1NDQA

Bacillus lentus subtilisin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Savinase
molecule tags Hydrolase
publication title Subtilisin surface properties and crystal growth kinetics
pubmed doi rcsb
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ndqA00
1AVTA 3BPSA 2W2NA 2X8JB 1SH7A 1WSDA 3P5BA 3AJ9A 1BE6A 1A2QA 1TO1E 2Z2ZA 1SBCA 4ZOQI 1BJRE 1GA4A 1NLUA 5JXJA 1DUIA 2PWBA 3OSZA 2HD4A 3DE7X 3QFHA 4YN3A 3DE4X 3WQBA 4CFZA 1TMGE 3L1KA 3ZXXA 4JP8A 1SCJA 1BFUA 4WOCA 5SICE 1DBIA 3BGOS 5AVJA 1SUPA 3AFGA 4KPGA 4AKTA 1BFKA 1YJAA 3GCXA 3VYVA 2PMWB 1CNMA 1PFGA 3QTLA 1AH2A 1S01A 3TECE 4CFYA 2ID4A 1GTJ1 3LPAA 1V5IA 2Z2XA 1SBTA 1ST2A 3DVQX 3EIFA 1YJBA 4K8RB 2WV7A 2ZWOA 5K7SA 3DDZX 2W2MA 1BE8A 1TO2E 3TI7A 2Z30A 4GI3A 4NE7A 3DYBA 1TK2A 1AV7A 1V6CA 3VV3A 1SUBA 1T1IA 2P4EA 3F49S 1GA1A 3VTAA 2QTWB 2Z57A 3DE2X 3Q40A 2Z2YA 4OMDA 5ARCA 1AQNA 5JMOA 1T1GA 1XF1A 3DE0X 2XTJA 1SCNE 1Y3CE 2PKCA 1IAVA 1C9JA 1SUAA 1GNVA 1PEKE 2W2PA 3DW3X 1KDZA 2PQ2A 1KDYA 3ZXYA 3A3OA 1SVNA 4HVLA 1AU9A 1UBNA 1P8JA 3WHIA 2HPZA 1Y9ZA 3I34X 2W2QA 3BX1A 3DVSX 1SBHA 1WMFA 3WIVA 1ZVJA 4B5LA 1OT5A 1P7VA 3GCWA 3DW1X 2SECE 4KG7A 1Y48E 4NMXB 3CNQS 1YU6A 3LPCA 1SIUA 5FBZA 5B1DA 3VHQA 1SCAA 1SUEA 2IY9A 3VSBA 3WIUA 4OV6B 1Y34E 1S02A 3AJ8A 5JXHA 1P7WA 1OYOA 4C3UA 1NDQA 4J94A 3I2YX 1SPBS 1Y33E 1SCDA 4NE9A 5FFNA 4ZARA 1SUDA 1AK9A 3GT3A 3QMPA 4MZDA 2PYZA 1WMDA 3H42B 4BWGA 1Q5PA 1JEAA 4LVNA 1AF4A 3F7OA 4HX2A 3D9QX 1MEEA 3GT4A 1KE1A 2X8JA 4KB5A 1R0RE 5I9SA 1HT3A 1C9MA 1Y3BE 1Y3DE 2GKOA 2WUVA 1VSBA 3A3NA 3DE6X 1CSEE 1MPTA 3DE3X 4LVOA 1C9NA 3Q5GA 3LPDA 1C3LA 1KDVA 5AVKA 5CW1A 1GTL1 1BH6A 1IC6A 1ST3A 1EGQA 1NDUA 1SCBA 2Z58A 3F7MA 4FONA 1GCIA 1OYVA 2DQKA 2SBTA 4H6WA 2G4VA 3EE6A 5B1EA 1TECE 4I0WB 5ARBA 2W2OA 4H6VA 1Y3FE 3SICE 5AMXA 1SIOA 5FAXA 1TM4E 1T1EA 1SN7A 1TM5E 3I37X 2PRKA 3SQOA 2XRMA 1S2NA 1GA6A 4OMCA 1TM1E 1Y1KE 3A3PA 4C3VA 3UNXA 1R64A 1ZVKA 1R6VA 1SELA 2TECE 2ZWPA 2SICE 2IXTA 2Z56A 1PTKA 1THMA 1GNSA 2DP4E 4M1ZA 3VV2A 4DZTA 3I30X 3EDYA 2WWTA 5AQEA 3T41A 4DJ5X 5JXIA 1WMEA 2ZRQA 5ARDA 1Y4AE 3PTLA 1GTG1 2SNIE 1PJ8A 2WUWE 3DE5X 1SBNE 1Y4DE 1KE2A 1YJCA 1SBIA 2E1PA 1EA7A 3DWEX 3DE1X 1WVMA 4DWWA 3PRKE 4RYDA 1LW6E 3TI9A 3D43A 2V8BA 2ID8A 1SIBE 1SUCA 2DUJA 3HJRA 1TM3E 1TM7E 3DVRX 4CG0A 4Z2AA 4WOBA 4AKSA 1GT91 5JXGA 2ST1A 2B6NA 3LXUX 4H6XA 3CO0S 2PWAA
chains in the Genus database with same CATH superfamily
1MLDA 2JAUA 1JU3A 5IVPA 5LD2C 1RYYA 5LBIA 4URHA 1GKLA 1EFCA 1V5GA 4LHZA 1E60A 4PYIA 4Y6PA 3WK9A 1VL5A 1TMGE 4FBGA 1YA8A 5G4KA 1YVUA 3H87A 4JWTA 4C3ZA 2IU6A 3IERA 4OHBA 1N5LA 2VP3A 3OT1B 3HA5A 3KPYA 1JHYA 1QO0D 1GUDA 2MMGA 2PK3A 4DARA 4YQFA 4JB0A 1U7DA 2SKEA 2HMVA 1DIRA 4I5DA 1FLDA 2NGRA 3DBVO 3JARA 4LDNA 2L17A 4QOJA 4OQDA 1CVLA 1YCGA 3G8DA 4BNYA 5JR3A 1M9NA 1OLUA 3JZIA 5T3UA 3U0VA 1I7QB 4JEUA 2GLTA 3JQGA 1V6CA 4QL3A 5BPHA 2EXXA 1FYVA 4HV4A 3MWJA 4DDVA 5JZ9A 2IELA 3HWRA 4IIHA 4ZVKA 4C14A 1G21E 1CEYA 4E5KA 3AWIA 1H2RS 4IGFA 5FNZA 3CINA 3G0OA 1ECLA 1Z0IA 1DBQA 3C3BA 3I58A 4HYQA 1YR8A 4IEEA 4KC0A 5EKXA 1SOWA 4DANA 3FBTA 1OV4A 1OUMA 3DEKA 4WN9B 5AH0A 1XCMA 2WU3A 2PLFA 3KE8A 4RV4A 3H9EO 3R74A 2Y92A 4BNNA 3F6YA 2XOKA 5MGNA 4PSCA 3NM6B 5D7NA 1KGSA 1NPDA 2GD0A 2QX7A 4N65A 3OE4A 5BWCA 5FPSA 4AQYB 3S2ZA 2DQ4A 1I7DA 4NCKA 1QQTA 1KPIA 2JFQA 2OECA 3F9CA 3Q8WA 3WK7A 3O95A 4G0OA 3RKUA 4BRSA 1KZ4A 1EHIA 1YOVA 3ACDA 3EGWA 3R6TA 4WZAE 2GTPA 3R9XB 3MBOA 4ZT2A 3V55A 2XX3A 1T8YA 2QM0A 2WA2A 4HD8A 3RSZA 1QFXA 4DA0A 1BIFA 1RKVA 3ZV4A 5LLDA 3JQQA 3AERB 3LO8A 1JSZA 4P31A 3RS4A 1KZHA 5JDIA 1B8PA 3DYIA 1BW9A 4E7PA 4ZYUA 1GNPA 1U1CA 3RHZA 1JHOA 1X1CA 5FOXA 4DMUB 3KRTA 4RD0A 2NVWA 4RETA 1VA4A 3AO0B 4RLQA 2IOQA 2DPLA 3QM1A 1VB3A 2DCMA 4L0CA 3TQHA 1IE3A 2VDMB 5E3HA 4DG9A 2FP4A 2FPPA 3A4TA 1VKJA 2SKDA 4M1KA 4LJ7A 3T3GA 1O9BA 2W58A 4FC6A 4R51A 1Q21A 2NYVA 4KRGA 1JDPA 3I9JA 5KVVA 2OM2A 3P32A 3VTKA 4EQ6B 3QWAA 1POXA 1RI4A 2K2QB 4LZOA 1YDGA 3REGA 2WQ6A 4FYJA 3PENA 4GP6A 2FW1A 5D3MB 4WMLA 1RQGA 3IBTA 5CPFA 4BMCA 3FHOA 2FEAA 4TWZA 1Q0ZA 2Y6VA 1II8A 3O83A 4FEGA 2V7XA 3TMKA 1EVIA 2ZQ5A 5DCUA 4A6DA 3DDHA 2H92A 1FQJA 1KH2A 2JJ2D 3AZQA 1R8SA 3HL0A 3Q2OA 4TTAA 1PNTA 3AYXB 4XVQA 5F5XA 4BX8A 2F3QA 4MVJA 1DV1A 2FUG6 2JGIA 1QPGA 2HFJA 3WBJA 4JELA 2D00A 4B8ZA 3NWPA 1XL1A 3VYSB 4F2HA 1ZUIA 1XZHA 2DQYA 3DNFA 2YBEA 3KKKA 3RRZA 3SJUA 4BBJA 4BCDA 2VH5R 1USVA 2CVHA 5WRFA 2EBUA 3ZHTA 4CMEC 3DR5A 4D46A 3BWBA 1TYAE 1XJQA 2IUUA 5LKRA 3CISA 2CJWA 4BWFB 3ELWA 3K0EA 1GAEO 2V4MA 4JEHA 2PMFA 2H2WA 1CCWA 4TSKA 4C0JA 1E9AA 3NUGA 5JYCA 3HJHA 1IJEA 2AW3A 3S8EA 4K6GA 3GFQA 3ECSA 4EUFA 2QP3A 3H18A 5A2QA 3Q87B 4P81A 4GXTA 3VNBA 3WK6A 2DQSA 3O4HA 4P4SA 2G9ZA 4EPTA 1T5TA 3WDSA 2QRKA 3EAFA 3I04A 3WHLA 3QV2A 5IN4A 1NONA 1B74A 1BU8A 3EDCA 1YS4A 1SU6A 4OUDA 3FUWA 1RXCA 2J3HA 3IAM6 1ZNQO 2ZBFA 3NBAA 4FDVA 4PGAA 3BQ9A 2JJQA 1IWBB 2I55A 3G7UA 3KD3A 3SC2B 3KZ1E 4LYDA 4G8BA 1RWQA 3PPIA 1TEVA 4BQFA 4Z3DA 3RVDA 1DEAA 4EG3A 1CX9B 2L42A 4GS5A 5LQRA 4QULA 3FSGA 4HDMB 4CV3A 5AFSA 3LVBA 2P79A 3DBOB 4PSUA 2C31A 2OVFA 1WOYA 5BUQA 3VHQA 3PSHA 