1NDQA

Bacillus lentus subtilisin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subtilisin surface properties and crystal growth kinetics
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Subtilisin Savinase
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ndqA00
2IXTA 3DVQX 2Z2YA 3DYBA 4I0WB 3F49S 1XF1A 4KPGA 2HD4A 4MZDA 3GT4A 1GTJ1 1AK9A 1SIUA 1R0RE 1SIBE 1SUAA 3L1KA 1SBTA 4OMCA 1SCBA 3VV2A 3QFHA 3UNXA 2ZRQA 3F7OA 4OMDA 3QTLA 3EE6A 1BJRE 1OYVA 4JP8A 1IAVA 1EGQA 1BFUA 1Y3CE 3I2YX 3LXUX 5ARCA 5AMXA 1GA6A 1THMA 4AKSA 1CSEE 1MEEA 2SICE 3DE7X 1TO1E 3DVRX 4KG7A 1T1EA 1P8JA 3VTAA 1Y3DE 1OT5A 4BWGA 1TMGE 3LPCA 3CNQS 1TECE 1AVTA 1ST3A 5AVJA 1BE8A 2DUJA 1T1GA 2GKOA 1Y4DE 3DE6X 4J94A 3T41A 2DQKA 1Y9ZA 3GT3A 3HJRA 1ST2A 1SBNE 2ID4A 5FAXA 1SUEA 4H6VA 3DVSX 1YJBA 5B1EA 1TM4E 3WHIA 1Y4AE 3DE2X 2Z30A 1SBHA 3D43A 3VSBA 2E1PA 1YJAA 1Y48E 1SN7A 1UBNA 2PWBA 3SICE 3D9QX 2X8JB 4LVOA 1ZVJA 3DWEX 5SICE 1GT91 1SELA 1GNVA 2PRKA 2WV7A 2SBTA 1GNSA 1TK2A 2Z57A 1GTG1 1Y3FE 4C3VA 1BE6A 2W2PA 3BX1A 2ZWOA 3DE5X 1WSDA 1YJCA 2TECE 3I37X 5I9SA 3TI7A 4AKTA 3P5BA 4H6XA 4NE7A 3DE1X 1TM3E 2WUVA 1SPBS 3GCWA 3LPAA 1OYOA 1S02A 2XRMA 4WOBA 2PWAA 2IY9A 3A3PA 3EDYA 1C9MA 5FFNA 4CFZA 3WIVA 3EIFA 5JXJA 2W2OA 1R64A 1TM5E 5JXIA 1SCDA 1NDUA 2G4VA 2Z58A 3H42B 2WWTA 1SIOA 2B6NA 4NMXB 1BH6A 1KE2A 3Q40A 3WIUA 1WVMA 4OV6B 1GCIA 1DBIA 1T1IA 5JXHA 1LW6E 1EA7A 2XTJA 5ARBA 2PKCA 2X8JA 5K7SA 3I30X 3VYVA 1MPTA 1AH2A 1SCJA 1AU9A 1SCNE 5FBZA 2P4EA 4H6WA 3TECE 3Q5GA 1R6VA 3BGOS 3AJ8A 1KDVA 4KB5A 3DDZX 3PTLA 1NDQA 2DP4E 3VHQA 1SBCA 4RYDA 1S01A 2PQ2A 4DZTA 1GTL1 4FONA 5JMOA 2W2QA 3QMPA 1BFKA 1DUIA 1PTKA 5CW1A 4DJ5X 1AQNA 3LPDA 1PEKE 3DW1X 1HT3A 4HX2A 3A3NA 5B1DA 3ZXXA 2QTWB 5ARDA 1VSBA 1GA4A 4NE9A 1C9NA 2W2MA 4B5LA 1P7WA 2V8BA 2Z2XA 1SH7A 4YN3A 3DE4X 1V5IA 1GA1A 4K8RB 3ZXYA 4Z2AA 2PMWB 4WOCA 5AVKA 1PFGA 2WUWE 1SUBA 4GI3A 3AJ9A 3F7MA 3TI9A 3BPSA 2HPZA 3OSZA 1AF4A 1SUCA 2W2NA 3GCXA 2ID8A 1KDZA 3VV3A 1SVNA 1C9JA 2ZWPA 1PJ8A 1IC6A 3A3OA 5AQEA 1KE1A 1ZVKA 3PRKE 3I34X 1KDYA 1V6CA 1WMDA 2Z2ZA 3WQBA 4DWWA 2SNIE 1Y1KE 1SUPA 1TM7E 1YU6A 1SUDA 1WMEA 3DE0X 1C3LA 3DE3X 4HVLA 4CG0A 1SBIA 1SCAA 3CO0S 1Y3BE 3DW3X 3AFGA 4ZARA 1P7VA 1S2NA 4LVNA 5JXGA 1A2QA 4C3UA 1JEAA 1TM1E 1NLUA 2ST1A 1CNMA 4M1ZA 3SQOA 4CFYA 2Z56A 1Y33E 2SECE 1Y34E 1AV7A 1WMFA 1TO2E 4ZOQI 2PYZA 1Q5PA
chains in the Genus database with same CATH superfamily
5F2EA 5LUAA 5AKLA 3A36A 3A14A 2XCSB 1J2JA 3LVRE 5ECGC 2HCTA 2YW2A 1H6BA 1RLUA 3OM8A 3DOCA 3I3OA 3UWSA 4D4JA 3G2NA 2C7QA 1PNTA 3M6UA 4DDKA 1ETHA 2IHZA 1Y81A 3F5SA 3ONWA 2AI1A 4NSNA 4YALA 4ZDIA 3I2YX 3PWZA 1H0HA 1QGED 5G0UA 4LJLA 2HTEA 2DYKA 1WEHA 3CUKA 3QUCA 3AOEC 3VDNB 4BQNA 3PQ4A 1P18A 1OT5A 2ZRCA 4A8PA 1MV8A 1I3OA 4FYPA 3DCJA 3LIIA 2NSHA 2P8JA 3FCYA 1OH6A 1H85A 3C6XA 4GPZA 4J6EA 1OX6A 5B4UA 5A62A 1LLDA 1QX4A 1IMJA 1YL5A 5E6SA 2ZJ8A 1YT5A 3OUTA 5JD5A 3EEQA 1HYQA 1YQ9A 4QVKA 2CEAA 2FE4A 3U49A 1EB8A 1LH0A 3ZU4A 2PD6A 5KAMA 3RU2A 2JG3A 1V5FA 2E4YA 3ZLTA 1UZUA 2NSJA 4NKRA 1ZNYA 2HFJA 3UK0A 3T4UA 5FBLB 2PD3A 3NDJA 5LXTF 2OFPA 4MA0A 1WETA 2R84A 3KIPA 1P0PA 3IVMA 4CKEA 5B58T 3MCTA 4C7MA 1E0KA 1GEGA 1ZWKA 3PCXA 1DUVG 3OD1A 2ZAMA 1OW3B 3UHAA 4JYMA 1PLJA 1E6EA 1S3SA 3N07A 3ZGLA 4WACA 4RMGA 1Z36A 4OB8A 4R1SA 2O59A 1XCJA 2WVHA 2Q6TA 3AWDA 2X2PA 5LZ5A 1S02A 4HFJA 1MQSA 4WOBA 2PWAA 4UZFA 1UQRA 2PS3A 1BGVA 3W6ZA 2WMNB 4D56A 2W83A 2XYHA 2G4VA 5FLEX 3W6OA 1A9YA 1Z5OA 3LHIA 5FNVA 3ENZA 2PKEA 3CE6A 3IFSA 1RR6A 4P8RA 4CL2A 3STXA 3B2QA 1T1IA 2C61A 3BWDD 3E3AA 3FOAA 3MGBA 2DBRA 1IIRA 2IX3A 1HPLA 3HKEA 1N6KA 3NJ4A 2JAPA 4KQCA 4NU8X 1VLZA 2WIAA 3A1DA 3AO0B 1ZRMA 3LRPA 3N86A 5DDIP 1PE0A 2VSQA 3KKEA 2O3SA 1SC6A 1YIOA 4I46A 3HJFA 3IA7A 4K9QA 1N6HA 4GYWA 5DBHX 5D3KA 4DJDC 4IBOA 2RGWA 4L7QA 2EKDA 3GRVA 4A8JA 1PJLA 1WNTA 2JLQA 4MA4A 4OL9A 1IONA 5L7TA 1EFAA 2VUSA 3EFOB 3D6HA 2WYVA 3Q8WA 4HQOA 2H9IA 4HWRA 4F2HA 3LT1A 1QV6A 2K87A 2BI7A 1ACMA 2AMFA 1QZUA 1EWTA 1JKJA 1ONBA 4GI3A 1JHDA 3WLAA 2OO5A 4LXYA 4NZ9A 4FDVA 1NR5A 4FSXA 4Y6GB 1MEJA 4OLAA 1Q50A 3M3DA 4OGLA 2G1JA 4PLPA 5AXBA 1BHJA 1D4OA 5L3QB 4FYIA 1GRCA 1L7VC 3LF2A 4GKBA 4PYLA 4QOSA 2VTVA 2IPXA 2WR8A 3CEHA 1DRVA 1T4MA 1V5GA 4I1SA 3ORHA 3AZOA 3OZ7A 5TC4A 3ZQJA 4EPRA 3ZD6A 2HLDD 1XDBA 1H9BA 4DTCA 3MCVA 3G7UA 4L51A 1GHTA 4MVCA 4XA8A 1UJ5A 4UCWA 3C6MA 1TQ4A 2RKWA 2PX2A 4LV5B 3LU1A 3OPYB 4R05A 4UC0A 5HKOA 2JJ1D 1DBQA 1G4AE 1SHKA 1H2FA 2I65A 4V03A 3VOBA 3M6WA 2HIHA 1S5PA 4DLLA 9LDBA 2EWVA 1U7XA 5ETJA 4RFSB 1CNEA 2G9VA 2QPOA 4CGYA 1HQYE 1YR1A 3OCCA 4ALJA 3PFKA 3PQ7A 4C20A 4G25A 1RD4A 3KLBA 1W30A 4ROTA 3R3JA 3WK4A 5JSUA 2B5VA 1N8KA 5D7NA 3RRFA 2ZI4A 1WMSA 2P9GA 2PRSA 3GMTA 3CRMA 1LCIA 2FPIB 3THOA 2MMCA 3B13B 3F9IA 4RY9A 2AQ8A 2IEZA 3EF3A 2XECA 2BFMA 4C0JA 2AEMA 2E37A 4BQSA 3IE1A 3UWDA 2H29A 4Z1MA 5KTKA 1RMQA 1XEFA 4IFIA 3WL8A 1WG8A 5BQPA 3S2ZA 1K5HA 3I9V6 1Y4AE 2NSLA 2WPDD 3SYRA 4BNLA 3O6VA 1YBMA 2PZGA 4WD3A 1G5QA 2UKDA 2V7QD 3R0IA 3M7IA 3AK4A 4BMXA 1LBQA 4GR9A 4B3JA 2I1LA 3IKVA 4I9FA 1NI5A 1IK6A 3LOQA 2VP6A 1PYDA 3P9QA 4IP0A 3EASA 