLE A;  3CD7 A;  2ZZN A;  3ZZP A;  1S1U A;  2LXU A;  4OYM A;  5C24 B;  4JV5 J;  1NJW A;  4KV8 A;  1WEX A;  1AB8 A;  1QDU B;  2PDA A;  4NA3 A;  1FER A;  1HMV B;  1V5V A;  1S6P B;  3R27 A;  2H65 B;  2OKQ A;  1QUV A;  1U7L A;  1UEV A;  1NK7 A;  1VC0 A;  4F7V A;  5BYR A;  3T5H A;  3A8J A;  1P9Y A;  2Q3P A;  3TUZ C;  2XS5 A;  2OAU A;  1NKE A;  2IVY A;  3EGV A;  1VRT B;  1TUW A;  2DB1 A;  2XMT A;  1TP7 A;  2YWH A;  3MMC A;  4IG3 B;  5F0W A;  2DK2 A;  5D4N A;  4A8O A;  3KLE B;  2B43 A;  5JJB A;  2DGO A;  3BF4 A;  4BCA A;  3TYT A;  4YB5 A;  5AXN A;  2BZ2 A;  1IR1 A;  4WPA A;  2QFI A;  2DRA A;  4ED6 A;  2XYG B;  2HHH F;  2HPU A;  1GFW B;  1JLC A;  2HS4 A;  1SL1 A;  2FLN A;  4I2P A;  3QJJ A;  3MOZ A;  3I9V 9;  4OJ1 A;  4F4W A;  3IR5 B;  1U8W A;  2HW3 A;  4JYA F;  2DHH A;  1N32 F;  3R5A A;  1S0O A;  4LUB A;  2PI5 A;  1MWZ A;  1S4F A;  3DRY A;  3IBF B;  4QZV B;  4F26 A;  1JLG A;  1LXN A;  3FC9 A;  3ULH A;  2AX1 A;  4EWT A;  5HSP A;  3HUL A;  5DZ7 A;  4KRW A;  1YBT A;  4DQI A;  2OHD A;  4ZCK A;  3AT1 B;  3GIR A;  3FZB A;  2MMY A;  3WC2 A;  1P9Q C;  1C4A A;  2GVD B;  2Y0B B;  2NXE A;  1V6H A;  2XCP A;  4OL8 A;  1K44 A;  2J0Q D;  5ETQ A;  3LTO A;  4CLF A;  5DM7 Q;  2HBR B;  2HFO A;  3RW6 A;  1CC7 A;  3C6T B;  2KG1 A;  3K0J A;  4K50 A;  1U2F A;  1IKX B;  2W8L A;  4KV8 B;  4HH0 A;  1WI8 A;  5A6P A;  1S1X B;  2AEM A;  2GJ2 A;  3QID A;  3VCD A;  2ZH3 A;  2WZ1 A;  5IV4 A;  3JSM B;  1IBL F;  2CQI A;  1DTT A;  4DCO B;  4K0K F;  3OT9 A;  1PG5 B;  1QAY A;  2A18 A;  2KHD A;  5E5N A;  1MRO B;  2N3O A;  1T9U A;  2W4P A;  1U0H B;  4E2F B;  3CWJ A;  2LDY A;  2XSJ A;  3BGO P;  1SIW B;  1XTZ A;  2FY8 A;  3KUG A;  1M1G A;  3IG1 B;  4RW9 B;  4DG1 B;  1VHF A;  2LVW A;  4I1T A;  1TAQ A;  1S9E B;  2IVM A;  4ZPD A;  5AJ3 J;  1FRM A;  3KLI A;  1RBA A;  4H4M A;  1O6X A;  2HHW A;  4URQ U;  3DFE A;  1P1L A;  3RAQ A;  1RKJ A;  2GHV C;  5IWA F;  2GC8 A;  4Q44 A;  3PHE A;  4RNO A;  4FYW B;  2ABY A;  4FF2 A;  3K17 A;  2ZH5 A;  2QRR A;  3NGR A;  3OR2 A;  3HI9 A;  4PWW A;  1HW9 A;  2MQP A;  3T1H F;  4JI0 F;  5D6G A;  1T0T V;  3ZTS A;  1IKY B;  4USW A;  3UDL A;  3DM2 A;  2CRL A;  1Z2L A;  1X5O A;  2CNN B;  2VU5 A;  2PEH A;  2Z56 B;  4TVA B;  9ATC B;  2V63 A;  4ZVU B;  1FRL A;  2B9Y A;  3C14 A;  1KQK A;  1LEO A;  2D9O A;  2JEJ A;  3ENA A;  4DPO A;  1WHV A;  2W01 A;  4OYA A;  2RVJ A;  3LWM A;  3ISZ A;  5CHC B;  1KRP A;  2YWG A;  3QO9 A;  4A8K A;  4YQW A;  3OR2 B;  3QYY A;  4UZB A;  4HYK A;  4OYP A;  4IO9 Q;  2CDR B;  5KFI A;  4U7C A;  1KSP A;  3NOG A;  3H2L A;  4EZ6 A;  1FDB A;  2Q6C A;  2H9Z A;  3EZU A;  5L38 A;  3RRG A;  3UN3 A;  4JI3 J;  3JAM Y;  4ZDN A;  2L48 A;  1J5O A;  2ROG A;  2FQQ B;  2E7X A;  3CDE A;  4OHW A;  4WFB Q;  1B7F A;  2IAJ A;  4M5D B;  1XWL A;  4YR0 A;  2BYC A;  2H1Y A;  4OI4 A;  2BJ1 A;  4KGX B;  4B9U A;  4RNF A;  2ZNY A;  1J5E J;  4UTG A;  9RUB A;  4C98 A;  2IPO B;  4GO7 X;  2F8E X;  2OEM A;  3IS9 B;  3N0V A;  1V3R A;  4RR5 A;  2J8S A;  3PW2 A;  4ECQ A;  2DGS A;  4K4U A;  4TQR A;  3FJ2 A;  4OI3 A;  4YHH F;  3MEE B;  5A2Q U;  2WOM A;  2DCL A;  2FZK B;  2DNY A;  2IBO A;  2WBM A;  4KGK A;  4O3N A;  1S59 A;  1DTT B;  1ZAX A;  3CJS A;  5KFF A;  3HHL C;  3PJ9 A;  3TWZ A;  1KLN A;  3DGV A;  5KFO A;  1U2C A;  4J9N A;  2AHO B;  2Z57 B;  4YFU A;  3GV8 B;  3Q22 A;  3H59 A;  4OYX A;  1RTJ A;  3NY0 A;  4QJV A;  2IRX A;  2YH1 A;  4DQP A;  2POK A;  3MM8 B;  1D09 B;  4LBI A;  3IMQ J;  3JTP A;  5CYQ B;  1UVI A;  3PVX A;  3OFG A;  1N54 B;  4NLV A;  4K5R A;  3R8Y A;  2BOP A;  3KG1 A;  3LP0 B;  1VQM S;  4R5P B;  1VBY A;  1TK0 A;  2EVZ A;  4FPI A;  1QVG R;  3FFI B;  3BPD A;  3UE2 A;  4CLS A;  1HBU B;  1SPB P;  3C6U A;  3TZZ A;  3FVY A;  3VR1 A;  2J9D A;  1VK8 A;  4RBU A;  1PGZ A;  4DCP B;  3PFO A;  4MFB B;  2VOO A;  1CQN A;  4K4T A;  1FKP B;  2HVI A;  3C46 A;  5IQQ A;  1N34 J;  3G8Q A;  3AOB A;  4Y2K A;  5A0Y B;  4I2P B;  3D9B A;  5DM6 Q;  1JLC B;  2DR9 A;  2W7P A;  1RA6 A;  3D7S B;  1NCL A;  1W26 A;  1R27 B;  4DR2 F;  3HK2 A;  3NMR A;  2AJQ A;  1H74 A;  3D28 A;  3OXF A;  3S7R A;  3O3L A;  1PO6 A;  1GXL A;  1QE1 B;  3P45 B;  4RW4 A;  1APS A;  4PPZ A;  3I4P A;  5KFX A;  1HHQ A;  4NCB A;  4LR7 A;  4DR6 J;  1C1B A;  2RIJ A;  2V2V A;  1J2V A;  3LUY A;  2E7W A;  3P5B P;  4FYV B;  5DRK A;  1HNW J;  1QAI A;  3BGL A;  2GV1 A;  5KT6 A;  1WC1 A;  2KT2 A;  4CLK A;  2W9B B;  2UXD J;  5A8W B;  5SUH A;  2BQU A;  2MEW