1C5KA 2COUA 4QVKA 1OH7A 2FSUA 3WY9A 1QHYA 3ZDRA 4QUDA 1A1VA 4JVOA 5ALNA 2QG6A 2FKAA 4ZTBA 3T5TA 3TAHA 4HRYA 2W37A 3WIUA 3RTDA 4B6JA 4U2EA 4BEJA 4CVNA 4R41A 5FH9A 4TM7A 4ZI7B 3H97A 1SCDA 3DDNA 3DLAA 3LX8A 4JFAA 1OBHA 1TC2A 4P7GA 6YASA 1FP1D 5EA2A 1OJ7A 2HA3A 4MZDA 3J81A 2HA7A 4JZKA 4FD2A 2HH9A 5BURA 1OBCA 3NT2A 5KC8A 1G1AA 2JCYA 2HHJA 1KVUA 4WDRA 4ZQFA 5FI5A 3INGA 3W8FA 1NMYA 4IVNA 3U4DA 3AHCA 3S0JA 3IUSA 1GUYA 1H05A 2C8KA 4PG6A 4X1IB 4ARBA 2JJMA 3KDPA 4E11A 4FB4A 5LZ4A 2Z2IA 3LPNA 3NNSA 1M2GA 3UXYA 2QL5A 1QHNA 2JZNA 3KDSE 2IYEA 2NO1A 4FFBB 2ZJAA 4MWZA 3FWYA 3TRJA 3NAMA 4Q3OA 1TM5E 1XTZA 1DFIA 4DT1B 5CD9A 1P2GA 4PGGA 2VDLB 2C00A 4Q4DA 1GGFA 4D4JA 4BB0A 2UXCB 4FS8A 2YWHA 4Z1MD 3TCXB 1NMQA 4IWXA 4Z4QA 1V37A 1WPRA 4KBGA 3MCZA 4TWIA 3TTUA 5AM3A 3H9JA 4GVXA 2BFNA 4J07A 4HX9A 5AHXA 3ZWBA 4B2YA 4D81A 3QOYA 2HMYB 1SG9A 4RIIA 4TSFA 1Q7CA 3CUEF 3MTEA 2IPOA 3FNIA 5TX7A 2ANBA 1W85A 1YDWA 2C58A 3NFRA 4BX0A 1A8HA 3CHYA 4JXXA 1NSYA 1ZMOA 4LBVA 2A3RA 4NSNA 1FIUA 2CZGA 1TYCA 1PWHA 1OMOA 3KWJA 3PLNA 4V0LA 5CDUA 1IK6A 4UE2A 4GOOD 4MS4B 5EPUA 4OHUA 4AJJA 1QE5A 1ABBA 1GAQA 3MWLA 4EY8A 4NQZA 3C6QA 4DRYA 3KG2A 1KJ8A 2YC2C 3TZQA 4LRXA 2QP9X 1KYYA 3ZLTA 3FE2A 5DE3A 3ZXXA 4BGVA 3IMKA 1FVHA 1G6Q1 4UFOA 3GLTA 3HUFA 1EK2A 2NSHA 5BSFA 3CJQA 1Q83A 2AN3A 1OXBB 1GYRA 1FOEB 1Y6QA 2AN1A 2X9VA 3GJYA 4MVJF 5L40A 6ABPA 4MP6A 5A1TA 5LJLA 3T5AA 4EATA 3W2HA 3KT6A 3ZHOA 5TV2A 3IULA 2WSIA 3VR4H 1WTCA 1SRQA 3OT4A 4CKWA 3LXMA 2LD4A 2OGWA 3QTTA 5DCWA 1II0A 4BQPA 1GL3A 3QU4A 4D42A 1TK2A 3H11A 4QGHA 4Q9IA 4AKIA 3ESZA 4L6IA 1RXSA 4ZYZA 1W9HA 2GBLA 1DJPA 1UZAA 3L04A 4EW2A 3DP7A 3LUKA 2YQ4A 4LXIA 3I5MA 5KKAA 1GFWA 4D9KA 4I6GA 3HCRA 1NM5C 1JALA 2A92A 1X74A 3MHPA 1YCFA 1SBQA 4J3FA 1JJVA 1XG5A 1XAJA 1KAOA 2I1LA 2BMEA 2Q2QA 3FVRA 3JQ9A 3RFXA 1JLLA 4CU5A 4M99A 3C8DA 2NO4A 1C7RA 2WVJA 1NIJA 1M6VA 2FLWA 3MD9A 4HNHA 4QVGA 4NH0A 5JVDA 2Z3VA 2E18A 3WLPA 1LPSA 2G07A 4O2LA 5L51A 1FVOA 2FUNB 4UUQA 4KLZA 1NX6A 3EARA 2WKWA 2I66A 1GRCA 1ZWLA 3GY0A 1K4KA 4QDXA 1PJTA 1OXXK 2QQGA 3O1JC 4WNCA 3KUCA 5JANA 1TEHA 4ZC1A 2BPOA 4BWGA 5KX5F 1ZN8A 4I55A 4ZRDA 1ECJA 3UBTA 3VDMA 1U3FA 2O4CA 3TQIA 2V9CA 1XU7A 3HXMA 2GCNA 3FGPA 5AHKA 4MKRA 4F6RB 1NZFA 2WSSD 2QPAA 4B3MB 1JR2A 1SVMA 3R09A 3M2TA 4A3SA 2QTMA 2QAGB 3PIDA 3H1BA 1UBEA 4N5IX 4RHYA 1EEHA 2BFCA 4FU0A 4DCSA 1Z29A 1MEOA 2PVPA 1UPUA 4PY2A 3D64A 4B7UA 3OOSA 1MORA 1UPFA 1WW8A 2Q45A 2XE8A 2WWGA 4PBTA 3AOEA 5HE9A 2FUG1 2VAPA 1CZRA 3I37X 1NPTO 5SY9A 4L8LA 4S0ZA 5ECGC 5JW6A 5HIIA 1RP1A 1Y6JA 3HCEA 2JASA 2ONCA 4PG7A 1ZI6A 4Q5IA 4TTSA 4OGKA 3V2IA 1E2HA 3I05A 3UN1A 2VRWA 5IAEA 3ZVNA 4YCJA 1SVWA 1GFZA 1K7SN 4UW9A 2P7HA 3UK0A 3JPYA 5TVKA 4MINA 2DFVA 1SHUX 3OMWA 4KQWA 4Q1DA 2WUWE 2H4FA 8ATCA 4Q4JA 2NYAA 3CVYA 3L0SA 3CM0A 3KJIA 5GINE 4Q9LA 2QEQA 3I3OA 5I7RA 1PS8A 2JIQA 5AHOA 3NBYC 1FTYA 3GFBA 3FDXA 2NT3A 3TSWA 3KLNA 4PC6A 3L8GA 2YHIB 3A6ZA 3KUDA 4QX6A 3IS3A 4TWAA 3I1FA 3HYLA 3SYNA 1M6YA 4KTVE 1C2YA 4UBKA 3GRCA 1MJNA 2XWPA 3N58A 1J90A 2CDNA 3LTEA 4PN3A 4YUAA 2RB4A 4MO9A 4X8MA 1SQGA 5EMLA 1KI6A 4NONA 2I3BA 4YJ2B 1HURA 1KOFA 2XOXA 3HY3A 4QU0A 1QZZA 5BVGB 3TRIA 3HLKA 4XASA 4WCVA 3NBXX 1DRUA 3TOSA 3WP0A 1GYPA 4X6YA 4D5GA 5F7OA 4XSHA 1REQB 3N2KA 2AHOA 1ML4A 5HPYB 2OCXA 4FHEA 1Z0SA 4X5OA 2OV8A 1MW8X 2QT0A 1CIPA 2W9XA 3W9UA 1P33A 3ZHSA 1O9GA 1FMTA 2UYCA 5MDHA 1BHSA 1DUSA 1QGDA 4F4IA 3IDQA 1CZKA 4MVJI 3EYAA 4R2MA 3GZ4A 3RYCB 3DMTC 4IVRA 3H1GA 1XGKA 2IPNA 1UBRS 4D0RA 5JSFA 3ZXYA 2PGOA 1JFRA 4BBPA 2ZM6B 2J0VA 3QLVC 2I7VA 1I0LA 2YWFA 4I14A 1DEXA 2IZ1A 2BMFA 3Q10A 1G2QA 4EF5A 4J4BA 2ONJA 1N7GA 4HCJA 2G72A 1MENA 2ZTUA 4F9TA 1MG0A 3RV3A 3E5RA 3E9NA 2Q5HA 1B15A 1XZNA 1AZSC 3DT6A 4Y7DA 2G08A 1H5NA 1MQ8B 3JQBA 2O3TA 3FOWA 4N82A 4Z3OA 1CULC 4ZDIA 1XPJA 5FTLA 3H9BA 4HQFA 1EWRA 1H1LB 1UDXA 4RESA 2R8RA 2VHJA 4HRXA 5CVCA 5HG0A 4BNDA 1R0WA 5L3VA 1Y4UA 1Z5GA 3UT5B 1EWYA 1JQBA 4AFNA 5BN5B 3E1KA 3UGJA 1UKVY 1R66A 4COKA 3JQAA 3MJDA 4PSVA 4N9WA 2VP5A 5EZYF 4AG5A 1DWQA 4X62B 4GDFA 1EMDA 3UWPA 3IMCA 3T99A 2JKVA 3JQAB 2P69A 4JJFA 3ETGA 4LHSA 2JBAB 4WKPA 4ZAGA 4ZVSA 2QTNA 4EP1A 1YJXA 4DIBA 2P2DA 4X93A 4PC7A 2ZYDA 4M3NA 2I3GA 2QRPA 3AESA 4OQEA 1RE1A 5EUCA 2QOEA 3DXZA 4Z0PA 2FZKA 5H0IA 5IJXA 1AUQA 4A0SA 5F2EA 4EYKA 1Q77A 2GVNA 3F4BA 4I1VA 4MLDA 4MUEA 4OBXA 5A4AA 1KMHB 3OJEA 4RTOA 1MDFA 2NV0A 1QSGA 4M8NE 4CKEA 5JQWA 4PS0A 4RNCA 1I1HA 1P1RA 1WUYA 2GWHA 1LRJA 2OM6A 5CP8A 3MJSA 1EVJA 2XQKA 3QBDA 1N2CA 1G4AE 2R47A 1K7XB 3MT0A 5LQCA 1RPTA 1EFDN 4NBLA 3HJGA 4H1HA 1X7YB 1NC1A 2A9JA 2W90A 4RLFA 2Y0EA 3DE5X 2XMQA 3GMDA 1KFCB 2ISCA 1SBIA 2C9YA 5GM1A 4NZPA 5F4ZA 2GR9A 3UV3A 4TS1A 2E4WA 4HDSA 3UAGA 1MX9A 3I53A 1XQVA 3ASYA 4V03A 2YY6A 3EWSA 4MWTA 3VH4A 5HRAA 4E31A 3TRFA 3VKVA 3F4LA 2GAJA 1NYRA 1MNQA 4EGJA 4AYWA 1H2BA 2D3TA 3GLRA 4NEGA 4WFQA 5P21A 3M33A 5AVRA 1WXQA 3Q7QA 1WKBA 4P6VF 4NPHA 1ZK0A 3PWSA 4R05A 4AYXA 3RU3A 2XNHA 3T9FA 3EQ8A 1YQEA 3ABIA 4IHJF 2HSWA 4JLNA 2IBTA 5I7EA 2YUTA 1TK9A 2R6GA 1PK7A 3DOEA 3JAWA 3MOGA 3U48A 1RMTA 1W4BA 4DNFA 4JVLA 3W5HA 1MH9A 4MYDA 1NRIA 3SY8A 3T5PA 2IYTA 