1NE8A

Ydce protein from bacillus subtilis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
b'LIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein YDCE
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal structure of YdcE protein from Bacillus subtilis
pubmed doi rcsb
total genus 33
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ne8A00
5CCAA 5CR2A 5CKDA 5CQYA 3TCJA 3NFCA 2KMTA 2VUBA 4ELZC 4MDXA 5CO7A 3G7ZA 5HK3A 4HKEA 5HK0A 5CKBA 5CKFA 4VUBA 3JRZA 5HKCA 4MZPA 5CKHA 1VUBA 4MZMA 4ELYC 1UB4A 4MZTA 4OF1A 1NE8A 3HPWA 5CKEA 5CQXA 5DLOA 1M1FA 1X75C 5CK9A 4ME7A 2C06A 3VUBA 3JSCA 2MF2A
chains in the Genus database with same CATH superfamily
4AG2C 4PJOG 2JOYA 2JTFA 3FRNA 4XQ3A 1UHCA 2WSFE 3VU3C 4E2FB 1W2BA 3EGXA 2RQRA 4M4ZA 4FT4A 4KH0B 4J9FA 2J6KA 1EX4A 1ZSZC 5D7UA 2L3PA 4DBQA 1JO8A 3C95A 4QQGA 2AK5A 2HNIA 4PFOA 1IZ6A 3LH0A 4HVUA 3VJPA 3OYFA 4CC2A 2GQIA 4J8OA 3QO3A 1GFDA 4M7DB 3JB9F 4YTLA 1YIJA 1E6HA 2QYZA 2EW3A 4N0AA 2RHYA 1YJWQ 3RKYA 2L5QA 1SEMA 2HKNA 3VS1A 1YJ9T 1VQOT 3LWHA 1D09B 3OMGA 4QKUA 3CXCS 2CT4A 5GAOl 3FB9A 3F70A 4XU1A 2MOXA 1M30A 2X51A 2DIGA 3CD6T 4HKEA 3OYMA 2C0IA 1X01A 5GMKe 1UJ0A 2QDYB 2COZA 2PUOB 2KDSA 1KC8U 3OYYA 1PRMC 1Z9QA 4OB2B 1NEGA 3E2UA 1Q82R 1K8AC 2RNAA 2V1RA 3CCRT 4M7DA 3TSZA 3OYHA 1BCOA 2C0TA 1UG1A 3V7CA 3ME9A 3S3MA 5FWBA 2O88A 1U1SA 4BI3A 2EJFA 3HRSA 2O9SA 3G6ET 1M90R 3QPHA 2LX9A 2EBPA 1KHCA 2COYA 2PU9B 2ZPFB 3TEEA 4PKCC 3G4SA 4R55A 2NUTB 1M8MA 5C6SA 2LCSA 4MZTA 2M02A 3UA7A 2RI2A 3CCVA 1M1KU 4M78C 5LJ3h 2CYZB 4LDXA 1S1NA 1K4US 4KH1B 5FW9A 5GAMe 5KYNA 3ZFJA 3TCJA 2MYSA 4DEYA 4Z89A 3AHUA 1G3SA 3CPWA 2O31A 2KE9A 3GF5A 4QVCA 1NJIR 2EYXA 4C92C 2DO3A 1M1FA 2L89A 2RQVA 5EG2A 1UECA 3VS7A 4ZTFA 2KEAA 3CCUT 1S72A 4D6WA 1H641 1VQPA 3NFCA 3QWXX 3L2RA 1G8XA 4M77F 2PUKB 2JW4A 3VKIA 4LN2A 3CCLQ 3SDZA 3A98A 1NLPC 1I0CA 5IH2A 3OS5A 2ZPBB 3BDLA 4BDZA 2RD1A 4DBRA 2DYIA 3KUFA 3CCMQ 3VV0A 2CREA 3CC7T 2LP5A 2O4XA 5CKHA 3H8ZA 1MHNA 1BU1A 1PKSA 1ZBJA 5CVIA 4TVRA 2V1QA 1YJNQ 3CCUQ 2QA4Q 1BCMA 2K5IA 2FPFA 1T0JA 1X2KA 1YNZA 2RQWA 4C8QB 2B86A 3EAEA 3HRTA 3QYGB 2HL5C 4KBMB 1F1BB 4QVDA 2OAUA 1W2BS 1BK2A 2JN0A 1QQJA 3MO8A 2RI3A 3M55A 4CRIA 2K9GA 3FJ5A 2CH4W 1O9SA 4FU6A 1U5SA 2FRYA 3JAME 4XAXB 1Y71A 4JLIA 2EGEA 2AT1B 1GL5A 1YITT 2WSEE 3PGGA 5IT9E 1NYFA 1K9AA 4KUIA 2LQWA 2RJDA 3G71Q 5I21A 2ESWA 5KE3A 2YUQA 3CCSA 1K8AR 1RABB 1W1FA 1OYXA 2LJ0A 1W70A 3JB9G 3S3NA 1Y96A 2B8AA 1ZA2B 4C8QA 4HCBA 4MMKA 3CC4T 1FMWA 2HSEB 4FYVB 1AEYA 9ATCB 2KAFA 2ABLA 4ZGEB 4KT0E 2V8KA 4E7ZA 3UDCA 1FMKA 4XU3A 5LJ3j 5FRMA 4XU2A 4JDSA 3QG1A 4O6JA 2RA2A 3VUZA 3I5SA 2F5KA 1YJ9A 1I4K1 2QQ9A 3H0HA 1I07A 1NJIU 5AYFA 4M7AG 2DZ9A 5GMKi 4AMCA 1BYMA 4PNOA 3OYEA 2R58A 3JRZA 3JB9J 2D0NA 1Q82C 1K73C 2QQRA 4RTYA 1VQ6T 2KROA 2HDAA 3RESA 1YIJQ 1OZ3A 1X75C 2E12A 4C0GA 2AKLA 2K2MA 2DA9A 4PLIA 1U3OA 5FLXE 2CP0A 5ECAA 5GAOn 5GMKj 1UGPB 3CQTA 3FC3A 4FW2A 4IUUA 1WXTA 4J9GA 1QVGS 4J9BA 4EMGA 1OX9A 4IIMA 1NBEB 1B34A 3CCST 4XTUA 1VIFA 4RTUA 1RAGB 1OU9A 1IREB 4C8QD 3CMEQ 1KQSA 1YWOA 1V76A 5IHNA 1HJDA 1MMGA 2XKOC 2RI5A 3JCMh 3GIBA 3QSUA 1CSKA 1JRIA 2ZAEA 3I9QA 1QKWA 4OP0A 4M7AE 3JCMW 5C0MA 4ESRA 2DYBA 2VWFA 5LJ3d 3I56Q 4UC4A 1M2VA 4F17A 1D1AA 2K57A 2SRCA 1M3CA 1SRMA 2F2WA 1VQ7T 1YCYA 2ROLA 2QTXA 5DLOA 2LCLA 1N8RC 4Y91A 3CBOA 4MMLA 1X27A 2DERA 1QVPA 1WI7A 1KC8R 1M8VA 2OTJT 4PK4A 1OQKA 2DPPB 2LRQA 1QP2A 3CCEQ 3UA6A 3J80E 4OMQA 1WJQA 3RKXA 1N8RR 2O9VA 3MEUA 3A5ZB 3OA6A 2CSQA 4HCKA 4C8QE 5DLQE 1UGQB 2MK5A 2ENMA 3M54A 3G1JA 5LJ5f 1HK9A 4C92E 4LD6A 2DETA 2GFAA 2RF0A 3EHRA 1D3BA 4M75E 2E5KA 2GGRA 2P0QA 4J9EA 1VQ6Q 2DVEA 4F7UE 1OPKA 1VQ9A 4M75A 1YHQT 2Y4YA 3P8DA 4IIOA 5J3BA 4QVZA 3G6EQ 2K5LA 1RI0A 3SB2A 2RJCA 2VGNA 1ABOA 3EFOA 2CGHA 3RKWA 2AIRB 1BI3A 3J81E 1I1JA 3UF4A 4FL6A 4OGEA 1EIFA 3UWNA 3EG9A 3CCUA 3MP1A 2W10A 1M9SA 1Q86R 1OI1A 2EYWA 1WQWA 2DEQA 4J6YA 1FWZA 4J83A 1KQ1A 2A36A 2HEQA 4E7SA 2JM9A 3KBGA 2YRDA 3OQ5A 1VQ9T 2BZ8A 3EG2A 2QXFA 4P5NA 1D3BB 3EGDA 2DTIA 3PVQA 1MGQA 2HQEA 2CP7A 2K6DA 2JT4A 2DILA 5CQXA 1W2BP 3CC2Q 1VYVA 4NL3A 4B9WA 3M0TA 1SSFA 1SSHA 5IHIA 4O5VA 1U1TA 1WXUA 2ZZDA 3ZBDA 3IQLA 3QDRB 4FSSA 2CH4A 3HFOA 4HCCA 1ARKA 4RTWA 1LNXA 4C5EA 1KHIA 4EPCA 1KSWA 5KYWA 2GF7A 1VQ7Q 1CKBA 1KQSS 3CD6Q 2XHCA 4GBQA 3CCVT 3M0SA 3OS1A 3I56T 4F7UF 3L2WA 4A4FA 2ZPHB 2HQHA 4C0DB 1M1KC 3PTAA 4BE1A 1RLPC 4PJMA 3QZ5B 3G7ZA 4LDUA 4XK8E 1N27A 1ZQ1A 3CCJA 3EFSA 3EFRA 3A8OB 1K9MU 1R0BG 1S72Q 2HKQB 4IURA 2J6FA 3L2UA 2EWNA 1YJWT 2CZ1B 1P92A 4M7DD 5KYXA 3HP9A 3RMSA 1RAFB 1NZ9A 3VS4A 4KUDK 5FRNA 1GCQC 2DL3A 3CMET 4PJOD 2HL3A 5LJ5j 1QVGA 3SD4A 1D0YA 2JMAA 3X20B 4HT8A 5GAOp 3ER0A 2SEMA 1ZLMA 1B7TA 4J6WA 3M0UA 2DJQA 3DLLA 1VQLT 5KCOA 1TUGB 2DLPA 1VQ6A 1YN8A 3H0FA 4PJJA 4IUPA 4K11A 1C6VX 3QUIA 4LDWA 3P8HA 1NEBA 4FSXA 2CKKA 1TTHB 2BTTA 1OU8A 3HKSA 3RNJA 1RADB 1YIJT 1KK7A 1PNJA 4JJDA 1EFNA 4QQDA 2QQAA 1WZOA 3C0CA 4PJOA 1BB9A 3WVDB 2CDTA 2HBPA 3QBYA 3CC4A 2AZVA 1YHQA 1WPYA 3CMEA 1M90C 3JCMe 3MPUB 3L2VA 2FHDA 3CPWP 3OS2A 2DFUA 2DXCA 2JMCA 3QYHB 3EGDB 4C92G 1QVFS 3OW2P 1MMDA 2XIDA 2RK1A 4RKUE 1U8RA 2GQVA 4C92B 2VC8A 1AWOA 1I81A 2DX1A 2MMPA 4OB3B 2EQIA 1HSQA 4JZ4A 3OYBA 4EMKB 4J9HA 2A3LA 2D8HA 3JB9I 1VQ5A 4JS4A 3URGA 1WHHA 1LOJA 1NLOC 2EGCA 2FPEA 3M0RA 2EYYA 4GY5A 4HA8A 2OTJQ 1KIKA 1QWEA 2KRSA 2ECZA 1VQKQ 7AT1B 3ASKA 1WHJA 2QA4T 3VRYA 2P4RA 5CKBA 1WLPB 4EDUA 2X4JA 3SWNB 1M90U 3CMAA 1N9RA 2BKDN 2JM8A 2OAWA 3NPFA 3E9GA 1WHLA 1QCOA 3MHXA 1QMCA 4DBFA 3QJ6A 3HTRA 2BIVA 3BDUA 4ZGJB 1IRXA 4Y28E 1QCFA 2RHXA 2YLBA 4JZ3A 1WHGA 4ZN3A 5CIUA 3CC7A 1AWJA 4C0FA 1Y07A 3S6WA 1ABQA 5KYUA 3OW2A 4HT9A 4EMHA 3CC7Q 4M7AF 4L59A 1MUZA 3OB9A 5GAN3 1O75A 1RAEB 3HFNA 5IXBA 3U23A 2FG0A 2VKNA 3OYIA 3X26B 1OULA 1Y7XA 3L2QA 2KRMA 1VUBA 2XDBA 3OYJA 4AFUC 3CPWS 2GTJA 1U06A 2FZCB 4M75D 4N0AC 2ZPGB 1PSEA 3G71A 4PJOF 3GPLA 5FU7C 1AZGB 1ZUYA 4MDXA 2FL7A 2ZPEB 2LCCA 4D8DA 2RHIA 2M9UA 1G3YA 1IHVA 4RMOA 4M7DF 2IVWA 3KXTA 4OF1A 3UATA 1V29B 4RTZA 4XTXA 4ZNXA 2AHJB 1PRLC 1YJWA 3A8HB 2CP5A 2X4XA 3EG3A 2K3YA 1SG5A 4JPBW 2VYTA 4KULA 1BI0A 1R0CB 3R6NA 4JRKA 2LQ8A 1QVFA 1X43A 2DRMA 4PFZA 2JTMA 2P84A 2KVQG 