A;  2B6A B;  4ZPV R;  2NUH A;  1YRX A;  1KNZ A;  3CCQ S;  5KFN A;  4RUH A;  1TL3 B;  2E9T A;  4JV5 F;  1ZPW X;  4NLW A;  2YTC A;  2KXF A;  4ZLN A;  2CQG A;  1JLF A;  3HFK A;  3MFI A;  2HK2 A;  1S99 A;  1BLU A;  4ZIW A;  2GVD A;  5F8G A;  1K8A T;  2RRN A;  3PYD A;  1Q53 A;  2JEI A;  2CAJ A;  1RK8 A;  2ERR A;  1T03 A;  3MPU B;  1S1W A;  4CH0 S;  1S1V A;  2HBQ B;  2V2K A;  4O3O A;  3N6M A;  5I3U A;  2I5J B;  2RS8 A;  4KYZ A;  2VH7 A;  1WI6 A;  4WJB A;  5K14 A;  1ZS6 A;  2C2K B;  4ID8 A;  2AYG A;  5HAN A;  4FKX A;  2AEF A;  3K89 A;  2VFR A;  4OX7 A;  1IBM F;  1QJH A;  4CLY A;  4DSL A;  3BQ0 A;  4X66 F;  4QBU A;  1EQM A;  3CJ3 A;  2YKN A;  3PDN A;  6FDR A;  4ELU A;  2V8V A;  3V6H A;  4HH1 A;  4ZLP A;  3NXZ A;  4OHX A;  1HNZ F;  5HAO A;  2KRB A;  4DSI A;  1LWF A;  4H4K C;  2WRM A;  1LNQ A;  5T7L B;  2O67 A;  2VPX B;  2YPY A;  2YKQ A;  3VAK A;  1Z1Z A;  4UY8 T;  1V5I B;  2NZC A;  1RWX B;  2OPP B;  1JB0 C;  1VQ4 S;  4G1Q A;  4NZ0 A;  4Q8F A;  2AV5 A;  3H40 A;  3QJL A;  2V69 A;  5EX0 A;  4B17 A;  2Y8W A;  1JWW A;  3OJU A;  1VRT A;  2G2Y A;  4TU7 A;  4K4V A;  1WC3 A;  2WVD A;  3CDW A;  1SQG A;  1XJW B;  3EJM A;  4Y2M A;  5CYQ A;  5L46 A;  4QW9 A;  2MJN A;  3GCW P;  3JYT A;  4LSN B;  1ZA1 B;  4DN9 A;  1LWX A;  3IO1 A;  4OZJ A;  3ENQ A;  3TZY A;  4LF8 F;  2W2Q P;  3C15 B;  1XR7 A;  3ET6 A;  5CQG A;  3R1L A;  3EDR B;  4EK2 A;  1U47 A;  4B9L A;  5GMK a;  4L72 B;  4M95 A;  1RBO B;  3ZZU A;  4LFC J;  4C3L A;  1JJH A;  5J2Q A;  2QN6 B;  5IOL A;  2QLX A;  3BSA A;  3GMG A;  5CYM B;  3CJK B;  4PEO A;  2HNY B;  2XI2 A;  3DRP A;  1S6O A;  4LF9 F;  4CO2 A;  1FK9 B;  5KFK A;  1U25 A;  3N79 A;  5EWE A;  2MB0 B;  3RB0 A;  2FHK A;  2KVI A;  1IQZ A;  4P2S A;  3CE8 A;  3VAI A;  3M8Z A;  3LP1 A;  3M8Q A;  5KT4 A;  1SC3 B;  1XNR F;  4KO0 B;  4KSE B;  1HR0 J;  2Y8Y A;  2JVR A;  1BHN A;  4UY8 5;  3NNC A;  2BM1 A;  3C3L A;  1WF2 A;  1SH2 A;  4U95 A;  2PA3 A;  3MF5 A;  1WSR A;  3WX4 A;  4ECV A;  5L39 A;  3HHN B;  1P8G A;  2RD5 C;  2KL8 A;  3BQ2 A;  5DGB A;  1B0V A;  1CJK B;  3SQG B;  2ASJ A;  1RHM B;  1YJ7 A;  2DHS A;  2R8G A;  2DNQ A;  4KY3 A;  2DXD A;  5IWA J;  3KMQ A;  4LF6 J;  2ZWO A;  4PQA A;  5F8M A;  2WVB A;  5DZ6 A;  2F1F A;  3KJF B;  4DPW A;  4OI1 A;  3RBE A;  1U6Z A;  1LXJ A;  3C8Y A;  3DC2 A;  2LQB A;  2WHO A;  3QAE A;  4C48 A;  3AAW B;  1MU2 A;  1TUV A;  2H5E A;  2KYZ A;  2XMK A;  4ATN A;  2NPI A;  3HM9 A;  3PG9 A;  1V3S A;  5DLF A;  4UUX A;  1KTQ A;  4I0W A;  1RQ0 A;  3ILJ A;  2B6A A;  3M6W A;  4YB7 A;  2R2R A;  1SC6 A;  2UU9 J;  4IOA Q;  1UWB A;  2F3J A;  3G82 B;  5BYQ A;  4LFB J;  4ZVS B;  4XO0 A;  3TJA A;  5I42 B;  5JUM A;  2HKE A;  2XMA A;  3DYA B;  5I42 A;  2BW2 A;  2RML A;  3VHQ A;  1F2H A;  2HQF A;  2XGQ A;  3SZ2 A;  1L3V A;  5D3G B;  2W9C A;  2AZ3 A;  5K9F A;  2X1A A;  1WSV A;  1WC4 A;  2CPF A;  5J1N A;  1Y5N B;  1KQF B;  1N88 A;  1EX8 A;  2XBP A;  2GA7 A;  5B7W A;  4NZ6 A;  3BJY A;  4NXM J;  2GVZ B;  2B5J A;  3M8R A;  2KKH A;  4LQ9 A;  1Q1K A;  4DQQ A;  1HW8 A;  3BS9 A;  4JI4 F;  3G71 S;  3PX6 A;  2CNO B;  2V4J B;  4LF8 J;  1MSW D;  4IG0 A;  2H51 B;  1FEE A;  1Q4R A;  2XO7 A;  1X9W A;  2QT7 A;  5KFH A;  4K8R A;  2V2Q A;  2DGX A;  4M5K A;  2Z58 B;  3BGU A;  1N52 B;  4WE1 A;  2P9C A;  3KHG A;  1CJK A;  1BXN A;  4P72 A;  2FLL A;  4PXC A;  3MWB A;  3V4I B;  3R2D J;  2DNO A;  1VI7 A;  1GX6 A;  1EKS A;  4FS2 A;  1RLD A;  2VA2 A;  5DG7 A;  4Q0B A;  1IBL J;  2DEJ A;  1TAU A;  1GTE A;  4QIF A;  1VQ6 S;  1VBK A;  4QYZ J;  3OFE A;  2CJ9 A;  4KO0 A;  2GHP A;  1T3O A;  4DR4 J;  4IRD A;  2B4P A;  3G8T A;  5H9F J;  4FF1 A;  2DEI A;  3I6P A;  3DU6 A;  4RNM A;  2CUY A;  1OWX A;  5IFM A;  4ECS A;  1VYA A;  2KO1 A;  1DRZ A;  3HVT B;  4OYO A;  1Q78 A;  4WU3 A;  1RWM B;  1X0P A;  2LU1 A;  1HR0 F;  2CNK B;  5IC6 B;  2HNY A;  3DRP B;  3HSG A;  3MPY A;  4PG4 A;  3EPI A;  5CYM A;  1KD1 T;  2R3V A;  3LPE A;  3T1Y J;  1RWW B;  4DS5 A;  3VTI A;  3OUY A;  3CED A;  4L6V 3;  2XGP A;  2K3I A;  1LW0 B;  5LMN F;  1R8P A;  2F63 A;  5F8L A;  1BD6 A;  4P74 A;  2E9R X;  1PBU A;  3ZNU A;  4OI2 A;  5LSR A;  5GAH I;  1TU0 B;  2K06 A;  1NZA A;  2WW8 A;  2HQG A;  2Z2Y B;  3BB5 A;  3V2U C;  1IJF B;  3M8S A;  3PW5 A;  1IKW B;  3KG4 A;  2V9K A;  4R8U A;  3RRK A;  3THP A;  4ECW A;  2ZBC A;  2A6O A;  3IA0 A;  1BQM B;  1RAG B;  2VFU A;  1JNZ B;  3SBM A;  1JLQ A;  4DXL A;  2KU7 A;  3H98 A;  3GV5 B;  2IVF B;  4AUK A;  