2J67A 4KQIA 2O0LA 4UEOA 5BMOA 3EK2A 3LDGA 2G5PA 4IKEA 1KR2A 2GKSA 3N9IA 4DEYA 3GFOA 5IAKA 5F76A 4DLPA 4EMBA 1V8BA 1GV0A 3LT5A 1CP3A 3E23A 1T0IA 3GWZA 3ETCA 4LTMA 4GFDA 3E1SA 2CL6X 2PH1A 4E2XA 2BKXA 3VGPA 1Y5IA 3UOAB 1ZJZA 3CEAA 4FE7A 5M5BA 3PJEA 3PQ8A 1R0SA 4K0RA 4L1KA 1R8XA 4RXUA 3AP2A 1E89A 1R0ZA 1CVIA 1WQ4A 2ZR7A 3PP8A 3JRXA 4GXQA 4B6GA 1I8TA 2EJVA 2IX9A 3QITA 3B1ZA 5CGQB 5FORA 2FPGB 2UUPA 2H07A 3AW8A 3P9PA 2DR2A 4G9EA 2GM5A 3EIEA 4LJ5A 3WX0A 3ZIUA 1K8YB 4EJ2A 4FR0A 4MV4A 3Q0IA 2I4MA 3R75A 5HUHA 1PNRA 5KYXA 1S2GA 1CNEA 4JUCA 1JA9A 2YW9A 2X0DA 2G80A 5HTOA 1KORA 3KQUA 4WGFA 3ZJUA 1S2MA 5DX8A 4MR7A 4DM7A 3K9LA 2WAXA 4Z4FA 3N2NA 3RRNA 3SZGA 3AETB 4WEQA 3E82A 1JDSA 4KL8S 4JYPA 4P4NA 4XRRA 3DKKA 4KACA 4L73A 4KOAA 4ZVNA 3BKXA 1NSFA 1N8NA 1O94A 5FI0B 1DXYA 4DR7B 1PZNA 3B1VA 3ILXA 4DBLC 1X8KA 2F8MA 2RK4A 4L5AA 1XVLA 1P5HA 1P2BA 3EXIB 3AGQA 3FMVA 1GEEA 4P08A 1UOPA 3BXEA 3QTLA 4UARA 5HQTA 4IVQA 1Z17A 4YA6A 5E6RA 3B6MA 2FRDC 3O3MB 3ELUA 4AB1A 2C2KA 2J45A 3QIVA 5HUJA 5JI3E 1IZYA 2OOSA 4UU8A 2XZTA 4H3HB 4CDGA 4RZSA 1QOQB 4TTPA 4TXHA 2QRVA 3CIOA 3ZY6A 2BFFB 4I08A 1MIOB 4HYYA 2VJCA 4RD6A 5EZ5A 3RVPA 4QJIA 4DB4A 3PWZA 3FF4A 4LWPA 1C3OB 2J0EA 1TQ4A 1M6VB 4DCJA 2FPSA 3O82A 5HJ7A 4QT4A 3NUQA 3OIDA 2ZWMA 3PR3A 3AUJB 1J2EA 5BNWA 3GLGE 1GRQA 2GETA 2O0HA 3ABZA 4LUCA 3X1WA 1JDBB 4LYEA 2MTBA 3R23A 2WHYA 4QHSA 5GONA 4WL0A 2C61A 2G06A 2AC2A 3DJYA 5CPBA 1PR4A 4KDFA 1TLFA 3NHAA 3RARA 5I4BA 3K6SB 3EPRA 2D5LA 3OLZA 2BKUA 4UQLA 3NVKI 1R5JA 3ZU4A 5CB4A 3NDJA 3HFJA 1W35A 3DEJA 3IUYA 1NW6A 2OBBA 2CHVA 4BAZA 4DV5B 2VSFA 3L49A 2VF7A 4MSUA 4N8DA 1OXMA 4GMHA 2INGX 5SYNA 4NOLA 5LXTB 5AK4A 2X9GA 2BY4A 1B0AA 1WDWB 3KEQA 2WKQA 3M1AA 5DN6A 1VJRA 3C3EA 1G2IA 2YN4A 3WGVA 4DIMA 4EJSB 5JCXA 2C5LA 3IMGA 1Z34A 1MQAA 1Y5MA 3BMXA 2HAEA 2V6FA 3DLIA 4OHPA 3R7SA 1J7KA 2ASVA 1M2WA 2W2LA 1IM8A 1RWPA 3NWBA 4LECA 4P3PA 3QBJA 4YGXB 2GASA 5BN4A 1LRKA 3KIPA 3KJGA 1P1JA 2BKVA 2XB2A 3EPHA 3CF4G 3M5DA 4E32A 1BXRA 2WIAA 2ZSIA 4PIPA 3R7FA 1M1NB 3GJ5A 3QI2A 4ED9A 4EFDA 4X94A 3L7BA 2OG2A 4F7DA 1KVQA 2GRAA 1NLMA 1W36C 3L8YA 4RHUA 2VLBA 3UMRA 1F2TB 2ETXA 2CMKA 3MM4A 4G5GA 3QUBA 1T9AA 3FD8A 1V2HE 4GI3A 1NU8A 3EVGA 2QUJA 1T9GS 2V7TA 4GYKA 1EFLA 4MVJP 2QN7A 2QGNA 4IJ5A 2EQBA 221PA 1R4ZA 3ZGOA 4RTSA 3ER9A 3PC6A 2IT1A 1FXSA 1W7AA 2XWQA 3PICA 3GPIA 3RTAA 3OFNA 1T8WA 1RLMA 2BBTA 3WQQA 4RJ2A 2HWKA 3SYLA 1XI2A 2CC2A 2Y0BA 3QYJA 3SHFA 2JG3A 4H16A 2VXBA 1TAGA 2IIBA 4LCBA 1UODA 4JLMA 1FTGA 1WHSA 2C7VA 2VHQA 4P3OA 2IJGX 4DIUA 5LVAA 4M7OA 2HWUA 1QKKA 3SJBA 1OLXB 1PJ4A 1CZNA 3VBCA 3TM5A 1L8XA 2EARA 4C5CA 1Q19A 1Z13A 3KKQA 3G8AA 3OHSX 3D2BA 1N0WA 3LUAA 3UAOA 3VNVA 4P4LA 2C3YA 3KYIB 3TBFA 1U81A 3RAFC 5BMVF 3PDWA 1FNCA 2F1JA 2YXPX 13PKA 3TZCA 1WMDA 2ZSKA 2WBLC 2ZFUA 3JALA 1IUKA 1P29A 2B8NA 5J4KA 3ILVA 4GXNA 2K4MA 3G13A 4URWR 5EG5A 4AAYA 2FRXA 3KE9A 2IP2A 3L7MA 3JY6A 4V0SA 1E0JA 1NRWA 4JMPA 2AR7A 4NYIR 2EKPA 3JWJA 5JE8A 5AOBA 1Z5PA 2FDXA 3WXBA 5M04A 1V7QA 4LGMA 5EC8A 1NJGA 4PYJA 4IUDS 4V1CA 5ISMA 4YAOA 4Q34A 1G20B 1B0UA 2V97A 1D1QA 1VCNA 1UPTA 1XNHA 3A6KA 3LA8A 4Q3EA 4QXMA 4U9HS 4URXR 1PDVA 1U5CA 5KYKA 2OO5A 2OY0A 5HIAA 5TEWA 4YXWD 3MQ4A 3I52A 1NAHA 3GEIA 4UVGA 1UMDB 1LDYA 3QPDA 3UT5A 4RPHA 1M34E 4ALKA 4P53A 2O7SA 4UE6A 5I7WA 1KFKB 1JLSA 1FP4B 3P20A 5ETJA 1Z36A 5GMOA 3VQTA 1JR6A 1X1EA 2E89A 3FBGA 1T4CB 2WIJA 4JROA 4QFMA 4YAWA 5EOVA 3ZI4A 5J2UB 1UXGA 2HRZA 3JYPA 4O4LF 3F46A 2QAJA 2R1VB 4TT8A 5DBEX 5GV8A 3SN6A 1PT5A 3T12A 1UPCA 4E2YA 2HHHB 1D9ZA 1JN0A 2OEPA 1JX6A 4M9CA 4X54A 3QVJA 4RA9B 1OI4A 5CBPB 4CODB 5K45A 2POQX 3I8SA 3N28A 5TY0A 4MV7A 3HJUA 3UHFA 1AX9A 3KB6A 3RUHA 4GOLD 4DR4B 3D31A 1XT6A 4N03A 4ROSA 3ZGNA 4CKBB 5CB8A 2H1OA 3TINA 3F3YA 4PYQA 1NQAO 1VGQA 1SUIA 4B84A 1IHDA 3G89A 1PZEA 4MQLA 4EVSA 4N47A 4YT4A 4R1TA 1DDGA 3O2QB 1R6AA 4D41A 1WPQA 5FIUA 1BEEA 1A2BA 3V4VB 1Z5ZA 3DLPX 3F98A 3SBDA 2DFPA 1YRWA 3IQHX 4ZCSA 4DLXA 3OZCA 1EXDA 2X6RA 2UZAA 2P9YA 2QJFA 3H2BA 2VBCA 3ZY3A 1BKDR 3H8SA 3ORYA 3NBFA 3K0FA 3LG2A 1R8YA 1YL5A 1KIMA 4AX4A 4M7PA 3GFGA 4D5EA 3U81A 3R40A 4Y1EA 4FWIB 2AVDA 4HQ6A 5AIAA 1PNQA 3EW7A 4BXOA 5KTOA 1T5IA 3NVMB 5G40A 2FRDA 5DHSA 4JI1B 2WUDA 5K0EA 1WQ3A 2J3KA 2QL6A 2WJZB 1DC6A 2Q3CA 3FF1A 1N25A 3M70A 3PFHA 3T6KA 2IYWA 1A7UA 3ZIAD 1I0IA 2OORA 2WV9A 5E2AA 1YMVA 1AKTA 4X7MA 3H84A 1TUEA 2XQGA 3OLCX 3VTFA 2JANA 4IIUA 1YB2A 5EERA 4I81A 1DX9A 1WL8A 3M89A 5A3JA 1DTWB 4KXWA 1K75A 4U9IS 3OAAD 4A92A 3OTOB 5EJ2A 1ESMA 1MB3A 3SLRA 3QPCA 5FTWA 1PD0A 2NO6A 2X7XA 1YAJA 4PZUA 4IV8A 1GAWA 5EP4A 1IWPB 1EX7A 4ATNA 3ME5A 4QIHA 1QU2A 3V8BA 1ZKMA 1C4KA 4Q37A 4BUZA 3A1EA 2X1VA 1ZM9A 3PQCA 1EFRA 1NPYA 2CXOA 3R24A 3GNTA 5E1MA 5E6UA 5GJWC 2BF7A 3KWLA 4BQQA 3UMMA 3PCXA 1K27A 1Q1GA 2ZJ7A 4DRXA 1E18A 2W2LD 4F2GA 2H0QA 1NW5A 1XD2A 2B9EA 2EC5A 2NZJA 4TXJA 4UNSA 4OX9Y 3T0GA 3H1TA 1LW7A 2PV7A 1W8IA 3NIBA 1I2MA 4AN1A 1Z16A 4RFSB 1W44A 5JDCA 5KC9A 2P30A 5FUQA 2OBMA 2YOHA 3GPDG 4IEIA 3RM3A 3U9LA 1QWSA 3S99A 1I6KA 1I2BA 4HRVA 4AS1A 1H2HA 5FCDA 1VKHA 4CKZA 4M8LA 3WZLA 3OQIA 4MJ7A 3G2NA 4B1FA 5BVHB 3U6BA 1U9ZA 