1CY4A 4KLAA 4BKUA 3H9JA 4LGCA 3OEYA 1XMQB 3MLEA 1R8QA 2VXCA 2RGUA 3ZX5A 1P80A 1PV2A 1C3JA 2I7CA 2QQFA 1H5NA 4LY3A 3FNHA 3R7WB 1SVIA 1AG9A 1Q21A 3JV7A 1MHTA 4IIHA 2ZBEA 1TUIA 1I4WA 4FUQA 4TXJA 5JJCA 3IT1A 5TMEA 5KJ1A 3K53A 4YCBA 4DVJA 4HK4A 1N1GA 2IE0A 3AKCA 4J0HA 4DBLC 2O8DA 5IANA 1QBKC 1SVUA 2OD2A 3NEPX 4A2PA 1QHXA 1Y8ZA 2BFBA 3T1OA 1PG5A 1WR8A 2F3TA 3TB6A 1XR3A 2R1UA 1JHXA 2K7ZA 3H18A 3CSDA 3FPEA 4TQGA 3VKUA 3LUCA 3WE7A 3K1ZA 4ER3A 3JQ8B 5ILOA 2QRJA 3ROTA 4UTZA 4KR9A 4FR2A 3FPCA 4J3FA 5K3FA 2G1AA 2HMUA 3GZNB 1RABA 4MQFB 3SC2A 4IHAA 3A9RA 3SZ3A 3SQDA 1P6UA 3TCKA 1PFQA 3OAAA 4EJSB 2ZE6A 1XXLA 2ZTUA 3L8MA 3WGLA 5LQJA 4IJKA 1RMYA 5FNVF 1HBJA 3AVUA 3LPDA 1XDZA 4GRDA 4Z7JA 4I1RA 1Z8DA 5AHRA 5CH3A 1V4BA 5LKAA 5F1OA 2EDCA 2IH5A 4FYJA 1J00A 1EDBA 1KJNA 3FHLA 1PFGA 3PJEA 1UJMA 2WWVD 1I3CA 3V8PA 2XDWA 4C4PA 4IH1A 3PDIB 1WBDA 4JVNA 5KU7A 5HRUA 1FSSA 5LZ9A 1JGTA 1CQIB 3HUDA 4CEIB 1NF3A 3BQMB 2L2QA 2N0SA 1H1LB 1O95D 2D00A 2I6XA 2A1UB 2IIPA 3FG9A 2IW1A 3HBAA 1SZPA 3WGNA 3WKEA 4CT0A 5F7XA 2FCRA 2CHVA 4QE3A 5BSHA 5LIPA 3WWCA 3BZUA 3QNMA 1A2QA 2HIGA 4OB6A 421PA 5CJ2A 3L0DA 4DLZA 4LDPA 1DUSA 3NAMA 1HNWB 2FQYA 1EVIA 1ISFA 5HKAA 4NYMR 1I9CA 5KOJA 2ONCA 4EEXA 4BNJA 4RX1A 1D07A 2JD2A 2ZYWX 4EVRA 1JR6A 4GSLA 2P5SA 4RZ2A 5ALWA 1FU8A 4XTCS 4D0NA 3VXKA 4TKVA 2G9RA 1MABA 3F0TA 3UJ6A 4CL8A 4O5OA 1SCUB 2EKLA 3I2KA 2RI0A 1FBTA 3NYRA 3O1IC 1I6MA 3ZEIA 3EVBA 5EGSA 3DZFA 2ZPUA 1BJRE 1GQOA 5BVGA 4RFLA 1U2PA 2FMTA 4LBZA 1OXSC 4E6PA 4LRUA 3C1UA 4ODIA 2V45A 5CVTA 2PIDA 2YINC 2P9HA 2DT5A 4E5NA 5AI6A 2F7SA 4AJ4A 4FBMA 3S27A 2C8LA 1X94A 3RARA 4DGSA 1PLKA 4ZJZA 4P3OA 2XCRB 1WSBA 1ZIYA 3EGWA 3HXOA 2B0CA 3KEOA 4LDRA 2I1VB 3LX8A 1BRTA 3AHHA 3NHMA 4Z9AA 1GP2A 3U40A 4E46A 3K6KA 5IFLA 1JW9B 3CPEA 4YRZA 1JG4A 3GVCA 3I9JA 1XZHA 4HN9A 2JFBA 3AONB 1QPGA 1KEEB 4HYQA 3E23A 5F4ZA 4MKZA 3U16A 4O4JF 1AGPA 5FEMA 1EZ4A 3T35A 1SQ5A 2X1MA 4LCJA 4XOIA 1JFLA 1NQOA 1TVCA 2HCBA 3G5TA 4MS4A 1H2ZA 4G8CA 1VG1A 2EBHX 4MVJG 4LA4A 4D0LB 3OD5A 1E2KA 4PONA 1B0UA 1XMIA 4V0ME 5GADl 3NMUF 1PJ4A 1DIAA 4QYIB 1NC1A 2X0IA 3P9SA 3DT8A 4ARBA 3KQQA 3T9AA 1P1KA 4IRUB 4C3VA 4EW3A 5B2ZA 4NJMB 1EFRD 1EX6A 1EZ1A 2XA2A 5H02A 3CR8A 1UFQA 4PYIA 5JHGB 3HM9A 1RSZA 4E70A 4RTJA 2FPGA 2IYZA 4PS0A 2IEIA 3TMAA 1QP7A 3PEYA 1U1CA 1U94A 1M1XB 3GQBA 3PR1A 4GP9A 3RK0A 5KC8A 5J3JA 3OZVA 5JXJA 4D3DA 4RV4A 1G98A 5FPTA 4EHDA 4OMUA 2BBWA 2IZ7A 1A69A 1V25A 2CJWB 2NVWA 3JD2A 4EQ6A 5DLYA 3KTAB 2OCYC 3QVLA 4KKVA 4LRQA 3RBZA 4YCLA 1W85B 1VZ2A 4CG1A 4PPNA 4G5XA 4KZKA 2JLZA 4DR4B 1L5VA 2QYTA 2YUTA 4JI7B 3SHTA 1KDOA 2VPPA 3I5MA 1KBOA 1TKBA 4N6NA 1VE3A 4QGHA 5GY7A 1MDFA 1QO7A 4C01A 2NNLD 1D1QA 5FL3A 4MR7B 3JAWA 1JA9A 1FFEA 2AR9A 2D1TA 3ONDA 5DHQA 1JAXA 5KI6A 2V7UA 1Q0PA 2VK8A 4LFBB 4ZTZB 3PPWA 3PGA1 1A9XB 3CNLA 2N47A 3UCEA 1ZEMA 1BAPA 1KKUA 1FEZA 3KJXA 5EWJA 2CC2A 2IUFA 2ZKLA 3G5MA 3OKAA 4RVHA 5TY0A 4YT8A 5K0GA 1AMUA 4RPHA 1T9BA 1I7SB 5KQSA 3EZNA 3IKTA 1SBZA 1HUQA 2WU1A 1ZVKA 3AQ4A 4KCGA 3TXYA 4HAIA 2KMLA 2H4FA 1KSGA 1LC3A 4RVOA 3RS4A 2GN0A 1Z0ZA 4BUJA 2HQBA 2H8KA 2CZQA 4V2UA 3GK3A 3QE0A 3EAGA 3O95A 3GJSA 3AVQA 3R5JA 1ORDA 4NEHB 5EKTA 3LMKA 2PMEA 4EJ0A 2H2GA 2PRYA 4V0QA 2GPNA 2Q3EA 3RAJA 4ESEA 1KI4A 2NYRA 2QNBA 3BA6A 3UB4A 4BYMA 4KGXA 3LKVA 2YY7A 1AO3A 2J5BA 3U3OA 1JA1A 1I13A 3GWZA 1C14A 4ZGBA 2GM3A 3TFOA 3CJTA 1XRNA 3CEJA 1DFGA 1U9IA 1X80A 3EK2A 3QBDA 3ZV5A 1ATZA 4OUDA 2C00A 3JQFC 3LBHA 2RHWA 4CLRB 3IVXA 5AM0A 1CQPA 4LJSA 4CKWA 1WDTA 2F62A 4KN5A 2IXEA 2LDXA 1E6MA 1P29A 4W5WA 4WXMA 3SVZA 2CL7X 1N5OX 3TNFA 3PFCA 3IGFA 3ROPA 1G5PA 2YS6A 4GF5A 3DNFA 2QPAA 4Q1AA 1KQNA 5KTTA 2ZJ3A 2GK7A 2BDUA 3PQ6A 2BPOA 3IALA 3EEFA 2ZU6A 3T5CA 1BE8A 4P7BA 4C4SA 2ID9A 5TJHA 5AJHA 1IUNA 1LBIA 1VIVA 1CDZA 4Q3AA 3JARA 3CGGA 3UGQA 2IW3A 2YDXA 4DLAA 8OHMA 2HT1A 2AFHE 2ZITA 2ZRMA 4BS9A 4Z9YA 2VLIA 2A0UA 1G5RA 1I5OA 2E5LB 2FV8A 5J59A 2OCGA 4NATA 3OIUA 1W4BA 4QU0A 5CVUA 4ATNA 4DC0A 1ZJJA 3D9QX 4MI1A 3V80A 1QZXA 2R6ZA 3EYWA 4E32A 5JCXA 1FTWA 2HYDA 1K0UA 3H5AA 4TMXA 1P4GA 4MULA 5TVGA 4YAWA 4D92A 1A9OA 3WLHA 4CGZA 1QO9A 2Y0EA 2A94A 1Q2UA 3BH6A 3D1LA 4G07A 4RH1A 3EBOA 3VPXA 4ZCMA 5C32A 2YBEA 3NHUA 4B6FA 2AZXA 2A92A 2XRMA 5J1SB 2C2KA 3ZJ4A 4MDEA 3OZBA 3M6IA 1J2TA 3GEEA 3BREA 4QHSA 4G0UA 2OHJA 2HLDA 2AE2A 5KKCA 3UN1A 4BJ5A 2P3SA 1AS3A 5K5EA 3BWCA 3FKSD 2QAGB 1NU8A 1Z5ZA 2EF1A 4QFCA 5AKEA 5K4AA 4WLVA 5AESA 3A06A 3EEOA 5CVEA 4B6JA 2P4EA 4CUJA 1YASA 3FF1A 5JANA 3VZBA 5K03A 2J30A 3S8EA 1VDMA 2SKEA 2VZ9A 3AHEA 3O26A 1ZZEA 3X2EA 3AESA 5I4BA 1S9DA 4UHKA 1SK9A 3HSYA 3SM9A 2PX6A 3SZRA 1Z4OA 2FP4B 2OGSA 5HUHA 4G63A 2EX1A 2QU8A 3CKLA 1NN1A 1D4FA 4LG1A 3TOZA 5LDHA 2CYBA 1XT6A 1VSBA 3V7NA 2XNCA 3WGTA 3C15C 1XF9A 2X3UA 4E2FA 3OZSA 5FAKA 1IG3A 5A7FA 2NOAA 2H06A 4P32A 4C0XA 3P45A 1IATA 1MAAA 3S5JA 2J0SA 3H8SA 4HLCA 4Z1MD 3TGWA 5E6RA 3V3TA 5JI2E 1ZGZA 3K70B 5DEOA 2F4NA 1HF3A 4HNAB 3D4NA 3G82C 2AWOA 4XJVA 1RLIA 5CBKA 3R41A 4ZT3A 5IYZA 4KPYA 5AQEA 3TLEA 2O07A 4WK4B 1GFSA 2PANA 2JVJA 1R9NA 2VYQA 3KOOA 4URXR 2NU9A 3C4JA 3UEOA 4CMHA 1BROA 3U17A 1U3CA 3UHFA 4AMVA 1G19A 