5M9OA 3CBMA 2HBWA 2NUTA 2RQTA 2OTJA 4CC7A 4PFPA 3C12A 1N9SA 2EVRA 1PHTA 2JUFA 2YUPA 1N5ZA 1X2QA 4J6XA 4FIBA 3GP8A 1YITQ 2YLCA 3X28B 3VYHB 5LJ5h 2OJ2A 3G6EA 2JNGA 3MCAB 4RTXA 4A4HA 2A28A 2EKHA 2XI9A 2L3SA 1VQ4T 4EIKA 2O01E 2LMJA 4F14A 4F16A 2KBTA 5LJ3e 1ZSGA 1MNEA 2MIOA 4OMMA 3JB9D 1WA7A 4X34A 4A4GA 1VQMA 2XU8A 4M78A 2R57A 3CCMA 5FWCA 2QK0A 3PFSA 1K0SA 1WX6A 1TSFA 1X6BA 1Q95G 2LQNA 3FJPA 2IIMA 1QVGP 2C06A 3JSCA 5I2SA 3OY9A 1K9MR 3CCET 2IG0A 1FX7A 1Z9ZA 1ZSZA 4B9XA 1M3AA 1N8RU 1EZZB 4C8QG 1QWFA 1OEBA 1QW1A 4GLKA 3OBYA 2QG9B 1JXMA 3O8VA 3ZEHA 1OZ2A 2K3BA 3OYCA 1YI2T 1Y57A 2K3XA 3MKDA 1RI9A 3CCEA 2PNIA 2L3QA 4C5IA 2GBQA 3EHQA 3V8LA 5I11A 1VQ8Q 2DL5A 2DXUA 2PQWA 4C5GA 4JUVA 2CP3A 4FM4B 1KC8C 5GJWB 2LNVA 4LUDA 5GAMd 1VQ5Q 4M78E 5D6YA 2XD0A 4B6MA 4KGZB 2P4TA 4AFZC 2MAMA 2DEUA 5CAIA 1M5Q1 1Q86C 5L8RE 1D0ZA 2F5TX 2DL7A 3FDRA 8ATCB 3CCSQ 4M7AA 2EYZA 2CUDA 2OTLA 4DA4A 1TXQA 5FROA 1T0HA 2KXDA 3SWNC 1IB8A 2WSCE 3PMIA 2RK2A 3MEVA 5D6XA 1QKXA 1VQKT 5HY6A 4A53A 4E7HA 1K9MC 4RUGA 4E6RA 4F04B 1VQ7A 2MI6A 1KG1A 1MMNA 2KXCA 3I55A 1GFCA 1XOVA 3EGXB 1BI2A 2RJEA 1SHGA 3H0IA 2NUZA 3EGUA 2E65A 3OSVA 4M7AC 1GCQA 3OYDA 2EQJA 2XDPA 4RCCA 3GNGA 3SWNA 4ZTJA 4JRPA 1PM3A 1FMVA 6AT1B 2L2PA 5GANe 1NPPA 3NHNA 3RMQA 1VQNT 4NOYA 1GBQA 2LX7A 1UGSB 2YHTA 5AT1B 2QEXT 4Q5WA 1JBMA 4MZMA 1YI2A 2RHZA 2Y4XA 1RACB 3M53A 5A0LA 3OYKA 2E6NA 4IUTA 2H3JA 1SPKA 1G5VA 5KYYA 4X9CA 3OYGA 1Q7YC 4E7KA 1VQOQ 1SRLA 4M7DC 4M77D 4E7LA 1QCNA 4Z88A 2M0YA 4XTYA 2E5QA 2JZ2A 1GRIA 1VYTA 1VQLQ 3BW1A 2RMOA 5FU7B 1RLQC 5KYUB 5KCHA 3M58A 5GANd 3ULRB 3I55T 1YJNA 2DK3A 4D8KA 2FEIA 3V7RA 1M1KR 2L3RA 3OS0A 3JCMX 4CC3A 4C92F 2O2OA 1PC0A 5CCAA 2QQBA 2RO0A 3JCMQ 4II1A 3R6OA 1WFWA 2KMTA 3VRZA 1KFZA 1Q86U 5I2MA 1YITA 2NLUA 5GMKl 3G4ST 2RQUA 3LH5A 3JB9H 1JJ2P 2H8HA 3VS6A 4XU0A 1H3HA 2KRNA 3LLRA 1NPRA 5GAN8 2QAZA 4LDVA 3VS3A 1K76A 1G83A 2DD5A 3NTIA 4M78G 5CR2A 4FCYA 2LVMA 1N6AA 4BY6B 1UHFA 2FZGB 1FYNA 3EH2A 4Z02A 3M56A 2HQXA 3DLMA 2FO0A 3HRUA 5GANf 2VV5A 3MEAA 3HHTB 3RERA 4QQ6A 4A4EA 2EJ9A 4FYXB 4DOWA 4KGVB 2K79A 2PVDB 3KFVA 5LJ5e 3NTKA 3SHWA 3M0PA 5A2QE 4N4HA 2DZCA 2GTOA 4JLGA 2CSIA 1YI2Q 2CZ6B 2X4YA 1B34B 5DM7R 2LT4A 4KRTA 2R5AA 4NS5A 1VQ4Q 2KQWA 3EG9B 4AG1C 1BBZA 1SKUB 5FU6B 3QIIA 3JCMP 3LGFA 2NUPA 2LT1A 5CKEA 1AT1B 1BKBA 2X9HA 1ZHIA 2H3EB 2DE0X 2M0OA 3T9NA 1Q81R 3M4GA 1R77A 3ZL7C 2BUDA 2DIQA 3UPUA 1Q82U 1X69A 4A54A 3CC2T 3JCMV 2EYQA 3OYNA 5D6WA 3X25B 5GANg 1K0XA 1VQPT 1SHFA 2PZ1A 5LJ3f 2OX7A 1WJRA 3QDFA 2J7IA 1VQMT 4BACA 1VQMQ 1Q81C 2RJFA 4BUGA 2HSPA 1IO6A 8AT1B 2CUBA 2P0PA 3VS0A 3SEMA 2VUBA 4X9DA 4JRIA 2HMAA 4RG8A 3LGLA 1GBRA 3A1PA 2VXFA 1YHQQ 1TH7A 1IGQA 1VQPQ 4DEXA 1JJ2S 2YUNA 3TVTA 2E41A 2RPNA 3JV3A 4DBHA 4FYWB 1AZEA 5IHKA 3JCMb 4LUEA 1LJOA 3PVLA 4C92D 3HSBA 3EG0A 3VS2A 4HXJA 3CCJT 5EC7A 2QI2A 4E47A 1KD1U 1M1GA 4C8QC 4OB1B 2DD4A 2YDLA 2OTLT 2ED0A 2CS7A 2PTKA 1NYGA 1RL2A 3CMAQ 3M57A 3RUXA 5CO7A 1T3LA 2EAYA 4M77C 3JCMc 4HVVA 1C0MA 1KQSP 2RB6A 2DVJA 2KY9A 4CI0C 3OYLA 2LZ6B 2HAXA 2KT1A 1UDLA 1AVZC 4M7AB 1A0NB 2GCXA 1AWXA 2YSQA 2D9TA 2M1HA 3LYIA 5GMKh 5GAOr 5GAN6 3C4SA 1ZUKA 3CXCP 1YJNT 1OOTA 3AT1B 5GAOq 3CCLT 1PSFA 3NMZC 2BZXA 1NJIC 3CCVQ 2PVOB 4DOVA 5KH6A 2EGAA 4OMLA 3MEWA 2DKGA 3VS5A 2JS2A 3G4SQ 1S72T 4PJOB 4HVWA 2RM4A 2JVVA 4ANJA 1R8OB 4A63B 1LVKA 4A4KA 2DAQA 1HYOA 1MV3A 2DBKA 2DXTA 2DF6A 4BD3A 4M77E 2R5MA 1G3TA 3PT9A 1VQ4A 3RR6A 3CXCA 2LNHB 5HCKA 5L23A 2QTVA 1OX8A 2VXEA 5CQYA 5LJ5d 2L0AA 1H3ZA 4OMOA 1H8KA 3DB4A 4C92A 2HD0A 5KE2A 1BI1A 4HCZA 2I2LA 2ATCB 3QXEB 4XTVA 5KYXB 1JQQA 2DJZA 2J05A 4BY6C 5KYYB 2LTOA 2OTLQ 3RIRA 3TREA 4C0ZA 3CC4Q 3H6ZA 1JB0E 5CK9A 3I55Q 4PL6A 5DY9A 1GCPA 1KQ2A 1VQ9Q 4DQ2A 2COWA 1ZUUA 2F69A 3Q1JA 3DB3A 1QP3A 5CKFA 1VQNQ 2CP6A 2A37A 2F2VA 2I0NA 3GLXA 3CCQQ 1TOVA 2FYKA 2KNBB 3E19A 1IGUA 3M5AA 2LJ1A 3PE0A 4L5GA 1PCXA 1WIEA 1PD0A 4C5HA 2HCKA 3S3OA 1K73U 4E7IA 3SFMA 4JS5A 1ZSZB 1WJSA 2DNUA 4LE9A 1VA7A 4M75C 4OMNA 2RHUA 1RAIB 3REBB 2EFIA 2BZYA 3CPFA 5HK0A 4VUBA 4OMFB 4M75F 1PWTA 3V8JA 5GAMj 2E1HA 1UGVA 2G3RA 3PIOA 3QZ9B 4WF2A 3M59A 4IUQA 1XTDA 5GAMh 3HL8A 1AD5A 3JCMf 4PLLA 2L8DA 4KGXB 1WHMA 1YCSB 1ZBXA 2V8JA 2DL4A 2IPOB 1CKAA 4PJLA 1G3WA 2KSSA 2QQSA 1WXBA 3UT1A 4BI8B 3EG1A 1VQOA 1JEGA 2DTOA 5IXFA 1UFFA 2ZCFB 3CEYA 1FXXA 2GNCA 1MMAA 2AZSA 2KI7A 1UJYA 2XICA 2A08A 2XMFA 4PJNA 4OB0B 1E6GA 4IUVA 4M75G 1YFNA 4IKFA 1IHWA 4ATOA 1VQLA 2K5FA 2NWMA 4F7UG 4JJNK 2EIFA 5LL6S 1D1BA 1OPLA 4LNPA 3OYAA 4JRQA 3N5BB 4EMKC 2D0QB 4F7UB 3E1SA 1D0XA 3FIFA 4M78F 1M2OA 4M75B 3CMAT 2QEXA 3META 1K8AU 3M9QA 1H92A 4OMPA 2D8JA 3V7SA 4R56A 4E7JA 1XQHA 3D7SB 1TUDA 2QDLA 2ZPIB 3FEOA 2FRWA 4ORZA 2KYMA 4CC4B 4RG2A 3VYGA 1XNIA 3JCMg 1TG0A 2VB6A 2FB7A 3TSWA 1DJ7B 3L1AA 4LD9K 1I5LA 2E6ZA 4BDYA 3O5ZA 1C1AA 1TWBA 3RBBB 2KYBA 1M2VB 1JJ2A 3I35A 4RCBA 3A8GB 1VQ8A 2VVKA 4OGCA 3EFOB 3PIPA 2QGFB 4M7AD 5GAMg 4JJBA 1I5OB 1X6OA 2EKOA 4M77A 2YWWA 4ZGDB 1Q7YU 3EH1A 3OMCA 4N4IA 3WXMB 2DTHA 3INZA 4LXCA 1M3BA 4M77G 4BI4A 4ELZC 1M4ZA 2MWOA 5HK3A 3QJYA 3A8LB 4WTOB 2C0OA 1GXIE 3CCRA 4M78B 2D6FA 4XTWA 2KR3A 1HD3A 1TUCA 5GANj 3JCMd 2JTEA 1JU5C 1VYUA 3LW5E 5GAMf 3CCRQ 1WNLA 5FU6C 1LCKA 1WYXA 2EPDA 3PNWC 3QHSA 2WACA 4C8QF 3A8MB 2GFUA 2FVUA 3RDVA 3GNFB 2YRVA 2J6OA 2LDMA 3THKA 2YT6A 1K73R 1YBYA 4QW2A 3LX7A 1M27C 1KJWA 3G71T 5A0GA 4PJOC 2XDDA 2F1LA 4Z8AA 4M77B 4LDYA 2VASA 2JS0A 1AOJA 4X1VA 1PKTA 2DMOA 3E9FA 4RTVA 4L6V5 1MNDA 4GLMA 4J7IA 1BIBA 4PJOE 3WVEB 1AWWA 1IXDA 4M78D 1YJ9Q 2W0ZA 1UEBA 2ROTA 1UE9A 1Q81U 1UTIA 1Y0MA 2K7AA 3MJXA 1K1ZA 5I22A 3GOXA 4M7DE 2RH2A 1RUWA 2LJ3A 3CCMT 4BE2A 1LPLA 2A7YA 2CT3A 2X35A 2E10A 2QASA 1X6GA 4F7UA 2O4XB 2EQUA 1YP5A 2BE9B 4ELYC 3LWIA 2DM1A 1UB4A 4Y92A 2EQKA 3I56A 2F2XA 3I5RA 5CKDA 1VQ8T 5J39A 2ED1A 1I8FA 2Y90A 1E7OA 2VGMA 2KGTA 1KD1C 1NG2A 3JCMJ 1BIAA 5J26A 1ZA1B 1RAAB 1SF9A 3QWYA 2CP2A 1PD1A 3OBWA 2Z0WA 2K2VA 4RTTA 3VUBA 4J5YA 1D1CA 3BE3A 2DRKA 3DKMA 2P0KA 3BY7A 3MP8A 5GAN4 1WHKA 2CZ7B 2E3HA 1KD1R 1W4SA 2QGGA 2E64A 3CD6A 4J9DA 2EJGA 2HZYA 1AHJB 1W6XA 4R0KA 4AFSC 1HXDA 3J7AF 2M16A 5GAN7 3L42A 4FT2A 1NE8A 2EQMA 3MP6A 2V26A 4QT7A 5IN1A 1G2BA 1Y96B 1QLYA 2JXBA 2K4YA 3CCJQ 2G6FX 1NM7A 4ZN1A 3CBPA 3CC2A 3NGPA 3TQ7P 2V8IA 3P8BB 3GBQA 1WQ7A 1Q7YR 1ACMB 2DL8A 2X4WA 4J9CA 4AFQC 4C0DC 2QEXQ 1PG5B 5LJ3g 2YXYA 1T3SA 1VQNA 3X24B 1XJWB 2E4HA 2MF2A 3TU4K 1RAHB 2BE7D 5KYWB 1UUEA 3M0QA 4AT1B 2NUPB 3C94A 2YRCA 2D1XA 2LC4A 2E70A 5LJ5g 2NYSA 4EMKA 2XG8D 2MCNA 4WCIA 1ZX6A 2PVGB 1WGSA 4MZPA 2MPXC 5GANh 2X3XD 3PMTA 1JXOA 2X3WD 1V1CA 2ZGWA 2JJ9A 1UGRB 3CCLA 4FYYB 4BE0A 3H41A 4OVAA 5IAYA 1MV0B 2CZ0B 3M4YA 1VIEA 2J06A 3L2ZA 3V8KA 2A0FB 2MWPA 2FZKB 2DXBA 3NTHA 3QKJA 2DBMA 4J7FA 2LQKA 1QVFP 4MDWA 5GJVB 2RN8A 5HKCA 4FW1A 5GAN2 2XK0A 3CCQT 4V2SA 1VQKA 2KK4A 1OV3A 1YWPA 1B3QA 3REAB 3HPWA 5GAOm 1TS9A 2KT8A 5A0DA 4BB7A 3CCQA 2YUOA 3H9NA 4JJCA 5GAN5 3OW2S 3OSSC 4J9IA 2QA4A 4NL2A 2OI3A 1TU0B 4N4GA 4M7DG 2FPDA 2E3IA 3FLGA 2M51A 1B07A 2AKKA 3BFMA 1WDXA 4XTZA 4ME7A 1VOMA 1VQ5T 1J3TA 5GMKm