1Y3FE 1SBYA 1UBTS 2PFGA 2W2VA 4GPAA 4TLMB 1T1EA 3IVAA 3RUFA 4F84A 2FG7C 3AFNA 4FGKA 1AQJA 4O33A 3QP9A 4X91A 1ZOSA 1ETUA 3NVAA 4Y6QA 2YNMD 2NXCA 4HMOA 3N0TA 2A9RA 5T8KA 2LKDA 4D92A 3IE1A 2TECE 4OHZA 3T9AA 1ADCA 4Q00A 1AOXA 4X64B 2WWTA 5CEJA 1PDOA 5DGCA 1WMEA 1FDVA 1Z5NA 4ZDKA 2AF4C 3O8DA 2B37A 2ZIEA 4XM2A 4HFJA 2P2LA 5G3YA 4HDOB 3EUEA 4C6HA 4K0KB 1LW6E 1OLUB 1R4AA 2IEDA 4C03A 1Z3CA 5EINA 4M8KA 3EULA 4HAWA 2AG8A 3PQFA 2NU8B 4XLTA 4B6PA 5BXQC 2Q4RA 3CUYA 3NP9A 5HS6A 4ZYTA 5CDSA 3DVLA 5JXGA 4Q6BA 3RS5A 5B2FA 1U2DA 5FX2A 4YP0A 5DI9A 2GYUA 4FX5A 3GDWA 2ODNA 1C3OA 4P92A 4F72A 3GT0A 2AS0A 2HD4A 2JD1A 2P67A 2VZ8A 3NC1C 4MUYA 4OHYA 3TK1A 4ABYA 2VPIA 3PF9A 4IM7A 2JLUA 3ZV5A 5CDYA 4JP8A 3UTDA 2IEIA 1KAHA 1BMFA 3CMMA 1K7CA 2Z5FA 2PZJA 3V80A 4F3NA 4PX5A 1FSSA 3MELA 2GHRA 1SZJG 2CXNA 1B4DA 2QRLA 4AL4A 1PX0A 3PUKA 5I45A 2WYIA 2BM1A 2XUHA 2Z6UA 2WJIA 4UBIA 4GGOA 2GGSA 1OIWA 3DEAA 5KSZA 2FUCA 3KV1A 1W4CA 1P4JA 2C5BA 3ZDEA 1CQXA 2Q9UA 1OX5A 2IYOA 1ZLYA 1SOUA 3NANA 3QX8A 2ZATA 1X70A 3X2SA 1QTRA 3R5SA 4BVGA 3Q85A 5CVEA 5FBQB 2GERA 3IALA 3RVRA 4H08A 4EUNA 2GILA 5CA1A 1SXJD 2YJ3A 2F4NA 3DZIA 1AF7A 3MMZA 4Y18A 2NG1A 3VSCA 1WDKA 2J5BA 3BF7A 4AT1A 3QX3A 1USGA 1VECA 2CXUA 1EB8A 1XTKA 1G7TA 3B89A 5D1HA 3AHHA 1JR3A 2ZE6A 3K9FC 1IXYA 2F1KA 3KWFA 1SCAA 1U1DA 3ZI0A 5BW5A 1YS7A 4HG2A 1J20A 4PQEA 4TL8A 2MDTA 1O6ZA 1X6VA 2OC4A 2XJ4A 2NPFA 4R6XA 4NHEA 3OEYA 4GOND 3GJZA 5DNAA 4DNPA 3W05A 1R15A 1FLVA 2X22A 4Q12A 3LL7A 2DUMA 4P5DA 2OPHA 1P4SA 3PHCA 4GU5A 4G97A 1N92A 4B4KA 5SZJA 4EG0A 1I10A 4G85A 3PC4A 4PRZA 4WK4B 3EW9A 3I2GA 4NV0A 4TVOA 1UC5B 1BWSA 1N3BA 1QGYA 3G2JA 3T7EA 3TD2A 8AT1A 4XR9A 1Z39A 3K94A 4JKIA 2A86A 4OOFA 2M6KA 4C0BA 2DPYA 1RJFA 2D62A 4WA8A 1NQUA 2RGUA 3FPSA 4KUEA 3NTLA 2W2KA 4IQ4A 2FGKA 1A82A 1SN7A 3SQOA 3QVXA 1S2NA 2A35A 3PT9A 4BJ1A 2P5TB 3UUGA 4UUBA 3L2OB 1KBZA 4JKYA 2O2GA 2MSNA 3TW6A 1Q0PA 2D2FA 3KUKA 3ICEA 4YBZA 2PUEA 4H7DA 3QEJA 4NDZA 1Z8NA 1CUBA 4C6TB 3Q0EA 3W4JA 2WMNB 1RIFA 4BJ6A 1OWLA 2ZDHA 3U37A 2QTVA 4P33A 3KB8A 3QKSB 4XWWA 3X2EA 5DOVA 3S29A 5HJ2A 1F38A 4ALJA 4LQDA 3WMWA 1IXSB 3EXEB 2NSJA 2PMKA 3ROQA 4B4DA 3GMTA 3IUBA 5ALRA 5AVUA 1IHUA 1EWVA 1DJQA 1IY9A 1T1SA 1VLQA 5KYUB 4AP6A 3GC6A 4MUFA 2RONA 4HWKA 5E8JA 1U3TA 4AMUA 4HT3B 2UKDA 4D3DA 5LOVA 1TGYA 5JC8A 1HUQA 1KJ9A 3H5VA 1U3WA 1YASA 2AK2A 1UQRA 3BAFA 1X2BA 3ZGYA 3ZQ6A 4K2AA 4YRPA 2WWFA 4KXYA 1PUIA 3RVQA 1T35A 3PQ4A 4BCCA 4I3GA 5CURA 4WZZA 5H5JA 4ENWA 2VH1A 2YHBA 4W1QA 3GCXA 5ESRA 5JNTA 3OX3A 1E1QD 2QQFA 1WB6A 4BO6A 3AR4A 3DO5A 1FSGA 1LQUA 3MS4A 5I5GA 1NM5A 2ADFA 2Y27A 5JYEA 1IHYA 4XCVA 2CWWA 1M0WA 4RNDB 4EPYA 4KAFA 1W8DA 1L4BA 1W34A 1XZPA 4EB0A 4R8RA 4Q4AA 2WNHA 1D5WA 2WE8A 3A58B 2W6NA 3G2OA 2VYVA 4EMUA 2O6HA 5C1DA 1L7XA 3FPFA 5DX1A 4L9AA 1RXUA 1Q6YA 2ZI7A 5FBVB 1TADA 2AKYA 4MKFA 3ZE8A 3EPKA 1DIBA 4QWMA 2AFHE 1E79A 2FKNA 3T3PB 4FOOA 4O59O 3S1AB 4J0JA 4RK1A 5AUOB 2IP1A 5JCJD 2HWYA 2QIPA 2J3QA 3THRA 5IWAB 2QL7A 2Z4TA 1IB6A 3B9RA 2COEA 3CNOA 2CUKA 2MINB 2ZJ2A 1P7PA 4B6OA 3R5HA 4W6QA 2ISQA 1RJGA 1ZD2P 3TL6A 3P9KA 1N9ZA 1S02A 2JIRA 1ZAYA 2Z1MA 4LE1A 3W0LB 5JWRA 2C88A 2RBKA 5LDGA 3ITNA 4HZGA 3DMNA 4TS4A 3UEOA 2H52A 4J3NA 5AVZA 2XUOA 3IEUA 3PSAA 4X20B 4ON9A 4KB5A 5IASA 3I6YA 1LEHA 1PG5A 3DE3X 5T6BA 5J58A 1M34A 1SK8A 121PA 1XDSA 2BFEA 3O7WA 1L4FA 5JCPA 2HNKA 3TUZC 2PVSA 3LOPA 2Y1GA 3ZD8A 1QC5A 1XHEA 4LPSA 2YYSA 4QDKA 3ADBA 1DAIA 1ST3A 4KQ6A 4R1PA 4KIFA 2AXEA 4YQEA 2EL9A 2QTCA 4F2WA 2J08A 4UQPA 1A9ZA 1XX6A 2X3YA 2WD8A 3MJFA 5K3EA 3JAKB 4IMRA 2XSZD 3AERA 1WUHS 3ORQA 1KAGA 3GU3A 4KVAA 3RS2A 3EG5A 1GPUA 1G20A 1I4TD 3K0AB 2O8FB 1ID8A 2XE4A 3EVFA 1EM8B 1QVWA 5D6NA 1RHMA 2QD5A 1CUVA 2XECA 4L8YA 4BFWA 2JRCA 3R0JA 5I4KA 1LPNA 4P38A 2BGLA 4E33A 1E62A 1ZGHA 3U19A 2VTEA 5CVVA 1CBUA 2IV7A 2XLBA 1T9HA 2O3SA 1AN9A 2JFGA 2Z4RA 3TI9A 2RI6A 2UXDB 1MFPA 4ZVLA 3ZDBA 2Q8QA 2ORVA 4R2JA 1KARA 1R37A 2YWCA 2EDAA 5KHAA 3ZWXA 4I3HA 5BVGA 2QTRA 2XT9A 4K1XA 1RM5A 1FRZA 3SP1A 1VZ3A 4GKAA 5LOVF 1T34A 4EGCB 4YRCA 5LA6B 1TL7C 4LZJA 1VTKA 1W5FA 2C07A 4JH0A 4P82A 4RA6A 4W82A 4AS2A 1OOEA 1GA4A 5IDQA 1K0FA 2FFJA 4FMPA 4YAFA 1V1JA 3JYLA 4LZWA 3TZKA 1QRRA 3EHDA 4LSZA 1ILEA 1QLHA 4XRGA 4V0QA 4W1PA 5BQFA 1RPJA 1J0XO 3KJNA 4BGDA 3IR6A 1U2QA 2VSNA 2LCFA 5AI9A 5TPZD 1ISIA 4BNIA 3NH6A 4ZJPA 4U0KA 2AHRA 2BHRA 5C3MA 1BGVA 3FUCA 4RS3A 4WADA 3ST7A 1SVUA 4G6ZA 2XCSB 4TUYA 3FUVA 1P6UA 3BMQB 5I9MA 3QA3E 4XVRA 5AJTA 4Z2YA 2JBHA 3WMEA 2WJHA 1JZSA 3A06A 1UDWA 1IYZA 1TUBB 2AJCA 2GK3A 2QY9A 1LNZA 1ZUD1 2XT6A 4NH4A 1QONA 2C4NA 1J1IA 2HYIC 1V95A 2XNCA 1TF5A 4XQCA 1ZGZA 2B78A 5T8KC 4LRSB 2RI0A 4TV9A 3KAPA 3L8DA 3M5PA 2J9FB 2I5PO 2I6XA 4KXLA 2CBXA 3TSAA 1I3LA 1RRGA 2RGGA 1I4DD 1Y9ZA 1Z06A 3OPXA 1PFUA 2WTBA 3JD2A 1N1EA 1YHZA 1IXRC 1H3NA 3P7MA 1VI6A 4X85A 5JFGA 1VHDA 2GN6A 5CB0A 1RXEA 1SIUA 4D97A 4PTZA 1NE2A 2P9FA 3BKWA 3DFKA 1LBEA 3AUSA 2LW7A 3CBQA 3E9CA 4O1HA 4PAWA 1AG9A 1WKCA 4KNWA 4OAPA 4OQPA 4XTRA 2P2CA 3RTBA 1OZGA 3HDQA 1KMMA 3MTQA 1W76A 3C6XA 4TQUS 2NSLA 3AF4A 5ECYA 5JO9A 5KSPA 4MIYA 1HQCA 4QREA 1LZKA 3V7NA 1POWA 2XYPA 3LCJA 