1NDQA

Bacillus lentus subtilisin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin Savinase
publication title Subtilisin surface properties and crystal growth kinetics
pubmed doi rcsb
molecule tags Hydrolase
total genus 99
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ndqA00
1NLUA 2X8JA 3GCWA 1KDYA 2X8JB 5I9SA 1GCIA 1IC6A 4FONA 4K8RB 3F7OA 2HPZA 2ZWPA 3VV2A 1S02A 3OSZA 1GA4A 2DP4E 2ID4A 3PTLA 1VSBA 2IXTA 1WMFA 1TO2E 3WQBA 4GI3A 4WOBA 1XF1A 1CNMA 1AU9A 1S2NA 3LPCA 1SBHA 3A3NA 3CO0S 4HX2A 4KPGA 1SPBS 1AK9A 5JXJA 1MEEA 2PYZA 3Q5GA 3DE3X 4M1ZA 2PKCA 3TI7A 2XRMA 1SUPA 1AV7A 1TM3E 2Z2ZA 3DE0X 2W2MA 3DE5X 1GNSA 1BJRE 4AKTA 5FFNA 4JP8A 4LVNA 3F7MA 1IAVA 3A3PA 3VHQA 2IY9A 2SNIE 4RYDA 3TI9A 1Y3BE 2PWAA 5AVJA 3DVRX 2B6NA 3SQOA 3LXUX 5JMOA 3I2YX 3DYBA 3ZXXA 4NE9A 1EA7A 2Z58A 2W2OA 1EGQA 2PQ2A 4OMDA 3DE4X 2SECE 4OV6B 1SUBA 1SCNE 1SBCA 1BFKA 3DDZX 3DE1X 1R6VA 3F49S 2WUVA 4NMXB 4MZDA 1WMEA 1KDVA 1PJ8A 3D43A 1LW6E 1HT3A 3VYVA 5FBZA 1KE2A 3DW3X 1T1EA 1Y33E 1ZVJA 2Z30A 3VV3A 5AVKA 4KG7A 3AJ9A 1GTG1 2W2QA 3GCXA 3I37X 5JXIA 4H6WA 2G4VA 1TM7E 1Y34E 1SUEA 1DUIA 1GNVA 4C3UA 4H6VA 2V8BA 3T41A 3Q40A 4CG0A 1SCBA 1TM4E 1T1GA 1P8JA 1GTL1 1SUCA 1NDQA 1GA6A 5ARCA 1DBIA 3PRKE 1AVTA 1TM1E 1WSDA 1Y48E 1OYVA 4Z2AA 5SICE 3LPAA 1WVMA 3TECE 1AH2A 1C9JA 2GKOA 1C9MA 1SN7A 5JXHA 1ZVKA 2HD4A 1A2QA 4ZOQI 1OT5A 4KB5A 4H6XA 1ST3A 3WIVA 4DJ5X 1Y1KE 2Z57A 3I30X 1SBTA 4AKSA 3ZXYA 2ST1A 4B5LA 3VSBA 1SIOA 1R0RE 4C3VA 5B1EA 2W2NA 1SCJA 1P7VA 1GTJ1 3GT4A 1SH7A 1C3LA 2ZRQA 3DE2X 3BPSA 5ARDA 2TECE 5FAXA 3EIFA 4YN3A 1YU6A 1AQNA 4DZTA 1SIBE 1Y9ZA 3WIUA 3HJRA 4WOCA 2PMWB 1KE1A 1TECE 1YJBA 2DUJA 2WUWE 3I34X 1SCAA 3H42B 5AQEA 4BWGA 2XTJA 4CFYA 1V6CA 1SIUA 1KDZA 3LPDA 1PEKE 1R64A 1JEAA 2ZWOA 1C9NA 1Q5PA 5JXGA 1BE6A 3L1KA 4ZARA 1OYOA 1Y3DE 3AJ8A 3DVQX 3DWEX 1P7WA 3QMPA 1Y3FE 2WV7A 1BFUA 3GT3A 2QTWB 1UBNA 2P4EA 2E1PA 3DE7X 2Z2YA 1Y4AE 1PFGA 3QFHA 3D9QX 3EE6A 4OMCA 1SCDA 5ARBA 1BH6A 1Y3CE 1TM5E 1T1IA 2SICE 2Z2XA 1SELA 1SBIA 1WMDA 1ST2A 1GA1A 5CW1A 3QTLA 3SICE 1NDUA 3DW1X 1GT91 1TMGE 3EDYA 4I0WB 5K7SA 2DQKA 4CFZA 1MPTA 1TO1E 4HVLA 3AFGA 3A3OA 1SUAA 4NE7A 3DVSX 3BX1A 3DE6X 1YJCA 3VTAA 1TK2A 3CNQS 1SBNE 5B1DA 1V5IA 3WHIA 2PRKA 2PWBA 2ID8A 3P5BA 1Y4DE 5AMXA 1PTKA 1BE8A 4DWWA 1SVNA 2W2PA 3UNXA 2SBTA 1YJAA 3BGOS 2Z56A 1CSEE 1SUDA 4J94A 1S01A 1THMA 2WWTA 4LVOA 1AF4A
chains in the Genus database with same CATH superfamily
2E48A 3TZCA 9MHTA 4JR0A 5ALOA 2WYHA 3ESDA 5WRFA 1R12A 2NUTA 4GLLA 3SR4A 1SB8A 2QENA 5COQA 5F78A 2NG1A 3V1TC 2R6FA 3AG6A 2H1FA 1V48A 4BQQA 4OB7A 3D8UA 5J4VA 3B1FA 2A5FA 4B45A 1IVYA 4CT0A 2UYGA 1NG9A 5LIPA 3I6ZA 3V2GA 4LOAA 5B6PA 1JA1A 1GKUB 2RHWA 1PZMA 2JGJA 3DD1A 2NXJA 1W85B 5FL7A 3F46A 2B4QA 2HF8A 4BUZA 2XCLA 2ATCA 3LQ1A 3BXXA 4KXVA 4ZRMA 1CZHA 3A70A 4KE8A 1MGOA 2I4TA 3UKJA 2Q2VA 1C5KA 1TF2A 4EWLA 3L7JA 5KNCH 5HS4A 3QLVC 3NFYA 3WNBA 3ECSA 1EM8A 1FP1D 1YHYA 1WR8A 4G9GA 4PAGA 5GQSA 3FPEA 1KNQA 4AM8A 5TEWA 4FWIB 2P7HA 1TK3A 4H4EA 3CLUD 1K0FA 4UNNA 1HBJA 1XF1A 1PFKA 1ZP6A 5ALMA 2OCIA 2DERA 4DIBA 3CY6A 1TQ8A 1SBHA 4JGGA 1JLLB 2I22A 1KU6A 1PK8A 1L2TA 2Z9DA 2B1QA 2O2IA 4DUGA 2HT1A 3REQB 3P0IA 3G2HA 3TLGA 2PX8A 2A9VA 3E2PA 5CYOA 2HTEA 4JJZA 2R44A 4UUMA 1FP2A 4FSDA 2B7BA 4X5OA 2XUKA 1JP7A 3R44A 4CEJB 2AFRA 2NXCA 3C3EA 4FYJA 5H68A 5LYJA 4FSHA 5E1MA 1OH8A 3O7MA 4F4JA 4CMBA 4UNRA 1JRLA 3G0CA 3IOEA 3PRHA 4L5YA 4ZAVA 1U9IC 1UKBA 4U02A 1E99A 3J80A 1QZ3A 3RYFB 2FI1A 1DDIA 4RORA 3UAGA 3RFXA 5LNK1 3P4UA 3OOYA 4PG8A 1E1RD 2B94A 1HK7A 3HBJA 4I8XA 4U7TB 3ADPA 1VLQA 4ZDKA 2I4OA 3OVMA 5JQGB 1PJTA 1NF8A 2GZ3A 1Y3BE 3ETHA 1TVKA 3EZ6A 1T9GR 4JLMA 4PVDA 4BBJA 3TG8A 4KPEC 1P6UA 2WYIA 2QM8A 3RYIB 1QDUA 3K9LA 2EZ4A 3EJWA 3AV0B 3DTNA 2Q07A 3FHCB 4JA0A 1VA5A 2Q27A 4PR0A 4PN7A 2R6R1 1KNXA 3DS8A 2JCXA 1XLVA 3T9AA 5CG1A 3HJUA 1ITZA 3PUWA 1IDOA 5AXDA 1XAHA 4N5HX 1E7RA 4O29A 3BH7A 4YT5A 5KDLA 5KC9A 3I2YX 4LOHA 2CDAA 3A6PC 4AN0A 2AZDA 3BGDA 2WHYA 5AJZA 4B3MB 4Y9DA 1NXTA 2ZVJA 1EVYA 2O7VA 1F2TB 3C48A 4IDPA 4EF4A 1F6BA 4GS5A 4XWOA 1JKJA 3BHIA 3E18A 1W29A 4CKEB 4E30A 2A84A 2VDLB 3DOFA 3AB8A 2ETXA 3DDZX 3KVNA 4C5CA 4V03A 2CFRA 2ZREA 5U4XA 1VYVA 2HDNB 2R47A 5C34B 4D4LA 3QEAZ 1B8OA 1LLFA 2C4WA 3O1HB 4O4HB 1KQFA 3CTPA 1N6RA 1KK2A 1X1EA 3AG5A 4KO8A 4BLSA 3RT1A 2HADA 3PGLA 1GRQA 4B1FA 5AKYA 4QDOA 2PZGA 3QBDA 1U98A 1H8EA 5LQAA 5JROA 1YFKA 4XDHA 3GEMA 1UPBA 2PX6A 4DR6B 4FKMA 3LUBA 1DFGA 2FR1A 4G8CA 5BNFA 4X6LA 5JBIA 5L4SA 5A71A 4JI5B 1F06A 3B5JA 2J8ZA 3BIOA 4NBKA 2GS9A 2PH1A 1H4TA 2E4AA 4D4IA 4EJSC 2P4UA 5FLYA 5B3LA 2IH5A 1XROA 3U3XA 1CZNA 3HKBB 3CPHA 4BKMA 1CQPA 1DXYA 4DNQA 3C85A 3FKQA 2W6QA 4XJVA 5TS3A 1H2ZA 2BM8A 4TT3D 3GCGA 4R1PA 3NBKA 2OO7A 4MKGA 5I47A 1QIKA 1H66A 1RKBA 2BMEA 3FUUA 3VV3A 1G7TA 1FTWA 2FUG1 3GJ5A 3RC7A 4DR1B 1AKEA 3I58A 1XZ8A 4Z1MD 2QTBA 4CQMB 4MDYA 2MT9A 3I37X 1SUIA 4ILKA 4RA6B 2LDBA 3GUVA 3OICA 1FFSA 3QYPA 5DU2A 3T61A 3TDKA 2ZRKA 3TLKA 4EDHA 4EAQA 1MN6A 3ODPA 3GX1A 4ND2A 5BSVA 1KY3A 2IGBA 1Q0RA 4PZUA 1W4CA 4TLLB 1SWVA 3AF0A 1VIVA 2E3JA 2K2QB 4TUYB 3UMBA 4ISCA 1CUFA 