4CO3 A;  2KXN B;  4HTJ A;  4MIB A;  3RBD A;  1J5O B;  1JMT A;  3ITH B;  2DNM A;  3KK1 A;  2C2E A;  3GYG A;  2FLO A;  4KKO A;  1RAO A;  2XZW A;  4B02 A;  1K9M T;  4DUY F;  3GYX B;  4NLQ A;  1ULR A;  3BYR A;  4N8N A;  2RAQ A;  5E7O B;  4QYZ K;  2HSE B;  4QU6 A;  3VVU A;  4O3R A;  1JQG A;  1LOU A;  4DF8 A;  2G1H A;  4ED7 A;  4ZP8 A;  1WKL A;  2G0I A;  2PC6 A;  1WF1 A;  2QL9 B;  3MXH P;  1NHV A;  4PG6 A;  4V1A k;  3JSY A;  4XAK A;  3BO2 A;  2B3T B;  3OFH A;  4DEZ A;  2W7A A;  2UXD F;  1VFJ A;  1UFW A;  1PJ5 A;  3BH7 B;  4F3M A;  5GAH U;  1Q82 T;  4AE5 A;  1MML A;  4ZLL A;  1AFI A;  2DH7 A;  1FRX A;  2VB6 A;  2PD1 A;  3CW2 C;  2GMJ A;  4KPC A;  4WFA Q;  4MKA A;  4C0O C;  2F4F A;  2ZVS A;  4ZN1 A;  3I55 S;  3RR7 A;  3EIC A;  4ZJO A;  1RSC A;  4QR2 A;  3ZZR A;  5DDR C;  2GGP A;  1OPI A;  2YQ0 A;  3R9L A;  2N82 B;  2OJ3 A;  5B0G A;  1JLF B;  1VHI A;  2NS1 B;  3Q2S C;  4J7C A;  1SUQ B;  5F8I A;  1A0O B;  3BM7 A;  4OZ3 A;  1SKR A;  4YOE A;  4OV1 A;  3AY0 A;  5K8O A;  2VIC A;  4YHH J;  4Q2L A;  4Y6I A;  4RBV A;  3IXQ A;  2VON A;  2ILZ A;  2H54 B;  2CQP A;  4KHM A;  3B8H A;  2C1E B;  4RNH A;  3IN5 A;  4N76 A;  4Q0B B;  5BR8 J;  4MH8 A;  1B0P A;  2ZDO A;  3ISN C;  2AU0 A;  3AXK A;  1KOO A;  4ZPC A;  1U1K A;  2K2P A;  4P6Q A;  1RT5 A;  1HQU A;  1X31 C;  2XSJ B;  4JP8 A;  4PKD B;  1N5Y B;  2LXF A;  2IM0 A;  2HIQ A;  4OHZ A;  3IR7 B;  4IRK A;  1RTD A;  1W2I A;  2MKY A;  3UNY A;  5DQI A;  1TKX B;  4LSL B;  3SI8 A;  2CQ4 A;  2J9C A;  4AD6 A;  1YIT S;  1NK6 A;  2DT9 A;  1W25 A;  3AHP A;  4OJG A;  5L1L A;  2XLK A;  1Z2Z A;  3KK1 B;  1NAQ A;  1RAD B;  2V5H G;  3M8P A;  2BXJ A;  2EK1 A;  1IWA A;  3OQ2 A;  1Q86 T;  1HHS A;  2FY1 A;  2BW7 A;  3RU0 A;  4A8F A;  1UW4 A;  4DN0 A;  2OEK A;  4YY3 F;  4KHP J;  1HD1 A;  1C0U B;  1WKJ A;  4Y65 A;  1FRK A;  4F02 A;  1K1S A;  1KR4 A;  5C25 B;  2VOD A;  5KFD A;  1KBR A;  4LRB A;  3KYL A;  4LFC F;  2L41 A;  1HBU A;  2IC3 A;  1S9G B;  2MSS A;  1AA1 B;  1EIY B;  3D1Q A;  4H54 A;  3MD3 A;  3QFW A;  4WXO A;  1U1L A;  4DOZ A;  4K4X A;  4LVO P;  1WG5 A;  3T6B A;  1SH3 A;  4DJB A;  3EX7 B;  2R7Q A;  5C2G A;  3THV A;  2ZHA A;  4PPD A;  1LW2 A;  4B9T A;  1VIX A;  2NXC A;  2E1M C;  1R8H A;  3MM5 B;  4HDH A;  4LRE A;  3T5J A;  4ILM A;  1S57 A;  2YQ3 A;  4OZ0 A;  4Z2X A;  3H4D A;  4CTA B;  5K14 B;  3TVY A;  2V4R A;  2C2R A;  2MLY A;  3TA0 A;  3UPF A;  1UKU A;  3JXO A;  5KG5 A;  4KT0 C;  4WFN Q;  3MR2 A;  3SCL E;  5IT4 A;  1UTA A;  3RJM B;  4ED4 A;  2AKW B;  4YP3 A;  3MEE A;  3PKM A;  2FJE B;  2P6S A;  3NG8 A;  4DX6 A;  3MMC B;  4RKU C;  4ZPB A;  2VQE J;  2GIF A;  2RNE A;  3BN4 A;  3DLG A;  3U02 A;  2WON A;  4WZM A;  1DJ0 A;  1SBR A;  1NJX A;  1RWU A;  4NPO A;  1PJ6 A;  2HVZ A;  1HMV A;  2ALZ A;  1RAI B;  2YNG A;  3IBC B;  3W62 A;  4IOB A;  3BSC A;  4PQU B;  1Q7L B;  3ISN D;  4WIQ A;  3AD7 C;  2OGU A;  1NJI T;  4ZJQ A;  3IWX A;  2QLB B;  4X4P A;  3GV7 B;  4FDF A;  2E5H A;  3BGR B;  4I64 A;  2E1C A;  1KVI A;  1UFK A;  3KLH B;  1C1B B;  1UCN A;  5D0R A;  4JUZ A;  2NCK L;  1MN9 A;  1YZ6 A;  2R7S A;  1ZH5 A;  4WWS A;  1ZM4 A;  5I3P A;  4C8Z A;  1VIS A;  4NLT A;  1JJC B;  3L9Z A;  4ES3 A;  4JI7 F;  1T05 B;  1S6U A;  1SIZ A;  3G8S A;  4IR9 A;  5F8N A;  4FF3 A;  2ZOG A;  2MQO A;  5KFG A;  4CO5 A;  1U1N A;  2UUA J;  1N5S A;  2BJ9 A;  2OI2 A;  2GML A;  2YVS A;  4L73 A;  3DDN A;  2HFN A;  4FVC A;  5EN1 A;  3ZTO A;  2WK4 A;  4WKY A;  4J9L A;  3J81 U;  1Q5V A;  3CB4 A;  3OL7 A;  1FKO B;  5IM0 A;  2AX0 A;  4IKA A;  1UVJ A;  1D3W A;  1YJN S;  4FNH A;  3K5M A;  2MST A;  3AJ2 A;  3OV7 A;  1RCO B;  2AJ4 A;  3M05 A;  3E01 A;  3RUB L;  3DLE A;  4NEZ A;  2M8H A;  1YKW A;  3FFI A;  4PZV A;  1CBK A;  3GFY A;  3TVZ A;  4P10 A;  3GSI A;  5KFA A;  4YS2 A;  4C2M A;  1S6Q B;  2W24 A;  3GR0 A;  4PYD A;  3MUT P;  1W2B R;  1S12 A;  1GNK A;  3H5S A;  2RQ4 A;  3J7Z T;  2XMJ A;  4KGM A;  1AZS A;  3P49 B;  4FS1 A;  5F41 A;  5IT9 U;  4RW9 A;  4E0D A;  2J7U A;  5MAO A;  1L5U A;  3NOC A;  1RIS A;  2FVC A;  4DR7 J;  2RKI B;  3H5Y A;  3NNA A;  2AQ4 A;  1JLB B;  2ZIT A;  2V9W A;  1NEE A;  2FZG B;  2G4B A;  2KJV A;  2EFQ A;  3UDC A;  2Z2M A;  4K4Z A;  2M2B A;  4LVN P;  3JSM A;  3CUL A;  1NLK L;  2AGP A;  1S1X A;  4Z7C A;  3M30 A;  1Q79 A;  3J81 Y;  3Q8R B;  1ACM B;  1VQL S;  3NL0 A;  2B4U A;  5G0R B;  3MMA B;  3SSS A;  2NPF A;  2VKZ G;  2C22 A;  4PWD A;  1NBE B;  2BAN A;  1EQ0 A;  2Y9H A;  