1CC1S 5CH3A 5K0LA 3SC6A 2GCPA 4BNUA 1NBME 7ADHA 1ZCBA 3E7WA 2GPYA 2EZTA 3EDOA 3UGQA 4B83A 1Q7BA 3LA6A 3D59A 1S4QA 2UZ0A 1IK4A 1QKIA 2PRSA 4UU1A 1DC8A 2PYDA 4V0ME 1BO6A 4H7IA 1F14A 3C5CA 2PS0A 3G49A 3JQAD 3U1VA 5AK0A 4XD7D 3OZXA 4J1QA 5HSGA 4W9NC 2WVAA 2JK1A 4MB2A 1N8TA 4TRJA 5HNKA 1QO7A 1OASA 1SAYA 2IU4A 2FI1A 4ITUA 1H42A 1MOSA 1QHSA 5BYAA 2BDUA 2OXFA 5AW5A 4S04A 3SAJA 4MI1A 1CE8B 1RM0A 3ILSA 1RRCA 3GA5A 1USUA 4Q03A 1WDLA 2H9IA 1OC2A 2PCLA 2B9VA 3RYHB 1EX6A 2VDPB 4OP2A 4DWJA 4OH7A 1J9GA 4MJXA 2IPLA 3NH9A 2UUBB 1H22A 4WECA 3VJRA 3K5HA 2A14A 1IBRA 3QWHA 4L72A 1WQ1R 1XRSB 4PLCA 3KS9A 5A7HA 2W6JD 4IKPA 2XQJA 5BSRA 3LMKA 4JI6B 2IH2A 1QAOA 1GG2A 3FFWA 5DU2A 3H9GA 3TRDA 3CWZA 2P2ZA 2IP4A 5EJ9A 4J03A 3CLUD 2PWAA 1GRNA 2XRFA 2ZVJA 1K6IA 3ZE0B 4ZZIA 3LO5A 1SH7A 2QRGA 3LOUA 4FK8A 3G88A 3QFFA 4MGZR 8ADHA 5H82A 5IKXA 4F46A 1M8JA 4MB6A 4XX0A 1UKBA 3HU3A 4FUQA 4LZPA 1GUZA 4RIFA 3T1QA 4BBAA 4X1YA 4Z9XA 3CT6A 5HK8A 1OWPA 4QE3A 5CNIA 3ZV7A 1XSEA 2WHXA 2CZQA 3LL4A 4POAA 3CUUA 3I39X 2VT7A 3HCAA 3OO0A 3VYVA 2YXLA 4LJKA 2VZ9A 3TLCA 3FLBA 3IHLA 4L5YA 4EA7A 5IKOA 1ZINA 2UYQA 1EAMA 3HMKA 4JFRA 5ALZA 1ZVVA 3PDIB 3QOWA 1OTHA 1EBUA 4XIIA 4RJKA 2HRDA 3OVMA 1P80A 4XGRA 3K92A 5K0GA 1HE4A 1EVEA 2DWCA 3GJSA 4TXMA 4W1SA 1CZUA 2GPTA 4NULA 5BVHA 3JATA 4RUKA 2PX5A 4TTTS 5LBTA 3U4HA 4H3VA 4EUEA 2VWHA 1XNQB 3ZK8A 1DG3A 3ED5A 1A4UA 1M7HA 1UKAA 3EA4A 3M4YA 3M3HA 4E7OA 4N6OA 2VLIA 3ZWVA 3OEED 4ARZA 3EISA 1WSAA 4QDJA 2MCFA 1E5XA 1RFLA 3PIRA 2Z83A 3QRWA 5COBA 4HLCA 3Q1KA 2C96A 4N0EA 3G5AA 1DQSA 2BEWA 2V8OA 1CYDA 2HZBA 1T0JB 4I46A 4NYJR 3AF6A 4YP1A 3II6X 4ILKA 1FZTA 4ACAA 3GFVA 1TTQB 2HUNA 4IYRA 2PGAA 4EG7A 2I80A 2WWXA 1VG1A 3A1UA 3SDSA 3AUAA 4Q7LA 3RBAA 2ZJ0A 1XKQA 2ZQYA 2IUYA 3K31A 3MFYA 4MDHA 2NZXA 2QLTA 1NQTA 1HOTA 5GADl 3E61A 4M53A 2E4AA 5JQGF 3U16A 2ZIXA 5IAAA 1NUTA 4HX2A 1DTWA 3R5FA 2J09A 1N6KA 1B8VA 1NVEA 1O96A 1UJ5A 1MR3F 3ENNA 3HHPA 5HF8A 4OP3A 2Y1CA 2D8MA 2XOEA 5U1PA 3VC1A 3EXG1 2Y1LA 2HMWA 2JLCA 3T94A 3WQRA 1GSIA 1GPYA 4KOEC 1QUFA 1Z0AA 1VL0A 3LQRA 4BNKA 3M4ZA 3OFKA 3ZCVA 1RS0A 1VJDA 3KCQA 4HGOA 2BFAA 3GH3A 2IYVA 1TJNA 4HK4A 4K6CA 4Q47A 2CL7X 2O14A 1ZHOA 3L7OA 5DTIA 3FCUB 4N1AA 2H0AA 1Y7IA 1YCDA 2R68A 4HXYA 2XB6A 4J0GA 4UHKA 5BWNA 1QB8A 2AFHB 1P9OA 3B3FA 3EASA 3G02A 4ZPXA 5T64A 1W0JD 1NBMD 3W06A 3RF6A 2OUKA 4O4JF 1BTOA 4JLBA 3CRVA 4MHTA 4Y7CA 3WADA 1FDIA 2O3UA 2PUHA 1W2HA 2EDCA 4PPFA 1VGVA 5G1PA 1CY8A 3HZOA 4DC0A 3QOXA 5AOAA 2O8EA 1HLPA 3T7IA 3PGJA 5EIOA 1MTOA 5BOVA 1OILA 2H11A 3B8HA 1Q0SA 4E70A 5D3MA 4TZ0A 4LWOA 2R1UA 1GN8A 3J7AC 4V24A 1TT5B 1ODCA 3M49A 2OXRA 1WIWA 2JCBA 3F9IA 3Q2KA 4G23A 4QFBA 3U80A 1U3VA 1I7NA 2OGZA 4XSGA 3VPSA 3EVAA 1YZLA 1E5QA 3QV1A 4NKRA 2EOAA 1H4SA 2P9ZA 3CVJA 2O0MA 4I1RA 1CJUC 5BOSB 1J21A 5CA1F 5F5LA 3B6ZA 2M6LA 1AJEA 2I7XA 3GXBA 4JL5A 4QODA 1YFZA 5EMNA 2BM0A 1DAFA 4IFTA 4A15A 4RDHA 4BECA 2FOIA 2PTHA 3WB1A 1HYEA 3BXZA 3U4AA 3UJDA 4DMGA 1HT2E 1PGPA 2MSEB 4DTIA 3L7KA 2CCKA 1RBYA 1GTJ1 1TUBA 4BPBA 3ND9A 4YJ2F 5K7SA 2XRZA 3BXXA 4HP8A 5FWDA 2ACEA 4DDUA 5A3QA 4KFCA 4M9UA 3FB4A 1WU8A 1QV9A 1UT5A 1DRJA 3FUTA 3LUPA 2AE2A 1SNYA 1RQXA 4G5OA 4GPTA 4ALMA 1SULA 1XU9A 1U3GA 2VP4A 3VA7A 5CHEA 5A0TA 2FW9A 4LGYA 4QC2A 5G3ZA 3E03A 3LSYA 5JATA 3LT1A 1MO5A 3BRSA 2HR1A 3FLMA 2HI0A 4MWSA 4RKEA 1CLUA 5LQSA 5EIAA 2XAAA 3TLEA 3DAPA 1E2NA 2OR3A 4TQGA 3IUQA 3F5MA 3AL3A 4Q02A 2XE6A 4EENA 4TL7A 4TN1A 1GV1A 3U49A 2A3NA 4GMFA 5AICA 1YZKA 3ZHQA 1NXQA 4JJKA 5BP7A 4MWOA 1BWRA 3HY6A 1D1TA 1PR5A 4PM4A 5K3FA 3TKYA 2JGKA 2G7MC 2W98A 2XGSA 2HDOA 3BXHA 4Z4IA 3GB9A 3L41A 3MIZA 3VO9A 1ZISA 2ZTSA 3CGWA 2HADA 2JBWA 3FTQA 4YQZA 2CL5A 1V8OA 1TKRA 4HNSA 4EBFA 1OREA 2QD1A 5TMDA 1J99A 1NAIA 1JEEA 4TMVA 1SKMA 2Q62A 1DHRA 2FQ1A 4EFKA 3D3WA 1I6WA 4FGUA 3LNTA 1BHJA 3C5VA 1T25A 2KS6A 3VSAA 2XTZA 5EMHA 4NF2A 2FWRA 3PGKA 5H16A 5BWBA 1FY2A 4CIVA 4L3OA 1DO0A 3KFXA 4RY9A 4L8FA 4LC9A 2HBZA 2HHCA 3S3TA 4CM8A 1OXUA 1BRMA 2EZUA 4GR4A 1IY2A 3L0CA 1PZFA 3KU4A 4E0BA 1NKVA 1JXMA 1NXSA 1X15A 1HTBA 2X6TA 3D3KA 5ER6A 2I2DA 1XRRA 4PONA 5FP0A 2C4VA 2AN9A 5K2OA 2R751 4NYMR 4CR6A 2VPTA 1TM1E 3NYRA 3AEQA 1AHNA 1FRNA 1GY8A 2H3EA 2JDIA 3PEFA 5ADVA 3BIXA 4YP9A 4KXUA 1SELA 3E22B 5HZMA 1EE2A 4YXFA 1AV6A 4YJGB 2HPAA 1E3JA 1BDJA 3PQ3A 4PU0A 1L1RA 1A9RA 1JWBB 2FW7A 4FDTA 2IGBA 4QYIA 4G41A 2VNKA 3FCYA 4BU0A 2WWVD 5IP5A 2PRYA 1Z2CA 4KEAA 3W5VA 4AMBA 3HVIA 3SX2A 3KP1A 4RENA 3PZRA 2OFXA 3T3NA 2VC2B 1HMYA 1GKYA 1E69A 4IPTA 2IY7A 5C7IO 3PZBA 4JS0A 5KTNA 5FBLB 1F51E 3QNMA 1XO1A 3VNRA 1JQDA 3MWFA 2D5BA 3LLMA 3NEAA 2WPDD 5E9JA 3MJCA 1T8UA 4FYPA 721PA 2YJTD 1J0DA 2E9SA 5F98A 3DZFA 1E6EA 3ZZUA 4N5NA 3K7EA 4ZU6X 4B17A 4CKEB 1SCUB 2G1UA 1J22A 2ZB2A 5CMLA 3RRYA 2CEKA 3T9EA 4KNVA 1L3CA 3U3XA 1CUYA 4EITA 1TKCA 1YR1A 2AJTA 2H7VA 2IEBA 4LGVA 4MUNA 4R4JA 2OGTA 2JKYA 4OJNA 4AG3A 1OAKA 2DKNA 1EPUA 1Z28A 4XFKA 3DLCA 4JJ7A 3USZA 4C5AA 5JZVA 1O54A 5AIBA 3JZDA 3BCRA 1XVVA 3FGOA 3GBVA 1RSZA 1N2ZA 2J46A 3DOUA 5KYYB 2NUPA 3K16A 2NIPA 3L5OA 3B5EA 1AZTA 2CLSA 3AJAA 4FZJA 1SXGA 2Q3HA 2XY4A 1VRWA 2OZLA 1JS1X 1U2SA 