1NU6A 3MWLA 1XLUA 1DKLA 2AZTA 5FIUA 5HCIA 1HE3A 1QVWA 3CBQA 2CZCA 3QG5A 3BRQA 3EG9B 3VOBA 1L5VA 4C3UA 1OWOA 2QLBA 2ZR0A 3JQPA 2OV1A 1T10A 3BWMA 2C7BA 1A9SA 4JT4A 2XB4A 4ZFNA 3TRIA 5KWIA 5IK2A 2V8BA 4O1HA 3T41A 4R54A 4IZHA 4GMHA 5IW8A 1QB8A 2W6OA 3EZFA 4EKNB 1J22A 3AFNA 4ZOBA 3I6QA 1SCBA 3AIIA 3QGMA 4IKOA 4HZGA 1WUHS 4H15A 3ZBUA 4LXYA 2C2OA 5IDVA 5A0TA 4FCWA 3G6KA 3ID6C 4KSCA 3UWOA 4Y6OA 5D7BA 4H0NA 3NTRA 4AMBA 1U8ZA 1USWA 4UE3S 1YTLA 2UYOA 1QPGA 4R0MA 4KITB 3QQ5A 2HEGA 3L8YA 4WXPA 4H7HA 2XQIA 5HKKA 1NW3A 4MB6A 1YQUA 2W6PA 2GFHA 4XDZA 1RVDA 3AVPA 4D8TA 4WLOA 1DARA 3F4LA 3TJZA 2WILA 3MMNA 3MRXA 2CNLA 3LBNA 3QHQA 5K03A 4IQGA 4RHUA 1XWFA 3GLSA 2IV7A 2N47A 3ENZA 5C8YA 4XQ0A 1ZUD1 2JVIA 1ECCA 2GCGA 1DPFA 1LU9A 2P3SA 3B8HA 3DDOA 3KG2A 3NHWA 1T3GA 3ULKA 4EFNA 4AY2A 1IBKB 1PEYA 4GQBA 2D5AA 4H1HA 4RD2A 3IDFA 4MUGA 3CVUA 4B34A 1QGZA 4RIGA 2VTEA 1F9EA 4O4IF 2C2HA 3GUCA 4TSFA 1JLSA 4UZEA 3FMFA 1YQGA 1RC1A 3I28A 2P5UA 4QWWA 5BN5B 1GZ5A 3UTDA 5DM0A 3TO5A 1WULS 1YK1A 2YWEA 4NABA 5EZSA 1KMHB 2DBRA 2FDCA 4I6GA 3FIJA 4X8OA 2ZDGA 2DPXA 4W6QA 4HUTA 1OLUA 1AKVA 1RJGA 2FZ4A 2MDTA 5COAA 1GPDG 5BNWA 2IS1A 5BUQA 4I1PA 3BFXA 2HSZA 5L3VA 2WPDA 4URUR 1ORHA 3VI3B 1BCRB 1CY0A 2QL5A 4CLOA 3RWBA 1E5TA 1TRHA 1IQUA 4B3CA 1OJ7A 5TE9A 4LOKA 4NBLA 3U9TA 3FD8A 5JC8A 3KUXA 1XJWA 2HNBA 4E94A 3G9TA 1Y1TA 1IDN1 3PXXA 3QG1A 5B1EA 3FY4A 1PS0A 4TV8B 2OHOA 4GXTA 1ZQ9A 3ETGA 3V1KA 4ZEVA 4LJSA 3GT4A 3PLNA 3S3TA 5HZGA 5JI2E 4EGSA 5IARA 3BF8A 4BQPA 4RDIA 2FQQA 4XYGA 1L5OA 2NU6B 3QA3E 4JOCA 2FPOA 3BIWA 4L7VA 5EP4A 4DIKA 2FWRA 2ET6A 1PL8A 3I9KA 2INGX 2VUIB 2B30A 2W48A 2XNCA 2Z95A 3D6AA 4CI0B 7ABPA 3MW8A 1P2UA 1T2NA 3UXEA 5KHLB 1TQDA 1SQ0A 3OP4A 4KPYA 5I4IA 3LCVB 2UU9B 3M6LA 1NYLA 4QLOA 5M7EA 4A03A 4UNSA 3QUTA 4RACA 3V7FA 3WK7A 1K5HA 4XGKA 1GGEA 5FBKA 1ISMA 3COYA 3IIMA 1J99A 1GPH1 1HG1A 1QFXA 3ZGOA 1VE3A 3M33A 4LV8B 4G5OA 5YASA 4F56A 3ZNPA 2IP2A 1DZ3A 5CNKA 2QJFA 4OHPA 3DKPA 4AX8A 3UJDA 1NJ6A 1S8OA 1TECE 3AEUA 4AK9A 1QQ5A 2DBVO 2K7FA 1C29B 1H23A 1YAJA 4QXOA 4EGCB 2HU5A 2R11A 2G1UA 4QXRA 5E2AA 1YHNA 2YVLA 4PNEA 5BQXA 4MWZA 4QRHA 4RZ3A 1H93A 4Y2UA 2H1CA 2JIOA 1G8AA 3BXFA 1F1BA 3GZTB 5CLGA 5CDTA 1EVIA 4EEXA 1ORDA 1PCXA 3ZVMA 4BB5A 2QSJA 4OXRA 3B6EA 2XNJA 5IUKC 5IH3A 2RSLA 3LJKA 4HDKB 5FTJA 2UUAB 5F23A 4Z7QB 2WU8A 1THTA 2WAMA 2YMQA 4WLVA 3TE7A 2P2LA 4BRWA 2RC5A 4QEKA 3VVCA 4FTWA 3GVHA 4B71A 1C9NA 1FFXB 4UFNA 2I3GA 2R4TA 2YV2A 3EAFA 3Q87B 2EL7A 3M6UA 5JO9A 3IRVA 4BMCA 2PUFA 3AONB 4FILA 2SCUA 4IR7A 2JHFA 2GM9A 1ZK4A 5L40A 1O8BA 1B0ZA 3EZXA 3DTVD 2Q5HA 2DFLA 4DJFC 1BYUA 1Z35A 1EUCB 3O95A 2J5RA 2VRCD 2EG9A 5DW3A 2X77A 2Q2OA 3KJFA 5BOVA 1NBOA 2G77B 1KO5A 1JHDA 3B3FA 3CNOA 3DMPA 2F9FA 4YCSA 4FN5A 4MQ5A 4AS3A 4TVBA 2HL6A 4K9QA 2XTZA 2QX6A 3RADC 3B5EA 5K8JB 2EKDA 2CV0A 1QTNA 2EFDB 1P7WA 2G0TA 1I7LA 1S2IA 4MUNA 3DBLA 3G79A 1IB6A 1OZGA 1OLXB 1NQOA 3LXMA 4EEKA 2H5LA 5EJ7A 4AZ0A 2DHCA 3IV6A 4J3NA 3NB0A 1E2BA 1DEAA 3OEEA 2R1TB 4R5HA 5BRNA 5LLTA 1RM3A 1IOLA 5LQUA 3SBDA 1DG3A 4KVGA 1D09A 1U9ZA 1ILWA 1NVEA 2WAXA 4UXIA 2GLTA 2JJ1A 4XD7D 3RIMA 1L4MA 4IIFA 1GGJA 1NJ2A 3DHVA 4K28A 5G02A 4Q9KA 5LLSA 2GRJA 3M0EA 3W3AH 1S2OA 1FFHA 2AR0A 1NLYA 3KJGA 1V37A 1QVAA 3MJRA 3AHHA 4Z53A 4OMCA 1LNQA 2VG8A 2EEZA 2GAIA 3DFMA 2V6FA 2AFIB 2X0DA 1U11A 2FVXA 3Q4GA 4TT3A 3HUUA 1M1ZA 2F3SA 1MO6A 2FWJA 2JRLA 1CV2A 2X4LA 5DXJA 1H5UA 2GK6A 1DC5A 2G36A 3L02A 5FPPA 4U8HA 3V8QA 3UXHA 1TQ6A 1QVZA 1I0IA 3H1TA 4ND4A 5M04A 2KI5A 1KOJA 4D9KA 1NDUA 2FDRA 4LECA 1XPOA 2FUKA 1LWOA 4EQ6A 5DCWA 2EFGA 2CXHA 2Y0PA 3JZAA 3OJOA 3DCNA 1ISJA 1QQBA 3O1IC 4R51A 4XJSA 4AN4A 3WMFA 4CHTA 2ISQA 4MPRA 3PC4A 2O7QA 3CBGA 4KAFA 2VJBA 3JD1A 1XLTC 3IAXA 3MTJA 4KGDA 4Z5XA 5EJ9A 3GLFA 2FSHA 4A4DA 2XZPA 3AVVA 2B61A 4TKUB 1MP0A 1F2UA 3EZLA 3O92A 3KKKA 2X6TA 4JLDA 4AG5A 3Q11A 3KAKA 1T2DA 2WZBA 1XMXA 3FHOA 5I48A 2IEBA 3Q2OA 4W5JA 5JNVA 1JJVA 4X84A 4P4UA 3UW3A 1NMEA 4OPMA 3N58A 2OE2A 5BV1A 1MG5A 3GLIA 2VR1A 5CCDA 1YBMA 3FLEA 3S28A 3RRXA 1B14A 1ZW1A 2ZB8A 2R6JA 3QHAA 1LRKA 1U2TA 2QD2A 1MH9A 1BEZA 3CNQS 4Y2SA 4XOUA 3OQNA 4PFJA 3KSAC 5AI0A 4RMIA 4WV3A 3WKCA 3WX0A 1U0LA 4BVJA 4CQNA 4M54A 1M2OB 1HG0A 2NLOA 1SVSA 3LU1A 4J9VA 4NR0A 3TNFA 1QLJA 3CX4A 4IV5A 3I52A 2PWZA 4PCAA 5BQOA 2QG6A 4JC4A 4WIAA 4X44A 4JQCA 1E0KA 2I4LA 3WHIA 4BGIA 4RF4A 3W79A 5JU6A 1H3NA 4A6DA 2C7OA 4UTVA 3DEYX 4L0MA 1PFVA 4ENVA 4TWZA 2PWBA 4P5EA 4JV5B 3MOIA 1M6HA 3WHPA 2J9YB 1PNQA 4L8WB 3O73A 1B76A 5DB4A 3W05A 2GPTA 3RWMB 3TIFA 3FGPA 4BQRA 2C0CA 4KCGA 1DAIA 3HO6A 2Z1DA 5F12A 1XNGA 2C9OA 1IUOA 2W2PA 3OQIB 5GM2A 4AJHA 1CY4A 2A88A 5JRZA 1G2OA 1TIPA 4ODIA 1YBAA 5K2MA 2E4ZA 3HDJA 5C8YF 3K2BA 5CX1B 3BGOS 4PY2A 1SUDA 5B3JA 2O5CA 2WYVA 3I32A 3C16C 4JYZA 2Y1KA 4MPJA 1M76A 5K8LA 3RS2A 2EARA 4Q3AA 1SCUA 1GNLA 1KBZA 4IHKA 3PZRA 3CB2A 3B7GA 3L49A 3E22A 3SC2A 4DDVA 3DVAB 4Q5IA 4R6XA 1NLUA 3TVTA 5T3YA 3I9NA 1XTKA 4Q3BA 4RA9A 4YAUA 1A9RA 2C77A 5JLAA 4AO7A 4RIFA 1W88A 2WFLA 4DRXB 1RI1A 2H1OA 3I83A 5EXEA 1DTEA 3H3XA 2BFDA 1A5AB 2J6BA 4K8RB 1W36D 1FF9A 3HXLA 2XTAA 4KXMA 2ZXEA 2B69A 3TFQA 3WWYA 