1R0B G;  3P6Y C;  1YBA A;  2W9B A;  2ZJR Q;  3RB6 A;  4HHH A;  2ZM6 J;  3DLG B;  2FJX A;  4N77 A;  1NK5 A;  1BUX A;  5LXR A;  1MNE A;  3Q8Y A;  1RWK B;  2C3P A;  2FVR A;  4O0N A;  4B9S A;  1K1Q A;  4Y28 C;  3J7A 1;  1TL7 A;  3H7H B;  5A8K B;  2FJW A;  4L76 A;  1WOO A;  2ZH4 A;  1FXD A;  1OO0 B;  3H4B A;  1HBM B;  5G4D A;  4ALZ A;  3GIL A;  2HS3 A;  3W64 A;  4DV5 J;  3VV2 B;  4M5H A;  2X3D A;  4ZVE A;  2NSC A;  3MM6 B;  1EAY C;  1U1Q A;  2G9O A;  4BHQ A;  3WIV A;  4NRU A;  4DL2 A;  1HI8 A;  1ZET A;  4OYW A;  4LFB F;  3CCZ A;  4W4M A;  1CQM A;  3JSR A;  1YK9 A;  2YX4 A;  4ETZ A;  4F50 A;  1QD1 A;  4ZVH A;  5CCM A;  3EVM A;  2HHH J;  2HMI B;  1XNQ F;  2F8M A;  5KG7 A;  5L8R C;  3LAL A;  4WFX A;  3MM9 A;  4DSK A;  1HL6 A;  2L08 A;  4USI A;  4DX8 H;  4JI2 F;  5HMY A;  1D8Y A;  1A6L A;  2DNP A;  3FBC A;  2QYC A;  1IKY A;  2OPR B;  1U09 A;  1FRH A;  1Y5I B;  3IBW A;  4IO1 A;  3W63 A;  1VOM A;  3L3C A;  2NXN A;  1H72 C;  1B7Y B;  1ZM9 A;  2G0C A;  3CMQ A;  4XK8 C;  3PYF A;  4IG3 A;  5KFS A;  1NKC A;  1IBK J;  3L7P A;  1NSA A;  3AD9 C;  2JX2 A;  5HRO B;  4ZPA A;  4R5P A;  4X4N A;  4ES1 A;  3OVS A;  2VUG A;  1YGY A;  3M7V A;  4J9Q A;  2R8K A;  3G4S S;  2ZKT A;  4KR0 B;  1N5Q A;  1FNX H;  3W2W A;  4JI1 F;  2F4V F;  3M2V B;  3Q86 A;  4ICL A;  2BAB A;  3W8G A;  1R7I A;  2KVQ E;  5E3C A;  4X64 J;  1IM6 A;  3GON A;  4AXI A;  2LA6 A;  3R7B B;  5CH7 B;  1S9E A;  3C16 A;  3GIK A;  1HIY A;  4RL1 A;  3G6X A;  2J6S A;  2ZOM A;  4I68 A;  4OFZ A;  2CPI A;  1WG4 A;  2UUB F;  1XBW A;  2C2N A;  3QZ7 A;  4TLQ A;  2RUS A;  2WOM B;  4P73 A;  4UQG A;  3J7Y I;  3CJT A;  3G6V A;  1FWK A;  3IWL A;  1GQE A;  1B64 A;  1YJV A;  3HHL D;  4M63 A;  1JLA A;  2VG6 A;  3IM8 A;  3U1L A;  3U1M A;  4I4B A;  2VKR A;  3PKY A;  2KFZ A;  1X7V A;  2EPI A;  2YKA A;  4RW8 B;  2QLJ B;  2C2M B;  3QT5 A;  2V4Q A;  4C7Q A;  4R25 A;  3TX8 A;  5CCL A;  2QFJ A;  3HLU A;  1N33 F;  4WYW A;  1FTC A;  1IKX A;  5LSL A;  2IA6 A;  3DRX A;  3PRD A;  3T1Y F;  3AB2 B;  3NLC A;  2ZH6 A;  3S6E A;  4DSE A;  2O01 C;  3H42 A;  3ILO A;  5EUH A;  3KJV A;  1OY8 A;  1XK8 A;  4OQJ A;  3JQK A;  1JIH A;  3SSR A;  4NLY A;  1JJ2 R;  1P6T A;  3HHL B;  1YVF A;  1NDC A;  3I31 A;  1JKH A;  3L4B C;  4USK A;  3RRH A;  1ZYQ A;  2PN6 A;  1NZ8 A;  4UF4 A;  2DY9 A;  4I67 A;  2DBB A;  3NEK A;  4OMF G;  1R8B A;  1RE1 B;  2BKO A;  2CQ3 A;  3DN9 A;  3J7A N;  2ZH7 A;  3OL9 A;  3QJP A;  3I0S B;  2DNK A;  1K47 A;  1G6B A;  2QIF A;  3W2V B;  3D68 A;  2JLE A;  3MPV A;  4U9R A;  4DBQ A;  3CDA A;  2W1B A;  5DQG A;  3E2E A;  2PGC A;  1U1P A;  1U24 A;  3NAI A;  2DNG A;  1JK9 B;  2HNZ A;  4PAB A;  4UQT A;  4AXJ A;  1SJ4 P;  3B4D A;  3Q2T C;  1HWJ A;  1S0V A;  4PR6 A;  2ATL A;  4F4K A;  1HYS B;  3TVK A;  2CPY A;  3MEG B;  3TRG A;  1EP4 A;  4CYU B;  2YWF A;  2HHP A;  1CJT B;  1IM4 A;  2AT1 B;  5L1K A;  3PYG A;  2HWH A;  4OHY A;  4CM0 A;  1WHX A;  2YKM A;  3MCO A;  4U8V A;  4C3K A;  2W8K A;  3CUN A;  4LF4 F;  4PUO B;  1M90 T;  3AQO A;  4EBD A;  1SCJ B;  2P9E A;  4K59 A;  2YBV A;  4J9U E;  2N4C A;  2HAI A;  3GR1 A;  4U7U K;  3OXG A;  1JKH B;  2E66 A;  1OYD A;  3VGT A;  4DG1 A;  2N3L A;  2UXC J;  3W1Y C;  5KFT A;  1T3N A;  5AXL A;  5LM7 E;  1VQ7 S;  1YJ9 S;  1RHR B;  5EX3 A;  3G87 A;  1KLM A;  3FEY B;  1RTZ A;  4H4O A;  4ZN3 A;  4N56 A;  1RXO B;  1J5E F;  4K4S A;  5C24 A;  3OL8 A;  3JQJ A;  3HD2 A;  4ES2 A;  2D41 A;  1MRO A;  5LJ3 Y;  2MTL A;  6AT1 B;  3VGV A;  4TQS A;  1T7P A;  1S7H A;  2A0F B;  4LT6 A;  2DHG A;  5F3Z A;  4DV1 J;  4RU2 A;  1CLF A;  1Y10 A;  3RBX A;  2J6U A;  5BR8 F;  1RT3 B;  2FHJ D;  1H7X A;  5EWF A;  1I1G A;  3DOK A;  3EE3 A;  4GO5 X;  4I2Q B;  4X4U A;  1SH0 A;  4OJ3 A;  2AZ1 A;  1TV6 B;  4MTP A;  5LXY A;  2RT3 A;  3C6T A;  4OYI A;  2GQQ A;  5LT5 A;  3MD1 A;  2BQR A;  4LR8 A;  2GAH C;  1WHW A;  3NBP A;  3I82 A;  3O6Q A;  4DZD A;  2DR5 A;  3G86 A;  1QTM A;  3W8P A;  2J6T A;  4JI5 J;  2ZUG A;  1MMN A;  3SEO A;  5CAB A;  1TKD A;  4CNY A;  4C0B A;  1RT6 B;  1Y9O A;  1NH8 A;  2XMW A;  4V19 X;  4F3O A;  1FD2 A;  2M3D A;  1O0P A;  3H8Y A;  3U7J A;  3LOU A;  4LR9 A;  3CJ0 A;  4HEA 9;  4WP3 A;  4CM2 A;  3HVR A;  1SI9 A;  3M2V A;  3HZE A;  5C2C A;  4BC9 A;  3P4U B;  1X4C A;  1E6V A;  2JSX A;  1TFY A;  2GJI A;  2OPQ A;  4USM A;  3BSO A;  1HBO A;  4QWE A;  1FHT A;  2B5J B;  2CFX A;  1FVS A;  1UJ4 A;  3NRB A;  4I7F B;  1S79 A;  2QA2 A;  2F40 A;  3HXM A;  2DR8 