chains in the Genus database with same CATH topology
4C5IA 2VGNA 2JOYA 4PJOG 2JTFA 3FRNA 3V8LA 4DQ2A 2CGHA 3RKWA 2DXUA 2F69A 3Q1JA 4XQ3A 1BI3A 2PQWA 2WSFE 4C5GA 4JUVA 3J81E 3DB3A 4FM4B 3VU3C 1W2BA 1KC8C 2LNVA 1QP3A 5GAMd 4FL6A 4OGEA 4FT4A 5CKFA 1EIFA 3GLXA 3UWNA 4M78E 5D6YA 3CCUA 3MP1A 2XD0A 1M9SA 2FYKA 3E19A 3M5AA 1VQ6T 4L5GA 1OI1A 2P4TA 3C95A 1WQWA 4QQGA 2DEQA 4J6YA 1FWZA 4J83A 1KQ1A 4C5HA 2MAMA 2HNIA 5CAIA 1IZ6A 3S3OA 3LH0A 1K73U 1M5Q1 4E7IA 5L8RE 1Q86C 3SFMA 3VJPA 3OYFA 3KBGA 4JS5A 2F5TX 4J8OA 3QO3A 1WJSA 3FDRA 3OQ5A 4M7DB 1VQ9T 3JB9F 4M7AA 4M75C 4YTLA 1YIJA 2QXFA 4P5NA 1D3BB 2OTLA 2RHUA 2DTIA 4DA4A 4N0AA 2EFIA 3CPFA 5FROA 2RHYA 5HK0A 3SWNC 1MGQA 2HQEA 4VUBA 2WSCE 3PMIA 2RK2A 3MEVA 4OMFB 5D6XA 4M75F 3V8JA 1VQKT 5GAMj 2E1HA 3RKYA 2L5QA 2G3RA 5HY6A 4A53A 3PIOA 5CQXA 4E7HA 3QZ9B 4WF2A 3M59A 1YJ9T 4NL3A 1K9MC 1VQOT 4IUQA 3LWHA 4B9WA 1XTDA 3OMGA 5GAMh 3CXCS 3HL8A 1SSFA 3JCMf 5GAOl 4PLLA 2L8DA 3FB9A 3F70A 4O5VA 1VQ7A 1U1TA 2MI6A 4XU1A 1KG1A 2ZZDA 3ZBDA 3QDRB 3I55A 1XOVA 1ZBXA 2DIGA 3HFOA 2V8JA 1BI2A 3CD6T 4HKEA 4HCCA 3OYMA 2RJEA 1LNXA 4C5EA 1X01A 1KHIA 5GMKe 4EPCA 2QDYB 2PUOB 2KDSA 1KC8U 3OYYA 1G3WA 2KSSA 2QQSA 3UT1A 2E65A 2GF7A 3OSVA 4OB2B 3OYDA 1KQSS 4M7AC 2EQJA 4BI8B 2XDPA 2XHCA 3CCVT 1VQOA 1K8AC 2DTOA 3OS1A 3I56T 4F7UF 4RCCA 3L2WA 2ZCFB 3GNGA 3SWNA 3CEYA 4A4FA 4ZTJA 2ZPHB 1FXXA 3CCRT 4JRPA 4M7DA 4C0DB 2XICA 1M1KC 4OB0B 3PTAA 4BE1A 5GANe 3QZ5B 4IUVA 4M75G 4IKFA 3OYHA 3G7ZA 4LDUA 1NPPA 4ATOA 4XK8E 1N27A 1ZQ1A 3CCJA 3RMQA 1KD1U 3EFSA 3EFRA 2K5FA 4NOYA 1VQLA 3A8OB 4F7UG 1VQNT 1UGSB 1K9MU 4JJNK 2YHTA 2EIFA 5LL6S 4Q5WA 3V7CA 2QEXT 1JBMA 4MZMA 3OYAA 2RHZA 2Y4XA 5A0LA 3M53A 1YI2A 4IURA 4JRQA 3L2UA 3ME9A 2EWNA 3S3MA 3N5BB 4EMKC 2CZ1B 3OYKA 1YJWT 2E6NA 2D0QB 4IUTA 2H3JA 1P92A 3E1SA 4F7UB 1U1SA 4M7DD 3HP9A 4BI3A 2EJFA 3RMSA 3FIFA 1G5VA 3HRSA 1NZ9A 4M78F 3G6ET 3QPHA 4M75B 4X9CA 3CMAT 2LX9A 4KUDK 2QEXA 3META 3OYGA 1K8AU 3M9QA 1KHCA 5FRNA 1Q7YC 3CMET 2PU9B 4E7KA 3V7SA 4R56A 2ZPFB 3TEEA 4PKCC 4PJOD 5LJ5j 3G4SA 1QVGA 4E7JA 1XQHA 4R55A 3SD4A 3X20B 5C6SA 4M7DC 4HT8A 5GAOp 3ER0A 4M77D 4E7LA 4MZTA 4J6WA 2ZPIB 3FEOA 4XTYA 2E5QA 3DLLA 3CCVA 2RI2A 1M1KU 1VQLT 4M7DF 2JZ2A 4M78C 4RG2A 5LJ3h 1XNIA 2CYZB 3JCMg 3VYGA 5KCOA 4LDXA 2FB7A 3BW1A 5GAMe 1VQ6A 5FU7B 1DJ7B 3ZFJA 3L1AA 3TCJA 5KCHA 4LD9K 3M58A 5GANd 4IUPA 1I5LA 2E6ZA 4BDYA 3I55T 1YJNA 2DK3A 3QUIA 4LDWA 3V7RA 3AHUA 3P8HA 1G3SA 3CPWA 1JJ2A 4FSXA 2CKKA 4RCBA 3A8GB 2L3RA 1VQ8A 3GF5A 3JCMX 3OS0A 4QVCA 3HKSA 4OGCA 3PIPA 4C92F 4C92C 4M7AD 1YIJT 2DO3A 5GAMg 1M1FA 2L89A 5EG2A 1X6OA 2EKOA 4M77A 4ZGDB 4QQDA 4ZTFA 1Q7YU 3CCUT 2QQAA 5CCAA 4D6WA 1S72A 3OMCA 2QQBA 2RO0A 4N4IA 1H641 2DTHA 4II1A 3WVDB 3WXMB 3R6OA 2HBPA 3INZA 3QBYA 1VQPA 3NFCA 3CC4A 2KMTA 1YHQA 1WPYA 4M77G 4BI4A 4ELZC 3CMEA 1M4ZA 2MWOA 5I2MA 3JCMe 3L2RA 1Q86U 4M77F 1M90C 1YITA 2NLUA 5GMKl 5HK3A 2PUKB 3QJYA 3G4ST 3A8LB 3VKIA 3L2VA 1GXIE 3CCRA 4M78B 3JB9H 3SDZA 2FHDA 2D6FA 4XTWA 3OS2A 5GANj 3JCMd 2DXCA 4XU0A 3OS5A 3LW5E 2ZPBB 3LLRA 1NPRA 3BDLA 5GAMf 5GAN8 4BDZA 4LDVA 3QYHB 4C92G 2RD1A 1WNLA 5FU6C 3KUFA 2DD5A 1QVFS 3NTIA 4M78G 5CR2A 3PNWC 2LVMA 3QHSA 4RKUE 2XIDA 2RK1A 2WACA 4C8QF 1N6AA 3A8MB 2GFUA 2FVUA 3VV0A 4BY6B 1U8RA 3GNFB 2GQVA 4C92B 2YRVA 2VC8A 4Z02A 3M56A 2HQXA 3DLMA 2LDMA 1I81A 3CC7T 3HRUA 2MMPA 1YBYA 4OB3B 4QW2A 3LX7A 5GANf 2O4XA 2VV5A 3MEAA 3HHTB 5CKHA 3G71T 3RERA 4QQ6A 4A4EA 5A0GA 2EJ9A 3OYBA 4PJOC 2XDDA 4EMKB 4DOWA 3H8ZA 1MHNA 2A3LA 3JB9I 1VQ5A 4JS4A 5CVIA 2PVDB 4M77B 4TVRA 3URGA 5LJ5e 1LOJA 3NTKA 4LDYA 2K5IA 5A2QE 4N4HA 4GY5A 4HA8A 2DZCA 4C8QB 3E9FA 4JLGA 4L6V5 2CZ6B 2X4YA 1B34B 3EAEA 4J7IA 5DM7R 3HRTA 1BIBA 3QYGB 2LT4A 3ASKA 1K73C 2QA4T 4PJOE 3WVEB 4KBMB 2R5AA 4NS5A 5CKBA 4M78D 4EDUA 2KQWA 4QVDA 2OAUA 1W2BS 2X4JA 3SWNB 5FU6B 1UEBA 3QIIA 3JCMP 1M90U 3LGFA 2JN0A 3CMAA 3MO8A 1N9RA 2RI3A 2BKDN 1Q81U 2LT1A 5CKEA 3M55A 3CCEA 3E9GA 1BKBA 4CRIA 1ZHIA 3GOXA 4M7DE 3MHXA 1O9SA 2M0OA 2RH2A 3QJ6A 4FU6A 3T9NA 3M4GA 2BIVA 3CCMT 3JAME 4PJOA 4BE2A 3BDUA 4XAXB 4ZGJB 1Y71A 4JLIA 2BUDA 2A7YA 2DIQA 4Y28E 3UPUA 2X35A 2RHXA 1Q82U 2YLBA 1YITT 4ZN3A 2E10A 2WSEE 3PGGA 5CIUA 4A54A 3JCMV 3CC7A 2EYQA 5IT9E 3CC2T 4C0FA 3OYNA 4F7UA 4KUIA 1Y07A 5D6WA 3X25B 3S6WA 2O4XB 5GANg 2EQUA 1VQPT 3OW2A 2RJDA 4ELYC 3LWIA 1UB4A 5I21A 4HT9A 5KE3A 4EMHA 3CCSA 4M7AF 2EQKA 4L59A 5LJ3f 3I56A 1WJRA 1OYXA 3OB9A 1VQMT 3JB9G 5GAN3 3S3NA 1O75A 3HFNA 1Y96A 4BACA 1Q81C 2B8AA 5CKDA 4C8QA 2RJFA 4HCBA 1VQ8T 4MMKA 4BUGA 5J39A 3CC4T 1I8FA 2Y90A 2P0PA 3OYIA 2VUBA 2VGMA 3X26B 4X9DA 1KD1C 2KAFA 4JRIA 1Y7XA 3JCMJ 1BIAA 4RG8A 3L2QA 3LGLA 4ZGEB 4KT0E 2V8KA 1VUBA 5J26A 2VXFA 1TH7A 3UDCA 4XU3A 5LJ3j 3OYJA 2XDBA 5FRMA 4XU2A 4JDSA 3OBWA 3QG1A 4O6JA 2RA2A 3VUZA 3CPWS 1JJ2S 2F5KA 1YJ9A 4N0AC 4M75D 2K2VA 1I4K1 3VUBA 2QQ9A 2ZPGB 2E41A 4J5YA 1PSEA 3G71A 4PJOF 3GPLA 5FU7C 3DKMA 2P0KA 5AYFA 1NJIU 3BY7A 3MP8A 2DZ9A 5GAN4 4M7AG 3JCMb 5GMKi 2CZ7B 1LJOA 4C92D 1W4SA 4MDXA 3HSBA 2FL7A 1BYMA 2ZPEB 2LCCA 4PNOA 2E64A 3OYEA 2R58A 3CD6A 2RHIA 2M9UA 2EJGA 1AHJB 3JRZA 3CCJT 3JB9J 1G3YA 1HXDA 3J7AF 4RMOA 2QI2A 4E47A 2M16A 5GAN7 1Q82C 1M1GA 2IVWA 2QQRA 3L42A 4FT2A 4C8QC 4OF1A 3JCMQ 4OB1B 1NE8A 1V29B 2EQMA 2DD4A 4XTXA 3MP6A 3RESA 2AHJB 1YJWA 1OZ3A 1X75C 3A8HB 2OTLT 2X4XA 2E12A 2K3YA 2CS7A 