3PYLA 3IA2A 5I7VA 1X2EA 5GM1A 1ZL2A 3SXPA 3VU8A 2AE2A 3PA6A 2YV5A 3DFFA 2XYVA 5BN3A 1EFCA 3IPLA 4N12A 3GFBA 2PWPA 1T4DA 1XFAA 4TYMA 3SF8B 3L1JA 2IXTA 1EJ6A 1P5HA 2K2WA 2VJKA 2ZJ8A 4QSMA 2BL4A 1M7HA 2XUOA 3JXEA 5TY0A 3THXB 3VYRB 2RHDA 3JCZA 4MITA 1JHRA 4DUZB 2ZZMA 4B7XA 1XLWA 1UCFA 3INGA 3NVMB 3DOHA 4RV4A 3AL0C 1GPMA 2Z98A 1OFIA 4P1ZA 4BTLA 3KYJB 2P2GA 1NJSA 1UPCA 3WRVA 2QVGA 3O82A 5AM3A 4TL7A 1DOAA 2EP5A 1AK9A 3I61A 3D3JA 1OHHD 4EYQA 2QN8A 3RK0A 5HSGA 3IPYA 4K03A 3N2KA 2ZRGA 3CF2A 1UDWA 2K87A 3AYXB 3GAZA 1UWVA 1EK5A 4HNRA 2QUIA 2XW6A 1O77A 2AN5A 4GMFA 4PYJA 5JCXA 1UZUA 2GN9A 3FYUB 3FAKA 3QFCA 3ZJYA 3S5JA 4K3UA 3VHRA 2ZDQA 3ELYA 3OM8A 4L2IB 4L78A 4GOXA 4BDTA 2OGZA 2XKAA 2CJWB 1B8NA 5DE3A 3A31A 1MIOB 1OAAA 3SZ3A 4GP6A 2ODBA 3CF6R 4N49A 1P7YA 3JQ7A 4V0LA 3ASYA 1PR3A 1GITA 1SZCA 4E7OA 5K8VA 5C51B 4LF6B 2ZATA 2QX8A 3BWYA 3B3JA 2WUGA 4IDOA 3EPLA 1QU2A 1AZTA 3FB4A 3IVGA 5DHAA 5KOJA 1WBDA 3BZWA 2WHXA 5ESWA 1P4JA 2G04A 3GNSA 3RDPA 1JAYA 1EDZA 2XZTA 1G4UR 1H1LA 3L7OA 3FOFC 1Z16A 1GN9A 1JILA 2H07A 2I80A 1RWQA 4XCQA 5FA8A 2OORC 5HFJA 4MAFA 3VPGA 5GINE 1T8WA 1FTNA 3FCAA 5KJ6A 3KEGA 2XZLA 3KCNA 3MILA 3OMWA 2P3QA 5TNXA 4F9TA 3O2SB 1M6NA 5FPSA 5IKMA 2XOEA 1AURA 3D0KA 3IJ5A 3I04M 1D6SA 5EJEA 1KTIA 3PX2A 1MX5A 3ZWWA 2HMAA 3WYFA 3G9QA 1R8JA 3EDRA 4Q39A 3WOHA 2VHTA 1EI9A 3AESB 2ID7A 4CRWB 2Z4SA 3KDPA 3GW8A 2IYEA 2ZJAA 1UPAA 2RH5A 2O2CA 4LHWA 4PTZA 4JXXA 2WSYB 3A4VA 1G9XA 4ID9A 5ALHA 1BCSB 2FFBA 4HWTA 4JYAB 3EVBA 2JRCA 2G72A 1EXVA 1SC3A 2GZAA 2X76A 5EKTA 4E2XA 1GOTA 4XFKA 1YONA 3AO0B 1TYCA 4MZDA 4XD7A 2OLJA 1Q7BA 4EMBA 4YRAA 1JR3A 2NVWA 2O1EA 3M4XA 4RESA 1LTQA 5JAHA 2A86A 1SG6A 4BATA 2IYZA 2FMTA 3DMTA 3J7TA 4QU9A 2HY7A 4JEMA 5CA1A 2F4NA 4XDYA 5CB0A 4PX2A 3TZQA 3MIZA 1P2VA 1WDKA 4XE5A 3VYVA 3BYZA 1U1GA 1J7JA 2JFNA 3I01M 4FFBA 3SVZA 3WGUA 4M8IA 2AN9A 4F2DA 1KZ9A 4F3KA 4EI2A 2GXAA 2WVHA 3LLMA 1G1MA 1U3FA 3MXOA 5CB6A 5KHOC 4YDRA 4RM3A 4ZMSA 4RNCA 1Y0BA 1L7BA 1XGKA 4LF4B 3CWQA 2IEDA 4YCDA 4WK6A 3ROFA 2R68A 4BVHA 3M8KA 2B3TA 5IULC 2Y1XA 3OT1B 2OOSA 4IJUA 3HVIA 1D1SA 1GTG1 1YNOA 1YA6A 1I7SB 1XWWA 4PE5B 3S1SA 5MF6A 1NFQA 4OXYA 4II7A 2AMJA 1V3TA 2BP7A 1G9TA 1XJ5A 2D1YA 2NADA 5EE3A 1JQLB 1XDZA 2NZXA 3WOVA 3A1SA 4HEJA 1S1CA 1USGA 2WKWA 2ZIWB 3WGJA 2P9CA 1N9ZA 4KV7A 1CJCA 4BWYA 3B5IA 3NS7A 4LX8A 2EAUA 3HGTA 3LO5A 4WVFA 3FPFA 3T9EA 1G1AA 4OHZA 2BE9A 5AESA 4P83A 4F8EA 3GP8A 5TB5A 2D13A 1IWBB 1EDBA 2I2FA 3KEOA 3ME5A 5DHPA 4E5KA 1EUDB 3ZJ4A 4AY6A 1UKZA 1WUJS 3OQHA 2AOUA 3ONDA 4ON9A 3MB8A 4YB8A 4DDUA 1L7MA 3BMQB 3ORSA 2CHGA 4TTVA 4JI7B 3IEUA 4Q4HA 2RGWA 3HL4A 3NUZA 1QE0A 3OPXA 3VU9A 1ZNZA 2G9NA 1SKYB 2A5JA 1P8JA 1DC8A 1JIQA 2AR9A 3FZNA 1XAJA 3IDQA 3LT2A 4MLDA 4R81A 4BMSA 4C89A 1FMCA 1P2SA 5KC8A 3U9LA 3IE1A 5EE5B 2Y27A 2Y1CA 5LU9A 3W6PA 1CQZA 3A37A 1C81A 4OK6A 1T36A 4OSOA 4N54A 4Y2JA 1F5NA 2GM3A 4FGZA 1Z9BA 3WJ2A 4LMRA 1UAGA 3JVUA 1JA0A 1ZIDA 1CX9B 2IIQA 5CXXA 2XQKA 4I50A 2EDCA 3MAAC 2Y4OA 1C1DB 3HBFA 4XUCA 1U2QA 3MWDB 1G4HA 3TSOA 4F8YA 4Q7KA 4PANA 2CD7A 2H63A 2V7WA 3B78A 1XCLA 4LK3A 4EI7A 5GGYA 3TTUA 2RKWA 2QP3A 4L5IA 2HD4A 4YRFA 1IWPB 5ALLA 3HA5A 4CMEC 1B8UA 3GJ8A 1PJ4A 4MVJM 1SKYE 2FPGA 2Q1SA 3IBYA 4PSUA 3RS7A 3DAGA 1S5PA 2XT9A 4AN1A 1OFUA 4X6UA 4CUZA 2E5FA 4JWTA 3O31A 2QAGA 4K3VA 4IEFB 4KNVA 3WWOA 1PJ2A 2GDZA 2J48A 1TLFA 1NPYA 1TIKA 2XDAA 1AHNA 1VJ1A 2X40A 3LOUA 2KSQA 4E3WA 4DLLA 1HNWB 2NIPA 2P3OA 1LPOA 1P5FA 3H5RA 4KFCA 1SKMA 4H7DA 1Q1ZA 4W8OA 3SKVA 3GJRA 2G71A 3M6XA 4BC0A 5E9QA 5G0UA 2ZJ7A 4RF5A 1E5QA 4DQLA 2WUEA 1YO6A 3PHJA 1B16A 4X24A 2FNAA 1YJXA 3NNNA 5KNBH 1BIFA 2W8BB 3BTVA 2ONCA 3W5HA 1E7WA 1K7SN 1MO2A 5DYYA 3LL4A 1QJ4A 4OQDA 3THOA 5A1JA 1CYEA 2QD3A 2H2GA 4WK4B 1KO8A 1XQVA 4BIIA 4BLOA 3QKSA 4CMIB 5LD2C 4BVKA 5BT8A 4EY7A 3QVMA 1FVFA 2FLVA 3SEZA 1JAIA 3EQ8A 4B2IA 4M0EA 3WXMA 4HFJA 4LWOA 1QMGA 1S89A 2EATA 2IHJA 5EXDA 1KWKA 3EWNA 4QG7A 3DZDA 3CVVA 5SZHB 4JXZA 2WP0A 4GX5A 4XEUA 2BD0A 3LH5A 3H2ZA 1HOXA 3LX8A 1ECLA 3U7GA 3HP4A 4R2JA 3D6VA 2H48A 4CTJA 1EX1A 3O83A 5IZCA 5JZ9A 5CBPB 4MKIA 1SXGA 1KXZA 3QI7A 4C4SA 5KOHA 1XQXA 3SY8A 5L3ZA 4A92A 1B93A 4W82A 3O21A 1ATIA 2WJ3A 3DEHA 3O91A 4DJAA 5KX5B 1SULA 1OHHA 1VPLA 1YR3A 4V0KA 5IAEA 5K51A 3IA7A 1PL7A 2PMWB 3KYIB 3IELA 3M6VA 4GLBA 4MWGA 4WE3A 5BMVA 2OVBA 2ZK7A 3E1SA 4YX9A 3UHPA 3S29A 3CH4B 5ER9A 3I0ZA 5KTPA 1ZRHA 1V6AA 3ASVA 2HK6A 2PKQP 3I34X 4IDAA 2WKQA 1I0LA 1N0VC 2B7CA 5HF8A 5KTRA 1UM8A 2OG1A 2BFNA 3FGZA 3WLHA 4ZAFA 3GDWA 2VTKA 3DJYA 3F71A 3LDFA 1Q7CA 3E03A 4YT8A 2H2FA 4YUWA 3S81A 4X85A 1R6UA 2GERA 4C6RA 4WNAA 2B4AA 3TMYA 2W6ID 4GRDA 2FWIA 2WE7A 1WDMA 3RBXA 4OFXA 4HYYA 2FW1A 4D56A 1CF2O 1QRDA 4E5MA 4OKSA 1C3VA 1IK6A 1JEAA 1QIFA 3RAFC 3KUKA 4TKVA 1CY7A 1O4WA 4G2NA 1RZVA 3PNOA 3TSZA 4CEIA 3NVKI 2YNMD 3E1KA 5THQA 1L5KA 2J0SA 3D3WA 4AX4A 2RG1A 4W1SA 1YC2A 5CXQA 1RJFA 2G9VA 3NDBB 3PDWA 4LXIA 3NHPA 3R8FA 2NTVA 4K9MA 2ETVA 3GLHB 2WUDA 4AT1A 2D5CA 2ISSD 5HM8A 2PKEA 2JFOA 3LTEA 5DZSA 3L6EA 1U8TA 3GGOA 2MSNA 1C9DB 4LRXA 5IMSA 1U8CB 3RASA 2ZTHA 3QJ5A 1BEUB 1M8PA 2LPMA 3DVQX 2VVTA 4FLEA 1VKZA 1ECPA 