1DC3A 5GIPE 4JZKA 5ALSA 2Y05A 4Q48A 1A8HA 1KFJB 2VJQA 5AQ1A 5M5BA 1R0SA 4G65A 1FJXA 4LWZA 4MICA 3JAKA 4Z4FA 1PUIA 2SECE 4P80A 5C1DA 4QDKA 3F90A 3FKJA 3FWNA 3DYBA 3NDBB 3NYQA 4DR6B 1Y6FA 4C06A 1E5QA 1TUGA 2OCLA 3MJTA 2NZXA 2Z5FA 1R4NB 1EXMA 2IYNA 2Q7OE 4OHRA 2JGMA 4B0OA 1HTTA 4JL6A 2PRJA 1DIBA 1EBFA 2AYXA 4JJ6A 4LI3X 3GC6A 1LS1A 5EC8A 2G7MC 4PIPA 4TWAA 3LDUA 5A9SB 4XB1A 3UM9A 5F1PA 2QSUA 1LRJA 1TAGA 2HLHA 4OK5A 4DANA 1ZOOA 1GT6A 1UKEA 5ESXA 3F2IA 2GVNA 2NO5A 1ADYA 2QMOA 3TMYA 5CFOA 1MVOA 3V2UA 4PYRA 3RS2A 4OAOA 2EJUA 3U4CA 3H2KA 4C78A 2JH3A 1NW6A 2ZE7A 1R0LA 5D5HA 3L3BA 3IQZA 1E3LA 1RJ9A 5FOTA 4X66B 4QPJC 2CMKA 2WD7B 1OILA 3GLFE 1T9GR 4YR9A 4DLPA 1JR2A 5EE0A 3UXEA 1R4NA 3L7BA 1T0UA 1DBSA 2XZTA 2GBCA 3IR5A 3DG9A 4TWBA 4EPTA 1XZBA 4WBXC 3WA7A 2WHYA 3LC0A 1U1DA 1IB6A 3DL4A 3KKKA 4REQA 4TVOA 4YJHA 5IYZF 2IU0A 3BX1A 1B74A 3E81A 3U09A 1L0BA 3CSUA 2H5LA 4UOQA 1PSWA 3O82A 3OT4A 1TK9A 5DCYA 3WGOA 1QTNA 1I33A 2ECPA 2JHGA 3T7IA 2V5AA 3HNOA 4F1JA 1R15A 3EGVA 5BRJA 4OO3A 2WJJA 4CM7A 5ALUA 4HMOA 1NTRA 4PPFA 3TTVA 4IQGA 4X97A 3OCVA 5IZCA 5K6AA 1HE3A 1P7CA 2E18A 4X1KB 4LYDA 1V47A 5HM6A 1KJYA 3B1KA 3AI3A 3T5PA 1BQ4A 3U4GA 5BVHB 2WQZA 4RENA 4DQLA 1SD1A 4D44A 3VDQA 4HB0A 1H6CA 3THSA 1XTJA 3KEMA 1OB5A 1KVTA 4IINA 4KLZA 1QO0D 3NHRA 3DMTA 3CLUC 1J0EA 1XN1A 4S35A 1PFWA 4LHWA 5JYCA 2VP2A 4JJ7A 3H1PA 4UULA 3LE8A 3L8DA 4KIGA 2J3LA 4BLUA 2QE7D 3R1IA 4BRSA 2IH4A 1CR1A 4QDTA 4D9FA 2OM6A 1FFYA 5AXCA 3UMCA 2MSKA 3V1LA 1ZW6A 4URYR 5TS2A 1PV4A 1FL9A 2WJWA 5D51S 2XYGA 5EP4A 5IH3A 3FOZA 3F3MA 1Z0UA 2UYCA 1RAAA 3OJEA 5ILQA 5BP7A 2YJ4A 3FCCA 3HVJA 4FN4A 3FYUA 2B8EA 2IIQA 3DMTC 2PGJA 2BCEA 3F6EX 5LC1A 2ADMA 2PXXA 2AT1A 5C53B 1E96A 1HDZA 1VKJA 3SM3A 2C4WA 4LOLA 5FXMA 5U4XA 4F4DA 4RDXA 2HA7A 2WIDA 2JIZA 4ZZ0A 1QYCA 2B4KA 1ZCBA 2PGDA 2WEKA 3O3CA 4AMBA 2X8LA 5IHPA 2HB6A 3HU5A 1JWAB 1SBIA 4JYZA 3OA2A 1VKHA 3U37A 1IOLA 2ZIEA 2WP0A 4FSHA 4C1BA 4E15A 2BSQA 4Y6LA 4PCAA 2VTBA 3JQ9C 3NIWA 5HS6A 4KC0A 4Y0AA 4YWJA 2B8TA 2Y1CA 4ZTBA 4JX9A 2YUIA 2AN5A 3KYCB 3QA9A 2I67A 2K6GA 1A77A 1WXDA 2ODPA 2X9NA 4B7XA 3SF8A 1TD1A 1KZYC 1NULA 2H57A 2QSJA 2Z1DA 3ANTA 3KOMA 3WDMA 4DSUA 5K99A 1NR1A 2RH9B 1B7GO 2EHJA 2NZVG 1P2UA 2ZG6A 3KJZA 1R0RE 3PWTA 4UFNA 4BEJA 5KYGA 2GD2A 4UFPA 5ADWA 2Y6VA 2LTAA 1E3DA 1M8FA 5B1SA 1WZ2A 2GERA 4MI6A 1PZXA 3RC8A 1YJQA 3D3QA 3OPQA 5HP4A 1ISRA 1ETUA 1FCJA 4NBNA 2GZAA 4EL5A 4Y2SA 2VJLA 1U9ZA 2GKSA 1WMAA 4CIYA 1UJNA 5IM5A 1L3IA 1NJ5A 4TTAA 3W7BA 2QD1A 2GKOA 2I6GA 4I7EA 5KWJA 2WTNA 4L8WB 3TLXA 3L0SA 4ZTUB 3VMFA 2GCGA 1JEEA 1Y3AA 3LT2A 4NOKA 4W9RA 4OXYA 4I9GA 4DSTA 2Y1LA 1ZH0A 4FDAA 1LWNA 3NRBA 3TDKA 3AKDA 3P2EA 2QRPA 1YQWA 4J90A 7MDHA 2RH8A 1LNQA 1Z17A 3I6IA 2AN1A 1ZUNB 1R0WA 3BIXA 1ZD9A 3PA8A 4L27A 2X8JB 4MVJP 1V9CA 2VT6A 3DWEX 2DAPA 4BFWA 1K27A 2JBAA 3R7DA 3UW3A 2BIFA 5FP0A 1Z6QA 4CTOA 2Z9BA 3SZUA 3BCRA 4UBJA 1VMDA 1Z8FA 1YRYE 3ZHZA 4MCJA 3G1WA 3PQ2A 3DOFA 4W4TA 5AKGA 2PGLA 3B70A 4S3MA 3GEHA 4JI1B 2VYVA 1F06A 3WISA 3ZD9A 3NASA 2DM6A 1Z2DA 3G23A 4FX2A 1GSOA 1JT2A 1SIOA 3BD6A 4NMXB 3OJOA 3RVDA 5YASA 4YQYA 2QTAA 3NV9A 4HMQA 3SZGA 1B8UA 5JSHA 2OCBA 2QPLA 1WNFA 2QHXA 5ARBA 4AK9A 4AX8A 4QWWA 3VPDA 1W581 3KEFA 2I2AA 5BYJA 1FFWA 1PG2A 2V59A 4FS3A 4FZ3A 1J5EB 1XN4A 4XI9A 2JIBA 3M5PA 5CFLA 5KZMB 2JFGA 3FYSA 3HBLA 1WHSB 3QITA 4JLKA 4BE7B 3LTEA 2QJTA 4YMWA 3NH6A 3NTQA 3B1VA 4QTUB 2ZRPA 3DMDA 2EF0A 2ATEA 3DWFA 1D9ZA 1W4ZA 1L8LA 3H83A 3A8TA 4RVUA 4CTKA 3I9OA 3WYDA 4JBGA 4EIWA 3C1AA 2VDKB 4HDNB 5KEIA 1NYTA 4GDFA 1UMDB 3RC1A 4HADA 4RNCA 2ZYGA 5IEJA 1VLLA 2Q4RA 3E7XA 3JQ6A 4TTPA 2A7XA 3F3KA 2GX6A 3MWYW 1VB5A 2TYSB 4Q4CA 3GJQA 3AUYA 4G4JA 4WUTA 3FXAA 3RFUA 3DKVA 5M04A 1A4IA 2WWIA 4W1RA 3LXXA 2F3QA 4L5CA 3CZQA 4O8ZA 1L4GA 4DUGA 2IPAB 5C46F 1A3CA 3RSGA 2WUEA 3JPWA 4DB2A 3WQRA 4Q3OA 1XQ6A 1XTSA 4KX5A 3LA8A 1KK3A 4QKQA 1MIHA 4M36A 1Z83A 4DGQA 4E08A 1RKUA 1NUHA 1J70A 2NTEA 2HWYA 3BD8A 4R7ZA 4Y2TA 4ZPJA 4C7JA 4EB0A 1TUBA 2DFKB 3SAJA 1H6AA 2GCOB 3DTTA 2L42A 1PK7A 1M8GA 1JKJB 1IWOA 2ZUVA 3UHOA 1AUPA 1SCUA 1PTJA 3O2NA 5KSPA 1Q3KA 3VV2A 2ZYSA 3GLHB 3OWOA 4D3XA 1U8FO 2VJBA 1Z4KA 4YQZA 2OT3B 1XNQB 5IVHA 1N36B 3Q5DA 4K3VA 1KY3A 1JFSA 1USWA 5EXXA 2RC6A 4YAOA 4OA8A 2HADA 1TQ8A 1E32A 4U0KA 2JASA 3H7IA 3DDCA 2B4YA 2DUJA 4QBTA 4ZOLA 2WF6A 1ISHA 5TS3A 4LXXA 5L6LB 1LJLA 4ZT6A 5AK3A 3W2HA 2YJ5A 5WRFA 1U5BB 8GPBA 3K6SB 4ICIA 1T3TA 4GPAA 1Z7EA 1E4VA 1IRXA 4G8BA 4R1UA 2ZRHA 4S1TA 2X2FA 4F5EA 4FOTA 4F2GA 1GAEO 1S3FA 2RIPA 3NVMB 5DX0A 2CNKA 3A25A 1YR3A 2YHAA 4KBYA 1NV9A 1AN0A 2PJZA 1G291 3RCBA 5SZKB 1HOTA 3R3YA 1D6NA 4HDNA 4MPRA 4P5DA 3WNDA 1K7XB 1LC0A 3C3BA 4PSUA 3W9BA 5TDHA 1XHFA 2E55A 4AZ3A 1RQRA 5FI3A 4PTLA 1PJTA 5CT6A 1VI5A 4G8DA 5DCWA 4DBVO 1ZMTA 1W5TA 5IC4A 4NARA 1MA0A 5AW8A 5BR1A 1JWLA 1UAAA 1XCGB 3FTNA 3HJHA 2UZIR 3ISTA 4MXDA 4MIOA 4JZYA 2G9NA 4QTZA 3V00A 4IHJF 3W6UA 5KYUB 4FEGA 1AZWA 3RT1A 6REQA 3FPBA 2GK6A 2B99A 4BLPA 4G5FA 3GX1A 4P81A 2RHGB 3IAM1 5BSTA 1Y9AA 4WKOA 2AE1A 5C8YF 3D0RA 1SCNE 3KFVA 4XFKA 2WIBA 3TL3A 4M8IA 3ESCA 3VU1A 1P72A 1B0PA 4LNAA 3KAKA 1RYBA 4OLJA 1GFIA 