A;  3R5C A;  1G2E A;  3RB3 A;  1RWV B;  2H48 B;  2B56 A;  2DKO B;  2MKS A;  3KNG A;  2BX6 A;  4IDK B;  4QIV A;  4RBT A;  2E1A A;  2I8E A;  4MK9 A;  4A47 A;  4CNZ A;  1WC5 A;  4J9P A;  2UVU A;  2IYI A;  2OSR A;  3CIZ A;  3R5B A;  4C8O A;  4YUD A;  3HT3 A;  4B3O A;  3PX4 A;  1I3O B;  4DV3 F;  4B3T J;  2BJ7 A;  2MKC A;  3Q24 A;  4C8L A;  2HQC A;  1IQT A;  1I6J A;  1ZAV A;  4G1P A;  3R1H A;  2I0X A;  2Y1L B;  1UVN A;  4ZP9 A;  1UJ5 A;  3R2C J;  3MOJ B;  1OSD A;  4NCA A;  2EG2 A;  2R42 A;  1F6T A;  4G3I A;  3HSJ A;  2MZJ A;  3OTE A;  2ZD1 A;  3CD5 A;  3PZP A;  2HBY B;  5CZV A;  4USH A;  1UWA A;  4ZA1 A;  3UFC X;  2YKP A;  4F67 A;  3HHD A;  1TMJ A;  1Q8B A;  1F5B A;  1REG X;  5E3P A;  3RW7 A;  5E2Q A;  1O8B A;  4CH1 A;  1KC8 T;  4K4W A;  2IDE A;  3UVJ B;  4NMX A;  2DNL A;  3DI6 A;  3Q89 A;  4EMD A;  4WZQ A;  2L9D A;  1HNV A;  2M9K A;  3QMQ A;  1WOP A;  4NYP A;  3HPO A;  5K8P A;  3MDF A;  4QQB A;  3GII A;  3MTJ A;  4ED1 A;  4Y3C A;  5JVG Q;  2DR7 A;  2R7X A;  2CVE A;  3P5T L;  4J37 A;  1FF2 A;  3S1T A;  3W60 A;  1FWL A;  1H7W A;  2HWI A;  4ZS6 A;  4N47 A;  3T6J A;  3PJW A;  4A46 A;  4URG A;  4G65 A;  5GME A;  4CO1 A;  1FVQ A;  5C5J A;  2GNK A;  4HT5 A;  1PC5 A;  4WKR A;  4WTO B;  4OX8 A;  1FJ7 A;  4I56 A;  5HMZ A;  2RKI A;  3PO4 A;  4IQM A;  3DMJ B;  4OJH A;  2ZJQ Q;  3QGI A;  4DHV A;  4J9M A;  1RKI A;  2IBK A;  1VQN S;  1RDR A;  4OHV A;  3SV3 A;  1E6Y A;  2X3G A;  2CQ2 A;  3UD3 P;  3FNN A;  4MT1 A;  4JI3 F;  1XNQ J;  2XHC A;  2ZBR A;  4C8N A;  1VBX A;  1FES A;  4O0I A;  4J9V A;  1TKZ A;  4QR1 A;  4QW8 A;  3KNA A;  2MGZ B;  2FJB B;  5GAD I;  2LYV A;  2R2U A;  1I94 J;  2R7T A;  3SCI E;  3JSB A;  3CCR S;  2LQ8 A;  2KFN A;  5CZX A;  1T02 A;  3FSY A;  2EKN A;  4DL7 A;  2GO8 A;  4QWC A;  3C15 A;  3ET6 B;  4FKY A;  4HTI A;  4ETX A;  2DVI A;  3GZ7 A;  4LRA A;  3MMB A;  2AYE A;  5J2P A;  1UP1 A;  3LAM A;  3MR7 A;  1U26 A;  1FKA F;  3U27 A;  2B8P A;  4IH5 A;  1LWC B;  4S0M A;  2W2O P;  2JWN A;  2RQC A;  4MIW A;  2XMV A;  3WBZ A;  1TVR A;  4RUC A;  2PO4 A;  3FEZ A;  3MAA A;  5KFR A;  4J5O A;  4DDF A;  1B0T A;  2B4O A;  2HG4 A;  2CG4 A;  4U67 Q;  1SL0 A;  5E33 A;  4K4Y A;  3D5M A;  3LH2 S;  3NGT A;  1WDD A;  4OX6 A;  1HBN B;  3PJX A;  2EC0 A;  1NU4 A;  1U2R A;  2JFD A;  2M88 A;  4CLT A;  1S97 A;  2XQC A;  2ZH8 A;  2H4W B;  5IXU A;  2ZBQ A;  4DLG A;  2FIU A;  1LK7 A;  2IFX A;  3CC2 S;  1VQY A;  1UA1 A;  3SV4 A;  1XNR J;  1V9O A;  3B54 A;  3QRR A;  5SZT A;  4F36 A;  3HCX A;  2XC9 A;  1XMQ F;  1DTQ B;  3TQ1 A;  1RT1 A;  2YNG B;  3DDK A;  3CO0 P;  1F9E B;  1H2V Z;  1S1W B;  2JLF A;  4Q7A A;  4GVL A;  1R8A A;  1T03 B;  5GVQ A;  2QLW A;  1VQK S;  2D69 A;  1ZOT A;  2FUG 9;  4ED3 A;  5DS7 A;  4IFY A;  5HQM A;  2DIV A;  4LJM A;  3IGN A;  1FJG J;  1TKT B;  4RW6 A;  3TNV A;  4LRC A;  1T9X A;  1CUL B;  1DBD A;  3QIP A;  4Z7Y A;  5HP1 B;  2X1F A;  5AJ3 F;  4RUB A;  4WCE Q;  5J1P A;  1UPM B;  5ADZ A;  2CAD A;  2RB7 A;  4HLB A;  3OTO F;  3KK2 B;  4KB7 A;  1R0A B;  2XYH B;  5F8H A;  4HDG A;  3GB0 A;  2W4C A;  4DV5 F;  4CTA A;  3V6J A;  4DR7 F;  2EC2 A;  3TAM A;  3JTN A;  3OD2 A;  2LU2 A;  2GIQ A;  2V67 A;  1RA7 A;  1O51 A;  1XN9 A;  4K7Q A;  2CQB A;  2HQD A;  1C1C B;  4OZ5 A;  4DPY A;  4ECT A;  3P3D A;  1FJE B;  1G3O A;  1IKV A;  1CJU A;  1DLO A;  4W98 A;  1YDL A;  2CNL B;  4P2F A;  5DG8 A;  1HHT P;  3J81 j;  3J7Z 5;  1OS5 A;  4DL4 A;  5LL6 d;  2XY5 A;  1B4S A;  3OFF A;  4DR5 J;  3FRZ A;  3QSI A;  1REV B;  4DPT A;  3AXM A;  1KEK A;  4YB1 P;  4IQX A;  2RF2 A;  3MHY A;  3ZNJ 1;  5HBM B;  5L9X A;  2IM3 A;  1QAX A;  1PYT A;  1FEH A;  3W3S A;  3B6B A;  3VGU A;  3W5Y A;  1CPZ A;  2K3K A;  3RBZ A;  3FSX A;  3I0R B;  4XDC A;  4YEA A;  1SJ3 P;  3KTQ A;  4ZOS A;  2QEX S;  4JI4 J;  1VC5 A;  2MZQ A;  2YWW A;  3GJS B;  2ADC A;  2RF2 B;  2FD2 A;  3GYN A;  2MZT A;  3EYZ A;  4OYZ A;  4WXW A;  2O5D A;  3IC1 A;  1EET B;  4I7F A;  2Z4P A;  3ENW A;  5KFB A;  1FRJ A;  3C66 A;  4EYI B;  1XMO F;  4N7T A;  4FVM A;  4QIW D;  1U4B A;  1U49 A;  2VL1 A;  2DCU B;  5A6W A;  1I5O B;  3GTY X;  1X5T A;  4HAC B;  1L3U A;  1WG1 A;  3Q8P B;  1D9F A;  3GE9 A;  2NZ4 A;  2YNH B;  4ECY A;  1OMS A;  2C2Z B;  1RT7 B;  4IFV B;  3PW7 A;  1ZA2 B;  1HQE B;  4KGV B;  4DF4 A;  2B7B B;  2CPX A;  1WTF A;  2JC1 A;  4NML A;  4O44 A;  2FVQ A;  1DFD A;  2QMW A;  2YWE A;  4Y2I A;  1IBK F;  2CQD A;  3TUI C;  3ZZT A;  1TL4 A;  1FWP A;  3RG6 