1S96A 1KI9A 2V4UA 1ZIPA 3PWZA 3Q6IA 4R1TA 1WSBA 1WZEA 2BFEA 1CUDA 3QMPA 2BW0A 4FSXA 4XWAA 4QQRA 2EKZA 3AXSA 3SXUA 3LQFA 1NY6A 2ONZA 3NFRA 4MR8B 4MW1A 1K7EB 1CP2A 1A98A 1SHJA 3JWIA 3SE0A 2BIFA 2PMBA 3QELB 4XM0A 2IY8A 4JXJA 4QO7A 5IJ0B 4MVXA 3ZD6A 2NAFA 5AKJA 3IBSA 1E9VA 3KQWA 1NF9A 4FGJA 4L4ZA 2HBZA 1BX1A 2Z2JA 3GQVA 4X3OA 4L74A 3GLHE 1RMYA 2FGKA 2M1XA 4LJ4A 3P7MA 4RO0A 1U80A 2ZBVA 1DIAA 2GTHA 2WFAA 4HXYA 4HAUA 1BDJA 3BD7A 4RDHA 3ITKA 2FP4B 3HU1A 3K6KA 1P0CA 3BMOA 1R2QA 1WU7A 2X0NA 3BE5A 1E2GA 1N0IA 4DNPA 1OQAA 1JPUA 2J32A 2NN3C 2HQOA 5F33A 5TEVA 3AF6A 3KR0A 4EITA 5JCOC 3TTSA 2Z43A 3DO6A 1MNAA 3D9QX 3T7AA 5C80A 1CQJA 2AZMA 4BBPA 1MT3A 4IFEA 4I9GA 4IH4A 1TMYA 1DQZA 2OZEA 4QAQA 4WAUA 5TJHA 4JB2A 2REOA 4JJFA 3S99A 1X7DA 4EL5A 1AGPA 1O6CA 1YZUA 5H02A 3UPDA 3OZFA 1VGQA 5CA1F 5JPDA 1PJCA 3V42A 5TIIA 2JHPA 1JDJA 1RBYA 4RPGA 5FWYB 2LW7A 3H19A 4OIFA 4D43A 1DO8A 3D0RA 4DMRA 2FAXA 2AI1A 5FHRA 5TXGA 1RZRA 2H4YA 4UMFA 3ZV7A 1SFRA 3EGCA 3BCHA 5REQA 2E6KA 4F2GA 2D00A 1S4MA 4FX2A 2ZCVA 5E9AA 4YPOA 2NU9B 2XMDA 2NU8B 3ZEIA 1IG0A 4I8IA 1BGVA 4D42A 5LQRA 1XRJA 3A2MA 4NHOA 3KZMA 1OFHA 4E03A 5DNUA 3WDMA 2ZTUA 5KNLA 3RVSA 3L4SO 2ZLBA 5ECGC 4ZDWA 2FW6A 1C8LA 2FMHA 3SGLA 3OQPA 4K9DA 4RSRA 1PN3A 4WNIA 3B51X 4L22A 4AURA 1AMNA 4XWYA 1KYXA 3H1BA 3N7AA 5BV0A 4EYKA 2PX0A 3RYHB 4AYTA 4NV1A 3IUSA 4MCHA 4HATA 1P33A 5KKCA 1SU7A 3VTAA 3ZV3A 4YYZA 4O4JB 2NPIA 4CM6A 3L6CA 4C4TA 2GBCA 4KKVA 3DLCA 3FKSD 5FWNA 3NOOA 1SIWA 1RQ7A 2VJCA 4GWKA 4FMCB 3CZQA 3H1PA 5CB4B 2V3WA 4GMKA 3FWHA 1VMKA 2RHHA 5EJAA 1QS0A 2QYHA 2V4MA 1UWKA 4CM4A 4CVNA 5CCXA 3CA8A 4I6EA 4D80A 1J9ZA 2RHTA 5KREA 3LHFA 2HQRA 4QDKA 5I5EA 1UDRA 4GF5A 3AHGA 2O52A 4RZSA 4UW9A 3NHRA 3UB4A 1NGSA 3NNDA 4MAAA 4RELA 4CCYA 2DT5A 3V1UA 4G09A 3RE1A 3U13A 2PH7A 3ICWA 4OHRA 4DLAA 4ENWA 1QIJA 3SYRA 1KORA 2CLIB 4BFSA 3NC1C 4RV9A 4LJ6A 4AD8A 1UDCA 1DAOA 2AJBA 5SYMA 3WRXA 3UNXA 1GPLA 4I50F 1WKCA 1W7AA 4TMKA 3R6DA 5KQSA 4ZVMA 5LU8A 3P45A 1YJAA 5LOVA 2UZ4A 3LUPA 4BASA 1M2VA 2QGZA 4RY8A 1JMKC 3S2FA 3S2SA 1X2BA 4Q3DA 3N2YA 3EUAA 3V2HA 2CLOB 1ESZA 4R8RA 4UUNA 3VR5D 1N32B 1QF6A 3RRBA 3GMSA 3L92A 4J94A 1ID8A 4DQVA 3BBPA 1SK8A 4OJKA 2FUCA 4AXXA 2EBHX 2H1IA 5T4BA 5CD1A 1N9GA 2QORA 2IYRA 3CU5A 4LVOA 1FXSA 1AK1A 2NO0A 1X8KA 1KAGA 4LSWA 4YCJA 5F7XA 3Q41A 3C8HA 1JYFA 3ABOB 4F9EA 3EF1A 4DARA 4RK6A 2VC2B 3F2VA 3SIRA 4ZAWA 2OMKA 5CH5A 1U3GA 2YV1A 1T13A 3EBLA 3H0CA 3L4EA 1NURA 4TKLA 3SQWA 2ZJZA 4LQCA 3ODGA 2H2AA 4MS1B 2PFGA 2X22A 4A10A 4MR9B 2H29A 2JAHA 3ZWCA 4M1EA 1VSUA 3OZUA 2NZJA 3E7XA 5ALDA 1D6JA 1JXQA 3CEJA 1Q1BA 1N57A 5C8VA 2WU0A 4YHBA 3L0OA 1VSBA 4IJQA 2J9XB 1UWCA 2NYUA 3DDUA 3FYDA 3G5LA 5GTDA 4UATA 5L7WA 2BE7A 4R2KA 2VJAA 5ALSA 1JTVA 3JTEA 3DAFA 1W4ZA 2XMSA 2Q8QA 2X0EA 1GHTA 3OJ0A 2DFPA 2NQ8A 3LRXA 3BQ9A 5HTKA 1N6LA 3C3BA 2Q4EA 3GCDA 3TR6A 1RIFA 3HB7A 5HIIA 3GP5A 1MORA 1KJQA 3LBFA 1X7XB 4IXWA 5IPFA 3EXIA 4WRRA 1VCMA 2PKWA 3A3NA 3L0CA 4M4SA 1ZRSA 2H9YA 2Y6VA 3SZRA 3VPDA 2V7VA 4QYTA 4W9NC 4DY4A 1O96B 3ZDQA 3BXEA 2DFNA 1VG8A 2HA7A 1M34A 1WG8A 2IBMA 1U8FO 2GPWA 1Q0QA 5CCBA 4ARBA 3THSA 3ANMA 1KEWA 1A4XA 1IFXA 3K92A 3U0VA 4M1ZA 3MMSA 1N5OX 3ZQ4A 1HEYA 1G5IA 4EYOA 5K0BA 5ITZB 4Y6QA 5LVAA 1LA2A 2H7VA 3REGA 4LZLA 4OHUA 2V6JA 3MLAA 1YBHA 3GZ4A 3AUUA 4EW2A 1GVHA 4JYMA 1YULA 5BMVF 1ZCZA 4IAOA 3DT9A 4TQ9A 1Z0AA 2ZAOA 3SK0A 3WA6A 4E1VA 2ATVA 4P4LA 1C0PA 5K4GA 3LY5A 3DTTA 4OJTA 4CEHB 2P65A 4BFZA 4MKZA 3THRA 1SVKA 1MABA 4LIPD 1GNSA 3ADBA 3OZSA 1Q95A 4DV6B 2YNMA 1T5BA 3ABQB 3WWZA 5DMHA 4KH1A 4AKTA 2CMDA 2YHBA 4B32A 1NRXA 1WDWB 3AI3A 4EKYA 4LE2A 5AW1A 1JE0A 2IY9A 4MYCA 5ALUA 1G2IA 1BSVA 1KDPA 4LFBB 1X8JA 3NW9A 1PT7A 1YQXA 1U2DC 2B37A 4OQPA 4PAOA 3W8NA 2DETA 4U6SA 1CR1A 3C1UA 2LTAA 2RC6A 3PHCA 2B6NA 2AYZA 3OLZA 4DUPA 1Y8RB 5DT2A 3NHAA 1T3LA 1FUIA 3H04A 1XV5A 3BMNA 5FTNA 4TYYA 3WV5A 3QXXA 3KO8A 4EA7A 2Y93A 3H9GA 3WQQA 2BVNA 2PJZA 1JKMA 1RHQA 2EX4A 3VA7A 1MCZA 3ECCA 5CITA 4GP9A 1DIHA 1EA7A 1JQKA 1K7CA 2Z58A 1H2EA 1FNDA 2P6PA 3NKVA 2YHUA 4QTYA 5KQLA 2YYYA 4J0FA 4QUJA 2EKLA 3MFYA 2OPHA 1OIXA 1L5MA 1PNRA 1YDEA 4QSHA 1XCMA 4ZDJA 4PWZA 3CSDA 1AUQA 1CF4A 1M2NA 1MAHA 1Z56C 2MSEB 2JFGA 2WWXA 5FEMA 7GPBA 3ZWVA 3WLTA 3ZY3A 4X1IB 4ARZA 2MINA 4AZ3B 3DF9A 3W6UA 1VXRA 2D1TA 3R7WA 1RM0A 1O8CA 3K09C 3GRKA 2C2BA 5F7JA 3CB4A 3DZFA 3CUWA 5LCXA 3RC2A 3BWEA 3WHLA 3ZCRA 1E3QA 4B31A 5A4KA 5JFTA 4CR6A 2X6RA 3ITEA 5FI3A 1E3WB 3JALA 4V2IA 2B25A 4GVXA 3IKJA 3RW9A 5C5DA 1T5OA 4N65A 1T0BA 1NM5C 3AR7A 2WB4A 1OXVA 5FR1A 1YUMA 3V32A 2BYTA 3KLOA 4ZQCB 1WD7A 1QG4A 3ABSB 1GLGA 2QWXA 2VDJA 4H16A 3X1KA 1RDFA 1Y33E 3OIYA 5DLEA 5EFOA 3HZHA 3RSSA 5KQMA 2BEWB 1H42A 4FWBA 2G25A 1KAOA 2YX1A 3QBVA 4GR9A 1N5IA 3AT1A 2EQAA 1CG6A 1FTQA 4PHGA 2D54A 3BB3A 3RCBA 3QIVA 3Q72A 3PRJA 3AWDA 1U2ZA 3P9QA 3R6GA 1IXSB 2V9ZA 4URFA 4IIDA 1G19A 2I03A 4FZ5A 4PAMA 4WNYA 3QVTA 2XEDA 1NR7A 3HBMA 2HBQA 1H2HA 4HZUA 3TZEA 3CINA 2PCLA 3KKZA 2ANCA 4MI9A 1C3EA 4IQ0A 1HZZA 4M7OA 3KQTA 1OVGA 1Y34E 2PA3A 1FJHA 1XR3A 2DY0A 3P96A 2AG0A 2NVOA 4HPWA 4BBZA 1HNXB 4Z4EA 1M1NA 2REQA 3N2LA 4G67A 4L3OA 5JNLA 