1D09A 1YB7A 2YIVX 2ZE5A 4B6SA 5CVJA 3C7DB 1KR2A 2DKFA 1VC2A 2QLBA 2RG1A 1CR6A 1MN6A 3RWOA 1G20A 4FHFA 4C2UA 1ZN8A 2QUAA 5EXPA 4US0R 5FTNA 4BASA 3KHSA 4DCOA 4MGKR 1GARA 2RG7A 3RUDA 4MS3B 2RB4A 5KJEA 2P75A 2ERCA 2H85A 3DBHA 2A88A 4AJIA 2B8JA 5C34B 1FUKA 2GB4A 2NO6A 4BAZA 1OGIA 4CQMB 4ZHQB 2C4UA 1PEYA 3Q9UA 3PUYA 1Z8NA 1NI4B 1WXWA 4AMZA 1L5KA 1VZ3A 3LI2A 3N2GA 2B37A 5IKEA 1Q16A 3A6LA 1RYMA 3KBBA 3MTGA 2W9XA 5ALYA 5T8KC 1QTIA 3FB1A 1K1EA 1YZVA 1ZKMA 3PEFA 4GDMA 4U63A 3RRZA 4GI1A 2Y0BA 3QW4B 4H17A 3DEKA 5JCZA 2B30A 1VKOA 3BMCB 3GRZA 4F11A 2Q1XA 4IO1A 3OOWA 3PCTA 3EWAA 3GFFA 4UU0A 3RS0A 2CE7A 3S2IA 1EDZA 4CN9A 2QXTA 4S0ZA 3EMBA 3O8DA 5GPBA 2RKBA 3AB3A 1ZD4A 4C0LA 5JTTA 1QHYA 2ZYDA 3H2HA 3VKWA 1EFHA 4MDHA 3EHDA 3DEJA 2CHUA 4PAWA 1OX5A 2HJVA 1RRMA 3IESA 1XPOA 5EZSA 2X2EA 2J3HA 3BCHA 3CLHA 2FR8A 4CYMA 7AT1A 2JD1A 3ER9A 1IQPA 1CSEE 2HRDA 2W4IA 3CMCO 4ND8A 1W36D 5FPHA 2Q1UA 1ZYUA 4BCCA 4IV0A 5DMXA 3B9QA 5EJ9A 4B74A 2QUZA 2Z8XA 1UKAA 4CKBA 1PUJA 3IP1A 1T1GA 3WL3A 5ERXA 4EF5A 4NBLA 1T13A 1U1GA 3QEBZ 3HN7A 4X1YB 4EEKA 3QV2A 5EE1A 4A4DA 1R6TA 2O8NA 1VQ1A 2HAEA 1DC5A 5IJ9A 5JMWA 2BM9A 2JVKA 3KAQA 3D8TA 3GYGA 1Z2EA 4RZHA 3WFJA 4BQOA 1JWBB 1TYDE 4MCAA 1VL5A 2BRUA 5FPQA 5BMVA 1U7WA 1G5TA 4I2NA 4I55B 2HHLA 4GC5A 3RS8A 3E82A 2W8BB 2VXBA 4Q7QA 1OTYA 1OI3A 3CIOA 3GPBA 3BXEA 3KT8A 2OEPA 3R8FA 4R8LA 3RIYA 4YRGA 5K20A 2RHLA 3HEMA 3G9UA 4IUCS 4QEZA 4AY4A 2ZSHA 4URUR 3ZCTA 4EELA 2IPLA 1HT0A 3PIDA 2GTHA 1SOAA 3M83A 4P4LA 3ZI7A 1PFYA 1G66A 1VG9B 1X8XA 3EVZA 5DYGA 1USGA 4BNVA 3G1UA 3T1TA 4FMDF 5FTJA 5ALDA 4F06A 2EW1A 2GZ2A 2OAP1 4Y3UA 5DOVA 4RU1A 4OKSA 3VYUB 4KXFB 1LDYA 4N49A 2OFWA 4R71A 5CLHA 2VYVD 3ZGZA 4DMLA 1G8FA 1H65A 1K6IA 3L6CA 4JAVC 1CQJB 4DR2B 1E20A 2JHPA 3BDAA 3WOVA 1J23A 3JARB 1EKXA 1OXXK 2P9YA 2BKAA 2IDMA 3PG5A 1QK4A 2FPMA 1AUQA 3HG7A 5C1IA 3U7QA 3W7AA 2ONKA 5A3RA 3VU3A 3M9XA 3BGOS 1Z13A 3PYLA 3DKIA 3O8QB 3A58B 2YVAA 3EXIB 1EHCA 4H4DA 4Y0VA 3LQ2A 4X7PA 1YDFA 2PUTA 3TXXA 4IGKA 4WJZA 3PEUA 2RCYA 3KKLA 5LPNA 1W1IA 3CZ5A 3T0FA 5ARDA 5F3WB 1ZCAA 5BN5B 1W8DA 4CQMD 3L40A 2XTAA 4J4HA 1SFRA 2ZR9A 4FYWA 4WOCA 1XDUA 3DULA 3ZWXA 5JAPA 2Q2QA 4GE0A 3GCXA 4KMMA 4MPPA 5ESRA 5F2KA 2M1ZA 1WB9A 3L18A 1E8NA 2O5RA 3DZKA 3K1AB 5DNYB 2ORIA 2CD9A 5TEWA 1S8OA 4OGKA 3OLXA 3K0KA 1QPZA 3C5HA 5A4IS 5FTLA 3R9XB 4AROA 1QNLA 3TTTA 3M4XA 5HZHA 1XKXA 3L8CA 4INPA 2PGIA 3B1WA 4Q21A 1C81A 2I54A 4IY1A 3FYUC 4NZYA 4QOJA 5BSVA 3EAFA 2Z98A 1I6WA 4HD8A 2HMVA 3I2JA 4TQUS 4DV6B 3STUA 4YP5A 1NOIA 4O6VA 5ITZB 2DXIA 3L1KA 3LLSA 4A0SA 4B85A 1NONA 3BDIA 3NKFA 4WMLA 1PO7A 5H5JA 4DXDA 3NHKA 3PEVA 4A2WA 2BFPA 2R6HA 2B4QA 5BSKA 1OLXB 1PQWA 1TMGE 1REQB 1IOZA 4QSHA 5KVCA 1H4SA 1TAQA 1P2FA 1RHQA 4NLLA 4ALLA 4HQFA 5CT8A 4DR1B 3AEKA 3OP4A 3HJRA 4OXQA 4RHUA 3ZI4A 1C9DB 1H0KA 3FCSB 1ORTA 5JQGA 1ZMBA 2XMDA 2HO4A 1YH3A 2Q8QA 2DRIA 3K9NA 4QFMA 4EHFA 3KQLA 2GA8A 2Z1NA 3OTWA 2D5BA 2GLUA 5JDCC 3K4QA 3ZHUA 3KB2A 4TWIA 1QIGA 3GHHA 2FH5B 1ZHHA 2VRWA 1GYQA 2Y1FA 3AU8A 5A9RA 1F8YA 1Y1RA 3S28A 2ODNA 3GFPA 4RIEA 2J3DA 1VXRA 2YBDA 4H59A 1WUJS 2HMAA 3RVSA 5KIAA 3K0CC 2HDOA 6ADHA 4GMDA 3AF2A 5BR8B 3FMPB 2IXDA 3H6HA 4LDQA 3MOSA 1NXVA 2GPBA 3AP1A 3O21A 1I30A 3TRDA 3S0JA 3MTIA 2VPXA 2WD9A 2XR1A 1N3YA 1XD2B 2GXSA 2WZDA 1H8ED 1MOSA 1ZNWA 1IVYA 2JGJA 3O0TA 1C0KA 4QARA 4Y2JA 1N9ZA 3IAS6 1ECJA 5I47A 2WB2A 3BXXA 4F8JA 1D7AA 1U2DC 2W2OA 4YAUA 4XEUA 1YIDA 4FYVA 4GXTA 3W4KA 4TTSA 5EYPB 1SEPA 1XVAA 4BNKA 2I22A 5BUCA 1W0JD 3DAGA 1DBIA 4KACA 3W8DA 4BO3A 2I66A 4ZN6A 2GH1A 2JHAA 4HEA6 4LKRA 4YRLA 1QS0B 3DPUA 5H4GA 1MPTA 2GGSA 1U8YA 2YWHA 3NOXA 1DHRA 3WK5A 1K8ZB 3PXCX 4ZO9A 1IK4A 1VFPA 5T8KA 3ZJVA 3KOXA 5BV2P 3BQ9A 2C4HA 1IXZA 1CY6A 4TLMB 5A0FA 1Q0LA 3E58A 1YS1X 2Z6VA 3MS4A 1KVUA 4HAOA 4QNRA 3VR2A 3LM8A 1HLPA 3QMPA 6YASA 4M8LA 2ZRAA 3BJRA 3W5UA 2ILTA 1B6GA 2JHFA 4ZVMA 1JVSA 1YI8A 2G4LA 5F5NA 5L51A 4NCHA 4UOEA 2VTDA 3OM9A 5THKA 3W1EA 1KAEA 1SUBA 2QX4A 4GL4A 4GOMD 4NI5A 2XOKD 4NZMA 4CV0A 2YWCA 5JZ9A 5KSWB 3BEDA 4POAA 4D3FA 1L5NA 4YAGA 1C3XA 4BFLA 2R86A 2FGJA 2XT0A 4X93A 1Q3HA 2WM2A 4DWWA 5BYAA 5L3VA 2GD1O 1X9GA 4HNSA 2PUEA 4K8OA 3S5UA 2KM1A 3QKRB 2G5GX 2JIOA 1QE5A 4MR9B 1CFZA 2CMDA 1USIA 2MWMA 3HY6A 5ENVA 1P4JA 1ZVQA 2FCAA 1H1DA 1W49A 2GO7A 3E5MA 4P36A 1YB1A 1QKIA 1RQGA 4UCFA 2WQ7A 3IIIA 3QP9A 4XH9B 1P9NA 3RADC 2EVWX 4E12A 3M1YA 4EKNB 3FPJA 1RYYA 3LQQA 2C77A 3KQYA 2PZFA 2QG6A 2FY8A 2HD4A 2JAXA 4OHYA 2XVXA 3MWLA 1KI2A 3K96A 4LY9A 4PS1A 4BDSA 3FCEA 3MAAC 4O1HA 3D6VA 5U1PA 2VHWA 4B31A 4I5IA 4PXAA 3R9XA 3QVXA 4XEHA 2TRSB 3LVFO 4PTYA 4FT4A 5MFPA 3P96A 4IMJB 4FQ5A 4RIGA 1TZJA 2QI9C 2WC1A 1VGQA 4L0DA 2PXCA 3WLPA 3EPRA 5DGXA 1I2MA 1P8JA 1AK2A 4B7UA 2VNJA 3SQXA 1GTZA 3ZCQA 1IG0A 1ST3A 1QFMA 3DAHA 1COWA 4MUBA 2ZS8A 4U9IS 1ANKA 1RAGA 3RO7A 2FSVA 3DTYA 1ID8A 3IBCA 3JZFA 4AI6A 2REOA 2VATA 3LO5A 5DLDA 1GO2A 3DMGA 4GX1A 2UZ1A 2GMWA 3A4TA 4RANA 2NUAB 1XVTA 3X1WA 4AP5A 1ZH6A 2HI0A 3VPBA 3I28A 1F2TA 1ZNZA 4GVXA 3A7DA 3IOBA 3QYFA 2JFXA 2BM1A 2PFSA 3SICE 5T4BA 4EY6A 2NU6A 4G5HA 2C04A 1GNVA 1YCFA 4AYTA 1JQ3A 1F7VA 1IY1A 4JJFA 4RQUA 