5IN1A 1Y96B 2VYTA 4C0GA 2K4YA 4PLIA 4KULA 1BI0A 5FLXE 1RL2A 5GAOn 5GMKj 1UGPB 4JRKA 3FC3A 4IUUA 3M57A 2LQ8A 1QVFA 4ZN1A 3RUXA 5CO7A 1QVGS 2EAYA 4M77C 3JCMc 3CBPA 2JTMA 3CC2A 4EMGA 2RB6A 2V8IA 2KVQG 3P8BB 1WQ7A 5M9OA 2KY9A 4CI0C 3OYLA 3CBMA 2X4WA 4C0DC 2HAXA 1B34A 2OTJA 5LJ3g 3C12A 1N9SA 4M7AB 1VIFA 2GCXA 2JUFA 4XTUA 3CCST 4C8QD 1IREB 1VQNA 1KQSA 2D9TA 2M1HA 4J6XA 3LYIA 4FIBA 3X24B 2MF2A 5GMKh 3GP8A 5GAOr 3TU4K 5GAN6 2YLCA 3X28B 3C94A 2XKOC 2RI5A 2LC4A 3JCMh 3GIBA 3VYHB 1JRIA 2E70A 5LJ5g 3QSUA 3C4SA 4OP0A 1YJNT 4M7AE 4EMKA 3JCMW 2XG8D 5C0MA 5GAOq 5LJ5h 3CCLT 1PSFA 5LJ3d 1NJIC 4UC4A 3G6EA 2PVOB 2JNGA 2PVGB 2K57A 3MCAB 1WGSA 4MZPA 4A4HA 1VQ7T 4DOVA 5KH6A 1YCYA 5GANh 2XI9A 3MEWA 3PMTA 2QTXA 5DLOA 2DKGA 2LCLA 1N8RC 1VQ4T 2ZGWA 4Y91A 2O01E 3CBOA 4MMLA 1UGRB 1S72T 3CCLA 4BE0A 4OVAA 5IAYA 1QVPA 4PJOB 2CZ0B 3M4YA 5LJ3e 1M8VA 1VIEA 2RM4A 2JVVA 3L2ZA 3V8KA 2OTJT 2MWPA 2DXBA 1R8OB 3NTHA 3JB9D 3QKJA 4A4KA 4J7FA 2LQKA 2DAQA 4X34A 2DPPB 4A4GA 1VQMA 4MDWA 2DXTA 2XU8A 4M78A 4BD3A 2LRQA 1QP2A 5HKCA 4M77E 2R57A 5GAN2 2R5MA 3J80E 3CCMA 2XK0A 3PFSA 3CCQT 4V2SA 1VQKA 2KK4A 3HPWA 1G3TA 1WJQA 3RKXA 3PT9A 3FJPA 5GAOm 1VQ4A 3MEUA 3A5ZB 3OA6A 3CXCA 2C06A 4C8QE 3JSCA 5DLQE 5I2SA 3OY9A 3CCET 2IG0A 1UGQB 1FX7A 5A0DA 3KXTA 4B9XA 3M54A 2VXEA 5CQYA 5LJ5d 4BB7A 3CCQA 5LJ5f 1N8RU 1HK9A 1H3ZA 4C92E 4LD6A 5GAN5 2GFAA 4C8QG 3OW2S 3DB4A 3OSSC 4C92A 1D3BA 2HD0A 5KE2A 1BI1A 1QW1A 4HCZA 4M75E 2QA4A 4GLKA 4NL2A 2I2LA 3QXEB 4N4GA 4M7DG 2P0QA 4XTVA 3OBYA 2DVEA 3O8VA 4F7UE 2DJZA 4BY6C 3ZEHA 3FLGA 1VQ9A 1OZ2A 4M75A 3OYCA 2LTOA 1YHQT 2Y4YA 3RIRA 1YI2T 3TREA 4C0ZA 5GMKm 3P8DA 3BFMA 2K3XA 4XTZA 5J3BA 3H6ZA 1JB0E 4QVZA 5CK9A 4ME7A 4PL6A 1VQ5T 5DY9A 2K5LA 1RI0A 3SB2A 1KQ2A 2RJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  5CR2 A;  5CKD A;  5CQY A;  3TCJ A;  3NFC A;  2KMT A;  2VUB A;  4ELZ C;  4MDX A;  5CO7 A;  3G7Z A;  5HK3 A;  4HKE A;  5HK0 A;  5CKB A;  5CKF A;  4VUB A;  3JRZ A;  5HKC A;  4MZP A;  5CKH A;  1VUB A;  4MZM A;  4ELY C;  1UB4 A;  4MZT A;  4OF1 A;  1NE8 A;  3HPW A;  5CKE A;  5CQX A;  5DLO A;  1M1F A;  1X75 C;  5CK9 A;  4ME7 A;  2C06 A;  3VUB A;  3JSC A;  2MF2 A; 
#chains in the Genus database with same CATH topology
 4AG2 C;  4PJO G;  2JOY A;  2JTF A;  3FRN A;  4XQ3 A;  1UHC A;  2WSF E;  3VU3 C;  4E2F B;  1W2B A;  3EGX A;  2RQR A;  4M4Z A;  4FT4 A;  4KH0 B;  4J9F A;  2J6K A;  1EX4 A;  1ZSZ C;  5D7U A;  2L3P A;  4DBQ A;  1JO8 A;  3C95 A;  4QQG A;  2AK5 A;  2HNI A;  4PFO A;  1IZ6 A;  3LH0 A;  4HVU A;  3VJP A;  3OYF A;  4CC2 A;  2GQI A;  4J8O A;  3QO3 A;  1GFD A;  4M7D B;  3JB9 F;  4YTL A;  1YIJ A;  1E6H A;  2QYZ A;  2EW3 A;  4N0A A;  2RHY A;  1YJW Q;  3RKY A;  2L5Q A;  1SEM A;  2HKN A;  3VS1 A;  1YJ9 T;  1VQO T;  3LWH A;  1D09 B;  3OMG A;  4QKU A;  3CXC S;  2CT4 A;  5GAO l;  3FB9 A;  3F70 A;  4XU1 A;  2MOX A;  1M30 A;  2X51 A;  2DIG A;  3CD6 T;  4HKE A;  3OYM A;  2C0I A;  1X01 A;  5GMK e;  1UJ0 A;  2QDY B;  2COZ A;  2PUO B;  2KDS A;  1KC8 U;  3OYY A;  1PRM C;  1Z9Q A;  4OB2 B;  1NEG A;  3E2U A;  1Q82 R;  1K8A C;  2RNA A;  2V1R A;  3CCR T;  4M7D A;  3TSZ A;  3OYH A;  1BCO A;  2C0T A;  1UG1 A;  3V7C A;  3ME9 A;  3S3M A;  5FWB A;  2O88 A;  1U1S A;  4BI3 A;  2EJF A;  3HRS A;  2O9S A;  3G6E T;  1M90 R;  3QPH A;  2LX9 A;  2EBP A;  1KHC A;  2COY A;  2PU9 B;  2ZPF B;  3TEE A;  4PKC C;  3G4S A;  4R55 A;  2NUT B;  1M8M A;  5C6S A;  2LCS A;  4MZT A;  2M02 A;  3UA7 A;  2RI2 A;  3CCV A;  1M1K U;  4M78 C;  5LJ3 h;  2CYZ B;  4LDX A;  1S1N A;  1K4U S;  4KH1 B;  5FW9 A;  5GAM e;  5KYN A;  3ZFJ A;  3TCJ A;  2MYS A;  4DEY A;  4Z89 A;  3AHU A;  1G3S A;  3CPW A;  2O31 A;  2KE9 A;  3GF5 A;  4QVC A;  1NJI R;  2EYX A;  4C92 C;  2DO3 A;  1M1F A;  2L89 A;  2RQV A;  5EG2 A;  1UEC A;  3VS7 A;  4ZTF A;  2KEA A;  3CCU T;  1S72 A;  4D6W A;  1H64 1;  1VQP A;  3NFC A;  3QWX X;  3L2R A;  1G8X A;  4M77 F;  2PUK B;  2JW4 A;  3VKI A;  4LN2 A;  3CCL Q;  3SDZ A;  3A98 A;  1NLP C;  1I0C A;  5IH2 A;  3OS5 A;  2ZPB B;  3BDL A;  4BDZ A;  2RD1 A;  4DBR A;  2DYI A;  3KUF A;  3CCM Q;  3VV0 A;  2CRE A;  3CC7 T;  2LP5 A;  2O4X A;  5CKH A;  3H8Z A;  1MHN A;  1BU1 A;  1PKS A;  1ZBJ A;  5CVI A;  4TVR A;  2V1Q A;  1YJN Q;  3CCU Q;  2QA4 Q;  1BCM A;  2K5I A;  2FPF A;  1T0J A;  1X2K A;  1YNZ A;  2RQW A;  4C8Q B;  2B86 A;  3EAE A;  3HRT A;  3QYG B;  2HL5 C;  4KBM B;  1F1B B;  4QVD A;  2OAU A;  1W2B S;  1BK2 A;  2JN0 A;  1QQJ A;  3MO8 A;  2RI3 A;  3M55 A;  4CRI A;  2K9G A;  3FJ5 A;  2CH4 W;  1O9S A;  4FU6 A;  1U5S A;  2FRY A;  3JAM E;  4XAX B;  1Y71 A;  4JLI A;  2EGE A;  2AT1 B;  1GL5 A;  1YIT T;  2WSE E;  3PGG A;  5IT9 E;  1NYF A;  1K9A A;  4KUI A;  2LQW A;  2RJD A;  3G71 Q;  5I21 A;  2ESW A;  5KE3 A;  2YUQ A;  3CCS A;  1K8A R;  1RAB B;  1W1F A;  1OYX A;  2LJ0 A;  1W70 A;  3JB9 G;  3S3N A;  1Y96 A;  2B8A A;  1ZA2 B;  4C8Q A;  4HCB A;  4MMK A;  3CC4 T;  1FMW A;  2HSE B;  4FYV B;  1AEY A;  9ATC B;  2KAF A;  2ABL A;  4ZGE B;  4KT0 E;  2V8K A;  4E7Z A;  3UDC A;  1FMK A;  4XU3 A;  5LJ3 j;  5FRM A;  4XU2 A;  4JDS A;  3QG1 A;  4O6J A;  2RA2 A;  3VUZ A;  3I5S A;  2F5K A;  1YJ9 A;  1I4K 1;  2QQ9 A;  3H0H A;  1I07 A;  1NJI U;  5AYF A;  4M7A G;  2DZ9 A;  5GMK i;  4AMC A;  1BYM A;  4PNO A;  3OYE A;  2R58 A;  3JRZ A;  3JB9 J;  2D0N A;  1Q82 C;  1K73 C;  2QQR A;  4RTY A;  1VQ6 T;  2KRO A;  2HDA A;  3RES A;  1YIJ Q;  1OZ3 A;  1X75 C;  2E12 A;  4C0G A;  2AKL A;  2K2M A;  2DA9 A;  4PLI A;  1U3O A;  5FLX E;  2CP0 A;  5ECA A;  5GAO n;  5GMK j;  1UGP B;  3CQT A;  3FC3 A;  4FW2 A;  4IUU A;  1WXT A;  4J9G A;  1QVG S;  4J9B A;  4EMG A;  1OX9 A;  4IIM A;  1NBE B;  1B34 A;  3CCS T;  4XTU A;  1VIF A;  4RTU A;  1RAG B;  1OU9 A;  1IRE B;  4C8Q D;  3CME Q;  1KQS A;  1YWO A;  1V76 A;  5IHN A;  1HJD A;  1MMG A;  2XKO C;  2RI5 A;  3JCM h;  3GIB A;  3QSU A;  1CSK A;  1JRI A;  2ZAE A;  3I9Q A;  1QKW A;  4OP0 A;  4M7A E;  3JCM W;  5C0M A;  4ESR A;  2DYB A;  2VWF A;  5LJ3 d;  3I56 Q;  4UC4 A;  1M2V A;  4F17 A;  1D1A A;  2K57 A;  2SRC A;  1M3C A;  1SRM A;  2F2W A;  1VQ7 T;  1YCY A;  2ROL A;  2QTX A;  