3M3DA 4AWBA 4JJ8A 3D2CA 2PLNA 4EG1A 4LVCA 2QR3A 1JIVA 4CMGA 1J1UA 1T13A 2B4RO 1LBSA 2XTMA 1Z7EA 2BEUA 3Q0TA 2E37A 3ZX5A 4DQ0A 5BW8A 3NHRA 2F3PA 3EZYA 3M82A 4YMUA 2A58A 3KKZA 2IHVA 3O31A 5T67A 5DCLA 2YIJA 1RP7A 4MKXA 2O2HA 1AZWA 2YXDA 3LX6A 3MMNA 3LZCA 4PVDA 1QIIA 1E3EA 4YK7A 2A5FA 1OWNA 2JIDA 5EE0A 3SLGA 4U2GA 3IUJA 7MDHA 2Z1DA 3OPYA 2O2YA 2YZ2A 4YP5A 4BMOB 4V0MA 3K0BA 5EIBD 4I50A 2WIBA 4X90A 4UNNA 4A0FA 1YH3A 5B3LA 1XFAA 5BV1A 3K70B 4KQMA 4HN9A 4QXQA 2FPOA 5F35A 4TKZA 2R8PA 4RVCA 3JVDA 1OWOA 3AW9A 4OQFA 3DT9A 3N0XA 2XV1A 1FS5A 3A9RA 4J9VA 3QIAA 3MGBA 2D3WA 4K46A 1G6KA 2EKDA 3NDPA 4C7KA 1K98A 4F5ZA 5JIBA 1UZLA 4XWOA 2VPXA 4M49A 1EUDB 1UFOA 1XTRA 2HEIA 3ZH2A 5LA6F 1Y8ZA 2R00C 1G8GA 1HT3A 4KK4A 2GO1A 4Y3UA 4EY5A 5A4JA 4NOJA 4KPFC 5ICEA 1LBTA 1F0YA 1DRVA 1M2KA 1C3LA 2J5XA 2D0DA 2NXWA 3NM4A 4X1KB 2Q4TA 3PKIA 3BWMA 4PNEA 2VPPA 3CRNA 3N2IA 2B3TA 2Q2WA 3L8MA 2H65A 2JFXA 3PE3A 4WXYB 3SZ3A 2DQKA 4LJYA 4XGIA 2QG9A 2Y9PB 5JWHA 1KEPA 4NICA 4Q15A 5JBNA 1JHDA 1I24A 1HA3A 1KHHA 1ZRNA 1TTHA 3DSRA 3P2MA 3DFMA 3FAZA 4RS4A 5BN3B 5JH7B 3ZJVA 1J6UA 2FGJA 3L0YA 4D9GA 4DRZA 4PG5A 2H5IA 4MCHA 3D8BA 1GVHA 1WCYA 3KHSA 4QNNA 5J2TA 5KYWA 2HJVA 1V45E 1G98A 3UNXA 2JHCA 2EBFX 3KX2A 3NHPA 4DADA 5HKKA 5AVXA 1HL3A 1UBGA 4G89A 2E5FA 3NOQA 4REQA 3I30X 5FQNA 2G0AA 1U31A 4BASA 5AW6A 2DHDA 1KAQA 1Y4SA 2P9GA 1PR9A 2PZFA 4I4LA 1GRVA 1DG9A 3GGJA 5TB5A 2G9QA 4KFUA 2WB4A 4QOFA 4D74A 3RGGA 1ZM7A 2GN8A 5GAJA 3PXDA 1Q11A 2JF0A 2R8OA 4IINA 5C46F 3OEWA 5KWJA 4NOMA 3W34A 4OLFA 4C22A 4F6CA 1F2VA 3N8GA 5JY6A 4X24A 5ED4A 1AXEA 2VQDA 3FFBA 4G4IA 4GOXA 5EWJA 2WWIA 2A7QA 4BHTA 1LLUA 2SKCA 4V38A 3DVAA 2AR9A 1RYMA 5HMMA 1X7ZB 2NO0A 3WK5A 3IBYA 3OWOA 4LXXA 5EXDA 3ZWMA 2FPXA 5EGNA 4HX5A 4N54A 4LXTA 5FOSA 4NZ9A 5EKUA 1FNSA 2ES4A 3JQRA 5K0NA 3WLEA 2ZOSA 4MXDA 3DMGA 1DKOA 3EB9A 5IKEA 2FSFA 5ALDA 3H3XA 3K4HA 2CVZA 1RQLA 5IHXA 3OX1A 1CNMA 1EUCA 1N2CB 1PZMA 1H9CA 1IBMB 4FHDA 3K73O 5FJJA 5CBPA 4YCNA 2XUFA 3K1ZA 3M6FA 5JI2E 1QGZA 4OH1A 4EA6A 3ILHA 3KC2A 1D6JA 3DDZX 4FFVA 2ZSFA 3BH7A 1R4MA 3MIIA 1Z6YA 3D0OA 1TMKA 3B6JA 1GA1A 1WXEA 2ONKA 2XJ9A 2FW6A 1X14A 2JJYA 3L0ZA 4ZI5A 2CMDA 4C0LA 1LK5A 5A4MS 5HQ3A 1NV8A 4DV3B 1IAVA 1C9JA 1G8FA 4KH1A 1OF1A 5JISA 1NC3A 3KR2A 5B1IA 2UYHA 4KQ1A 4ZC8A 3O8QB 4HMQA 2FG5A 4XVUA 5JLAA 4R31A 2G9VA 3BE5A 3D7MA 4RPJA 5DLYA 1KYZA 5TGDA 1G8YA 5KJEA 2AK3A 4LF7B 3WYNA 2IYPA 2OAGA 5KYYA 4JP1A 2J3IA 1GCGA 2QLJA 1D8AA 3ONFA 4FFWA 4UM5A 2QMQA 2D1QA 4WW0A 1ZCJA 1I4EB 2ERXA 3PPWA 2F48A 1RCTE 2BSXA 1RKBA 1HDCA 1Z6AA 2YZMA 3TGLA 3MWDB 4LF4B 2RCYA 3TQFA 3WSVA 3EDMA 4YUZA 1NSTA 2O8BA 4XEUA 1ONPA 2O1SA 4Q9KA 2PS9A 2TMKA 1B26A 1QV6A 1CQWA 3ROGA 2IZZA 1QLJA 3KT0A 3D81A 4I3FA 5AVWA 1AS0A 3L4SO 4JC5A 1PLLA 3PK0A 1Q14A 4G0PA 4FEAA 1V3VA 3U3JA 4ALIA 1UJ2A 1Y3DE 4OJQA 2NPIA 4LY0A 2O4UX 4QRHA 2AD5A 4ZO4A 4UATA 3SEFA 2Q28A 1GTL1 3BWVA 3D6MA 3NOXA 5JFTA 2X40A 4JXKA 3T0IA 5GP1A 2FRVA 4HSEA 3C6BA 2DETA 1WOMA 1FYXA 1SD1A 4BB5A 4PS1A 5F3DA 2C98A 3L43A 2DU8A 3NS7A 4JHXA 1JHAA 2ZI6A 3N7TA 4RPGA 3RU9A 4XVHA 3EGOA 2HMSA 2FPKA 4MTCA 1P74A 5BT9A 2C82A 1F1JA 1A1SA 1OH6A 1LSOA 4B3FX 2ZU0C 2VRCA 4IGKA 3RSQA 3TTVA 2EQAA 4AF8A 1EKXA 4ZTZB 1KS2A 5ERGB 3KSBC 3WQHA 3MZ0A 2RKWA 1P1KA 2AQ8A 1COZA 5K0FA 1GSAA 1M6EX 4OQYA 3K72B 3QWIA 2XKJE 4PBSA 4BLPA 3FOEC 1FX1A 2K6GA 4N18A 4YJDA 4RHCA 4CDNA 5A9SB 1UJ4A 3AUXA 3IDSA 1DBPA 4MLCA 1YUBA 3K8OE 5THXA 1JPNA 4F3KA 3LQQA 1X87A 3K70C 4DV4B 5JTUA 1E64A 4B3GA 3DL2A 1F12A 1U8YA 4A8TA 3AI1A 1JEJA 2O2CA 3EIHA 2QN3A 2UVPB 1P3JA 4DWOA 3CLVA 4JJ4A 3FZEA 4LMPA 1QJ4A 3GAAA 1XD8A 1HE5A 3QG1A 4LS3A 4PHFA 1XEXB 3TVYA 4OP1A 4F3YA 4G07A 2Q8PA 5LYJB 3P94A 3PYLA 2FQQA 2FMHA 2GPWA 4LZNA 5AW1A 2B82A 2G1AA 1GEGA 5HIMA 3O2SB 3BL5A 3ZH9B 5IC6A 1EZZA 2R1ZA 1AMNA 1SOMA 1E7YA 3EMVA 2XDWA 3WGMA 1L6IA 1UF9A 1Z45A 3KV3O 3TW4A 4E13A 3W3AD 2A1UB 3WGGA 1MB4A 2GCIA 1TA0A 1JVBA 4E5UA 1YRQA 3AKYA 5E7MA 3VI3B 1I13A 1QCCA 1DLIA 2HHAA 2PBRA 3Q40A 4W5TA 3V1LA 3UAYA 2ECFA 4BPRA 4YRGA 2JLWA 3DE0X 2VTBA 4YWJA 1R8QA 4C4XA 1GXSB 3GFPA 421PA 1HNXB 3GGCA 2CJXA 4Z8YA 1FP2A 3A6FA 4URUR 5SZHB 2WPDA 4KUGA 3NJ4A 4CW7A 4FMCF 3WTCA 1ENYA 2HX1A 2IEYA 2BAGA 2M2IA 3DBHA 3FYTA 4QBHA 4UBMA 5EXTA 1E2JA 2RCNA 3V4OA 2RSLA 3WL5A 4CTNA 3HCOA 3O8QA 1G63A 5FBZA 3V1NA 2QY6A 2B20A 3STUA 4UPEA 1QF6A 5EUMA 2WKRA 1QCDA 1QX3A 1S2DA 1S89A 2WJYA 4GQAA 4HNAB 4HY3A 4TLEA 5B36A 1JI0A 3C1OA 3OTGA 3RHFA 5CLGA 4J4HA 3HXKA 1IXZA 3SXUA 1Y8AA 4FHZA 5A0VA 2A0FA 1R0XA 2PZ8A 4NL4H 3WRWA 3ZCQA 5DASA 2ZRBA 3HSKA 1E6CA 1WU7A 1YR9A 2GUWA 4L5BA 1TFUA 3KWMA 1BHQ1 3WKBA 3HUEA 1Q44A 3EHEA 3T4PA 1CQIA 4JU8A 1R0RE 4NLLA 3OM9A 4ZEWA 7GPBA 3DPIA 4EDHA 2J87A 3DKPA 4PFSA 4AUMA 2O06A 3OLVA 4MVJD 5HKOA 1XMQB 4JSYA 4YP6A 4DCGA 4YREA 4ARCA 1P2DA 2J07A 3HVUA 1R50A 4O4HB 3N0RA 1H4TA 2HXYA 4R9UC 5GOZA 2HWWA 1C1HA 1ULTA 3AOGA 4S24A 1K7YA 3HNRA 3LCMA 4FP9A 1IEWA 2WTNA 4TUYF 2BR5A 4D9IA 4UTVA 2FZEA 4X41A 4YV1A 4QNMA 4TVKA 2HRQA 3CRMA 1CS0B 4QICA 2HC9A 2I99A 2IV2X 2BTEA 4DB2A 3DLBA 1FTSA 1HETA 2QUZA 3QY0A 2V65A 1D6SA 3VPBA 3FHJA 1KOGA 1Y82A 4Y1GA 1N0IA 