A;  2CJY B;  5E41 A;  5L1I A;  3V4M A;  3OW2 R;  2YXL A;  2BE2 B;  2OMO A;  3HKW A;  3WC0 A;  2DGV A;  1NDL A;  1VIO A;  3QNW B;  4XPE A;  1P1T A;  4ED8 A;  2BQ3 A;  1L3S A;  2GMH A;  4Q8E A;  1UMJ A;  3HHK A;  1FX2 A;  2HIY A;  3IS9 A;  4I2Q A;  2ZEJ A;  3HP6 A;  1HPZ B;  2P8I A;  4QOT A;  4QPT A;  4HI2 A;  4WK1 A;  2KDO A;  3KK3 A;  4RPF A;  1PC4 A;  1QY7 A;  1QSL A;  4UOF A;  4P9S A;  5F8J A;  1NK8 A;  4LF9 J;  5K8M A;  4ZCL A;  2ZFH A;  1HI1 A;  4F2S A;  4Q43 A;  2B51 A;  2FVP A;  3O5T B;  2J0W A;  1SJF A;  2K7J A;  3HX9 A;  3GWC A;  2IMW P;  2MQM A;  5B0A A;  4DS4 A;  1DAR A;  4RW7 B;  4C97 A;  2CQC A;  3H90 A;  4B3T F;  2XLJ A;  2BA9 A;  3QGH A;  1VK3 A;  1NHU A;  2BV3 A;  2QLF B;  2UV8 A;  2W7O A;  3VAM A;  4CLP A;  4OIX A;  5CA5 A;  3C14 B;  2ZVI A;  2FYX A;  1H3D A;  4WP9 A;  3T41 A;  4LMZ A;  3POT A;  2W4D A;  2DYA A;  2HFV A;  3BGF A;  2MQQ A;  3QZ8 A;  5ETS A;  2LLZ A;  3MM7 B;  4LF4 J;  3MI7 X;  2GS8 A;  2J7W A;  3H5X A;  4DL5 A;  1NME B;  1YJT A;  3D67 A;  5HLF A;  2AYB A;  1Y00 A;  2PSZ A;  4M5N A;  1HPZ A;  3SIP B;  3GG0 A;  3I32 A;  3GU0 A;  4BLG A;  3GIM A;  3VAH A;  4DV7 F;  3M8Y A;  1RT4 B;  1RTH B;  3OXL A;  3TR5 A;  1C2P A;  3BR9 A;  1OIA A;  2BE9 B;  2WVF A;  1GK8 A;  1SV5 B;  2CDQ A;  2HLT A;  2OFH X;  3HJF A;  2FZC B;  3WX8 A;  3ETO A;  1C0T B;  4DR2 J;  3TZW A;  1U45 A;  1H0H B;  2EFG A;  2Z30 B;  2MJU A;  2I38 A;  4DWI A;  3L7O A;  2FHM A;  3RAX A;  2JEG A;  1NSP A;  3HFV A;  1HQ2 A;  2CPD A;  2XNQ A;  3W7B A;  2Q66 A;  4XDD A;  5FLX Y;  2ROP A;  5HMW A;  3KKF A;  4DV1 F;  2BMB A;  3VAJ A;  2AJ0 A;  4FF4 A;  3NNH A;  1KVJ A;  3HVT A;  2HEK A;  1D0E A;  3KUE A;  5KFW A;  4O3S A;  1M0S A;  2WB4 A;  2VHG A;  2RDD A;  3CC7 S;  3QLH B;  1ZPV A;  3NBP B;  4YR2 A;  4WP8 A;  3KDO A;  2FJV A;  2XHW A;  4ZMM A;  1DHM A;  3M2U A;  4KGZ B;  3M2R B;  3LO3 A;  3MFH A;  3O8W A;  2H4Y B;  2I1R A;  2GJF A;  2HS0 A;  3BBF A;  3DDI A;  4UW2 A;  4RUA A;  1UVK A;  3MED A;  4F04 B;  3PEJ A;  4NXM F;  3A8I A;  4CQ1 A;  4CI0 B;  2ZE2 A;  4B3R F;  2PFD A;  4EZ9 A;  2RRB A;  2YWK A;  2CJX B;  3I0R A;  2CPJ A;  5J2M B;  5MLC V;  3ILL A;  3I96 A;  4WF9 Q;  1SB6 A;  4X62 F;  1JLE A;  2UV8 G;  4QIG A;  2OD4 A;  3V6D A;  3GSD A;  1GH8 A;  4O3P A;  3DOL A;  4DUT A;  2GVZ A;  4TYB A;  2AYM A;  2YPZ A;  3PFE A;  2AMC B;  3TUJ C;  3C2P A;  4DPU A;  2W2P P;  4X66 J;  2ZH1 A;  4X4Q A;  4WFY A;  3MR3 A;  1X5S A;  1U48 A;  2NLW A;  1PJ7 A;  2Q79 A;  4XPC A;  3Q23 A;  3BO3 A;  2QO3 A;  4ED0 A;  2UUT A;  3DYA A;  4KQZ A;  4IH7 A;  1N0U A;  2KH9 A;  2E5J A;  3MEG A;  4MMO A;  5D0E A;  1C1C A;  3K5O A;  4TYA A;  4CZC A;  4TU9 A;  4KBI A;  1KS2 A;  3TAM B;  2AW0 A;  2EFP A;  5HK4 A;  4DQR A;  1V3Z A;  3HVW A;  3PTW A;  2BDP A;  1PIL A;  3FBB A;  3MM7 A;  3QFH A;  4NLP A;  5KOX A;  3K58 A;  3T5L A;  3QRQ A;  1AW0 A;  1X4A A;  2KZZ A;  3V6K A;  4DV2 J;  3QIP B;  3N4W A;  2QA4 S;  5HP1 A;  1NDK A;  3LQV A;  4O4G A;  3PX0 A;  2M5Y A;  1E6V B;  2QMX A;  2P2C B;  2VDH A;  3EDQ B;  3QGP A;  4R0E A;  5HJX A;  2JLG A;  2NRE A;  3QWP A;  4LFA F;  1FJG F;  1CJV A;  2E7V A;  3ICL A;  3DRS B;  5D4P A;  2CZV C;  4PCQ A;  3IFE A;  1GXU A;  2BEF A;  3D0G E;  1VRU A;  2DHA A;  3OTC A;  4NOH A;  1NDP A;  3PR5 B;  3OVB A;  3SQO P;  2UUW A;  3KUH A;  3LGN A;  3KK3 B;  1L3K A;  1HI0 P;  3NGD A;  3ADA C;  3TZX A;  2HHS A;  1VQ5 S;  4Y0F A;  4L74 A;  2BRK A;  1GMW D;  3QWU A;  2M7S A;  3DRR A;  4G6V B;  3SFU A;  3UDE A;  1URN A;  1RT3 A;  1N33 J;  3CDU A;  4RNN A;  2DR6 A;  3MAA B;  3W65 A;  1T9V A;  4F3Q A;  1LWC A;  4C11 B;  2BAC A;  3A8K A;  2W2N P;  3D6F B;  3IRX A;  4KH0 B;  4MIA A;  4OV6 A;  2KJW A;  3M9O B;  2UU9 F;  1RT2 A;  3SXL A;  4UUW A;  4MK8 A;  3CT9 A;  1DY3 A;  1NK9 A;  1WF0 A;  2GHW A;  2UUC F;  4L75 A;  1RHK B;  3ZZO A;  3M1V B;  4CLL A;  1LQ9 A;  3T1A A;  3BDE A;  1TL1 A;  4WTY A;  2B4V A;  4Q2M A;  5D0H A;  4J9K A;  4X62 J;  3ILI A;  3SYZ A;  4DFK A;  5KT2 A;  3PV8 A;  4ELV A;  4FYX B;  2EW9 A;  2YNI A;  3A3P B;  5HRO A;  2MGZ A;  2FDN A;  4EYH B;  1TKZ B;  1KHW A;  4F25 A;  2ACM A;  1UZH A;  3SMZ A;  1JX4 A;  3R3T A;  2VPZ B;  3BKF A;  2H3E B;  2OPR A;  2K1R A;  2VFT A;  4I6W A;  4MJK A;  2UZA A;  5F3T A;  4CYU A;  4HKQ A;  2J76 E;  2ASD A;  1XMO J;  2NQP A;  3DMJ A;  2VIH A;  3A8E A;  3KLV A;  4KH1 B;  2VA3 A;  1QTN B;  4U6P A;  3GFX A;  3HHE A;  2XTJ P;  2ZHB A;  1HWK A;  