4OYRA 3EVFA 4X20A 2GASA 2GBLA 1QIEA 3CM0A 4RMJA 1YFJA 3WE7A 1RHKA 4DA0A 4L5JA 2EX1A 2QGNA 1AGRA 2IDZA 1A5TA 3QF4A 4PZCA 1X9HA 3IMFA 2HIGA 2C9YA 2B1RA 3RROA 1JJFA 3WLPA 2G5CA 1NI4B 1XRNA 1JIXA 4J1NA 1CRWG 5F35A 4KW7A 3OHPA 2IV3A 1CUJA 4UVIA 2XB6A 1NBIA 2D59A 4OHMA 5G2OA 4AUMA 1RWXA 1HE2A 5B1IA 4CF5A 3SQXA 2ZBGA 3OU7A 4Q18A 1F8XA 2CVPA 5JNUA 1J25A 4XPIB 5PNTA 3D54D 1FK8A 1LK5A 3EBPA 5EHQA 2ZIGA 4IH1A 1H2AS 1OYVA 2XTMA 5HMLA 2D1QA 1TD9A 1RRMA 1CRZA 1QHYA 1KJNA 1XELA 4OH1A 4LE1A 2OV8A 3GLGB 3GAAA 3K8ZA 4ZXFA 2CLCX 2IK8A 1O1YA 1IIRA 4G1UC 4ZMBA 1T8RA 4YAEA 3HB9A 3VU3A 2QD4A 4EVRA 3AINA 3RLIA 5BVHA 1EP3B 1JIUA 1T8UA 2WDZA 1HMPA 1MV8A 3P2MA 4G9EA 4N01A 1XCJA 1H4QA 1FYFA 1GCUA 2Z9CA 3AL3A 5HZHA 1GPKA 3RYTC 2A3NA 2UVPA 3KOXA 4TYNA 2FRXA 4FDMA 3PQ2A 3HU3A 2VQSA 5LQKA 5LOVF 4P7BA 1YR1A 3HDHA 3KJEA 1NVWQ 3R3SA 3VBCA 3TXAA 4AKSA 2VPTA 4EG7A 2C94A 4D9CA 5CVVA 3WNDA 3AQ4A 4Q9AA 3U0BA 2G82A 1G5QA 1ZHFA 2AUTA 1N5LA 1QVVA 4KZPA 2X3FA 5HK8A 5IAGA 1ZWLA 2BUCA 3W4IA 1VLJA 4EPTA 1IY9A 1FDIA 1Q6ZA 2HSJA 4LRTB 1PD1A 1ODSA 4FHEA 3ZR4B 3UT0A 1OGJA 3W2EA 5K2OA 2YASA 1UINA 2W2NA 2WYOA 1RXWA 1Z73A 1RLOA 1GTJ1 2WJPA 1LBEA 5CYGA 1IXYA 1LKZA 2D0DA 1NXPA 2J5QA 2ZIZA 5I7FA 3WSWA 4DIMA 2OB2A 2QRNA 3CLSD 3OIFA 4PINA 5JMTA 1L5QA 2XVXA 4MYSA 4LDRA 4QBKA 4C05A 2GESA 3MUOA 3KWFA 3ZCQA 1VMDA 1L7OA 4AW9A 2EFJA 3SJ7A 3SMVA 5A9SB 5IEJA 4OAPA 2UZ0A 1Z28A 2TECE 1P62B 2CXNA 5EHIA 5FAXA 1BFDA 2NYVA 1N34B 3RUIA 1PK7A 5H59A 4YJDA 1SC4A 3A4LA 4MQ4A 4I1RA 2JLRA 1SD1A 1UMDB 4G0XA 1P2GA 4QLAA 4B47A 2R4UA 1AQNA 4DQUA 2DSNA 2ATIA 2J5BA 2PJDA 1F7UA 2EJBA 4F1WA 4M1SA 2QRGA 2IP1A 1GQQA 2EYQA 3F5QA 3G7SA 3M5CA 1NUTA 2W5UA 3WBJA 5J4HA 4W7IA 4HDMB 4D0SA 1Z0UA 5JISA 1G8JA 1KE1A 5KWEA 1KMQA 1H2WA 1Q21A 5L8VA 4FT4A 4AC9A 4XKJA 2DUJA 3EGXA 1B6TA 1J5EB 3ZD8A 3HDYA 5BR7A 3CRW1 3G23A 4NOLA 1C0KA 4HTFA 2E87A 1CDDA 4PZPA 1X80A 2HMYB 2NO5A 3L1IA 4CETA 2ES4A 5DBGA 2OO3A 4AO6A 4BGEA 2GPSA 4ZGBA 4BB0A 2ADOA 3C4JA 1CU1A 3W9YA 4DE5A 3OQJA 2Y8EA 1UPFA 3FBWA 3BCSA 3BG5A 1SHLA 1Z4MA 4UBJA 1ZGZA 1IEWA 1Q20A 3L8MA 1QQAA 4ZVNA 3DL4A 1XDWA 3SNHA 3TNLA 3UATA 4BMPB 4OYYA 1DHRA 2ZWOA 4RZ2A 3DAHA 1W0CA 2EJCA 4WEOA 2A78A 1LS1A 2YV3A 3UBTA 5IS2A 4IZ6A 4TL8A 1SVIA 2VHJA 2QUBA 1G41A 1P17A 3AUYA 1N8SA 3F0TA 4LJ7A 2RIPA 4CDMA 1A7JA 1XQYA 3CWZA 2KMLA 1ODIA 4LCBA 2LGJA 5DVZA 5EC8A 3ZH9B 4B8ZA 4EL0A 4L3WA 4L7QA 2XCRB 4C3ZA 4BMZA 1PWEA 4BQFA 2VRWA 3RNOA 1QXSA 5I7AA 1H6BA 4R69A 1E32A 4XWTA 4MPTA 4UAVA 4DPKA 1EINA 4A8JC 3ZYCA 2IITA 3BIXA 2V6BA 1GDHA 1HDOA 5DBIA 2FN7A 1S7CA 4JDUA 4HNAA 3PQEA 2AEEA 2QL9A 5BOSA 4E33A 1DI0A 3UOWA 3HRHA 3MRTA 2C20A 2QTWB 3EN0A 2ZSHA 2ZBDA 4A82A 2XGOA 5JDCC 4KLZA 3T1HB 1BXRA 1V8BA 1Z2NX 3A26A 4O63O 1PEDA 2JBWA 3CURA 2M6SA 2BZ0A 2QMEA 4PLPA 1IAQA 1BHQ1 4DGSA 3N2ZB 3OURA 1SCKA 1KSJA 3K9WA 2Z9BA 4DLZA 3TFOA 2VTBA 3I6MA 4FUTA 3X1YA 1CUHA 1GL6A 1ZXBA 2KW5A 2PV7A 3AY0A 1KPIA 3P1JA 1Y7PA 2ALJA 2BFAA 1ZAYA 3IO5A 1KERA 5K8UA 5E1OA 1Z33A 1CK4A 3GMIA 3PNLA 4JIGA 1T5TA 4Y9TA 2XIJA 1S3FA 4I19A 4XSVA 2NUPB 5AP9A 5A1TA 4YCCA 1WV1A 2ZUTA 1U7WA 1RQRA 1SVUA 3A28A 3ZHTA 4TS9A 1ST2A 1OFTA 5LP6C 3DEIA 1HDGO 5C7OO 4R9SA 4C6TA 3NOVA 2XMRA 1WSWA 4TTRA 4RIEA 4CODB 1QCYA 1ULZA 2JEYA 1NY5A 1FXUA 1R00A 2C4UA 2X5NA 4LNUB 4B3SB 1JIIA 3VRHA 1KJWA 2VSNA 3FCXA 1XNRB 2C2YA 1RS0A 3V8BA 2AKYA 1YGPA 2B78A 3G7NA 1W8DA 1ZY2A 1NJFA 2EL9A 4RXMA 5ALXA 1QYIA 4J6FA 5TMBA 4Q6WA 4EJ6A 2OOKA 2I54A 4X41A 4Q1EA 3RB8A 1PHRA 2Y0DA 2ZB4A 1XDDA 2FUNB 3QEMB 3OHMA 4GMDA 5IDWA 1ILEA 1EWQA 1E9DA 1VE5A 3RIEA 2QRKA 2WWIA 3LXRA 5BR1A 4NCBA 1K3UB 1U5BA 1JHOA 2QM7A 4UM8B 1YJ8A 4X63A 4DV4B 3PQ3A 1EPUA 1I4LD 1G20B 3ZWPA 3CUSA 4YYEA 3F7TA 3NUGA 3ONWA 1VBFA 4PGHA 5F7ZA 4HWGA 3U4QA 1BDIA 3L7BA 1ZCBA 4HMQA 4JJ4A 1U8XX 3DE6X 3FZYA 3GP3A 2XWBF 4FOPA 1KEEA 3NNSA 3VVBA 2BMDA 1OR8A 1Y1RA 2WNIA 2WV9A 3WB0A 2ZJ5A 2ZE7A 1SZPA 1K92A 4D8XA 1OH5A 5BWLA 3OFND 3TEJA 1UJNA 3FNGA 4KGVA 3FPLA 4TPKA 3V33A 2VYQA 3OCCA 3R4VA 2IUTA 2X13A 1ONSA 1MVNA 1W8IA 1IPEA 1I30A 3UPUA 2VPZA 2YYZA 2JAQA 3OF5A 2Q9CA 1MFPA 3AW9A 1FFCA 4QAJA 4UEOA 5BPFA 5CA0A 5FTKA 2BGLA 3ROGA 4C4AA 1XZIA 3R7DA 4RVSA 3H1FA 3ZU5A 1WXGA 1X9GA 2P2CA 5IVDA 3P5BA 4L16A 5A3SA 4EHNA 3PYXA 3RHSA 1UBSB 4Y6PA 2BFCA 2RE8A 2AQKA 3X1MA 5C8XA 1A9XB 2GFQA 2UDPA 2LZ0A 3QFRA 4WA8A 4DR3B 3AU8A 5ALGA 1CQIB 3MJEA 2HK7A 3ABZA 4IDDA 2G88A 4RFVA 4M0MA 1LY1A 1E9AA 3CGGA 4J43A 1CSEE 3C5CA 4U7WA 3AEYA 3ZY4A 4BJ6A 5AM2A 1TXGA 3GWZA 5ICCA 5I8WA 4M8LA 4NEGA 3AJDA 2QM3A 1JNYA 2J09A 4PTLA 4ID3A 3WLEA 1OLSB 4Q00A 4MOWA 4RVUA 1E2NA 3P0HA 1PV4A 3PCXA 1NW8A 1UMKA 3GCWA 4EABA 1T9GS 2X8JB 5KUTA 1QBGA 2C5BA 4H18A 3A4TA 4MA0A 5K0GA 3WAJA 3VR6D 2VP2A 3FDJA 2OXIA 3I2JA 2JKYA 4BO7A 4O8ZA 4RJKA 3SD7A 5A5VA 1JN0A 3K70D 1HX7A 1KIMA 1C2YA 3KP1A 5LBIA 1NOJA 3H05A 4UVEA 5TGTA 4Y1EA 3KHKA 3ELBA 5C1IA 3JYPA 4G5HA 1ZCFA 3OPYB 3QPDA 4GZ6A 2XE8A 1W85A 5ELMA 4OOEA 1WQ4A 3K0KA 4K9KA 1ZIXA 1LRLA 5H9VA 3OM9A 1TA4A 4C08A 4S3MA 4C4XA 2ZSUA 3DV9A 2QJWA 3S1AB 3E3AA 1IY0A 3IC5A 1YGYA 1NSYA 3RUCA 4EJMA 4OAOA 4P08A 2QJRA 2OO5C 1EAYA 1V8DA 1CNMA 2JBHA 