5DLO A;  2LCL A;  1N8R C;  4Y91 A;  3CBO A;  4MML A;  1X27 A;  2DER A;  1QVP A;  1WI7 A;  1KC8 R;  1M8V A;  2OTJ T;  4PK4 A;  1OQK A;  2DPP B;  2LRQ A;  1QP2 A;  3CCE Q;  3UA6 A;  3J80 E;  4OMQ A;  1WJQ A;  3RKX A;  1N8R R;  2O9V A;  3MEU A;  3A5Z B;  3OA6 A;  2CSQ A;  4HCK A;  4C8Q E;  5DLQ E;  1UGQ B;  2MK5 A;  2ENM A;  3M54 A;  3G1J A;  5LJ5 f;  1HK9 A;  4C92 E;  4LD6 A;  2DET A;  2GFA A;  2RF0 A;  3EHR A;  1D3B A;  4M75 E;  2E5K A;  2GGR A;  2P0Q A;  4J9E A;  1VQ6 Q;  2DVE A;  4F7U E;  1OPK A;  1VQ9 A;  4M75 A;  1YHQ T;  2Y4Y A;  3P8D A;  4IIO A;  5J3B A;  4QVZ A;  3G6E Q;  2K5L A;  1RI0 A;  3SB2 A;  2RJC A;  2VGN A;  1ABO A;  3EFO A;  2CGH A;  3RKW A;  2AIR B;  1BI3 A;  3J81 E;  1I1J A;  3UF4 A;  4FL6 A;  4OGE A;  1EIF A;  3UWN A;  3EG9 A;  3CCU A;  3MP1 A;  2W10 A;  1M9S A;  1Q86 R;  1OI1 A;  2EYW A;  1WQW A;  2DEQ A;  4J6Y A;  1FWZ A;  4J83 A;  1KQ1 A;  2A36 A;  2HEQ A;  4E7S A;  2JM9 A;  3KBG A;  2YRD A;  3OQ5 A;  1VQ9 T;  2BZ8 A;  3EG2 A;  2QXF A;  4P5N A;  1D3B B;  3EGD A;  2DTI A;  3PVQ A;  1MGQ A;  2HQE A;  2CP7 A;  2K6D A;  2JT4 A;  2DIL A;  5CQX A;  1W2B P;  3CC2 Q;  1VYV A;  4NL3 A;  4B9W A;  3M0T A;  1SSF A;  1SSH A;  5IHI A;  4O5V A;  1U1T A;  1WXU A;  2ZZD A;  3ZBD A;  3IQL A;  3QDR B;  4FSS A;  2CH4 A;  3HFO A;  4HCC A;  1ARK A;  4RTW A;  1LNX A;  4C5E A;  1KHI A;  4EPC A;  1KSW A;  5KYW A;  2GF7 A;  1VQ7 Q;  1CKB A;  1KQS S;  3CD6 Q;  2XHC A;  4GBQ A;  3CCV T;  3M0S A;  3OS1 A;  3I56 T;  4F7U F;  3L2W A;  4A4F A;  2ZPH B;  2HQH A;  4C0D B;  1M1K C;  3PTA A;  4BE1 A;  1RLP C;  4PJM A;  3QZ5 B;  3G7Z A;  4LDU A;  4XK8 E;  1N27 A;  1ZQ1 A;  3CCJ A;  3EFS A;  3EFR A;  3A8O B;  1K9M U;  1R0B G;  1S72 Q;  2HKQ B;  4IUR A;  2J6F A;  3L2U A;  2EWN A;  1YJW T;  2CZ1 B;  1P92 A;  4M7D D;  5KYX A;  3HP9 A;  3RMS A;  1RAF B;  1NZ9 A;  3VS4 A;  4KUD K;  5FRN A;  1GCQ C;  2DL3 A;  3CME T;  4PJO D;  2HL3 A;  5LJ5 j;  1QVG A;  3SD4 A;  1D0Y A;  2JMA A;  3X20 B;  4HT8 A;  5GAO p;  3ER0 A;  2SEM A;  1ZLM A;  1B7T A;  4J6W A;  3M0U A;  2DJQ A;  3DLL A;  1VQL T;  5KCO A;  1TUG B;  2DLP A;  1VQ6 A;  1YN8 A;  3H0F A;  4PJJ A;  4IUP A;  4K11 A;  1C6V X;  3QUI A;  4LDW A;  3P8H A;  1NEB A;  4FSX A;  2CKK A;  1TTH B;  2BTT A;  1OU8 A;  3HKS A;  3RNJ A;  1RAD B;  1YIJ T;  1KK7 A;  1PNJ A;  4JJD A;  1EFN A;  4QQD A;  2QQA A;  1WZO A;  3C0C A;  4PJO A;  1BB9 A;  3WVD B;  2CDT A;  2HBP A;  3QBY A;  3CC4 A;  2AZV A;  1YHQ A;  1WPY A;  3CME A;  1M90 C;  3JCM e;  3MPU B;  3L2V A;  2FHD A;  3CPW P;  3OS2 A;  2DFU A;  2DXC A;  2JMC A;  3QYH B;  3EGD B;  4C92 G;  1QVF S;  3OW2 P;  1MMD A;  2XID A;  2RK1 A;  4RKU E;  1U8R A;  2GQV A;  4C92 B;  2VC8 A;  1AWO A;  1I81 A;  2DX1 A;  2MMP A;  4OB3 B;  2EQI A;  1HSQ A;  4JZ4 A;  3OYB A;  4EMK B;  4J9H A;  2A3L A;  2D8H A;  3JB9 I;  1VQ5 A;  4JS4 A;  3URG A;  1WHH A;  1LOJ A;  1NLO C;  2EGC A;  2FPE A;  3M0R A;  2EYY A;  4GY5 A;  4HA8 A;  2OTJ Q;  1KIK A;  1QWE A;  2KRS A;  2ECZ A;  1VQK Q;  7AT1 B;  3ASK A;  1WHJ A;  2QA4 T;  3VRY A;  2P4R A;  5CKB A;  1WLP B;  4EDU A;  2X4J A;  3SWN B;  1M90 U;  3CMA A;  1N9R A;  2BKD N;  2JM8 A;  2OAW A;  3NPF A;  3E9G A;  1WHL A;  1QCO A;  3MHX A;  1QMC A;  4DBF A;  3QJ6 A;  3HTR A;  2BIV A;  3BDU A;  4ZGJ B;  1IRX A;  4Y28 E;  1QCF A;  2RHX A;  2YLB A;  4JZ3 A;  1WHG A;  4ZN3 A;  5CIU A;  3CC7 A;  1AWJ A;  4C0F A;  1Y07 A;  3S6W A;  1ABQ A;  5KYU A;  3OW2 A;  4HT9 A;  4EMH A;  3CC7 Q;  4M7A F;  4L59 A;  1MUZ A;  3OB9 A;  5GAN 3;  1O75 A;  1RAE B;  3HFN A;  5IXB A;  3U23 A;  2FG0 A;  2VKN A;  3OYI A;  3X26 B;  1OUL A;  1Y7X A;  3L2Q A;  2KRM A;  1VUB A;  2XDB A;  3OYJ A;  4AFU C;  3CPW S;  2GTJ A;  1U06 A;  2FZC B;  4M75 D;  4N0A C;  2ZPG B;  1PSE A;  3G71 A;  4PJO F;  3GPL A;  5FU7 C;  1AZG B;  1ZUY A;  4MDX A;  2FL7 A;  2ZPE B;  2LCC A;  4D8D A;  2RHI A;  2M9U A;  1G3Y A;  1IHV A;  4RMO A;  4M7D F;  2IVW A;  3KXT A;  4OF1 A;  3UAT A;  1V29 B;  4RTZ A;  4XTX A;  4ZNX A;  2AHJ B;  1PRL C;  1YJW A;  3A8H B;  2CP5 A;  2X4X A;  3EG3 A;  2K3Y A;  1SG5 A;  4JPB W;  2VYT A;  4KUL A;  1BI0 A;  1R0C B;  3R6N A;  4JRK A;  2LQ8 A;  1QVF A;  1X43 A;  2DRM A;  4PFZ A;  2JTM A;  2P84 A;  2KVQ G;  5M9O A;  3CBM A;  2HBW A;  2NUT A;  2RQT A;  2OTJ A;  4CC7 A;  4PFP A;  3C12 A;  1N9S A;  2EVR A;  1PHT A;  2JUF A;  2YUP A;  1N5Z A;  1X2Q A;  4J6X A;  4FIB A;  3GP8 A;  1YIT Q;  2YLC A;  3X28 B;  3VYH B;  5LJ5 h;  2OJ2 A;  3G6E A;  2JNG A;  3MCA B;  4RTX A;  4A4H A;  2A28 A;  2EKH A;  2XI9 A;  2L3S A;  1VQ4 T;  4EIK A;  2O01 E;  2LMJ A;  4F14 A;  4F16 A;  2KBT A;  5LJ3 e;  1ZSG A;  1MNE A;  2MIO A;  4OMM A;  3JB9 D;  1WA7 A;  4X34 A;  4A4G A;  1VQM A;  2XU8 A;  4M78 A;  2R57 A;  3CCM A;  5FWC A;  2QK0 A;  3PFS A;  1K0S A;  1WX6 A;  1TSF A;  1X6B A;  1Q95 G;  2LQN A;  3FJP A;  2IIM A;  1QVG P;  2C06 A;  3JSC A;  5I2S A;  3OY9 A;  1K9M R;  3CCE T;  2IG0 A;  1FX7 A;  1Z9Z A;  1ZSZ A;  4B9X A;  1M3A A;  1N8R U;  1EZZ B;  4C8Q G;  1QWF A;  1OEB A;  1QW1 A;  4GLK A;  3OBY A;  2QG9 B;  1JXM A;  3O8V A;  3ZEH A;  1OZ2 A;  2K3B A;  3OYC A;  1YI2 T;  1Y57 A;  2K3X A;  3MKD A;  1RI9 A;  3CCE A;  2PNI A;  2L3Q A;  4C5I A;  2GBQ A;  3EHQ A;  3V8L A;  5I11 A;  1VQ8 Q;  2DL5 A;  2DXU A;  2PQW A;  4C5G A;  4JUV A;  2CP3 A;  4FM4 B;  1KC8 C;  5GJW B;  2LNV A;  4LUD A;  5GAM d;  1VQ5 Q;  4M78 E;  5D6Y A;  2XD0 A;  4B6M A;  4KGZ B;  2P4T A;  4AFZ C;  2MAM A;  2DEU A;  5CAI A;  1M5Q 1;  1Q86 C;  5L8R E;  1D0Z A;  2F5T X;  2DL7 A;  3FDR A;  8ATC B;  3CCS Q;  4M7A A;  2EYZ A;  2CUD A;  2OTL A;  4DA4 A;  1TXQ A;  5FRO A;  1T0H A;  2KXD A;  3SWN C;  1IB8 A;  2WSC E;  3PMI A;  2RK2 A;  3MEV A;  5D6X A;  1QKX A;  1VQK T;  5HY6 A;  4A53 A;  4E7H A;  1K9M C;  4RUG A;  4E6R A;  4F04 B;  1VQ7 A;  2MI6 A;  1KG1 A;  1MMN A;  2KXC A;  3I55 A;  1GFC A;  1XOV A;  3EGX B;  1BI2 A;  2RJE A;  1SHG A;  3H0I A;  2NUZ A;  3EGU A;  2E65 A;  3OSV A;  4M7A C;  1GCQ A;  3OYD A;  2EQJ A;  2XDP A;  4RCC A;  3GNG A;  3SWN A;  4ZTJ A;  4JRP A;  1PM3 A;  1FMV A;  6AT1 B;  2L2P