2YNF A;  2BUN A;  4OZ1 A;  5HAT A;  4JV0 A;  4F4A A;  7FDR A;  1NSQ A;  1VR6 A;  1D8Z A;  3NCQ A;  2LKZ A;  1RHJ B;  3MEC B;  5ETV A;  1HLW A;  2IY5 B;  1KWM A;  2VQF J;  5LOQ A;  4E98 A;  4C8Y A;  1QUP A;  3G6E S;  4TNO A;  3TI0 A;  1N6Q B;  1UET A;  2YKO A;  4DR4 F;  3HSZ A;  4Z37 A;  4ANE A;  2LA4 A;  3DOM A;  4XIU A;  3UR0 A;  2F9J A;  4UT4 A;  5H9E K;  2DNR A;  3UDV A;  4ANC A;  2UXB F;  1QAJ A;  4ED2 A;  3RAM A;  3KFW X;  3CTR A;  4P7V A;  3R7N B;  3D66 A;  3CJ2 A;  1TL3 A;  2ZM6 F;  2DGQ A;  4TY8 A;  5KG2 A;  2XWX A;  2ZD1 B;  3J7Y U;  1RTI A;  3DLK A;  1GTH A;  1UPP A;  2WTF A;  1B3T A;  2GCF A;  1BQN B;  1WHY A;  1NND A;  2ZJP Q;  4DX5 A;  4MKB A;  3F44 A;  1JLA B;  3HDS A;  1TKT A;  4JI6 J;  4PYA A;  2PE8 A;  1KHV A;  2HUR A;  4PG7 A;  4QCL A;  2RU9 A;  4KFB B;  5A8R B;  4B3O B;  1AYE A;  4OYB A;  1LWE A;  2CZ9 A;  2A2D A;  1UZD A;  3M32 A;  3QT7 A;  4ZVG A;  4EGL A;  4NXN J;  3MMJ A;  3NKY A;  3ZZ0 A;  2XI3 A;  5DO2 A;  3K57 A;  4OI0 A;  3RB4 A;  3LGH A;  5LMN J;  2KI2 A;  2DGU A;  3MM5 A;  1S10 A;  4ECU A;  1IJE B;  5H9E J;  3I87 A;  3GLJ A;  3TA1 A;  5C42 B;  1X4B A;  3X3U A;  2O66 A;  4YB6 A;  5DQH A;  3T9Z A;  1M5K C;  2BJ3 A;  3OR1 B;  1XMB A;  4O3Q A;  3CCS S;  4M94 A;  3EZO A;  4MFB A;  3T19 A;  5IT9 Y;  6FD1 A;  1F5A A;  1F1B B;  2VBY A;  2GQ2 A;  3K5N A;  4A8S A;  5EGY A;  2DTJ A;  3MUR P;  1RT2 B;  3G6Y A;  5KFU A;  2UVR A;  3HD1 A;  2IA0 A;  4K5S A;  2G13 A;  1VLY A;  3F41 A;  3KHL A;  4CRJ A;  1R31 A;  3POT B;  3FMW A;  1XIQ A;  5M2R A;  2WSE C;  1FNO A;  3LAK A;  3MM9 B;  2X51 A;  2CG8 A;  1U0S A;  1VQ8 S;  2VG7 A;  3PXG a;  1PIE A;  2OPS A;  4FXW A;  3BZQ A;  1EB0 A;  1ZTT A;  2FGC A;  3M6X A;  1D1U A;  2BVZ A;  2K8G A;  3MM8 A;  3TEH B;  2RRA A;  2ATC B;  1YJU A;  4GKK F;  2ZE2 B;  1RTJ B;  4QYR A;  5U47 A;  1KON A;  2QG9 B;  4LF2 A;  1RHU B;  1RTI B;  1X4H A;  3DLK B;  3R5D A;  4IR1 A;  1N32 J;  3H5U A;  4Y00 A;  2QZ8 A;  3E8O A;  4ZVT B;  1K73 T;  2B7C B;  1D9D A;  4BWJ A;  3ZFV A;  1HBM A;  2OFG X;  3CJ5 A;  3M2R A;  3EPG A;  2DY1 A;  4ZIV A;  1YWX A;  1FXR A;  5ETP A;  2ALY B;  1NK4 A;  4EO6 A;  1TUG B;  2MHN A;  2MLZ A;  5ETM A;  2CJK A;  2HHX A;  2RQM A;  2QX0 A;  2ZKU A;  1F3V A;  1VQP S;  3B78 A;  3DOM B;  1RT5 B;  1N5Y A;  3Q8S B;  3CF5 Q;  3HVA A;  2XY6 A;  4QU7 A;  2VFS A;  5B0F A;  1M5V C;  4X4T A;  5G0R A;  2EFN A;  4KAI A;  4ZHR B;  5DDO C;  3MEC A;  2AWZ A;  1IR2 A;  4PUO A;  4X4R A;  2PII A;  1YG0 A;  1XR5 A;  1F9F A;  3OLA A;  2LQJ A;  2CJQ A;  1RU1 A;  2FC9 A;  3QAU A;  4DV6 F;  3THT A;  1F60 B;  1F0X A;  4AQY J;  3AQP A;  1NB2 A;  2VPW B;  4IFY B;  4ZPW R;  2UP1 A;  1HYS A;  4IFV A;  4NI2 A;  1I51 B;  3S8S A;  4X4V A;  1NO8 A;  4G1I A;  4DV4 J;  1GMV A;  3VWS A;  5GAE U;  3G2X A;  3BO4 A;  4DR1 J;  2AGO A;  4NLG A;  1BC6 A;  2VBZ A;  3UQS A;  4OZN A;  8AT1 B;  5KFE A;  4PAA A;  1YRU A;  1R43 A;  3IP0 A;  5B0D A;  2E1P A;  1ZM3 A;  3I0S A;  4HI1 A;  5JVH Q;  2HZV A;  1F3F A;  2DIT A;  4NL5 A;  5A76 A;  4QPX A;  2D9P A;  4RLE A;  2XZT B;  5ETK A;  2MY8 A;  2XB2 D;  4KC5 A;  2LQ5 A;  2VZ9 A;  3B82 A;  3H2V E;  2CPE A;  3I9Z A;  5FDL A;  2J7K A;  2E5I A;  1X4E A;  2IM2 A;  3OBI A;  1U8S A;  4ZIT A;  3V6D B;  1FKO A;  5IM0 B;  2C3M A;  1JXL A;  4C4W A;  1YSJ A;  2M52 A;  2A2C A;  2C3Y A;  3T1H J;  1BGX T;  4TY9 A;  3V81 A;  1S77 D;  5J2M A;  1TQL A;  1VDH A;  2MKK A;  2R8H A;  3HT0 A;  2QL7 B;  5HQL A;  2QSW A;  3KLI B;  4BC7 A;  4EFA C;  2DGT A;  1HNI A;  4H4K A;  4WFZ A;  3OHA A;  2F9D A;  5GAE I;  2BJD A;  3M8P B;  4HHU A;  2IIH A;  4PWU A;  3SCK E;  5KG0 A;  3ZC4 A;  4R8U B;  2IM1 A;  1WKK A;  3M9N B;  4DSF A;  1WC6 A;  2OO4 A;  3O1L A;  2E5G A;  1JJ4 A;  2Y0S D;  1Y7P A;  3CJ8 A;  5FII A;  4DFJ A;  4C0H A;  4MKY A;  4URS A;  1RLC L;  1OJ4 A;  1RUS A;  1TL5 A;  1TZ0 A;  2B9W A;  2JH3 A;  1IXK A;  3FRY A;  4M5L A;  3MR5 A;  5GMD A;  1CG2 A;  2APO A;  3GCX P;  2C2O B;  8RUC A;  2XS7 A;  3JQM A;  3H0P A;  3MCM A;  5B08 A;  1X4D A;  4ED5 A;  2RU3 A;  5D8H B;  1CJV B;  4F4Y A;  2YNH A;  2R2T A;  3H20 A;  4MYT A;  5D0G A;  1FFS B;  2H5J B;  4Y2A A;  2XG8 A;  4RU9 A;  1SUQ A;  3IGV A;  3KLF B;  3PW0 A;  3TJ9 A;  1F9H A;  2NXU A;  1RAC B;  4AND A;  1EHW A;  4EU0 A;  4ZK7 M;  3CJQ A;  3DCA A;  2MQN A;  4O4G B;  1K0T A;  3NMA A;  4ZCM A;  3OVA A;  3N5F A;  1Q8I A;  1TEL A;  4CDI A;  2OSQ A;  3K8V A;  5DDQ C;  2UUA F;  3IR6 