4OYLA 3R7DA 3ROPA 4CNQA 1I9GA 3VZSA 1RJDA 1M5TA 1NUSA 4MWDA 4RAQA 3UJBA 5BNTA 5BSHA 4WFIA 3OX4A 3IESA 2G1KA 2A57A 1UJNA 2D1SA 2BDTA 1EJ6A 3QXCA 1A9SA 1T5SA 3C7DB 4KX3A 1XDUA 4MA4A 3MCUA 2BFMA 2V03A 3ZXIA 4BKOA 2WYOA 2WTEA 1U6IA 1IVSA 4L78A 4RFSA 5KNBA 1X77A 4GPD1 5CK4A 4QBFA 4MQ4A 3IP6A 1YIAA 3LXUX 4EF4A 4EVRA 2BISA 2REQB 2VHYA 3IURA 2IZOA 3LHSA 1NWCA 1PQ4A 3QSYA 3EZNA 5HX7A 2HNBA 2OBNA 1E3WA 1TCCA 3CH7A 3DHEA 3ZTTA 1ML3A 3E84A 4YLYA 5BN3A 1Z68A 4UHCA 3ZU3A 1BDIA 2PWBA 3I4CA 3QJGA 4PGHA 3OZVA 1SOAA 4EABA 2ATCA 1F8FA 4I6EA 1B23P 1OFTA 4BLWA 3AHIA 4DV7B 4PZAA 1LQTA 2C5EA 3HB4X 4TX1A 5IDWA 1DKMA 4GKBA 2PD4A 3QXGA 2JGLA 2PMEA 1EFUA 3HJCA 5AXBA 5FNVF 3T34A 2Q21A 1FU7A 2H9AA 4QGGA 1R18A 2HK7A 4GBED 5DNDA 2LV8A 3LRPA 1V5IA 4F3TA 1X7XB 2VHZA 1Z56C 2QENA 2P6PA 2J7PD 1UAAA 5ECWA 4BEBA 4OB7A 2I67A 1CLEA 3HR4A 5HEKA 4GSYA 3LFTA 2WE7A 2XITA 4ARZB 2BMJA 3FFTA 5ARCA 4MVJG 4Q1CA 1RQNA 3JWPA 3NBKA 5B7PA 4NBKA 4KK3A 1GNVA 1WX1A 5EJFA 2VWGA 2JFWA 3FZQA 3I4LA 4QQFA 3RTEA 4W8HA 4CETA 1RI5A 1NX9A 4DZRA 1RAAA 2R96A 4EGQA 3T7TA 1UWLA 1HFWA 3OPYB 4L0DA 4EHBA 4EL5A 4A6EA 1E1RD 3BK1A 3RTGA 1PFYA 3BBPA 1DV2A 2IEAA 3WIVA 1YFJA 5T6MA 4C0HA 2IHKA 1D2AA 2AE1A 4PCLA 2ZROA 1EBFA 2WUGA 1RM3A 2XNDA 2PFSA 3CTMA 3JQ8B 3LZ6A 5F78A 5FPTA 4D9NA 3HCFA 2J3LA 3P0RA 5IABA 3VVMA 2EF0A 2GLUA 4JVSB 5FF9A 5JXHA 1OLSA 2R25B 3FTPA 3HKEB 3KAKA 4YMTA 3JR3A 1BCRA 1OVGA 1S7CA 1ZXXA 4WNAB 3A14A 1J8FA 3ZE6A 4KAAA 4C4RA 5EKTA 1JILA 4LY9A 4DQXA 5L3SA 4OHCA 1J0EA 3ZW8A 4NARA 4HYTA 3GG9A 4QU9A 1DFHA 1PJZA 5AVQA 4LC0A 4GLFA 1E2FA 1ZZEA 3GRPA 3BICA 4OI1A 4E1AA 4ZRNA 1VKRA 3BRCA 5LIPA 2XVZA 1QO9A 1WBJB 1T8SA 2VXCA 2H4JA 3LZDA 4K86A 1UK7A 2C1EA 2W6IA 5AHWA 3OZEA 1P31A 5L9AA 3MUNA 1EFVA 4LF5B 3TWOA 4IOJA 3DF7A 4FTWA 1HL7A 2H18A 3CZPA 3IJ5A 3M9WA 3UXEA 4DTCA 1PUJA 1H8ED 3ZCUA 1NLZA 1G5HA 2P1RA 1Z33A 2HHLA 5FWXB 1OJLA 5C2JB 1HPLA 1O77A 1VIAA 3NKVA 2IVFA 2P2SA 5IVDA 1Y5RA 4UNIA 2QXTA 3INRA 4GE0A 1DC4A 4NE2A 3IV7A 1NN3A 3OTIA 5EP3A 1ATIA 2J3JA 3HXLA 3MW8A 1F6DA 2O1EA 2X9LA 2JI8A 4FC7A 2CD9A 4HJXA 4NFYA 2ZCJA 3DZDA 5I6DA 1L7RA 4XW2A 3H1PA 5C0OE 3LNCA 4CF5A 4JGGA 2OHIA 5B4TA 1ZSNA 1X1DA 1VCOA 2D5IA 4QSHA 4RZXA 4S2UA 3NFYA 4CG0A 3LUHA 3P97A 4AKSA 4XXHA 1N33B 4R84A 1DX6A 1RQRA 2Y1WA 3HBMA 5DLPA 2X8JB 4YRSA 3OCYA 2JLSA 4UFPA 4KYIB 1EP1B 3QFHA 4G01B 3FI9A 2AN5A 2EJTA 1G3IA 3UMYA 2RHRA 3QVUA 5JPDA 4Y0VA 5CT4A 2YHAA 1YULA 2CBGA 3CJRA 3G8YA 3W2IA 2BR3A 3HS3A 2UUAB 4QDOA 1A9YA 4L4RA 3DAOA 5EZSA 1YJAA 1SKUA 1PBTA 1Z0FA 3EQ2A 1QTIA 3GWGA 3G2PA 1OYYA 3CMCO 1LF5A 1XLTC 3PTAA 2C7PA 2ID4A 3OKCA 3FOFC 3O8CA 1J49A 4KP7A 1A7JA 4GMXA 2IWRA 4PZPA 2X19A 3PUYA 4UVDA 2PKRA 3COSA 3KZOA 1FFGA 1KKUA 1NF2A 1T2AA 4PYLA 3UK7A 4AY6A 4Z4EA 4K9QA 4RLHA 3GX1A 4HWPA 1E3DA 4XCXA 1BS1A 3MAGA 3W8EA 2IYXA 4BNZA 4EO9A 3K09C 5FL7D 2BFBA 2R3SA 1UP6A 2P40A 2JGMA 4TV9B 3W6PA 4G24A 2B69A 1GYQA 1QQBA 4HH4A 1L4YA 4JZYA 4BFVA 1VJGA 3T9CA 4BJ5A 5KVCA 4HVAA 4KI7A 4WLVA 2HGSA 4CMAA 1DCFA 1NASA 1ZAKA 1R6XA 4QAJA 3I28A 1G9XA 3AU9A 2EYUA 3CVUA 2ZSEA 3K09A 2HMTA 1IXKA 1T5OA 4OKNA 1N77A 1GGJA 4YO8A 5SY6A 3VSBA 2IPMA 2PO5A 1QYIA 1U8UA 4HDSB 5KNCD 4OL0A 2X8AA 3AUKA 5TARA 4BFUA 1PS0A 1W46A 3U7IA 1V9CA 4H4DA 4I4TF 4N5MA 5JZSA 1Z2DA 1N0UA 1KQ3A 4BFTA 5LLTA 3KT3A 1YR6A 1KGDA 2VJAA 4N4AA 3GGGA 5SY4A 2C4HA 2VL7A 2BV3A 4XZ3A 3UXHA 3PC3A 4BP9A 1ESDA 5E6UB 1YMUA 2BMVA 1X7XA 3EUAA 4BMDA 1H6DA 2GZSA 1RDFA 5EI5A 1VIYA 2AKAB 2B4AA 1UXIA 2C5SA 1ISFA 2W8BA 2XYQA 2YZKA 3E9MA 3L40A 3MINB 2NOAA 1MOQA 3PFFA 4C4SA 5BRAA 1P72A 3DL4A 5DYNA 1JAIA 4TQAA 5AJYA 1M6NA 4CKXA 4ZI2A 4F9GA 3PNLA 3D6FA 5AKLA 3ZN2A 5KWSA 4IXDA 3PRHA 4J7UA 4CEHA 3QVGB 1BH2A 1NVVQ 2O7QA 4R7ZA 4WY8A 1C7EA 1DS6A 1Y8RA 3HA3A 3JARB 3DAYA 4Y2TA 1CY4A 5EGSA 4R7TA 3K0CC 3SI7A 3PX7A 4IV0A 1ACMA 3NEJA 4B48A 1X39A 1U8TA 3H9UA 3HCWA 3ITEA 4FGSA 1X7WA 3JXEA 3VR5D 3EGXA 3QA9A 1XAHA 3G9TA 2JGDA 1ARZA 3JD4A 1U80A 3KL4A 1RRMA 1N5MA 3OZSA 4KSBA 4CT0A 1EIWA 1JSCA 1ONBA 1QQ7A 3D6TB 1YS6A 2MSDB 1QG0A 3HDTA 4RH1A 1NVWQ 1OX4B 1PJQA 2G3YA 2NTJA 3LUCA 3WLMA 4HPJB 1VFNA 2GKGA 2BP7B 4ZQGA 1QC5B 2EX0A 2GF2A 2M1XA 4F45A 2WJAA 3TYXA 4ZEMA 2F1IA 4JLSA 4Q01A 4MVCA 4JOBA 4AZ0B 3ICVA 1EA5A 1B3BA 3GYBA 1R5NA 5HCNA 5L95A 1NJ5A 1BWPA 1SQSA 1TZBA 3JX9A 4KLAA 1R9JA 4W63A 4X20A 4ZZ3A 3VPGA 3GIWA 1SBCA 1P75A 3QPVA 1MU0A 4IDFA 4E2WA 2BH2A 2WK1A 2VVTA 3ZK9A 5A5DA 1EUCB 3VXKA 1BFDA 4N5DA 2G17A 4FN5A 3T1NA 3MOIA 1YKSA 4FOLA 2FFHA 3FDZB 3G85A 2NAPA 3BE6A 1F6BA 4PXSA 5FB3A 2QAGC 2QTAA 5SICE 5H59A 3A1CA 2OLEA 3GJTA 2AMJA 3DZ8A 4RGVA 3N2EA 1UP4A 1ZL0A 5C7YA 3FDZA 3QE2A 1LUAA 5AI6A 1KP9A 4PTYA 3QNUA 4RZQA 2B25A 3PUJA 2GI4A 3QE3A 1VP9A 4KQXA 3PBKA 4LHVA 4TVSA 4KH0A 1T3HA 1UBLS 2W83A 2YTZA 1D6MA 1K8XB 1CRWG 2R1VA 3QXJA 4XPZA 1QIHA 4DXAA 2JI7A 1ZW6A 1O57A 3DGFC 3DMYA 4FLMA 1QQAA 3B7PA 4EJ6A 4N39A 5DH9A 4YV0A 1MJGA 2XTJA 1A50B 1P0FA 1W4LA 1WKVA 3CLRC 1KDTA 4HQLA 4OQXA 4QGFA 3E81A 3BUSA 4BO0A 5K5EA 3IRVA 1ENPA 1YC5A 2A0WA 1Y89A 2R6FA 4NJMA 3HCCA 1SY7A 3AGPA 3F74A 3JZFA 3T06B 3FYUC 2VHTA 2HW8A 1JBQA 3UYLA 5SZKB 1WSBA 1E1KA 2VNSA 