A;  5GAN e;  1NPP A;  3NHN A;  3RMQ A;  1VQN T;  4NOY A;  1GBQ A;  2LX7 A;  1UGS B;  2YHT A;  5AT1 B;  2QEX T;  4Q5W A;  1JBM A;  4MZM A;  1YI2 A;  2RHZ A;  2Y4X A;  1RAC B;  3M53 A;  5A0L A;  3OYK A;  2E6N A;  4IUT A;  2H3J A;  1SPK A;  1G5V A;  5KYY A;  4X9C A;  3OYG A;  1Q7Y C;  4E7K A;  1VQO Q;  1SRL A;  4M7D C;  4M77 D;  4E7L A;  1QCN A;  4Z88 A;  2M0Y A;  4XTY A;  2E5Q A;  2JZ2 A;  1GRI A;  1VYT A;  1VQL Q;  3BW1 A;  2RMO A;  5FU7 B;  1RLQ C;  5KYU B;  5KCH A;  3M58 A;  5GAN d;  3ULR B;  3I55 T;  1YJN A;  2DK3 A;  4D8K A;  2FEI A;  3V7R A;  1M1K R;  2L3R A;  3OS0 A;  3JCM X;  4CC3 A;  4C92 F;  2O2O A;  1PC0 A;  5CCA A;  2QQB A;  2RO0 A;  3JCM Q;  4II1 A;  3R6O A;  1WFW A;  2KMT A;  3VRZ A;  1KFZ A;  1Q86 U;  5I2M A;  1YIT A;  2NLU A;  5GMK l;  3G4S T;  2RQU A;  3LH5 A;  3JB9 H;  1JJ2 P;  2H8H A;  3VS6 A;  4XU0 A;  1H3H A;  2KRN A;  3LLR A;  1NPR A;  5GAN 8;  2QAZ A;  4LDV A;  3VS3 A;  1K76 A;  1G83 A;  2DD5 A;  3NTI A;  4M78 G;  5CR2 A;  4FCY A;  2LVM A;  1N6A A;  4BY6 B;  1UHF A;  2FZG B;  1FYN A;  3EH2 A;  4Z02 A;  3M56 A;  2HQX A;  3DLM A;  2FO0 A;  3HRU A;  5GAN f;  2VV5 A;  3MEA A;  3HHT B;  3RER A;  4QQ6 A;  4A4E A;  2EJ9 A;  4FYX B;  4DOW A;  4KGV B;  2K79 A;  2PVD B;  3KFV A;  5LJ5 e;  3NTK A;  3SHW A;  3M0P A;  5A2Q E;  4N4H A;  2DZC A;  2GTO A;  4JLG A;  2CSI A;  1YI2 Q;  2CZ6 B;  2X4Y A;  1B34 B;  5DM7 R;  2LT4 A;  4KRT A;  2R5A A;  4NS5 A;  1VQ4 Q;  2KQW A;  3EG9 B;  4AG1 C;  1BBZ A;  1SKU B;  5FU6 B;  3QII A;  3JCM P;  3LGF A;  2NUP A;  2LT1 A;  5CKE A;  1AT1 B;  1BKB A;  2X9H A;  1ZHI A;  2H3E B;  2DE0 X;  2M0O A;  3T9N A;  1Q81 R;  3M4G A;  1R77 A;  3ZL7 C;  2BUD A;  2DIQ A;  3UPU A;  1Q82 U;  1X69 A;  4A54 A;  3CC2 T;  3JCM V;  2EYQ A;  3OYN A;  5D6W A;  3X25 B;  5GAN g;  1K0X A;  1VQP T;  1SHF A;  2PZ1 A;  5LJ3 f;  2OX7 A;  1WJR A;  3QDF A;  2J7I A;  1VQM T;  4BAC A;  1VQM Q;  1Q81 C;  2RJF A;  4BUG A;  2HSP A;  1IO6 A;  8AT1 B;  2CUB A;  2P0P A;  3VS0 A;  3SEM A;  2VUB A;  4X9D A;  4JRI A;  2HMA A;  4RG8 A;  3LGL A;  1GBR A;  3A1P A;  2VXF A;  1YHQ Q;  1TH7 A;  1IGQ A;  1VQP Q;  4DEX A;  1JJ2 S;  2YUN A;  3TVT A;  2E41 A;  2RPN A;  3JV3 A;  4DBH A;  4FYW B;  1AZE A;  5IHK A;  3JCM b;  4LUE A;  1LJO A;  3PVL A;  4C92 D;  3HSB A;  3EG0 A;  3VS2 A;  4HXJ A;  3CCJ T;  5EC7 A;  2QI2 A;  4E47 A;  1KD1 U;  1M1G A;  4C8Q C;  4OB1 B;  2DD4 A;  2YDL A;  2OTL T;  2ED0 A;  2CS7 A;  2PTK A;  1NYG A;  1RL2 A;  3CMA Q;  3M57 A;  3RUX A;  5CO7 A;  1T3L A;  2EAY A;  4M77 C;  3JCM c;  4HVV A;  1C0M A;  1KQS P;  2RB6 A;  2DVJ A;  2KY9 A;  4CI0 C;  3OYL A;  2LZ6 B;  2HAX A;  2KT1 A;  1UDL A;  1AVZ C;  4M7A B;  1A0N B;  2GCX A;  1AWX A;  2YSQ A;  2D9T A;  2M1H A;  3LYI A;  5GMK h;  5GAO r;  5GAN 6;  3C4S A;  1ZUK A;  3CXC P;  1YJN T;  1OOT A;  3AT1 B;  5GAO q;  3CCL T;  1PSF A;  3NMZ C;  2BZX A;  1NJI C;  3CCV Q;  2PVO B;  4DOV A;  5KH6 A;  2EGA A;  4OML A;  3MEW A;  2DKG A;  3VS5 A;  2JS2 A;  3G4S Q;  1S72 T;  4PJO B;  4HVW A;  2RM4 A;  2JVV A;  4ANJ A;  1R8O B;  4A63 B;  1LVK A;  4A4K A;  2DAQ A;  1HYO A;  1MV3 A;  2DBK A;  2DXT A;  2DF6 A;  4BD3 A;  4M77 E;  2R5M A;  1G3T A;  3PT9 A;  1VQ4 A;  3RR6 A;  3CXC A;  2LNH B;  5HCK A;  5L23 A;  2QTV A;  1OX8 A;  2VXE A;  5CQY A;  5LJ5 d;  2L0A A;  1H3Z A;  4OMO A;  1H8K A;  3DB4 A;  4C92 A;  2HD0 A;  5KE2 A;  1BI1 A;  4HCZ A;  2I2L A;  2ATC B;  3QXE B;  4XTV A;  5KYX B;  1JQQ A;  2DJZ A;  2J05 A;  4BY6 C;  5KYY B;  2LTO A;  2OTL Q;  3RIR A;  3TRE A;  4C0Z A;  3CC4 Q;  3H6Z A;  1JB0 E;  5CK9 A;  3I55 Q;  4PL6 A;  5DY9 A;  1GCP A;  1KQ2 A;  1VQ9 Q;  4DQ2 A;  2COW A;  1ZUU A;  2F69 A;  3Q1J A;  3DB3 A;  1QP3 A;  5CKF A;  1VQN Q;  2CP6 A;  2A37 A;  2F2V A;  2I0N A;  3GLX A;  3CCQ Q;  1TOV A;  2FYK A;  2KNB B;  3E19 A;  1IGU A;  3M5A A;  2LJ1 A;  3PE0 A;  4L5G A;  1PCX A;  1WIE A;  1PD0 A;  4C5H A;  2HCK A;  3S3O A;  1K73 U;  4E7I A;  3SFM A;  4JS5 A;  1ZSZ B;  1WJS A;  2DNU A;  4LE9 A;  1VA7 A;  4M75 C;  4OMN A;  2RHU A;  1RAI B;  3REB B;  2EFI A;  2BZY A;  3CPF A;  5HK0 A;  4VUB A;  4OMF B;  4M75 F;  1PWT A;  3V8J A;  5GAM j;  2E1H A;  1UGV A;  2G3R A;  3PIO A;  3QZ9 B;  4WF2 A;  3M59 A;  4IUQ A;  1XTD A;  5GAM h;  3HL8 A;  1AD5 A;  3JCM f;  4PLL A;  2L8D A;  4KGX B;  1WHM A;  1YCS B;  1ZBX A;  2V8J A;  2DL4 A;  2IPO B;  1CKA A;  4PJL A;  1G3W A;  2KSS A;  2QQS A;  1WXB A;  3UT1 A;  4BI8 B;  3EG1 A;  1VQO A;  1JEG A;  2DTO A;  5IXF A;  1UFF A;  2ZCF B;  3CEY A;  1FXX A;  2GNC A;  1MMA A;  2AZS A;  2KI7 A;  1UJY A;  2XIC A;  2A08 A;  2XMF A;  4PJN A;  4OB0 B;  1E6G A;  4IUV A;  4M75 G;  1YFN A;  4IKF A;  1IHW A;  4ATO A;  1VQL A;  2K5F A;  2NWM A;  4F7U G;  4JJN K;  2EIF A;  5LL6 S;  1D1B A;  1OPL A;  4LNP A;  3OYA A;  4JRQ A;  3N5B B;  4EMK C;  2D0Q B;  4F7U B;  3E1S A;  1D0X A;  3FIF A;  4M78 F;  1M2O A;  4M75 B;  3CMA T;  2QEX A;  3MET A;  1K8A U;  3M9Q A;  1H92 A;  4OMP A;  2D8J A;  3V7S A;  4R56 A;  4E7J A;  1XQH A;  3D7S B;  1TUD A;  2QDL A;  2ZPI B;  3FEO A;  2FRW A;  4ORZ A;  2KYM A;  4CC4 B;  4RG2 A;  3VYG A;  1XNI A;  3JCM g;  1TG0 A;  2VB6 A;  2FB7 A;  3TSW A;  1DJ7 B;  3L1A A;  4LD9 K;  1I5L A;  2E6Z A;  4BDY A;  3O5Z A;  1C1A A;  1TWB A;  3RBB B;  2KYB A;  1M2V B;  1JJ2 A;  3I35 A;  4RCB A;  3A8G B;  1VQ8 A;  2VVK A;  4OGC A;  3EFO B;  3PIP A;  2QGF B;  4M7A D;  5GAM g;  4JJB A;  1I5O B;  1X6O A;  2EKO A;  4M77 A;  2YWW A;  4ZGD B;  1Q7Y U;  3EH1 A;  3OMC A;  4N4I A;  3WXM B;  2DTH A;  3INZ A;  4LXC A;  1M3B A;  4M77 G;  4BI4 A;  4ELZ C;  1M4Z A;  2MWO A;  5HK3 A;  3QJY A;  3A8L B;  4WTO B;  2C0O A;  1GXI E;  3CCR A;  4M78 B;  2D6F A;  4XTW A;  2KR3 A;  1HD3 A;  1TUC A;  5GAN j;  3JCM d;  2JTE A;  1JU5 C;  1VYU A;  3LW5 E;  5GAM f;  3CCR Q;  1WNL A;  5FU6 C;  1LCK A;  1WYX A;  2EPD A;  3PNW C;  3QHS A;  2WAC A;  4C8Q F;  3A8M B;  2GFU A;  2FVU A;  3RDV A;  3GNF B;  2YRV A;  2J6O A;  2LDM A;  3THK A;  2YT6 A;  1K73 R;  1YBY A;  4QW2 A;  3LX7 A;  1M27 C;  1KJW A;  3G71 T;  5A0G A;  4PJO C;  2XDD A;  2F1L A;  4Z8A A;  