1OC4A 5AR1A 2W2PA 3OQJA 4UXJA 2DUMA 1RTTA 5FH9A 5J58A 1VG0B 1E69A 1DJOA 1K9VF 4JR1A 5JNVA 1OYOA 1Z62A 4NQRA 4TMKA 3SR0A 4BMCA 2AQIA 3UICA 3WB1A 2QD2A 3KG2A 4L15A 3FKSA 4KN6A 1ZS9A 4QASA 1QH1B 1CZHA 1TEXA 3RC2A 3GAMA 3DBLB 3O9ZA 5LBTA 3UOGA 5EQJB 1JSLA 3AYZB 1LLQA 2I3GA 1OXKB 1DIHA 1N57A 3K1JA 2OCAA 3CT6A 2BRUC 2WIKA 3QFCA 3RJ5A 2YWBA 1TVEA 5JYDA 3IEIA 2OGZA 4YA6A 3CBGA 1V37A 4JLJA 4RDIA 3SJZA 3V7UA 4CM1A 1AGNA 3UAOA 1P1CA 3AYXB 2DP4E 4G1VA 4Y6RA 4P3NA 1H2AS 1ADCA 3E5HA 1T9GS 2QOEA 2F8MA 4ZO8A 2D5AA 3CONA 5B58C 5KBYA 2RHHA 5JUWA 3QEKA 3K16A 4QRDA 1KXJA 4OQNA 2W6PA 1GQ2A 1JEQA 3H5RA 3MTEA 2BZ1A 4PAGA 3TCXB 2HN9A 2XZLA 1C1XA 2ODEA 5K0TA 1OXUA 1Q57A 4Y6QA 4YUYA 1SXJD 3PKZA 2HM7A 1CU1A 4PINA 5KCZA 1NBAA 2B4TO 3B1JA 4OGWA 1XALA 4J7CA 1K66A 1GXSB 2OYRA 3E5NA 2ZFUA 2BMWA 3G0IA 4I1YA 4OFXA 2PZBA 2O2YA 4BNDB 3O4RA 2QENA 5BQ3A 3KV3O 4RZSA 3NIBA 3X0DA 1PT7A 1TM1E 1CNMA 3GDOA 1YB6A 1GAWA 3C3CA 1G41A 1NNI1 4HDSA 1TC1A 3TW4A 4RTNA 1QZ3A 2IUUA 2GCNA 5EZYF 1EWKA 4BWVA 4D4IA 5AXAA 2GBFA 3C7TA 2XF2A 4QGAA 1VL2A 1E66A 1GPNA 2R7MA 1LTQA 2WLSA 2KX7A 3OO0A 4PGAA 4LF7B 3KQTA 2WKWA 2X40A 1PX2A 4NMLA 5IG2A 3FFWA 4DCUA 4LZWA 4OQQA 4LE1A 2AG8A 2HOQA 3W5VA 2WT4A 2VJPA 1JDTA 1R27A 3OOEA 1GQSA 4F9FA 2VOEA 3A9VA 4Y2XA 3ZE0B 2FPRA 1YUNA 5LWHA 1L7RA 1JJFA 1VMEA 3FPFA 2H0AA 3Q7IA 4AKSA 5EHZA 3QLUC 3TJRA 5DT2A 1FNNA 3IBYA 3I01A 4DLBA 1UJCA 2P2ZA 4FW9A 4YFYA 2ONJA 1UC5B 2AL7A 1JL3A 2FX5A 4RHFA 4WFQA 3CUEF 4I36A 1EUQA 2CEKA 4MINA 3BL8A 1WVIA 4OHMA 3ZDQA 2PUJA 3TQHA 1SPXA 4PX2A 2FU5C 1YJBA 3D4BA 4M9ZA 4WLOA 1WPRA 5DFAA 4A1FA 5FTWA 2AOUB 1DG1G 3CX4A 3PXEA 2Y9PB 3H4TA 3UJHA 1YJAA 2P68A 3WL7A 1SG6A 4TV9A 5AI0A 4RJLA 1MO2A 1F0YA 1CS0B 1T5DX 5FL7A 4L8GA 4RFSA 4C2BA 1KO5A 3RIGA 2IYYA 4Q18A 4TTVA 4CUZA 4MPTA 2EAUA 3DDUA 2DTXA 1X0XA 1BDMA 3QUQA 4FGWA 4Q39A 2PLRA 4HYYA 5BUSA 2NU7A 2JFZA 3PENA 1ENZA 1EDOA 4RXUA 3IILA 1CUBA 4KAJA 1JFVA 2VHCA 4MVJD 1JDBC 1VE1A 3P4YA 4P3KA 4D8VA 5HK8A 3VU9B 4OBEA 1IWBB 1LF5A 2NXEA 1PSZA 1FQWA 4KQXA 3LBNA 1NMXA 1N1EA 2BHNA 3Q7EA 2PR7A 3TH5A 3AZPA 1IN4A 3FMVA 4MYTA 2QX9A 2JAQA 4AG6A 4EHLA 3OX4A 4KUGA 4D0RA 3QQPA 4M0PA 4F5ZA 2RSLA 2IYXA 2GXAA 1T3LA 2GRJA 2N46A 3CG4A 4QUHA 1BU8A 3EG9B 3JPYA 4NZOA 3O4JA 2HY7A 5E6SB 4PG6A 5CDGA 2CDCA 1P1IA 1Y6RA 2Y1OA 4IYRA 3OF2A 4RD6A 5FV7A 1BS2A 2DSNA 5DM70 5HILA 4OFBA 3SIWA 3DPIA 1U8ZA 2C1ZA 1KDTA 2N1BA 4MNTA 1BX3A 1UMKA 2IYOA 1OX4A 5E7IA 4KXLA 5IAKA 2HJSA 1XFAA 3QYJA 1GAXA 5B3LA 1QIHA 3EVCA 4JB0A 5I45A 3SWWA 1AUXA 4KQIA 1BYUA 3GY0A 2YNMA 5KINB 3H4IA 3DAYA 3AWIA 3ADCA 4GMGA 3D6FA 4NYJQ 1QG2A 5A05A 3B12A 1GUDA 3L4SO 2X5JO 3PQEA 4JT2A 1OBHA 2QR2A 3E7WA 3KUKA 3LWBA 3VR3D 1DARA 3STTA 1ZA1A 5ULLA 2R1VA 2W2NA 3D8NA 5DTMA 3E7DA 3V34A 3KL2A 4DA9A 2X2OA 1Q1BA 3K5IA 5LQAA 2IYUA 5AKXA 3UCXA 2IPMA 1W59A 4WA8A 1E59A 4B73A 3ROEA 2XUHA 2IBSA 2FW6A 1G0OA 1LSOA 3EZ6A 3BIOA 4P53A 4U9HS 1CVLA 2IVZA 3OVMA 1XIVA 3PVCA 5BV7A 1EVQA 1R6BX 4EGFA 2CKMA 3S7TA 2DKNA 1SCKA 4KSBA 4YNBA 5I48A 1QF7A 3SKXA 3HXMA 1H66A 4UHBA 3A2MA 4H0NA 4ZJUA 1ZIXA 1TUBB 4KWEA 3K9QO 5A6SA 3NJ8A 4UNPA 3HVIA 3IV6A 3GUUA 4N9QA 4O4HA 3INYA 4LC0A 5E4FA 1VPWA 4LOAA 1N5IA 2O23A 1RZ3A 1DRUA 5EOVA 1L5RA 2XRZA 2QBYA 3OHSX 4ZAYA 4IWNA 2DFPA 2W22A 1PWHA 1TDJA 3S2YA 3U3XA 4KIWA 2X19A 2X7HA 1UEXC 2Y71A 3VZPA 1WX1A 4GW3A 5LL6P 3GGPA 4AO7A 4EABA 2G04A 2X3YA 4M8KA 4YPFA 3OFND 3NDPA 3ERCA 2VUTA 3D7MA 4BDTA 1FDWA 3QXJA 3FJOA 1J6UA 4HZUB 4ND1A 5KNBA 5T64A 5EKXA 2XXJA 1GPJA 3MUOA 4ETWA 4AP6A 4PVDA 4RTRA 3RVRA 4YR7A 3IP6A 3OUZA 1VSUA 3IBSA 3V6MA 1OIWA 4RDHA 1DEXA 2C92A 1I2DA 2IWRA 3CURA 1D1PA 3Q3CA 4HDAA 1RWVA 2PS1A 1YJXA 2AXNA 2GZMA 2VSXA 4Q66C 3VSBA 3VX3A 3NORA 4M2LA 1DTEA 5L4SA 4IWXA 1K6MA 4YT5A 4DC1A 2JFHA 4E5VA 3WL6A 1F8XA 1KZGB 1T9KA 1I4TD 1FUUA 4RNDB 1P2TA 2OB2A 4Q15A 1Y6JA 4UE2A 4ARSA 5D3QA 1MRZA 1JECA 1TM3E 1UWCA 1WDWB 1XX6A 2AYYA 2NUPA 3HV0A 3BORA 3LPAA 4HXFB 4YRFA 2M6RA 3H0KA 3T52A 2A4KA 2I2CA 1KI1A 2DPGA 4DIEA 4XR9A 5AKKA 3FSJX 4MWTA 4W5RA 1M1NB 3M9WA 4Q3DA 4AFNA 1NMEA 1JTFA 4A27A 3LCCA 1NI3A 1O8BA 1F4PA 1TCAA 1OROA 1MOZA 1RWMA 2FRDC 2WHEA 5A04A 4G5OA 4HVTA 2AFIA 4DMMA 3ZGOA 1RCUA 2GXQA 5JC8A 3KZNA 3AM1A 5HQJA 2MTBA 1E6LA 4UU8A 5ALLA 1TVKA 2Y2VA 5EMNA 3ROGA 4I9HA 5DHPA 2MSWA 5FI5A 3WNQA 4MUHA 3ABZA 2AK2A 1J2UA 2VHZA 3OTQA 2GZSA 5COBA 3ZIAA 4FVTA 4B79A 3KOUA 1E2FA 1IYZA 5DW0A 2V7WA 3LK7A 3T7CA 3AHDA 2B1RA 4AJNA 4H0CA 3EBLA 3LQ4A 4HYEA 2HO5A 4O2LA 4QG3A 3F2VA 2WICA 3RSZA 5A02A 3F5QA 4A3SA 4CQMA 2UZAA 3K73O 4FCCA 1HLDA 4DWOA 4ZHQA 4JYCA 2XBMA 3IRUA 2C8JA 5AK6A 1XMXA 3CSSA 5HDBB 2Z4SA 2Y0CA 4QXRA 1OZAA 2C2BA 2P30A 4J0KA 5BT9A 5IAAA 5KC9A 2ZR0A 3BTUA 1G2PA 1RMTA 1E3MA 3K9BA 2ZAIA 3HWRA 3OQ1A 3G8DA 3OSZA 5K3BA 3VHXA 1X1TA 2I6SA 2HWKA 2WZCA 4AZVA 1TVMA 1Q1AA 1GG5A 4OSEA 3GDFA 4WZBB 5MN5A 1TZMA 1YCHA 2IDZA 3W9SA 3KTFA 4O59O 2E7ZA 1FUEA 3A4IA 3C3WA 4IOKA 4M1MA 2F55A 3L1VA 2X8WA 4MW6A 1MORA 3V8MA 1XD2A 2NVBA 2Z3ZA 4JWTA 3IDAA 4UMFA 4YV1A 5I7VA 1YF3A 1AA9A 4J1QA 3W5AA 4YRPA 3CVWA 4JT4A 5CYGA 2WTAA 1Z29A 1Q7EA 4K9DA 5AM4A 5U4QA 3BT7A 3GV0A 3KTAA 2FPWA 1ULAA 