2X19A 4WOJA 2JHGA 4ZOLB 1T4CB 3ETEA 1JLLA 4QDXA 1NU8A 4QVKA 4MNTA 1XFDA 1LFDB 3H5WA 1ZGGA 1SURA 3MOSA 2CW5A 5CVCA 3I8OA 1NNI1 3H2JA 1LRJA 3D7SA 3LCRA 3Q8WA 3K6RA 4XLTA 1WDLA 3Q3EA 3REQA 4LZAA 1ABBA 1JG4A 2AZ4A 3H9QA 1V11B 3LM8A 2P11A 3MBOA 2VHVA 5EHGA 4QXQA 5F5LA 5FBVB 4JYCA 1YUNA 4CEJA 1MX1A 2FQXA 2PKCA 2IEIA 3VR0A 1CDEA 1U4OA 1VB5A 5A2GA 2IKQA 2G4CA 1VHDA 3QOFA 4BVLA 4C0WA 4EYSA 4LGYA 1ULSA 2QNBA 4RD4A 2EW2A 1SKBA 3R41A 2K4MA 2C1XA 4GGMX 3V3TA 4ADSG 4B4VA 1J90A 1ZM9A 5KQGA 1FY2A 3L8CA 2YICA 4WZAA 4GUDA 1G6KA 2PSHA 1XP8A 3F3YA 3VPFA 2R48A 2AOXA 5FFNA 4CLDA 3M34A 5AW0A 5JQGA 1IAVA 4IDNA 4B7UA 2LRHA 1I8TA 3G5UA 4DTIA 3D64A 3FZEA 1DWQA 3IAAA 4RYDA 1RC0A 5AM0A 4EO4A 5G4KB 3BL6A 3RYIA 3WADA 4KDEA 1FB5A 2ZE6A 3L18A 4G4JA 4Y8VA 1TDJA 4D4GA 1HFEL 1PJLA 1C1XA 3Q1KA 5HILA 1ISGA 1S2MA 2X1VA 1K6XA 2G08A 1Q0SA 4LYEA 5DHSA 4HAZA 3FLAA 1OH6A 2DFTA 5KHAA 2XR1A 1JIJA 3DDHA 3LMKA 3H1EA 4OY3A 1KZHA 2ACKA 2WINI 1QV7A 3SS9X 1IOVA 4RFLA 3BK2A 3C6YA 3RBVA 4UUQA 3FOBA 4FBLA 4NE9A 1JLRA 2AWNA 3KR2A 3VZDA 2Z1MA 5EL0A 2LP4Y 2VPPA 3I2FA 4OMDA 4LJ5A 4ENQA 2HRZA 2SECE 3KLBA 4CKEA 4CV1A 1ENYA 4RPKA 1NW7A 3JW8A 5C53B 1REQB 1SCNE 1USKA 4QIHA 5IM5A 3KQHA 2HO4A 1EE2A 2J08A 4MWCA 2GJ9A 4P8RA 1WA5A 5B53A 1EXWA 1GQ2A 1R6VA 3GHYA 4FMPA 4FX5A 4O4HA 5CR9A 1Q50A 4KRXA 4XZ3A 2IHKA 4JEHA 4OM7A 2XBMA 4IZIA 2HM7A 2IBSA 1YRBA 1DTSA 2C78A 2ZBQA 4UCWA 4BO0A 1IMJA 2I2DA 1UF9A 4MKXA 5HCUA 1KAHA 4BNGA 1YFLA 5KNDH 3H2SA 1FE8A 4RWZA 1FP4B 2HA5A 3OQOA 5AJUA 1DIBA 5T64A 3TPCA 3WFZA 8AT1A 3L41A 3AFOA 3G2PA 4MSUA 1I13A 3BFJA 1UDBA 3HUDA 1QE3A 2QXYA 1ZN2A 2JGKA 3FPAA 2JGDB 3MBIA 2Q6TA 3VDXA 3GEGA 2IGTA 4W5TA 3HKBA 4NBRA 2CYCA 4IYRA 2YWCA 3SAJA 2B4KA 1XN4A 3N0XA 4G37A 5GP1A 1Y8QB 2YOFA 3LUKA 3M3DA 3UAOA 4ALIA 2LXNA 1Z6GA 1BO6A 3CEAA 1XXHB 3GRFA 4YRBA 5A6SB 1H3EA 4I81A 1E8NA 1HI9A 1JU4A 2W00A 1Q57A 1WD5A 1GGMA 3HBLA 4RE5A 5EPUA 2W2QA 4RA6A 1PDOA 1CEQA 1X77A 2B4RO 3B52X 1O9HA 1P6XA 2FMXA 2N0SA 2NV2B 3BA6A 5E6SB 4H6WA 5EJIA 2A9JA 5LIRA 3BIJA 1KVTA 5EJ5A 4R9VA 4FOSA 4TUYA 1HFKA 1UPXA 3Q7EA 2JLXA 2C59A 2WJAA 4UCFA 3H2YA 4LTDA 1D4OA 5G4LA 1EFLA 5EERA 2H8KA 1GD1O 1PQUA 2GD6A 1USIA 2WU3A 3DYVA 3TLBA 4WKPA 5GONB 4V0OA 3WLQA 2ZSJA 1KYVA 1T1SA 3PT5A 1X7YB 1GT6A 1U2GC 2XF2A 2EDAA 2ZTLA 3A58B 2MSCB 3FCEA 4L95C 3AUTA 1XXHE 1CERA 4FR2A 2Q0QA 1ODJA 3CW2A 4JD5A 4JUAA 3DP7A 3PK0A 2PFSA 1HL3A 2FQ1A 3O38A 4J1TC 4JOSA 3L04A 4U7JA 3OFNA 1CZOA 1I9GA 2OXTA 3T3IA 4D96A 1I3OA 4M76B 4A6XA 3WZ2A 4DEXA 3GFFA 3OUTA 5FR2A 4YRRA 2JFXA 1GTL1 3IEPA 9LDBA 1L5ZA 3H97A 4G26A 1U6KA 2IZZA 3GLQA 4O4LB 5A0FA 3MUFA 4FGLA 3RT7A 4URVR 1B41A 3CLTD 3HCOA 1G6Q1 2C84A 2AA3A 1X13A 5M5BA 1MGPA 3CRNA 1KO4A 5UKDA 3TOXA 1TJNA 2J33A 4LHVA 1MPXA 2FX3A 2QDXA 4XI9A 4I14A 1I33A 3EGEA 2I3DA 3KV1A 3RKUA 1DKPA 2FZKA 3QWFA 5FX2A 4URZR 4NSNA 5AHWA 2XTNA 1FFEA 1XF9A 1NBMD 4HEQA 4QPZA 1U0GA 3ZWOA 5KTMA 2R62A 2O0MA 3SXJA 2FEPA 2PS1A 4GMGA 4ENPA 1TK9A 1Z2AA 4UJ5A 3T1NA 2XQFA 4U9HS 5BQPA 5CA0F 4KZKA 3O8QB 4KXFB 4KB5A 3KBBA 4PYQA 1S3SA 3JAWA 4O2BB 2O4CA 1SG0A 4Q0MA 3G0IA 4WESA 4DBVO 2QD1A 3DV2A 4BFYA 5BN5A 4U7HA 4UQOA 4HQFA 4TZ6A 1ZGJA 4IHAA 1KMHA 1RYMA 3T9DA 2HA0A 2Q6KA 2X9VA 1G63A 1XL0A 2Y0CA 4HYQA 3EQZA 1TUIA 4GWGA 5J2UB 4W5RA 3HHEA 3OCXA 3S2GA 2NTNA 4MHSA 4YRPA 4MP3A 3UAYA 4DCJA 5IVHA 5L7TA 4J16A 1UMCA 2ZFUA 1WVGA 3GPBA 4TS3A 2HRDA 1UDXA 4OHCA 3WLJA 1BCRA 2PSSA 3VR6A 4C7KA 4I1OA 5D6OA 1OC4A 2VEOA 1Z47A 5FOTA 4IWXA 3QPCA 4XYLA 3BD9A 1TTQB 3RJMA 4U5XA 5DKFA 5EUBA 1YRQA 1IZ8A 1YZTA 3JARB 4G56A 4QBTA 5EQFA 4TTSA 2P9YA 2I2XB 3CUYA 2PEYA 3KNZA 4TV8A 3U31A 2NZUG 4BO1A 4CV0A 1DAMA 1T5LA 4EZBA 1H94A 3HMKA 1TAUA 5ADUS 2YZKA 4XCVA 5B2EA 1LZKA 3KYBA 1AKWA 2NU6A 5K3FB 2E5LB 3TPZA 4TXJA 3C3PA 1NN3A 3EA5A 3DPSA 4L73A 1UBHS 4Z0PA 2ZJOA 3GMTA 1HR0B 2YXPX 4TKZA 3MD9A 1G18A 3Q8LA 1P77A 2O2EA 2Q3HA 2O6HA 3GPDG 3S8MA 1GILA 3LVFO 3TMAA 1U31A 4HNHA 4R83A 1YE3A 3G8AA 3IEXA 2YWBA 2FEMA 3JRNA 3LFHA 4Q6BA 3NIDB 1FYXA 2P68A 4FJ1A 4E5VA 3SM3A 3P5SA 1YU6A 1EBUA 3SMQA 1XTSA 3E3NA 3P19A 1C8KA 3K53A 1AGYA 1E3TA 4DOMA 3CKKA 4DADA 3EXHC 1Q15A 2GR9A 3BL8A 3OCYA 4KFRA 2VATA 1A4IA 3K9CA 1GNRA 4KO3S 4Q37A 2LR0A 4Q9JA 1NR5A 5BRAA 2XA1A 1NQ5A 5C3MA 1B43A 3QBTA 3T3NA 1ZZEA 2JA2A 4M6WB 2WIGA 4KSBA 3WMGA 5EMKA 4X1YB 5GJCA 3ZTTA 9LDTA 1T9CA 1Z2PX 4F84A 2H9AA 4LOJA 3ZWAA 2O3UA 3C1OA 3SBEA 3UHJA 4YP7A 4D9EA 5INTA 4BQIA 1SU6A 2QY6A 3QJGA 2CHQA 5DT9A 5CXUA 4XYEA 3N9IA 3I2KA 3K71B 4KLCA 3TLMA 4GL2A 2GZ2A 1MXHA 3L7KA 4RS4A 1V6CA 3PITA 3Q3CA 1WXXA 1CULC 5SYNA 4HDKA 4DBLE 5IC4A 1YVRA 1JDVA 3FAZA 2QA5A 4MWEA 4ZI3A 5IJ9B 3K35A 4E32A 2IS6A 5EMMA 4YCMA 5GVRA 3NAMA 1PEKE 3U4MA 1FFXA 3LYHA 2A5LA 2QGFA 1P1CA 3PNQA 4MX8A 4R98A 4XR9A 3T3MB 4KN8A 1KS9A 1QGDA 2IOQA 1VL8A 2RGGA 3IHLA 4R2HA 5DSXA 1QP0A 1RIIA 1XRSB 2GNOA 2H4XA 5F73A 2CBGA 4ESHA 3OPVA 5DHRA 4AMUA 1WW8A 3E1GA 5I4CA 1DWPA 1EUCA 2XADA 1RYYA 3QEBZ 5F9FA 3IUQA 3X1JA 1C7JA 5JQGF 3VSCA 1KZ4A 2QVCA 2QTHA 4P3XA 2I3AA 3V1YA 4EHAA 2WSBA 4CIVA 3KQUA 3KZCA 1ONPA 2OY0A 5ILGA 1GZ3A 4Q7EA 4C2TA 1A7AA 1L9XA 1RNLA 5EIWA 4IGEA 1U3WA 3D8TA 