4M77 B;  4LDY A;  2VAS A;  2JS0 A;  1AOJ A;  4X1V A;  1PKT A;  2DMO A;  3E9F A;  4RTV A;  4L6V 5;  1MND A;  4GLM A;  4J7I A;  1BIB A;  4PJO E;  3WVE B;  1AWW A;  1IXD A;  4M78 D;  1YJ9 Q;  2W0Z A;  1UEB A;  2ROT A;  1UE9 A;  1Q81 U;  1UTI A;  1Y0M A;  2K7A A;  3MJX A;  1K1Z A;  5I22 A;  3GOX A;  4M7D E;  2RH2 A;  1RUW A;  2LJ3 A;  3CCM T;  4BE2 A;  1LPL A;  2A7Y A;  2CT3 A;  2X35 A;  2E10 A;  2QAS A;  1X6G A;  4F7U A;  2O4X B;  2EQU A;  1YP5 A;  2BE9 B;  4ELY C;  3LWI A;  2DM1 A;  1UB4 A;  4Y92 A;  2EQK A;  3I56 A;  2F2X A;  3I5R A;  5CKD A;  1VQ8 T;  5J39 A;  2ED1 A;  1I8F A;  2Y90 A;  1E7O A;  2VGM A;  2KGT A;  1KD1 C;  1NG2 A;  3JCM J;  1BIA A;  5J26 A;  1ZA1 B;  1RAA B;  1SF9 A;  3QWY A;  2CP2 A;  1PD1 A;  3OBW A;  2Z0W A;  2K2V A;  4RTT A;  3VUB A;  4J5Y A;  1D1C A;  3BE3 A;  2DRK A;  3DKM A;  2P0K A;  3BY7 A;  3MP8 A;  5GAN 4;  1WHK A;  2CZ7 B;  2E3H A;  1KD1 R;  1W4S A;  2QGG A;  2E64 A;  3CD6 A;  4J9D A;  2EJG A;  2HZY A;  1AHJ B;  1W6X A;  4R0K A;  4AFS C;  1HXD A;  3J7A F;  2M16 A;  5GAN 7;  3L42 A;  4FT2 A;  1NE8 A;  2EQM A;  3MP6 A;  2V26 A;  4QT7 A;  5IN1 A;  1G2B A;  1Y96 B;  1QLY A;  2JXB A;  2K4Y A;  3CCJ Q;  2G6F X;  1NM7 A;  4ZN1 A;  3CBP A;  3CC2 A;  3NGP A;  3TQ7 P;  2V8I A;  3P8B B;  3GBQ A;  1WQ7 A;  1Q7Y R;  1ACM B;  2DL8 A;  2X4W A;  4J9C A;  4AFQ C;  4C0D C;  2QEX Q;  1PG5 B;  5LJ3 g;  2YXY A;  1T3S A;  1VQN A;  3X24 B;  1XJW B;  2E4H A;  2MF2 A;  3TU4 K;  1RAH B;  2BE7 D;  5KYW B;  1UUE A;  3M0Q A;  4AT1 B;  2NUP B;  3C94 A;  2YRC A;  2D1X A;  2LC4 A;  2E70 A;  5LJ5 g;  2NYS A;  4EMK A;  2XG8 D;  2MCN A;  4WCI A;  1ZX6 A;  2PVG B;  1WGS A;  4MZP A;  2MPX C;  5GAN h;  2X3X D;  3PMT A;  1JXO A;  2X3W D;  1V1C A;  2ZGW A;  2JJ9 A;  1UGR B;  3CCL A;  4FYY B;  4BE0 A;  3H41 A;  4OVA A;  5IAY A;  1MV0 B;  2CZ0 B;  3M4Y A;  1VIE A;  2J06 A;  3L2Z A;  3V8K A;  2A0F B;  2MWP A;  2FZK B;  2DXB A;  3NTH A;  3QKJ A;  2DBM A;  4J7F A;  2LQK A;  1QVF P;  4MDW A;  5GJV B;  2RN8 A;  5HKC A;  4FW1 A;  5GAN 2;  2XK0 A;  3CCQ T;  4V2S A;  1VQK A;  2KK4 A;  1OV3 A;  1YWP A;  1B3Q A;  3REA B;  3HPW A;  5GAO m;  1TS9 A;  2KT8 A;  5A0D A;  4BB7 A;  3CCQ A;  2YUO A;  3H9N A;  4JJC A;  5GAN 5;  3OW2 S;  3OSS C;  4J9I A;  2QA4 A;  4NL2 A;  2OI3 A;  1TU0 B;  4N4G A;  4M7D G;  2FPD A;  2E3I A;  3FLG A;  2M51 A;  1B07 A;  2AKK A;  3BFM A;  1WDX A;  4XTZ A;  4ME7 A;  1VOM A;  1VQ5 T;  1J3T A;  5GMK m; 
#chains in the Genus database with same CATH homology
 4C5I A;  2VGN A;  2JOY A;  4PJO G;  2JTF A;  3FRN A;  3V8L A;  4DQ2 A;  2CGH A;  3RKW A;  2DXU A;  2F69 A;  3Q1J A;  4XQ3 A;  1BI3 A;  2PQW A;  2WSF E;  4C5G A;  4JUV A;  3J81 E;  3DB3 A;  4FM4 B;  3VU3 C;  1W2B A;  1KC8 C;  2LNV A;  1QP3 A;  5GAM d;  4FL6 A;  4OGE A;  4FT4 A;  5CKF A;  1EIF A;  3GLX A;  3UWN A;  4M78 E;  5D6Y A;  3CCU A;  3MP1 A;  2XD0 A;  1M9S A;  2FYK A;  3E19 A;  3M5A A;  1VQ6 T;  4L5G A;  1OI1 A;  2P4T A;  3C95 A;  1WQW A;  4QQG A;  2DEQ A;  4J6Y A;  1FWZ A;  4J83 A;  1KQ1 A;  4C5H A;  2MAM A;  2HNI A;  5CAI A;  1IZ6 A;  3S3O A;  3LH0 A;  1K73 U;  1M5Q 1;  4E7I A;  5L8R E;  1Q86 C;  3SFM A;  3VJP A;  3OYF A;  3KBG A;  4JS5 A;  2F5T X;  4J8O A;  3QO3 A;  1WJS A;  3FDR A;  3OQ5 A;  4M7D B;  1VQ9 T;  3JB9 F;  4M7A A;  4M75 C;  4YTL A;  1YIJ A;  2QXF A;  4P5N A;  1D3B B;  2OTL A;  2RHU A;  2DTI A;  4DA4 A;  4N0A A;  2EFI A;  3CPF A;  5FRO A;  2RHY A;  5HK0 A;  3SWN C;  1MGQ A;  2HQE A;  4VUB A;  2WSC E;  3PMI A;  2RK2 A;  3MEV A;  4OMF B;  5D6X A;  4M75 F;  3V8J A;  1VQK T;  5GAM j;  2E1H A;  3RKY A;  2L5Q A;  2G3R A;  5HY6 A;  4A53 A;  3PIO A;  5CQX A;  4E7H A;  3QZ9 B;  4WF2 A;  3M59 A;  1YJ9 T;  4NL3 A;  1K9M C;  1VQO T;  4IUQ A;  3LWH A;  4B9W A;  1XTD A;  3OMG A;  5GAM h;  3CXC S;  3HL8 A;  1SSF A;  3JCM f;  5GAO l;  4PLL A;  2L8D A;  3FB9 A;  3F70 A;  4O5V A;  1VQ7 A;  1U1T A;  2MI6 A;  4XU1 A;  1KG1 A;  2ZZD A;  3ZBD A;  3QDR B;  3I55 A;  1XOV A;  1ZBX A;  2DIG A;  3HFO A;  2V8J A;  1BI2 A;  3CD6 T;  4HKE A;  4HCC A;  3OYM A;  2RJE A;  1LNX A;  4C5E A;  1X01 A;  1KHI A;  5GMK e;  4EPC A;  2QDY B;  2PUO B;  2KDS A;  1KC8 U;  3OYY A;  1G3W A;  2KSS A;  2QQS A;  3UT1 A;  2E65 A;  2GF7 A;  3OSV A;  4OB2 B;  3OYD A;  1KQS S;  4M7A C;  2EQJ A;  4BI8 B;  2XDP A;  2XHC A;  3CCV T;  1VQO A;  1K8A C;  2DTO A;  3OS1 A;  3I56 T;  4F7U F;  4RCC A;  3L2W A;  2ZCF B;  3GNG A;  3SWN A;  3CEY A;  4A4F A;  4ZTJ A;  2ZPH B;  1FXX A;  3CCR T;  4JRP A;  4M7D A;  4C0D B;  2XIC A;  1M1K C;  4OB0 B;  3PTA A;  4BE1 A;  5GAN e;  3QZ5 B;  4IUV A;  4M75 G;  4IKF A;  3OYH A;  3G7Z A;  4LDU A;  1NPP A;  4ATO A;  4XK8 E;  1N27 A;  1ZQ1 A;  3CCJ A;  3RMQ A;  1KD1 U;  3EFS A;  3EFR A;  2K5F A;  4NOY A;  1VQL A;  3A8O B;  4F7U G;  1VQN T;  1UGS B;  1K9M U;  4JJN K;  2YHT A;  2EIF A;  5LL6 S;  4Q5W A;  3V7C A;  2QEX T;  1JBM A;  4MZM A;  3OYA A;  2RHZ A;  2Y4X A;  5A0L A;  3M53 A;  1YI2 A;  4IUR A;  4JRQ A;  3L2U A;  3ME9 A;  2EWN A;  3S3M A;  3N5B B;  4EMK C;  2CZ1 B;  3OYK A;  1YJW T;  2E6N A;  2D0Q B;  4IUT A;  2H3J A;  1P92 A;  3E1S A;  4F7U B;  1U1S A;  4M7D D;  3HP9 A;  4BI3 A;  2EJF A;  3RMS A;  3FIF A;  1G5V A;  3HRS A;  1NZ9 A;  4M78 F;  3G6E T;  3QPH A;  4M75 B;  4X9C A;  3CMA T;  2LX9 A;  4KUD K;  2QEX A;  3MET A;  3OYG A;  1K8A U;  3M9Q A;  1KHC A;  5FRN A;  1Q7Y C;  3CME T;  2PU9 B;  4E7K A;  3V7S A;  4R56 A;  2ZPF B;  3TEE A;  4PKC C;  4PJO D;  5LJ5 j;  3G4S A;  1QVG A;  4E7J A;  1XQH A;  4R55 A;  3SD4 A;  3X20 B;  5C6S A;  4M7D C;  4HT8 A;  5GAO p;  3ER0 A;  4M77 D;  4E7L A;  4MZT A;  4J6W A;  2ZPI B;  3FEO A;  4XTY A;  2E5Q A;  3DLL A;  3CCV A;  2RI2 A;  1M1K U;  1VQL T;  4M7D F;  2JZ2 A;  4M78 C;  4RG2 A;  5LJ3 h;  1XNI A;  2CYZ B;  3JCM g;  3VYG A;  5KCO A;  4LDX A;  2FB7 A;  3BW1 A;  5GAM e;  1VQ6 A;  5FU7 B;  1DJ7 B;  3ZFJ A;  3L1A A;  3TCJ A;  5KCH A;  4LD9 K;  3M58 A;  5GAN d;  4IUP A;  1I5L A;  2E6Z A;  4BDY A;  3I55 T;  1YJN A;  2DK3 A;  3QUI A;  4LDW A;  3V7R A;  3AHU A;  3P8H A;  1G3S A;  3CPW A;  1JJ2 A;  4FSX