5F2NA 3M1IA 3TR5A 4YMIA 4CKCB 3BWVA 2Y3IA 2GFHA 1EINA 2WTXA 3JZIA 1GKIA 2YFYA 3PBKA 2V3VA 4JITA 2OK8A 3VOAA 5ITZA 3F5DA 5DN6A 4US2R 1EX7A 1FTQA 4Y2QA 2DQZA 5J2TF 3R44A 4UDNA 2OG2A 3OZRA 3ONVA 4KNWA 5LZ8A 2Y0PA 4E13A 4BY9E 3NI2A 2ZRNA 2CCJA 1DAFA 1ZM2A 2PTHA 5FQOA 4DIDA 3I61A 2NWQA 1E2PA 4BO5A 3BMOA 2LD4A 2R751 5BSRA 3BTSA 4AN1A 3H3JA 4XIIA 3CVXA 2HA5A 4ZKEA 2ZS7A 1FXUA 1T4GA 3MNFA 3CRNA 3K1AA 2ID4A 5F9MA 3PVSA 2JW5A 3WC4A 2ZJ4A 3HXPA 1L4FA 4LNUA 3FX2A 4E30A 5IXJA 3PUJA 6REQB 1UFKA 2C94A 3SBOA 2X41A 2D62A 4KXWA 2YWJA 4U7DA 5JFOA 2ZUCA 3ODPA 4D4GA 3KVRA 1GPBA 1CYDA 5TJ9A 2H1WA 3OMLA 2V98A 4MR9A 1IM8A 1GTG1 1COZA 2Q2WA 3EXAA 4XASA 1EP9A 2I2BA 3NEAA 5IDVA 1YJCA 5CXQA 4NV1A 2V9PA 1FX1A 1O9GA 2XE8A 2D13A 3U62A 4CMGA 3KJNA 3W3AD 3FJ1A 1RZRA 1LU9A 2HUPA 3THYB 1D0IA 2PUHA 4URHA 1F9AA 1I8TA 2P5TB 3HU2A 1Y8RB 2OORC 3U7QB 2ADFA 5HZGA 2CLIB 5MFZA 3SGLA 5HSGA 4A8JC 3LLMA 3TGPA 1EVZA 1OCEA 2ZYVX 1ECLA 3H7AA 1U31A 4KRYA 3I1JA 1ESCA 3H5VA 3ICWA 2UAGA 3LUFA 3PV0A 2YN4A 4UREA 3SXJA 1IULA 3GLUA 4JCOA 3DV9A 3TKLA 2X6RA 3DFIA 1JHVA 4YFVA 1LBHA 2PZLA 4NY1A 2BD0A 16PKA 1FRNA 4C7BA 5HQ3A 1YZNA 2QEQA 2FXIA 1HDXA 2XADA 1XQXA 2PH3A 2GM9A 1B8VA 2C8KA 1L3BA 3EXIA 2VNIA 2WUGA 1NVWQ 4IDHA 4IS3A 1MAVA 4K1LA 4V39A 3J81A 4D7AA 3HK2A 4DG5A 1SU8A 3S7ZA 3F74A 3NEYA 3OQ6A 4NK4A 3R5XA 1GR1A 5CA0B 1NVDA 2PJRA 4R54A 2RHDA 2HRCA 4EITA 1ZH4A 2PSHA 2VAMA 3QUTA 4DNFA 1P1BA 4Z8YA 2P4SA 2BZGA 3EZ2A 4PXYA 3MIZA 1Q91A 4J0QA 1RP7A 2YOHA 3KSUA 5I7SA 1D8AA 1DP4A 2J9YB 3JD3A 4NCXA 5K9ZA 3IUSA 4NV3A 1U8AA 3HN2A 4P7KA 2YC4C 3ZYCA 2Q9BA 1JKIA 2SNIE 1Y1KE 1SUDA 2HMYB 2VZLA 1IEWA 3PHGA 3FNFA 1T25A 2I99A 1NUPA 2J6HA 4HLQB 4CKBB 1YR8A 2B8WA 4EBBA 3FVQA 1FDUA 2JDIA 1TCVA 3JRWA 3IQDB 3MINA 1IOVA 4MS1A 3IQIX 4MYSA 1JX6A 1DDOA 1BE0A 3NOQA 3Q98A 2GJ9A 3M0EA 4MP6A 4RF3A 1N6NA 3WY9A 5LQDA 5IDWA 4YS6A 1I6KA 4BXOB 1YVEI 2P2LA 1ISGA 3GJ6A 3JASB 3KZKA 3TO5A 4C6TA 3C41J 1LZLA 3MMNA 4LPSA 1U8UA 4LHXA 4MVJF 5I9NA 3TE6A 3AM3A 3MTJA 1AJEA 5BQ5A 3PNMA 5FPPA 1B3RA 1N8TA 2V8OA 2MCFA 2ZSFA 4KPUB 1WUKS 4DM4A 1W35A 3Q7QA 4K81B 1RM4A 3A2LA 3RANA 3DWGA 1CETA 1ADJA 1SVOA 2IQ5A 3E22A 4YCJA 4C08A 1F6DA 4E07A 2GNAA 5EJMA 4X64B 1JBEA 2MYTA 3AX6A 3NTUA 1Y7TA 3BXHA 4J03A 3OFNA 4OFZA 4QJ5A 2FRDA 2Q28A 4H3KB 4YX9A 1Q0SA 3EW7A 1TTQB 4B33A 3EEBA 5H80A 1Y3HA 4OHXA 3CR3C 4BJ6A 1TTTA 5LP6B 3LKZA 4KVFA 1R00A 4LWPA 1FXWA 4MJXA 1D4AA 5JAOA 3KSBC 5FB3A 5JADA 1J9ZA 1ZA2A 1SKUA 2VDWA 1E6WA 2R6AA 3AF3A 2CNOA 1V5EA 4KMSA 1NDHA 3CRZA 4N5LA 1GRNA 1WTCA 1JDJA 1Z2PX 2FSVC 3F98A 3WNZA 2H1OA 5JYBA 3KEQA 4JBXA 2WP8J 4KKXB 4DSOA 3WYGA 1UKBA 1UZNA 1F0PA 1H3FA 3BTOA 5FWXB 3C3PA 2D4AA 3WGGA 4B4WA 3OU7A 3KPJA 2AF3C 1RI4A 4L2IA 3BSSA 2XGOA 4FB4A 2XMPA 2Z08A 4WNAA 3ILVA 5H70A 1M83A 1YB2A 2Q21A 1K6EA 4NR0A 2YC2C 5BN5A 3AHIA 1XTKA 1K98A 2CFTA 2FZCA 5JSYA 3UG6A 2P77A 1ZCFA 8AT1A 4OQEA 4XAQA 3N2EA 1QQ5A 4KMOA 5IPFA 4BO6A 3BBLA 1CUZA 3KTDA 4CQJA 1VPEA 2WPNA 2PGXA 4BB9A 2F00A 1PNOA 4O2BF 4ZHSA 4ITUA 3NIGB 3AM4A 3K0AB 4HEJA 4LQDA 3UF0A 3TECE 3HR4A 4GWLA 5BPHA 2YZ7A 2A9PA 2R8BA 1DG3A 4PBSA 4Y0NA 1TFUA 3EY4A 3G17A 1RWOA 3HKBA 3EA5A 3URKA 2MMGA 4EUKA 3EZFA 3EQ9A 2AGVA 1OLSA 1A97A 2QROA 2QRNA 3JTMA 3IMGA 1OT3A 1OI2A 2KQUA 1CJCA 1YFKA 1U28A 3IP5A 1DEAA 2GCPA 4DYVA 1OXTA 3D6UA 1SXQA 4GPIB 3E05A 1YOVA 4V0MA 3SY8A 4S05A 4NFYA 4QTTB 3M70A 4HMPA 4BXOA 1JJAA 1FFHA 1U0FA 3BWBA 4ID9A 5MN4A 3O8NA 3KC2A 4HC4A 1NUTA 3SVTA 3AHGA 1PJ8A 2ZI5A 3IPCA 3PQFA 1KE1A 5AK4A 3T0IA 1IVNA 5IC6A 4BWYA 4LZAA 4XXHA 2JD0A 3C5EA 3OMXA 5C8XA 4MQEB 1SUPA 3DE0X 2IIVA 2ZOSA 2FWPA 2Q3DA 1XK6A 5IAOA 4MR8A 2PWZA 1CR2A 4N39A 1VSQA 1QE3A 4IPTA 4U02A 4QOGA 4E2ZA 4TKLA 4F12A 3BK1A 5I4CA 1AXGA 1OXMA 2XB2A 3WNCA 1ISIA 4U4AA 1V1JA 1FYWA 4BB5A 3B36A 4UEOA 4UJ5A 2C0PA 1UC9A 1YRLA 1BDHA 3HP4A 5EN4A 1YULA 4MWOA 4PR3A 3OG9A 3IIKA 2VDOB 1A2OA 2GZ3A 3OLZA 2G71A 1HDOA 3GT4A 3QLVC 3TGLA 1WCXA 4LMAA 1F2UB 2X5NA 3G5UA 3PPVA 1XTBA 4Q7JB 4K6GA 1NW9B 1XEWX 4JB2A 4XQ9A 3HB4X 1XCMA 3I72A 3N3BC 4JP8A 2QR5A 4J2TA 5EJ8A 3MSXA 2I4LA 2PUVA 2I0FA 4FWIB 4GI2A 2W58A 3ABIA 5L4NA 3SQWA 3LF1A 1UIMA 3X1ZA 3W34A 2X76A 3UMJA 1WQ3A 3UAGA 1YDMA 1MQAA 4LF8B 3LSYA 2EP8A 4UCXA 1QLWA 3AFHA 3ZBPA 4BIMA 5IDXA 1ZK4A 1NHGA 4YJGA 4DHWA 1WL8A 1N5JA 1GYPA 2QN1A 4D99A 3FPLA 3WK8A 1R12A 2Z09A 5H83A 5BWCA 3AUTA 3KZOA 4LC9A 4LZJA 2AMVA 1TB4A 1O8CA 3NT2A 1CRLA 5GAJA 4Y2YA 1XOIA 4WTOA 1KO4A 4RACA 4B47A 3SX2A 3W06A 2D1FA 1BXGB 4WESB 1H8EA 1Z18A 2G08A 3CLUD 5IF9A 4R5HA 2QX8A 5C51B 3DLIA 4CU5A 5HWSA 4YRDA 1POWA 3HKBB 1DDIA 4JROA 1I3KA 3FCAA 1HZJA 2HPAA 3BTVA 4I81A 4KFCA 1HV8A 2FWRA 4XUGB 3KYCA 4FKMA 2QQGA 3C74A 1ZQ9A 3I0ZA 5GINE 3KYBA 3SXPA 2PUBA 2WA1A 4H1WA 3GFBA 3A6FA 2FG5A 1SOUA 1V4NA 1X9HA 2IX9A 1WXGA 1U3UA 5EJ2A 3WQQA 4CV1A 3H1EA 5HE8A 4FFRA 3VDXA 1JAYA 4PTZA 4GLBA 2JAUA 4HN4B 5DOZA 5JDCA 2BE9A 4CG3A 2QSYA 3VYVA 1FVFA 1E61A 4M0MA 2OZVA 4NFSA 3WYBA 2F9LA 4ED9A 1DXOA 5KJFA 4WW0A 3VNAA 1RC8A 4AY3A 2FMFA 1XWFA 3QKIA 3SJBA 1N3LA 3L8EA 2M6KA 4F3NA 1CDEA 3EXG1 2YH2A 3JQBA 4DNXA 1C1HA 4KQJA 3PQ5A 1PJBA 2P0YA 3GLQA 4ZHQF 1SXIA 