2MJLA 1B7GO 3KJNA 4MZXA 5FQOA 3WP0A 2HLPA 3JQCA 2CXTA 3BHMA 2HLNA 2VP6A 1WHSB 3KQQA 4FK8A 3G5AA 1K6MA 1OLXA 4G0ZA 5KCZA 1VL5A 2YQZA 1NVBA 2MYUA 4HWSA 1XYGA 4EBFA 2N9UA 3NEJA 4H1WA 2NT3A 5KINB 2R1TA 4YUXA 5B6IA 1L8QA 4Q4JB 1MAAA 3WO0A 1UZNA 3DR5A 3DDCA 4MQFB 4WGFA 1XNQB 4Q3CA 1MC1A 1VFNA 4BNDB 4N0MA 3L7NA 1CUZA 1J2YA 1GGHA 1W2GA 5G53C 1A97A 3PF9A 4OO3A 3PGA1 1VG1A 9ABPA 1A95A 3F4BA 2IDMA 1ADCA 3NKLA 4RX1A 1C2TA 1JV2B 1GFWA 1Q77A 2QN9A 3ISTA 1Q44A 4O4HF 1M1YA 2BOVA 3IJEB 3NI2A 5DM70 1ZD4A 3U61B 5IABA 4ZHSA 2HO5A 5FI5A 3WLRA 1M67A 2AFIA 4XARA 1U3DA 3EMVA 4X94A 4YQZA 1HLGA 2QVBA 5AKXA 1OZAA 3TQRA 2BV3A 1DT5A 5HDQA 2WTUA 3FCYA 2O4UX 4M0KA 4AKEA 3G82C 4C7VA 2Y92A 2R7LA 2I2WA 3FMGA 3VKFA 5FWAA 5C81A 4PSCA 5DRTA 1XD2B 2PX2A 2HHHB 3LKDA 1ZL0A 4J3FA 2QYSA 1T43A 4UVGA 5J5AA 2WJHA 5HRUA 2UXDB 2V4ZA 5K3AA 1Y4UA 3ZWMA 3GFTA 5CDFE 5K3EA 4AICA 1W94A 2YY5A 5JNTA 2GTPA 4DIUA 4PYIA 2VHQA 2QPLA 5HE8A 1R0XA 4YPVA 3KKEA 4HNTA 4FHGA 1O6GA 3EDYA 1UKAA 4PFSA 5EN4A 1E58A 2OGUA 2M6KA 1Z4LA 3NYQA 5IRCD 1KZ1A 2PZKA 3HVJA 4C2UA 4R9RA 4BNXA 2BJWA 2GLXA 2X42A 4TKUA 3DKIA 2GN1A 4QPDA 3V4RA 4HQKA 3ZV5A 1O94A 2GX6A 1IATA 2PLNA 2WSIA 3BAFA 3OFJA 3RRYA 4NE7A 1RJ9B 1MQSA 5GPBA 4V1CB 3G0GA 2N46A 2Z1NA 4KWIA 1JLKA 4TUYF 2PXXA 3PQ7A 4V3BA 3ZDZB 4JZYA 2Q4TA 1T35A 1YJCA 3BUSA 5IDYA 4DM4A 5K6RA 3AUFA 1V5EA 3C3JA 4R0NA 4TM8A 2X2PA 3TSYA 1GNTA 4DQ0A 4ESOA 1V3QE 3UZUA 3EFOA 4FNOA 5HKLA 4AIIA 3A4YA 4H3HB 2Q5OA 4OGFA 3U16A 1EXDA 5LR6A 2VDWB 3SOZA 2O8VA 2W6NA 5TT0A 5J23A 2NO9A 3KQSA 3VYUB 2CHVA 1A7UA 5BO5A 1SVWA 1L4BA 2L82A 4QXAA 5JYBA 3KKNA 5K09A 1NNSA 3QVKA 4UJ3A 1GN8A 3D3QA 3VR3D 3OJCA 3JQAD 3MPUA 1RHJA 3UAVA 4MI1A 1WMSA 1NBMA 2A58A 2D0PB 3MF4A 4UCXA 1IWOA 5GZ6A 2GN8A 2W98A 1VTKA 2F6RA 3CUEF 2JGRA 3JWPA 3VUEA 5JFOA 2WWHA 1E5XA 4KMRA 1E77A 3TS1A 3KD3A 1WUTA 2GYYA 2XA9A 1RI2A 2Y2VA 3EWIA 3USZA 4A2PA 4XX1A 4E21A 3A1CA 1JYEA 2G7ZA 4F60A 4JY7A 2CNKA 2C3UA 5B4VA 2GPYA 3PDHA 2Z56A 3BGIA 4ZTBA 3QRWA 3OZTA 3QPBA 4E5SA 3BWCA 3RH0A 5JVDA 4LFAB 4IDHA 3CCBA 4G85A 4KX5A 3AOEC 3I9FA 2EFYA 4C87A 3R24A 4E4TA 1UKVY 5EZYF 2ROQA 1RJEA 2O20A 3P52A 3PUHA 3MT8A 1D0IA 5JHHB 4AYWA 3HKDB 3HYNA 3PUZA 3GQBB 1ENZA 1XKLA 2WJWA 1N1DA 2O54A 3KVYA 4EHLA 3IEVA 3G2NA 3WL4A 3QK7A 3URKA 3QXGA 4AS1A 2JD2A 3V7WA 1R9NA 1WX1A 2YS7A 2I78A 3IHTA 4DRXA 2B98A 2I6XA 2RGNA 3H9UA 3JQBC 3MJSA 4MUEA 3NCTA 2P6RA 1EGVB 1Z36A 3NM5A 1X7HA 1PE0A 4A8PA 2WICA 3ZU4A 1COWD 4J3JA 5BYAA 4YRLA 3KYDB 2P1DA 4JJAA 1KHTA 1D2AA 3LK6A 4XQGA 1CRPA 1NXSA 3BDAA 1KZ7B 2C5HA 2QQGA 3CX8A 4F06A 4HH4A 2JIPA 2VWPA 3WGZA 4BB9A 5D6NA 4XASA 3EDOA 3KZKA 3GLKA 4R40A 2AWOA 2EXXA 2WHEA 1FCJA 1D8AA 1KZ6A 3ESRA 4MMZB 4A8HA 5K6AC 4WZBB 4WACA 3SF8A 4OIMA 1M83A 2R8PA 4TV8F 3OPNA 1T6YA 4UM5A 1TX4B 2I65A 3MLEA 4JR2A 2VP0A 4LDAA 4QTTB 5A62A 4GICA 3BKWA 3ICQB 3FG9A 1L5NA 5FLKA 3HUEA 2O2YA 2WIJA 4PAQA 2Q4RA 4XYBA 5DIZA 4DCCA 5C8ZA 3THXA 3I5MA 5G3ZA 1IN8A 2DM6A 4A3SA 3WGLA 1N2BA 1GU1A 2V7GA 4IS3A 3QBEA 1A5ZA 2GILA 1FDSA 5KYYB 4CI9A 3WL3A 1K8RA 4DLWA 3DG9A 1D2EA 1SOMA 1PYDA 2ERYA 3KQVA 2JL1A 2HDWA 4HRXA 4LZOA 3RTAA 5KVAA 5GJWC 1AA6A 1AV6A 3SSNA 1ZUIA 2CKMA 3TTTA 1R0CA 4UC0A 3PUVA 4ZMRA 5BP7A 5H9WA 2WZQA 3EF0A 2IEYA 4MQEA 1ZWKA 4P4NA 2VTDA 2R6CA 4AJ2A 5KOIA 2W93A 3GELA 4C3OB 3CNEA 5JJBA 4JSTA 3I62A 3GRCA 2ZQ5A 3WZLA 1XMIA 2IEGA 4DCSA 2CK3D 2FZVA 2V59A 4L2IA 3W3ZB 1E64A 3JAKB 2CJWA 4JS0A 4KFUA 1MIOA 3H4VA 3FSGA 221PA 1UFVA 2OM2A 4OG2A 5KYUA 2DT8A 4LS3A 1SCIA 3UMVA 3PNVA 5IT9A 1J5XA 4D5GA 1GSHA 4YJKA 1E2FA 3AV3A 2BISA 4HXGA 3O2JA 4PNZA 1CIVA 2BGGA 4Z9BA 2PVSA 1UDAA 4WLFA 3AF1A 3X1WA 1DMRA 3KCQA 3REFA 4EPYA 3TCXB 4GMXA 5H4GA 1V9LA 3B89A 3IVAA 2DE0X 2FRDA 2JBAA 3ENWA 3ZWYA 4Q1CA 4UBKA 3CCCA 3D6TB 4X71A 2RAVA 1DRKA 5KWVA 2H7XA 1VYUA 1GGKA 1FNCA 4W7HA 3RVNA 2EKQA 1NNUA 2QVLA 3INNA 3K5PA 2A1IA 3DWIA 5JZMA 1Z39A 1JUDA 3N3AC 5EEHA 3EZ7A 2BHRA 3F47A 3SCZA 1XDSA 4URHA 3ZXSA 3AESA 2B34A 1VA4A 5ALPA 5K99A 2C3PA 2XOXA 1K8QA 3MT0A 3C7AA 3K5HA 2W6ZA 1L7RA 1P9OA 3OJWA 2Y1GA 4NLLA 3RC1A 5HQ3B 2XI4A 3PXEA 1MO5A 2PBLA 4G4GA 1D4FA 2AB0A 2VYCA 3AF4A 4PX9A 3WGTA 4AJPA 2OLKA 3RU9A 1NQAO 3TDMA 3VTZA 4GQIA 1YAHA 4WFQA 3F6YA 4UKDA 4NV3A 5KNCA 3JVVA 2ZSBA 5KYWB 2RB4A 3EYWA 5FTLA 2WU1A 4NFLA 4K2AA 4ZCSA 1WMEA 1W9HA 2GN0A 3A6FA 2OCKA 2Q1YA 3GL9A 4J2HA 4KO2S 3R74A 2IFTA 1WU8A 1RLJA 2CMGA 4KC0A 4P3NA 4EVIA 3PI6A 1PI3A 4CIYA 2UYCA 3O8NA 2OEPA 1LW6E 2DFVA 2I1LA 2I6GA 3NT4A 4I4IA 4OM8A 3W1WA 3KPUA 2FMIA 2Z4RA 4KEAA 1CQWA 4S35A 4AXBA 1FS6A 5J4LA 1TYAE 4ND5A 3S2ZA 3IKTA 1YI1A 2JD1A 4ZDIA 4JHXA 5G41A 1KFBB 4C4PA 5BSUA 3N8HA 3TTVA 3PJDA 3B85A 1C7ZA 4KHZA 5E4JA 2O5EA 4FYWA 4U2KA 5CXSA 1U0HC 4CM8A 4BQEA 3VHLB 1ZJWA 1E4OA 1K7XB 2R60A 4PLTA 3HNRA 4R68A 4XIJA 5MN4A 3VJRA 3UGKA 3WYBA 2GB4A 2BEKA 3M49A 1RYNA 4KYIB 4ARUA 1Z7GA 2FKAA 2QRPA 3QH4A 3GT7A 1RXSA 3T3HA 5TT1A 3I2GA 3K96A 2X3YA 3NBZC 3OZBA 2GNPA 4FJ2A 4AY5A 5K6TA 1XA4A 5DHUA 4F6RB 2L69A 1VE1A 3QW2A 2ZKLA 3B7WA 2FZGA 3CRZA 4G65A 5KOHB 4J49A 1JEQA 2BTOA 1EAMA 3BJMA 3EGVA 3N2GB 1DC7A 4L28A 4Y18A 5L6LB 4LA4A 3JD0A 2ZRPA 1ZLYA 4ER3A 5F77A 