3W4IA 1D4OA 4YEDA 2QQ5A 3D4OA 3FJ1A 1XELA 3CIFA 3LPCA 4PICA 3PU6A 1TVKB 3UT0A 2B2CA 2QXYA 3OUUA 3S81A 4NYJQ 2IY9A 2ZXEA 4XDHA 4QLAA 3N87A 4JITA 1GXSA 4NU6A 1O95D 3QLUC 2UU9B 4G1BA 1KEVA 1A8QA 1XCJA 1GLGA 2FEOA 2RJ3A 4PLYA 2Q9CA 3ZQUA 1YR3A 4X1KA 3MHTA 2OMKA 2WP0A 1OFIA 3DAFA 4OL9A 4RCVA 4GHWA 5DHUA 2Y2UA 4JX8A 4NCAA 5F21A 4MPDA 3BQMB 1RPNA 4YO7A 5COAA 5ALIA 1EEXB 2JHPA 3FZGA 4AJLA 1C4XA 5DTMA 4CMCA 4MYSA 2Y8EA 4XPIB 1NVMB 3HCBA 3JTEA 5CCBA 2IYSA 4FFPA 3VDRA 4HMPA 1A3CA 2DT8A 3PRJA 3M8KA 4H6VA 3VHXA 3HB7A 1LJLA 1CD5A 3PXEA 4KFTA 4XLLA 1HC7A 1ETHA 2O07A 2X2PA 2HCJB 3CNHA 4X45A 4BKMA 4C6TA 1T4BA 2B3DA 2JA2A 1JAZA 4HAZA 4MVXA 2PJDA 3KQMA 4YRRA 1WETA 4UBJA 4C3VA 2A6PA 4QEDA 4QJ5A 5JPIA 3RTCA 3KETA 2JS7A 5ENVA 3RWBA 3WAJA 3KSDO 5MFZA 4A0GA 4CQLB 4WZAB 5K3DA 2E55A 2DKFA 4OI0A 2B83A 1Z26A 2Z9BA 4L9RA 4D3ZA 1HGXA 1TIKA 3JRWA 5EXEA 4BS9A 4DWWA 4EGAA 2QNIA 4RGQA 2FZWA 3WLTA 2FQWA 4W5OA 2JFBA 3FAKA 2FOLA 4JOQA 5TNXA 1TOAA 4D1YA 2QRMA 3W1WA 1IUNA 4M87A 3L7NA 2I6SA 4U7FA 3PFGA 2QTHA 1TQDA 3BRQA 3W8RA 3FZNA 5KCMA 2RAUA 3ZY4A 4G5QA 3IT1A 2VDNB 1NZDA 1FMCA 1M1NA 1DDIA 1P5JA 5DRTA 2QD3A 4JEMA 5CFZA 2HF2A 4BWYA 4HI0E 4E51A 3LGXA 2PSEA 4FPXA 3W3AA 3EVNA 4MV3A 1SR8A 3Q6IA 3G8CA 2ZZMA 2OBYA 4B6EA 5EHQA 4Q1AA 5EHZA 5U4QA 4XM0A 1L7BA 2AG0A 4NENA 3VNSA 2XVYA 4CMHA 3J80A 4XYGA 1N9GA 2DQZA 4AJ1A 5LXTA 4ZEXA 5HOEA 1EVQA 3R0XA 2E5LB 4TVBA 1GKUB 1IG3A 3C4JA 4FSXA 1T91A 3ZI7A 1VOTA 3G5MA 1MA3A 1Y6RA 1C8KA 3LQ4A 1DOAA 1PTJA 3I8OA 3KXKA 3ZZ0A 1NZJA 3LDAA 1BDHA 4RKRA 5HA5A 3SS7X 3THSA 2CNKA 4M0CA 1NDHA 2ZWIA 3DOOA 4GG1A 5ESXA 1SC6A 2GDJA 3C85A 1P6XA 1NFQA 1Q3TA 1DBRA 2VHVA 1ZBQA 4WHMA 4ZXFA 2A0YA 2FPWA 4O02B 3NIGB 4EY4A 1MJFA 4G1VA 3TNDA 4EEXA 3AC0A 3OZAA 5IM5A 4H7KA 5ESDA 1WG8A 1ZU4A 4YJGA 1O0CA 2GBLC 2X4LA 1AQLA 3CVOA 3K0HA 1C0LA 1P2VA 1RIIA 1Y48E 1N8SA 2BFDA 2ZJBA 1WWKA 4LMAA 1Z2PX 2XUKA 1KVRA 3EZFA 4LE2A 4MIEA 2FZCA 4RD4A 3QG5A 1LDMA 2NW6A 1FP7A 1LPPA 4AY3A 1GNLA 5LDHA 2YBDA 2GWRA 5J1TB 2CYAA 4A5SA 2XCLA 3H8WA 4MYUA 2BCEA 3DDWA 4PSKA 2FSVA 1JDTA 1PK8A 1XJ0A 5CCDA 4NPAA 1J42A 4WZAA 5DT9A 2YMMA 5GZ6A 4XWYA 3UMCA 4O08A 2R8YA 2Z8XA 4F8YA 1UOOA 3ZBQA 5JC1A 3KQOA 5FOTA 2K7FA 4G0VA 4Z2AA 4XIFA 4XYMA 3BH6A 1P8AA 4ND5A 5LPNA 2JATA 3PR1A 1E9RA 1EDOA 3URMA 4HBZA 1U5BB 1NF9A 1Y0BA 3VBEA 5LQNA 3FHTA 3I12A 4CWAA 2CDCA 2B92A 2V4ZA 1JEQA 5EWLB 1GU0A 2FHSA 4MUIA 5B1EA 3DB1A 4PLFA 3R3JA 4F7WA 4K9RA 4RM3A 4C43A 1EGMB 2B1RA 2Q0XA 3USES 2RMKA 5FOVA 5K3FB 2IHBA 2FF7A 3UH1A 4RJJA 4R9SA 1A76A 1A71A 2IOYA 4OU4A 1G3QA 4IILA 3G0GA 4PC1A 2YR0A 4UTZA 3W6UA 5KNCA 2PGIA 1P0CA 2QVXX 4MKZA 2XGJA 1GQQA 2AJBA 1SU7A 4KPUA 3HMQA 4URYR 4DJ5X 1BS9A 1WD7A 3JQDA 2ZRQA 2I1WA 5FTKA 1YMQA 2Y68A 2JGNA 3WL8A 3NBZC 2YWDA 2KMLA 3SC3A 4D9EA 4WK6A 3UUFA 1XZJA 4AUKA 4Z7NB 3PD0A 1SCKA 4BRUA 4CRWB 1ESEA 1MT3A 1UZNA 1V41E 2E4UA 2OSVA 3KQPA 5AKHA 5ANRB 4Q7EA 4X8LA 1Z0DA 4QDTA 1X7HA 1N5JA 3C3KA 2A4KA 5EZQA 3K0AA 4X3CA 2ZCVA 2YJGA 3EJWA 4B4OA 2PEZA 2DCUA 3CV3A 5IULC 4HNUA 4EKDA 3TRKA 3JAMA 3SU8A 1RQPA 1ZONA 4MOWA 3WWPA 1MB0A 2GCOB 1S9DA 3R9WA 1XEAA 3R5XA 2W2XA 4BO3A 1QORA 4KVGA 1ZN2A 2PX2A 2BSAA 5TSDA 1UPAA 3I0MA 1DXOA 3QPUA 4UUAA 1ISMA 3ZHVA 3BGOS 5DWVA 2ILVA 1SUPA 2LP4Y 5CJJA 4YYEA 3RDPA 3L8CA 4ENQA 1GDDA 1L5NA 3QJ5A 3K3PA 2A9PA 1NVVR 1JLLB 4AP5A 3OA0A 2E49A 3F2VA 2JJ2A 3IPYA 3MCTA 2QU7A 1E3WB 2IQ5A 1VLHA 3OFJA 3SDZA 1D4FA 3LRTA 4YCAA 1EK5A 3IPRA 2BEJA 3TZHA 3WJ1A 4A82A 3DD1A 2F7SA 1UC4B 3GLUA 5F23A 5L6LB 3IFSA 2B8TA 2DHCA 1KXJA 3ZU2A 1VBKA 1X7YA 1TM2A 1U1FA 1WV0A 2O52A 4W4TA 1MHTA 5ER9A 3EDRA 3O4IA 1J97A 1T6YA 4JGIA 3TTTA 3HR8A 3C8MA 4DLUA 2HQ1A 3C43A 1QZTA 4BMVA 4FDUA 1FUKA 4LJ6A 4IJ6A 1O6GA 2ZB4A 4CKWB 1UWCA 1LGYA 1WULS 3GEHA 3OP4A 3KB1A 3V8RA 4P3YA 1K3UB 3WLQA 1S2LA 3PXGA 1K4YA 3GFRA 1RBZA 1KMHA 2JAXA 4KE8A 3ZWQA 3E1GA 4KW7A 1RCFA 2FQXA 2Q41A 1Y98A 4EJSC 1SFRA 1XDDA 2A5DA 2ZYVX 1SXJA 1X7GA 3K0FB 1OB5A 4JI4B 3N2ZB 2JARA 3JQ7B 1G8HA 4P2GA 4JT8A 4QPCA 1ZA2A 2C2HA 3AIOA 5JZOA 3IYLW 4CLOA 4DBLE 2VJBA 3R3VA 2VO1A 3K1AA 5GV7A 5DM2A 4JJAA 4IICA 3V2UA 2JBAA 4U7DA 2ORWA 2XMBA 3MGGA 2X8BA 1CUJA 1NXPA 3I64A 3JQFA 3GEDA 3LY9A 5D6OA 3KPUA 3A1SA 3PA6A 4L08A 3F8TA 4R1QA 4RSRA 1KE1A 4PNHA 4C2BA 3T3HA 4WX2B 5B53A 4CIYA 4EQ6A 1SHKA 1VLVA 2BUCA 5DBOA 2ODTX 5EQTA 3HB9A 5TR9A 4G8DA 4XAQA 4ZHQB 1EP3B 2Q5FA 2OFPA 3GJ3A 1BOFA 1CUFA 3KCNA 4HDKA 4MMZB 2RGDA 3N8KA 3UWDA 4EB6B 4ONEA 2FPPB 3B13B 3HB5X 3N76A 4N0QA 1FFSA 5C3UA 1GTSA 2DVMA 2FR8A 2R65A 4NJOA 1V96A 4XD2A 3TDKA 1YIDA 2IEZA 2RHOA 4QASA 4C9BA 4YJ3A 1TIPA 4XGKA 2R6JA 1RWVA 3BTSA 3QQPA 2C0CA 4NMLA 3WL4A 2BOVA 5CAEA 2VUHB 5AVOA 5FOUA 2PSSA 4C87A 3VJKA 1L7OA 1R4NA 1A88A 2ERCA 3WIDA 2Y9MB 4FE4A 3O3CA 3UF0A 4ENRA 5LU8A 5F77A 4BGUA 2N47A 3CNBA 3MRXA 4KXXA 3C8ZA 2YIVX 3IKMB 4FJ1A 4K9DA 9LDTA 2GXUA 1UJ6A 1UWVA 3F97A 4CR7A 2FE4A 3F2IA 3SD7A 1LPMA 4LF9B 3I83A 1U8XX 1G2PA 1JKMA 3FCOA 1VE5A 3HEMA 5AK5A 1VHLA 4KGDA 3B52X 2PUJA 2VRCD 4D25A 4L9WA 5HGJA 1NLYA 1K0UA 1X7ZA 4FKBA 1YS2X 2LIVA 4BIIA 4LJ4A 4WOBA 3K4PA 1GT91 2VHWA 2QRHA 1TX4B 2YIMA 1OHHA 3BXFA 1NNLA 1E9FA