4GEKA 1O6FA 2XAUA 4NBVA 3H2YA 3WK6A 4BPBA 5FOXA 5LZ7A 3F47A 3M33A 2F3RA 2GARA 3GEGA 3JQGB 3MCWA 3V1MA 4EHKA 1XPJA 1BJTA 1G5FA 4BB0A 3V2GA 5JTUA 4ZOLF 3V55A 1CJKC 4I1IA 4OD0A 1VXOA 3T1QA 2H2AA 3ZQKA 3U5ZB 3V5NA 1THTA 1IUOA 2NIPA 1QNFA 4Q19A 3W7VA 3EZXA 4FCTA 2ADOA 1JU3A 1DX6A 3G6WA 4KXVA 1VL1A 4LZZA 2LCIA 4R2MA 1W36B 1JHRA 3KR9A 1MB2A 1B3BA 5DTIA 4TVKA 2ZJBA 4ZWNA 5TT1A 1XEWY 3HACA 3ZWAA 1HQCA 1ZI6A 3MFQA 3IOMA 3BFKA 2G4CA 1NLFA 4F4FA 3E61A 4FOSA 1A9RA 3K71B 3DL0A 4IL5A 3REQB 3T5TA 2R1ZA 1NC3A 4OI4A 1G6HA 3SI7A 5C4MA 4W6ZA 1L4MA 1YCDA 1PGJA 3RS7A 1O2DA 2EEZA 3E9ZA 4GYYA 1XZMA 2XNDD 4OCZA 4C29A 1SUWA 2WINI 4A6EA 3QU2A 5AKYA 1G8KA 3QU7A 3P7MA 3KWJA 2ZBUA 3T12A 3UWKA 3U6BA 1A9ZA 2VKQA 3ME5A 1Y98A 1II8B 2EKPA 1JQJC 1NPYA 1KYTA 3N8HA 5FD8A 3SMQA 3VC7A 3IEMA 1O94D 1JFTA 1S6YA 4KMRA 4JI5B 4N6GA 1W5FA 3GDGA 4PRZA 4ZMBA 1Y80A 3B52X 5J2TB 3D6TB 2D7CA 3O8BA 1C30B 4MJLA 2NVUA 3AP2A 3IERA 1FP4B 4DR5B 3UUEA 5DNEA 3KEGA 3B6EA 2AB0A 3DE6X 3GLHA 3KYJB 5KOIA 4CLXA 2QM7A 4CF3A 1MR3F 3I83A 4LCBA 4W7IA 3QHPA 2ZIGA 5HK9A 2R6DA 1Q22A 3L06A 1LNSA 3DZHA 4O2AF 4MV4A 3I2IA 1R5NA 3F8TA 5EJGA 1ATIA 2YRXA 3QU9A 1JFFA 3ZVNA 4OM8A 1RWBA 4QPCA 2RKOA 1Z75A 1K5PA 2DECA 3QPBA 2D5LA 1NLYA 2HU5A 1ZI8A 1L7PA 4RCYA 3VR6A 2FZ5A 2YYSA 3PWKA 1EIZA 4CMKA 2VUHB 1W46A 1X7YB 2QN7A 2CHQA 3CNBA 2O57A 4UBOA 3LQYA 5BNWA 3ZD7A 2PMDA 3VVMA 4QXAA 1Y37A 3IH5A 2YHSA 4QXOA 1L4UA 2AUNA 4AIIA 5HIAA 2BFBB 1XRPA 2QY9A 5I7HA 3DHVA 4AZ0A 4HGNA 1P1RA 1HL7A 1UBMS 1T8PA 4Z86A 1E5VA 3ETHA 4J76A 1JEQB 4LBYA 1PT6A 2J0QA 4GGPA 5BUQA 4DZRA 1HE5A 1ONSA 3OQMA 2O8CA 2DH6A 4D4LA 2HPHA 1ZC4A 3WSWA 1TYAE 2VZ0A 4BLRA 2W2XA 3M1AA 4TV9B 4MX8A 2ETVA 2PAAA 4JP3A 1NVVQ 1ZISA 4ENTA 4HB3A 5FI1B 2O7VA 3VR4A 3UHJA 1QQTA 3BFPA 2FJ0A 4H6WA 4J0IA 5JLAA 1Y7LA 3TZCA 1K08A 4R51A 4D8XA 1NM5C 2J4CA 2V6FA 1X70A 3F7TA 1T8TA 4G41A 1ZIPA 4LQ4A 3ZCSA 4DDUA 3BAFA 5CA0F 1QGOA 3BSWA 2J5KA 3PC6A 3HZHA 3H2SA 2NX2A 1AQNA 1JRLA 4EM6A 4BO8A 1QRAA 5EMKA 5AI8A 3S2UA 4CLOB 1P17A 1TX4B 5AM3A 4DYHA 2FOLA 4YAFA 4MQLA 1Z5GA 3HN6A 4L57A 3NNSA 4PQRA 2FOIA 2R97A 1EJ0A 2HSDA 3OIVA 4JA0A 2G1PA 1QRDA 3IAM6 5K1ZA 5KOYA 3W3ZB 3E3OA 4TSFA 3FZGA 4RGQA 1YHZA 4E1BA 4YJFA 4AC9A 4B3MB 1T2VA 3JU3A 3DDHA 2QX7A 5EAIA 3TPFA 3VSEA 2BJHA 4Z7NB 1DXQA 1GPLA 1VJ5A 2R25B 1ZOLA 4EVQA 2I6TA 4BX9A 4M60A 5F23A 1KSJA 2WMOB 1M8KA 3B9BA 4DPMA 4W5NA 4M53A 5FUYA 2XZPA 1UIRA 2ZQZA 3UZUA 1CP3A 2OL4A 3EG9A 2O1WA 1DSSG 1Y4SA 5DWVA 3RTEA 1FMFA 3CGWA 5JXWA 2FWNA 4GU5A 1J0XO 4DAEA 1IZYA 1U3GA 4L4XA 2CXSA 4K3UA 3O92A 4PQGA 2Q5IA 2EGHA 4RSRA 2VYNA 1Z6YA 3NUZA 1E6KA 3T1YB 1DU4A 1HO3A 1BMTA 2J8ZA 3Q5EA 1RIFA 1JTVA 1PL7A 1BKYA 4R2LA 2P9TA 1Z8HA 4ETNA 3SOPA 2VF8A 1NFFA 1GSHA 1GLNA 3VR2D 3BE6A 5TLSA 4HAYA 3ZDZB 2G40A 2LIVA 3ASVA 5HM8A 5FPSA 5HA5A 1AQ6A 1SGWA 4I4NA 4ZVSA 1U1EA 4ILKA 1P8AA 5JH7A 3GL9A 2BFDB 3C45A 4RZ3A 1SHTX 5JH7F 4KV9A 1XRLA 3ORQA 4WKGA 2Q3JA 2FN9A 9MHTA 3R5HA 1DV2A 5KYVA 2VBFA 4FGSA 1HSZA 2PUFA 1QVZA 3V8VA 1OWPA 2O0LA 4NG5A 3ZHQA 1VKNA 2OQRA 2HMWA 3AIOA 3NXKA 3AL3A 5KDLA 1MC5A 3HMQA 3DE2X 3R9IA 2O3RA 4MW1A 1YZUA 4AJEA 2GI4A 5A3VA 5KNCH 3QW2A 5IBPA 4FI3F 2A2ZA 5T6MA 3UFXA 2X6TA 1TF2A 3EVGA 1RPNA 1FMCA 1T5TA 1W4LA 4OTZA 5HCUA 1EE2A 4ETIA 3MILA 4TWRA 4LVCA 2PY6A 1M9NA 4EI7A 2OHFA 1H6DA 4NTZA 3QG5A 4JNCA 4FYHA 1Q3TA 3HP7A 1A50B 4IICA 5EZYA 4GI7A 4G5SA 3M4ZA 2NU8A 1PR0A 2Y2UA 2XMZA 5CX1B 3UK6A 4Z6KA 3M81A 1LQ2A 1RU3A 2PH1A 3ZV7A 5KOHA 3AV3A 3G2MA 2BMDA 5E2AA 4MYHA 5DK4A 5JXIA 1BMQA 2GASA 4DTIA 2QA5A 3GZ4A 1GM5A 1ZSVA 2A9OA 1Q84A 4J9UE 4JFAA 4ON9A 3H5LA 4K9NA 3CVVA 1QKJA 1CUIA 1LFAA 2NACA 4WHMA 4IVQA 3KYDB 2V6GA 5DN9A 2XLBA 5G40A 3R5FA 1SCJA 2CL5A 4O63O 4Q9AA 5JZOA 2CFRA 3T5AA 4LX0A 2HXGA 3W77A 4FLEA 2F43B 4F2DA 4CCYB 4DV1B 2MDTA 4KB5A 3GYBA 3ND5A 3ZZTA 1GGVA 2VPTA 2QLFA 4JEMA 1A1VA 4DRXA 4IEEA 1EK0A 1PRYA 1QTRA 2G72A 1F20A 3RYIB 5KYKA 3Q2KA 2XVMA 3ADDA 3L43A 4CVNA 3UCFA 4BFCA 1F0NA 1JJBA 3GUHA 5TIIA 4KIUA 3GDHA 2RAUA 2JLYA 3ROZA 5LB2A 4RTOA 5JR3A 4B32A 5AW0A 3GLHE 2BP7B 4X00A 3C8MA 1K06A 2JIZD 4U8GA 3OLVA 5JH7B 3DMRA 1THZA 3A1WA 3RJMA 4DIKA 3I4LA 4F8YA 1Q14A 1ZIDA 2H5EA 2R6JA 3ENNA 2HRBA 4BGUA 1WW2A 2GBLC 1KFBB 1K63A 1GFWA 1MT0A 2Q6OA 1RI5A 4MA5A 1MEOA 1UP4A 4LYJA 1SD5A 5JPCA 2Q2OA 3SC2B 1LRLA 5T3UA 4E14A 5DX1A 2ZWVA 4OA5A 5CHYA 5FCDA 4X41A 4Z9FA 4ND6A 2UV8A 1UBHS 4H7IA 1KYZA 1VHQA 2FZEA 2XMGA 3D8BA 3IPLA 4LC1A 5ALNA 4F1KA 8ABPA 1ZGHA 3AV0B 3NP7A 2AFIE 2R48A 1PFUA 1U2TA 2OV2A 3NT5A 3QELB 4RD1A 1FYEA 2VXOA 5ABPA 4QBKA 5IF3A 3L4JA 2O2JA 4EZIA 3SS9X 1VHTA 1MU0A 3PGVA 3FWHA 1TE2A 2BFWA 4RV9A 4F85A 5CFNA 1EFDN 4LJ5A 1EGVB 3BEOA 3PUVA 4GBMA 1I4OA 2HNAA 3HJBA 4MVYA 1D2NA 1RM0A 2ONYA 3MUEA 5M29A 3ZDCA 5AMXA 4N0PA 4XFJA 4MO2A 1JSCA 2VJKA 4M0DA 4MW9A 4NYMQ 3AVVA 2OV4A 4GZMA 3KKZA 5SYAA 3E2MA 4F5YA 1PU2A 3AEUB 1RWKA 1G9XA 1P5HA 2CCGA 5IJ0B 1S3GA 4YDSA 3G9QA 4S12A 3LBIA 3K6SA 4H3HB 2JARA 2AJTA 1YKGA 4G23A 4IF6A 4PHCA 5GWXA 2YTZA 3IT2A 1N4DA 3RF6A 2FP3A 4E2YA 1TM4E 5LZ2A 3K9CA 1QIKA 2O0MA 4ZEVA 2VCYA 5A7GA 4X62B 3V1UA 3VVLA 4BNMA 4KR0A 2V7PA 4CL3A 3R7AA 2O0KA 