B;  4ER8 A;  4X65 F;  2VC1 A;  4O23 A;  2DGW A;  2E5L J;  1VQO S;  1HWI A;  3AA8 A;  4TY8 B;  1VJW A;  1S49 A;  1OY6 A;  5AXM A;  3BQ1 A;  1RWO B;  5D15 A;  1ICE B;  1Q95 G;  5IC4 B;  4AQY F;  2HMI A;  4V19 J;  2RIL A;  5KFJ A;  4TXS A;  1Q0N A;  2MKJ A;  1UFL A;  4JI7 J;  4TN2 A;  2MZR A;  2EEY A;  4B3M J;  2NYI A;  1YX2 A;  2VF3 A;  1Y3J A;  4ZJL A;  5ETO A;  3PW4 A;  4KPY A;  2MDA A;  1PAE X;  1HKA A;  3MM6 A;  3QGG A;  1N6Q A;  1S72 S;  3OHB A;  4R0J A;  4LRD A;  1ZAW A;  2RE1 A;  4CT9 A;  1S0N A;  5FJ4 A;  4C3M A;  5K8N A;  3EGN A;  3NGS A;  1GAO A;  1T9T A;  2VD3 A;  2COL A;  3GFH A;  3L95 X;  2HLU A;  1PCA A;  1O5J A;  5IQ6 A;  3KLE A;  3D3C J;  1CJT A;  2WCX A;  3D6H B;  3C19 A;  2MQ8 A;  5KFY A;  5C25 A;  4DQS A;  2ZZT A;  1JLE B;  4DMZ A;  5K20 B;  3J80 U;  2RSQ A;  3CMA S;  5EHH A;  3PRV A;  1OYE A;  2KT5 A;  1J27 A;  1IKW A;  1Q8K A;  1KQG B;  3F73 A;  4M1K A;  4P2M A;  4ECZ A;  1N56 A;  5L1J A;  1YRT A;  2EK6 A;  1X60 A;  1X0F A;  1SKW A;  3M9M B;  3CC4 S;  1DAX A;  1IUJ A;  3DLH A;  1HNW F;  2HRT A;  2LCW A;  1X9M A;  1FRI A;  1OPZ A;  3FBF A;  4MK7 A;  1RJJ A;  2FPH X;  3OPK A;  2XYP B;  3MED B;  1MU2 B;  2WBR A;  1S1U B;  4LBH A;  5D77 A;  2O1P A;  3N6N A;  5E0O A;  4U8Y A;  3BBC A;  2KM8 C;  4XTT A;  3TP2 A;  1XER A;  2HGM A;  3D0I E;  3KLF A;  2B8Q A;  1RCX B;  4O44 B;  5AE1 A;  1KQS R;  1TL1 B;  1W7W A;  2G0J A;  1TR0 A;  1QSS A;  4ZVR B;  1BE4 A;  4DR6 F;  1FI4 A;  4RX6 A;  1MMD A;  3MR6 A;  3SQG A;  2RDJ A;  4N41 A;  2V2Z A;  1TFW A;  2J5A A;  1WD6 A;  3EVO A;  3OTD A;  1RB0 A;  3CNQ P;  4O4R A;  2XEX A;  2ZC3 A;  4Q45 A;  3KJV B;  4DFM A;  1FJC A;  2DJW A;  3EXC X;  4E8U A;  1HWU A;  3DGP B;  1SJQ A;  3NGU A;  4C11 A;  1X8D A;  1SC1 B;  2ZOF A;  2IRU A;  3AOA A;  5DET A;  1C0T A;  1IBC B;  5KG1 A;  1IBM J;  3Q0A A;  3QAT A;  3V4I A;  2UXC F;  1TTH B;  2DRB A;  1CEZ A;  5H1S V;  4DSJ A;  3NP5 A;  1UW9 A;  2DRD A;  4A8X A;  2VG6 B;  1FFG B;  3W5X A;  1H2U X;  2SXL A;  2KHC A;  2VG7 B;  4QWD A;  5GAG I;  5HLF B;  4X84 A;  4Y2C A;  2MXY A;  2KYX A;  1HNI B;  2HYI B;  3D6M B;  2WSC C;  4JV1 A;  3EGZ A;  2U1A A;  4USJ C;  4AYB D;  4JI8 F;  2BJ8 A;  4LF7 J;  3MPD A;  4NLD A;  1VRU B;  3NAH A;  4I6Y A;  3BSN A;  1URR A;  3Q8Q B;  2AEJ A;  5HQ8 A;  1PBA A;  3V81 B;  4JV2 A;  3HFZ B;  3K7R A;  2CYY A;  1DQA A;  3TUP A;  3W66 A;  5CD4 A;  4ZVO B;  3S01 A;  5B0B A;  3M6U A;  3CXC R;  1Q5Y A;  3NWG A;  3OJS A;  4DUZ F;  1A7G E;  2C42 A;  2RS2 A;  2F4V J;  2HHT A;  2KM8 B;  2HGN A;  2L9N A;  4X4O A;  2XS2 A;  3OSN A;  4HT7 A;  3UD4 P;  3FUY A;  4B3M F;  3BGR A;  2L3M A;  4FBU A;  5KTQ A;  3PCO B;  4ECR A;  3KWM A;  3A4T A;  2HQ3 A;  2OEL A;  4F4Z A;  2FJA B;  4CH7 A;  3BKU A;  2H5I B;  2B9E A;  4ZCI A;  2QYG A;  2DNH A;  4N5S A;  3QT6 A;  3ZTP A;  4DU8 A;  3DKD A;  7FD1 A;  1SC4 B;  4FYD A;  2ZC4 A;  2M4M A; 
#chains in the Genus database with same CATH homology
 1NLK L;  3L7U A;  1NDK A;  2AZ3 A;  5BXI A;  1MN7 A;  1NDL A;  2HVE A;  4AND A;  1EHW A;  2DXE A;  3VGT A;  4FKY A;  4DI6 A;  1BUX A;  3Q8Y A;  1WKJ A;  4O0N A;  5CAA A;  2B8P A;  4UOF A;  2BEF A;  4S0M A;  3NGR A;  1NDP A;  1XIQ A;  3VGV A;  3ETM A;  3JS9 A;  3EM1 A;  3ZTS A;  1ZS6 A;  1JXV A;  2VU5 A;  3EE3 A;  3NGT A;  4FKX A;  2AZ1 A;  1PAE X;  1LEO A;  4C6A A;  3ENA A;  3EVM A;  4ENO A;  3NGS A;  1NHK L;  1VYA A;  5CAB A;  1S57 A;  2DYA A;  3Q83 A;  3B54 A;  4F36 A;  3FBC A;  2DXF A;  3PRV A;  3FBE A;  3GP9 A;  3EJM A;  4UOG A;  3FBF A;  5C7P A;  3WX8 A;  1LWX A;  1XQI A;  3Q86 A;  2CWK A;  3BBC A;  3Q8V A;  4EK2 A;  1NSP A;  2BX6 A;  2B8Q A;  1NB2 A;  1HIY A;  1W7W A;  1BE4 A;  5IOL A;  3VGS A;  1S59 A;  1PKU A;  3EVO A;  3FCV A;  3G2X A;  3PJ9 A;  3BBB A;  1UCN A;  4W98 A;  4WBF A;  1S5Z A;  2NCK L;  4F4A A;  1MN9 A;  3ZTR A;  3Q8U A;  1NSQ A;  3VVU A;  2HVD A;  3BBF A;  3DDI A;  3NGU A;  1WKL A;  1F3F A;  1B4S A;  1HLW A;  1F6T A;  1U8W A;  1BHN A;  1NUE A;  3BH7 B;  4ANE A;  3FC9 A;  4CP5 A;  4KPC A;  3B6B A;  3VGU A;  3ZTO A;  4ANC A;  3EVW A;  3VVT A;  4UOH A;  3EIC A;  3Q89 A;  3ELH A;  1B99 A;  3BH6 B;  3MPD A;  4DUT A;  1NSK L;  1NDC A;  2DXD A;  3R9L A;  3ZTQ A;  2DY9 A;  3FKB A;  4HR2 A;  1K44 A;  1NPK A;  1WKK A;  1KDN A;  1NCL A;  2ZUA A;  3FCW A;  2HUR A;  1HHQ A;  3EMT A;  3FBB A;  3GPA A;  4DZ6 A;  3ZTP A;  3DKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...