1VBMA 4AJKA 4DCPA 4OBXA 4AYXA 5EIEA 2P40A 1JEJA 4FD2A 2RHRA 3VDRA 3HQ4O 1EUDA 4ZYWA 1W4LA 1MJHA 2GN2A 3WWPA 1IOZA 2AG1A 1M54A 1Z12A 2WP8J 3FIUA 2I33A 1RWVA 3BMQA 3FYUC 2ONYA 2C7PA 4OXQA 1FDRA 4PNPA 1RRKA 4NF2A 3AFIA 2BUBA 2J87A 1IU9A 4DMKA 4X8LA 1T1GA 4GBED 4JU9A 3LSYA 1UOEA 2CE2X 1KK1A 1W36C 2E4UA 5FV4A 4HLNA 4EVSA 4OD0A 2UZ3A 1P4SA 3QX8A 3VR3A 5ADWA 1TEXA 2TMGA 4OATA 3A6LA 5ALKA 4GM4A 3TQHA 1ZRMA 1WSDA 1OX6A 1V96A 1KO1A 3IP5A 1D9XA 5DRYA 1M0TA 5CD9A 1HT2E 1OVMA 4LZJA 2V0NA 1NXWA 2BEVB 3LUFA 1KPHA 2NOAA 3K7EA 3QEJA 4Z2AA 2J3MA 1ZSYA 4GKVA 3MWDA 4PSVA 1CUVA 3PF8A 2CMKA 4HNQA 1KTVA 4Z2YA 2FWPA 3KV3O 3HFSA 1C9MA 5G1NA 3ZZ1A 4EKGA 3L3BA 4UDXX 4PYNA 2WUFA 4OJNA 2IH2A 2ZYVX 1PFYA 3WK5A 4G5GA 3GC6A 1JFRA 3B2EA 1FRVA 3P4YA 3EISA 4LGCA 3RS9A 3UG6A 3K0AB 1M73E 3OD5A 1BQ4A 5EXPA 1QZZA 3JATA 2OVFA 4WJLA 5F5NA 2CEKA 3R77A 3ZHOA 1MQ8B 2HQ1A 2VDPB 4OUDA 4CLRA 5JUWA 2GAOA 1JEDA 4EUEA 3O6VA 2PUVA 1KK3A 4AWBA 4DJ5X 1Y1KE 1GV0A 4WLEA 1BXKA 2CY0A 1XEXB 2C04A 4MUYA 3UWKA 4FP9A 3T5MA 4KRGA 2A5GA 3PG5A 3E9YA 1SBTA 2AK2A 4MXDA 1G2PA 1ZIOA 3BDIA 2MOKA 1FSGA 2XYPA 1ZU5A 5JVDF 1L5FA 2FWMX 1G59A 2ODPA 1JXOA 4FYHA 3MBKA 5JYCA 3LYAA 3MTQA 4V0ME 4JNCA 2W8BA 2BGJA 1SPXA 1UK6A 1V7PC 3SLGA 2ECOA 3DZBA 1PJ3A 3L9WA 3D8NA 4D4JA 1GSIA 4CMIA 4E07A 3DMNA 2G5TA 1G66A 1AZWA 3LFUA 5E2IA 3KR9A 1X0XA 1O58A 2Q3CA 1PGNA 3A2NA 1YQEA 2PS3A 4FGWA 4P7FA 4W6ZA 5C1BA 3RUFA 5BWOA 4B33A 2EQBA 1IQRA 3QITA 2F64A 1US8A 1T8TA 4HI0E 4OXKA 3BPSA 5AJTA 3IPXA 4AY4A 1KU0A 4ZODA 1VLLA 3E8MA 4NL4H 1EZZA 4Q9LA 3NIFB 1UBCA 3KTFA 3EIFA 3LLUA 2B5WA 4JYBA 4PHFA 3U4CA 5CBPA 4R1NA 5BW4A 4X7BA 4JMPA 3C24A 1S9DA 2IRWA 2OAEA 3PE4A 4RHYA 2ZQYA 1AKTA 1JTEA 4US0R 4WTOA 3WKAA 1L7EA 1RE0A 2YWXA 5ALJA 2HV8A 3EK2A 3RJ9A 5DNDA 5EJ8A 1NOIA 1LF0A 2P90A 3TVDA 4G97A 1N5RA 3WL6A 4EB6B 5K8IA 1XEFA 4IUCS 1WQ3A 4JGBA 1T4GA 4F4DA 4YMGA 4AJLA 3EY4A 4K05A 5B12A 1G8PA 2H2HA 2YCBA 2YVKA 2GUWA 3QX7A 1W73A 5BWMA 5D85A 5IP5A 4CF6A 3U7IA 1DG1G 1P73A 2PVCA 4OHFA 4ARVA 1U8YA 4B5KA 3R23A 2DPHA 3FOWA 2Q3FA 2YFHA 3H42B 2ODAA 1TKRA 4U7DA 5AVRA 2OBMA 4RKQA 4Y1FA 5MN5A 1GV1A 1TAQA 4JIMA 4QJ4A 3C6MA 4M0CA 2G1JA 4K9SA 3EGIA 2DAPA 3BCRA 4Q7JB 1KDZA 1DDGA 2OBFA 3L06A 1I4OA 2Q5IA 3BM5A 3ITNA 3B6MA 2F1IA 4CR8A 3EDCA 3FVQA 4HEA1 5AM1A 1U1FA 2X1MA 5CDHA 3R5JA 4Y2QA 1YV9A 4Z7OB 2YZGA 3BWDD 2NUAB 2AIRA 3MCWA 4UHFA 4DZZA 1J39A 2L42A 5L95A 3CR3C 1MB4A 5DLDA 2BKUA 2CVHA 2IEAA 3A4NA 3L1KA 2ZJ2A 5JYEA 4PLGA 3VPCA 5F1OA 2X0FA 3U5TA 3VNVA 3UMRA 4CT5A 2CLSA 1L5SA 3WL8A 3C5WP 3VC2A 1F0NA 3IIIA 4WBNA 5BURA 4IQ4A 4IBOA 1FFGA 1MU0A 3F1KA 1BRMA 5JD3A 2Y6UA 2IIBA 2IHBA 1K5DA 2VBGA 4NCJA 4P35A 5AXCA 4BP3A 2QG4A 3L7CA 4TSRA 1Y3FE 4CMGA 4MR8A 1P3DA 1LJUA 2Q1TA 4PGGA 3TJRA 3PQ6A 3GT3A 2O2DA 3QELA 4EHFA 4LDQA 2OV6A 3RIHA 3TXXA 3JV7A 3RRMA 5IJ0A 4CKCB 2CC2A 1RTTA 2GMWA 2YS6A 4WKCA 2ZS8A 3LLSA 4IEIA 1M2JA 3HNPA 4QQKA 4S1OA 1UR5A 4Q15A 5BXQC 3JWJA 3NJ4A 1WQ1R 2V7PA 1T25A 2OGTA 5DH9A 3ZY6A 1KGSA 3DHEA 3MGKA 2QTZA 5G0TA 2FP4A 3BC1A 5EESA 2NVBA 4IY1A 4YMLA 3EA0A 4N8DA 5HRAA 3PX7A 1QRSA 3FUXA 3H5VA 2CVZA 2E4YA 2JJYA 4TWAA 1PW5A 2AFVA 4EB3A 2QLMA 2C83A 3R0IA 2R5WA 4F85A 4BZWA 1N8TA 2AZXA 3DXXA 2ZR7A 5I9IA 1PFUA 4BNKA 4PICA 4PLZA 1R9MA 3KPYA 2Q4DA 1ZQ1A 1UMBB 2BKEA 4JCCA 3UBMA 1SVOA 2YDYA 3IAS6 3KLNA 4AF7A 3VPHA 3QFTA 4BNMA 4G9BA 1DKQA 1RHRA 2IDJA 1SR8A 4RHFA 3T12A 4ENRA 1RZ3A 1R10A 1PSZA 3IILA 1J0EA 2PNJA 4M0DA 4YAGA 2OGSA 1NLMA 5ENZA 3TTYA 1G5PA 4L9SA 4N6GA 4XA8A 4BMNA 4PAWA 3HTXA 3HXKA 3RBAA 2AFHA 4HDNB 3SDBA 4A27A 5U4QA 3I6BA 5C0OE 4BXOB 5CFOA 4PC7A 2YQ5A 2YHSA 5TMPA 4RTQA 3RK4A 1CXZA 2BF7A 3DW1X 3ZKWB 4GRAA 2H00A 5ALVA 4TYWA 3PR2B 2ECFA 1W1WA 1NONA 3CF0A 1IB0A 1C41A 1N2OA 2DQKA 1OX4B 2FPSA 2GYVA 1I5OA 3B8EA 3G1WA 3GBSA 5DP1A 4W5QA 1CETA 4FIZA 4UARA 2ZRDA 4GXQA 2H5IA 4X91A 4HVLA 3RUAA 3DDNA 2WD8A 3AR4A 1Z4JA 4CZ2A 4G1FA 2X7XA 4ZU3A 1J1UA 3A9CA 5CW2A 3OPYI 1G5TA 4PBSA 1OFVA 2R86A 2YXBA 2ID9A 1UM9A 2QNIA 3BFPA 3EIUA 5L3SB 4NCKA 1H6AA 5LBTA 2IX9A 3MELA 4PYKA 5DI9A 3HYLA 3KKLA 2P9GA 1ZGHA 3W9BA 1M6YA 1F5SA 1P6QA 3EIXA 1TK2A 3KTAB 3KS9A 2DR3A 3JPYA 4LTMA 2L17A 3TBHA 2X9LA 3U3ZA 3VNSA 1ZG3A 3B13B 3OA0A 5JBNA 3CN9A 5CB4A 2O14A 2V7BA 5GGXA 5EUMA 2ZAGA 1AXGA 1SUFA 1UOOA 2XGMA 4U2EA 3R7NA 1AY0A 3FDZB 3SI7A 5C1OA 1P2DA 1E4VA 3DBIA 4OQXA 2JDID 2VHEA 2Q46A 3EEQA 6NULA 4IF4A 4D26A 2PMKA 2QD5A 3NX4A 1AHHA 1ADYA 2ACVA 2OHXA 5ANRB 2JH3A 2IZ1A 3BGWA 2FHSA 3JU3A 1O3YA 3E4CA 4AP9A 1HOTA 1W5BA 1IONA 1XKQA 1XZDA 4V2UA 2LCIA 2I9PA 3LDGA 1LQ2A 3LLCA 4MQMA 4R1MA 4RJIA 4YAJA 4C88A 1NZDA 4MVJD 2UXCB 4XVHA 5CM2Z 4D9NA 2FR0A 4URWR 4RGVA 2NM0A 1ISPA 2A0KA 3GFQA 2ECKA 2YN2A 3PD0A 4G25A 4Q9DA 4RFSB 5LA6A 4X64B 3U44A 3O47A 1QORA 1OTYA 5E7QA 4ZT6A 2Y68A 2YWHA 2ZBEA 1PJRA 2ZT7A 2MTBA 1PHPA 4JI6B 3SX0A 2QYTA 2V8OA 3RSGA 4N40A 3VDMA 4YUZA 3E5RA 3GLRA 3P2JA 4N7JA 3WICA 2O8NA 3HJGA 1RM5A 4K6HA 4X90A 4IIEA 4LZWA 2NVUB 1N78A 1EFDN 1WXEA 4GOLD 4NE2A 4AJEA 4ANFA 3ROKA 2DC1A 2ZIXB 1Z83A 3DEKA 3EEYA 1PT8A 4N3GA 5JSFA 4P0QB 5AJVB 1KDYA 2A5YB 3AJAA 5DTJA 1JQ3A 1E79D 4JP2A 4LZZA 2ZTSA