3IJ5A 1NKVA 5EJ4A 5HIIA 2Q8PA 1NMZA 4QGGA 3OURA 4R7GA 3H13A 3G0HA 2FDRA 3T7SA 1U99A 3THWB 3RLFA 4LWQA 4ALMA 4H7PA 5SZHB 5LDGA 6LDHA 2O2GA 2H16A 1VHWA 2WT8A 1C1DB 3GAAA 4MKRA 4WN3A 4X61A 3KSDO 3EOBI 4TYQA 3WVNA 1M1UA 4LRWA 4ZZ2A 1NW4A 2J3JA 3JQ7A 1IZZA 3HB7A 4JJAA 4KHZA 4YLGA 4H16A 1W9MA 5GV8A 4P0TA 1KE2A 3VDRA 4BIIA 1DBWA 2A14A 4H1TA 5CDHA 1IBKB 1OBOA 1V1RB 1HX7A 1E8MA 3DLPX 4CIWA 1TK3A 1A9QA 1H8HA 4TUYA 1H93A 2CDNA 4I4LA 4JNKA 1A4UA 1LK7A 1A0OA 1Y42X 4XCVA 2EJTA 1MJHA 5AUPB 3FFXA 4DLUA 3UMFA 4NCIA 1ODKA 2A33A 3F3SA 3HGTA 3DV0B 5DWQA 3OA0A 4FEEA 4F3YA 5K0ZA 1RI2A 2AD5A 2W8BA 3HO8A 2O05A 3H84A 1SXPA 4C9BA 1U0RA 4ZOBA 4O2AA 3I8SA 3IV9A 3P0HA 2JLXA 4HT3B 1SM4A 1HZZA 2PJDA 3Q41A 3LHSA 1L5SA 1COWD 2YXPX 3W8FA 3KKQA 1QAOA 1ZAKA 2ZB8A 1M2EA 1GA1A 4A6XA 4FBLA 3VR0A 1Z0DA 1WKCA 5BN4A 5CFRA 2GZDA 2ZRFA 3TI9A 4LF5B 3ED1A 3NG1A 3UMRA 5AD1A 1DBVO 1YA6A 2XKBA 1XZLA 1Z5UA 1J5PA 2Z9DA 1YOBA 1CUGA 5BSUA 2GDJA 2DQYA 2QXUA 4TUYB 5TXGA 4KR2A 2Z2ZA 3H2ZA 1I80A 5DF1A 5DXAA 3SMVA 4IMPA 1A2BA 5JCOA 5KWVA 1JIUA 2QL9A 3CY6A 3L6BA 4PFQA 2QW8A 1MJGM 2AR7A 3GLSA 4NHOA 1XB2A 2K7FA 4PC6A 5ELXA 3CCBA 3FVVA 3Q8XB 4B8WA 1T6ZA 3UQYS 2ZJ1A 1DPFA 4M6WB 1N6PA 3PT9A 1E92A 2NN3C 4BBPA 4KNYA 3TLBA 2R87A 4EG4A 1JQKA 2C5BA 2H2WA 4QYIA 1IPHA 4TVBA 1N9KA 2R85A 1FFAA 1VHLA 4HP8A 3HPRA 1QTQA 1BSVA 4IOLA 2H17A 1JR3D 2AEJA 2O2ZA 3ZZNA 3WGIA 2CFSA 1K88A 4IG9A 3WRYA 4X7RA 5ER9A 4AUKA 1QU3A 4EA8A 2BHSA 2DFVA 1U6JA 1Y3CE 2XH8A 3B2EA 3E9EA 5MGBA 1I3MA 2E21A 3I23A 3CH5A 4D0GA 5KOJB 5C8VA 5BXQC 1E6UA 4P31A 3DVRX 4PU0A 2OB1A 2P3QA 2Y76A 2Z8YA 2GPSA 3F8SA 1J8QA 5T5QA 2J0UA 3KQPA 1FYFA 4Q7KA 1P33A 2ZSUA 4E11A 2C98A 5KB3A 4F9EA 5L4LA 3NM5A 3LHDA 3QLVA 2WAOA 2WSSA 3FCUB 2X13A 3MF4A 1YR6A 3GJXC 5BN3B 3M4JA 1QRSA 3VKGA 4YRKA 4DHEA 5BWBA 1JLKA 1L4YA 5FAXA 3VI4B 2V6MA 2ZT6A 3HA3A 2R66A 1KC3A 4F86A 3W0LB 4BQPA 4X0EA 3KT0A 3O2JA 1SBHA 1E9AA 1G3MA 2ZUEA 2R8XA 2DUWA 3JAWB 3NS7A 4PZYA 5CYOA 1DKRA 1AMOA 5JSQA 1S7GA 1GT91 2J0VA 2PEYA 3AEKB 3NBMA 2C07A 4E5DA 4RPJA 1GNSA 3RIEA 1WAMA 2JK0A 2XUJA 3QM1A 5B2FA 4OQMA 4G24A 2DWQA 2FWAA 1RE0A 1J8FA 3F6RA 3HCAA 3N87A 3NQ41 4CR8A 4QGSA 3B8EA 5CDFE 3JVUA 1VI2A 3JASA 5A2GA 4MROA 3SZLA 1G5HA 1TQHA 1A4XA 1PJZA 1T4CA 2GPJA 5JRDS 1SQSA 1T0PA 1WDMA 1I7DA 1C2YA 4YGXB 4EY3A 5CNMA 4F38A 1JYSA 2YRWA 4BNZA 1GXSA 2XUOA 3D5TA 2J9ZB 4M4SA 3T0GA 1UR5A 1EVJA 3MG9A 3CIFA 2DZDA 4RJIA 4EKYA 1WZNA 2X9QA 1Y7PA 1VTKA 2XA9A 3KU1A 2CSXA 1VCHA 4JI4B 3Q0EA 2GKGA 4UU7A 1TTPB 4UE3S 4BJ1A 1XNRB 4X45A 3SF0A 2X0FA 5I7EA 3A0RB 2OHXA 1QH8A 3IHWA 4ZFNA 2MSDB 1Z4JA 1JAIA 3L93A 1KY2A 2VUUA 5ED4A 1LQUA 5K4GA 3WAJA 5J2UF 3UOWA 1UDWA 1ULHA 2P4HX 1KEPA 5HF8A 4PLGA 1ZH8A 2B5WA 3GGCA 3BWMA 2ZJ7A 6ABPA 1B16A 2X4LA 2CL6X 4JMLA 5KHOC 1TIPA 3VZQA 1ECBA 3B78A 4P08A 3D7SA 3OPVA 4I66A 5CRIA 4O4LA 3U13A 2AX4A 1JZTA 4BX8A 1DAPA 2J31A 2WY2D 1S8AA 2CMGA 2R8YA 4J7UA 4ESOA 5CT5A 4R0NA 4BO0A 1C2TA 2WW8A 3VI3B 4GM0A 2D0PB 3BRCA 4Q9KA 4LW8A 5CNJA 1E7WA 4NQZA 3UK1A 1ZM3A 3MAGA 3B8HA 1TCCA 5ECDA 2C3OA 4WOKA 1ND6A 4PZAA 1M75A 4YJKA 3ZE8A 1QHIA 3N0WA 4QDUA 3V8QA 3GIDA 4MUNA 4R6XA 2EQAA 1IXKA 3NX4A 1JLRA 1Z16A 4BUCA 2HV8A 1HK7A 5C9ZA 1C3OA 4V1CB 5F98A 5DPMA 1RTKA 2XVYA 4R2JA 4CM5A 2C4NA 4DA6A 2JLVA 1C80A 5FNZA 1T36A 1O58A 2J07A 2J87A 3F9RA 4H1HA 1GZVA 3OBIA 2C2OA 5IDYA 4DLRA 5IU6A 5IT9A 4DJAA 2II6A 4EUHA 1JU4A 2HU8A 1MX3A 4OBXA 1GUBA 4J43A 4ZQFA 1QAQA 3QVUA 3GCDA 4FMDB 3RH0A 2PTGA 2FSHA 2V96A 1CE8A 3L0OA 4XQGA 4C3UA 4FHEA 4OQLA 1Y4DE 3W2EA 3AU9A 3CZMA 4XARA 3EIWA 5FR2A 1HDIA 1FP6A 3K94A 3LBYA 2F8LA 3ZXSA 4E03A 1BXZA 1H5UA 4NP6A 1FYVA 1TCUA 1UOOA 1WLYA 3HZRA 3TLGB 2XXAB 1CG6A 3LLCA 3TTSA 2RK3A 4KQMA 3OZDA 2JIMA 1IN8A 1PHPA 2HTFA 4UAUA 3RSFA 4RTKA 4BL5A 3GW8A 1BVHA 5D6NA 4UFOA 3TSOA 1GU7A 5EP3A 1I94B 5G53C 3VR3A 1ZM7A 2HRRA 1HTWA 1OE0A 3DYVA 4ARZB 1I2CA 1V26A 4D5EA 1D6JA 3USCS 1THGA 1LPAB 3VGJA 4EKEA 1BIFA 2NMVA 5E9WA 2EFEB 3SIXA 4KP7A 1YZQA 2FN4A 3BC1A 4QQRA 2B4AA 1P2BA 4X94A 4TMWA 5CIYA 1GL7A 3CM0A 4WKCA 1V3TA 2ZW9A 2ZJ6A 3CXUA 2XGMA 2PKQO 3HABA 4MK4A 5GOTA 1E4EB 3A3KA 2O7RA 4B3BA 1GCAA 4U00A 3MHTA 3I64A 4MKHA 3CLRC 5C8YB 3W5CA 1SNYA 2O2EA 2PGOA 5B7NA 2P1DA 2E4UA 2Q4BA 3C7KA 4F45A 2PKCA 3OT5A 2AUTA 3U9LA 2DJ5A 4X60A 2VSNA 1T5OA 2BKVA 4RA6B 3GJYA 1TCBA 2H1VA 1RLTA 3HEBA 2ZT8A 4WZBE 4ZAGA 3RIXA 3F6PA 2NPFA 1Q0UA 3RUFA 2DLCX 3PFWO 1OGYA 4F91B 1LTHR 5K0LA 2I2WA 4JENA 3KPWA 2B1GA 4CLOA 2G63A 3W2TA 4DDHA 4OLFA 2QT9A 3Q8KA 3EMDA 1AS0A 3EVDA 3ZE1B 2V8BA 3CISA 3E8XA 3HDGA 4TSFD 1VSTA 4CIAA 2Q4DA 3N76A 2OCDA 3AESB 3PNLA 4YJ2F 3MBIA 2AV6A 4S2UA 2BFCB 3JWGA 3NOOA 4G4SP 1L8OA 1N0HA 1SVNA 1V9LA 2NQ8A 3M6MD 2HH9A 4JBWA 4M3NA 2Q7XA 4BGVA 1Q0ZA 4QWMA 1BEEA 4XX0B 3DD5A 3UUFA 4TV9F 5ALHA 2OAEA 3N70A 5CLQA 2O50A 2GVDC 3C24A 3QGMA 3TK1A 5BN1A 3F4BA 1Z6ZA 1DTWA 1N2OA 3ICEA 1JF8A 1BS9A 2EFGA 1O95A 5KQMA 4NENA 2J1LA 3WHPA 1JI3A 1T1JA 3NM6B 4UNIA 2FEWB 5G4KB 1XHEA 1G7RA 2O1XA 3LO8A 3MB8A 1KTVA 1P9LA 2NUBA 1S7CA 2HKIA 2W6JA 1JR3E 4QUGA 2Z2YA 4EMTA 3RV3A 1J0DA 1FSFA 1RI3A 2NTNA 3MWKA 4QTYA 2Q07A 2XQIA 1KGDA 3OHMA 1T6BY