A;  2CKK A;  4RCB A;  3A8G B;  2L3R A;  1VQ8 A;  3GF5 A;  3JCM X;  3OS0 A;  4QVC A;  3HKS A;  4OGC A;  3PIP A;  4C92 F;  4C92 C;  4M7A D;  1YIJ T;  2DO3 A;  5GAM g;  1M1F A;  2L89 A;  5EG2 A;  1X6O A;  2EKO A;  4M77 A;  4ZGD B;  4QQD A;  4ZTF A;  1Q7Y U;  3CCU T;  2QQA A;  5CCA A;  4D6W A;  1S72 A;  3OMC A;  2QQB A;  2RO0 A;  4N4I A;  1H64 1;  2DTH A;  4II1 A;  3WVD B;  3WXM B;  3R6O A;  2HBP A;  3INZ A;  3QBY A;  1VQP A;  3NFC A;  3CC4 A;  2KMT A;  1YHQ A;  1WPY A;  4M77 G;  4BI4 A;  4ELZ C;  3CME A;  1M4Z A;  2MWO A;  5I2M A;  3JCM e;  3L2R A;  1Q86 U;  4M77 F;  1M90 C;  1YIT A;  2NLU A;  5GMK l;  5HK3 A;  2PUK B;  3QJY A;  3G4S T;  3A8L B;  3VKI A;  3L2V A;  1GXI E;  3CCR A;  4M78 B;  3JB9 H;  3SDZ A;  2FHD A;  2D6F A;  4XTW A;  3OS2 A;  5GAN j;  3JCM d;  2DXC A;  4XU0 A;  3OS5 A;  3LW5 E;  2ZPB B;  3LLR A;  1NPR A;  3BDL A;  5GAM f;  5GAN 8;  4BDZ A;  4LDV A;  3QYH B;  4C92 G;  2RD1 A;  1WNL A;  5FU6 C;  3KUF A;  2DD5 A;  1QVF S;  3NTI A;  4M78 G;  5CR2 A;  3PNW C;  2LVM A;  3QHS A;  4RKU E;  2XID A;  2RK1 A;  2WAC A;  4C8Q F;  1N6A A;  3A8M B;  2GFU A;  2FVU A;  3VV0 A;  4BY6 B;  1U8R A;  3GNF B;  2GQV A;  4C92 B;  2YRV A;  2VC8 A;  4Z02 A;  3M56 A;  2HQX A;  3DLM A;  2LDM A;  1I81 A;  3CC7 T;  3HRU A;  2MMP A;  1YBY A;  4OB3 B;  4QW2 A;  3LX7 A;  5GAN f;  2O4X A;  2VV5 A;  3MEA A;  3HHT B;  5CKH A;  3G71 T;  3RER A;  4QQ6 A;  4A4E A;  5A0G A;  2EJ9 A;  3OYB A;  4PJO C;  2XDD A;  4EMK B;  4DOW A;  3H8Z A;  1MHN A;  2A3L A;  3JB9 I;  1VQ5 A;  4JS4 A;  5CVI A;  2PVD B;  4M77 B;  4TVR A;  3URG A;  5LJ5 e;  1LOJ A;  3NTK A;  4LDY A;  2K5I A;  5A2Q E;  4N4H A;  4GY5 A;  4HA8 A;  2DZC A;  4C8Q B;  3E9F A;  4JLG A;  4L6V 5;  2CZ6 B;  2X4Y A;  1B34 B;  3EAE A;  4J7I A;  5DM7 R;  3HRT A;  1BIB A;  3QYG B;  2LT4 A;  3ASK A;  1K73 C;  2QA4 T;  4PJO E;  3WVE B;  4KBM B;  2R5A A;  4NS5 A;  5CKB A;  4M78 D;  4EDU A;  2KQW A;  4QVD A;  2OAU A;  1W2B S;  2X4J A;  3SWN B;  5FU6 B;  1UEB A;  3QII A;  3JCM P;  1M90 U;  3LGF A;  2JN0 A;  3CMA A;  3MO8 A;  1N9R A;  2RI3 A;  2BKD N;  1Q81 U;  2LT1 A;  5CKE A;  3M55 A;  3CCE A;  3E9G A;  1BKB A;  4CRI A;  1ZHI A;  3GOX A;  4M7D E;  3MHX A;  1O9S A;  2M0O A;  2RH2 A;  3QJ6 A;  4FU6 A;  3T9N A;  3M4G A;  2BIV A;  3CCM T;  3JAM E;  4PJO A;  4BE2 A;  3BDU A;  4XAX B;  4ZGJ B;  1Y71 A;  4JLI A;  2BUD A;  2A7Y A;  2DIQ A;  4Y28 E;  3UPU A;  2X35 A;  2RHX A;  1Q82 U;  2YLB A;  1YIT T;  4ZN3 A;  2E10 A;  2WSE E;  3PGG A;  5CIU A;  4A54 A;  3JCM V;  3CC7 A;  2EYQ A;  5IT9 E;  3CC2 T;  4C0F A;  3OYN A;  4F7U A;  4KUI A;  1Y07 A;  5D6W A;  3X25 B;  3S6W A;  2O4X B;  5GAN g;  2EQU A;  1VQP T;  3OW2 A;  2RJD A;  4ELY C;  3LWI A;  1UB4 A;  5I21 A;  4HT9 A;  5KE3 A;  4EMH A;  3CCS A;  4M7A F;  2EQK A;  4L59 A;  5LJ3 f;  3I56 A;  1WJR A;  1OYX A;  3OB9 A;  1VQM T;  3JB9 G;  5GAN 3;  3S3N A;  1O75 A;  3HFN A;  1Y96 A;  4BAC A;  1Q81 C;  2B8A A;  5CKD A;  4C8Q A;  2RJF A;  4HCB A;  1VQ8 T;  4MMK A;  4BUG A;  5J39 A;  3CC4 T;  1I8F A;  2Y90 A;  2P0P A;  3OYI A;  2VUB A;  2VGM A;  3X26 B;  4X9D A;  1KD1 C;  2KAF A;  4JRI A;  1Y7X A;  3JCM J;  1BIA A;  4RG8 A;  3L2Q A;  3LGL A;  4ZGE B;  4KT0 E;  2V8K A;  1VUB A;  5J26 A;  2VXF A;  1TH7 A;  3UDC A;  4XU3 A;  5LJ3 j;  3OYJ A;  2XDB A;  5FRM A;  4XU2 A;  4JDS A;  3OBW A;  3QG1 A;  4O6J A;  2RA2 A;  3VUZ A;  3CPW S;  1JJ2 S;  2F5K A;  1YJ9 A;  4N0A C;  4M75 D;  2K2V A;  1I4K 1;  3VUB A;  2QQ9 A;  2ZPG B;  2E41 A;  4J5Y A;  1PSE A;  3G71 A;  4PJO F;  3GPL A;  5FU7 C;  3DKM A;  2P0K A;  5AYF A;  1NJI U;  3BY7 A;  3MP8 A;  2DZ9 A;  5GAN 4;  4M7A G;  3JCM b;  5GMK i;  2CZ7 B;  1LJO A;  4C92 D;  1W4S A;  4MDX A;  3HSB A;  2FL7 A;  1BYM A;  2ZPE B;  2LCC A;  4PNO A;  2E64 A;  3OYE A;  2R58 A;  3CD6 A;  2RHI A;  2M9U A;  2EJG A;  1AHJ B;  3JRZ A;  3CCJ T;  3JB9 J;  1G3Y A;  1HXD A;  3J7A F;  4RMO A;  2QI2 A;  4E47 A;  2M16 A;  5GAN 7;  1Q82 C;  1M1G A;  2IVW A;  2QQR A;  3L42 A;  4FT2 A;  4C8Q C;  4OF1 A;  3JCM Q;  4OB1 B;  1NE8 A;  1V29 B;  2EQM A;  2DD4 A;  4XTX A;  3MP6 A;  3RES A;  2AHJ B;  1YJW A;  1OZ3 A;  1X75 C;  3A8H B;  2OTL T;  2X4X A;  2E12 A;  2K3Y A;  2CS7 A;  5IN1 A;  1Y96 B;  2VYT A;  4C0G A;  2K4Y A;  4PLI A;  4KUL A;  1BI0 A;  5FLX E;  1RL2 A;  5GAO n;  5GMK j;  1UGP B;  4JRK A;  3FC3 A;  4IUU A;  3M57 A;  2LQ8 A;  1QVF A;  4ZN1 A;  3RUX A;  5CO7 A;  1QVG S;  2EAY A;  4M77 C;  3JCM c;  3CBP A;  2JTM A;  3CC2 A;  4EMG A;  2RB6 A;  2V8I A;  2KVQ G;  3P8B B;  1WQ7 A;  5M9O A;  2KY9 A;  4CI0 C;  3OYL A;  3CBM A;  2X4W A;  4C0D C;  2HAX A;  1B34 A;  2OTJ A;  5LJ3 g;  3C12 A;  1N9S A;  4M7A B;  1VIF A;  2GCX A;  2JUF A;  4XTU A;  3CCS T;  4C8Q D;  1IRE B;  1VQN A;  1KQS A;  2D9T A;  2M1H A;  4J6X A;  3LYI A;  4FIB A;  3X24 B;  2MF2 A;  5GMK h;  3GP8 A;  5GAO r;  3TU4 K;  5GAN 6;  2YLC A;  3X28 B;  3C94 A;  2XKO C;  2RI5 A;  2LC4 A;  3JCM h;  3GIB A;  3VYH B;  1JRI A;  2E70 A;  5LJ5 g;  3QSU A;  3C4S A;  4OP0 A;  1YJN T;  4M7A E;  4EMK A;  3JCM W;  2XG8 D;  5C0M A;  5GAO q;  5LJ5 h;  3CCL T;  1PSF A;  5LJ3 d;  1NJI C;  4UC4 A;  3G6E A;  2PVO B;  2JNG A;  2PVG B;  2K57 A;  3MCA B;  1WGS A;  4MZP A;  4A4H A;  1VQ7 T;  4DOV A;  5KH6 A;  1YCY A;  5GAN h;  2XI9 A;  3MEW A;  3PMT A;  2QTX A;  5DLO A;  2DKG A;  2LCL A;  1N8R C;  1VQ4 T;  2ZGW A;  4Y91 A;  2O01 E;  3CBO A;  4MML A;  1UGR B;  1S72 T;  3CCL A;  4BE0 A;  4OVA A;  5IAY A;  1QVP A;  4PJO B;  2CZ0 B;  3M4Y A;  5LJ3 e;  1M8V A;  1VIE A;  2RM4 A;  2JVV A;  3L2Z A;  3V8K A;  2OTJ T;  2MWP A;  2DXB A;  1R8O B;  3NTH A;  3JB9 D;  3QKJ A;  4A4K A;  4J7F A;  2LQK A;  2DAQ A;  4X34 A;  2DPP B;  4A4G A;  1VQM A;  4MDW A;  2DXT A;  2XU8 A;  4M78 A;  4BD3 A;  2LRQ A;  1QP2 A;  5HKC A;  4M77 E;  2R57 A;  5GAN 2;  2R5M A;  3J80 E;  3CCM A;  2XK0 A;  3PFS A;  3CCQ T;  4V2S A;  1VQK A;  2KK4 A;  3HPW A;  1G3T A;  1WJQ A;  3RKX A;  3PT9 A;  3FJP A;  5GAO m;  1VQ4 A;  3MEU A;  3A5Z B;  3OA6 A;  3CXC A;  2C06 A;  4C8Q E;  3JSC A;  5DLQ E;  5I2S A;  3OY9 A;  3CCE T;  2IG0 A;  1UGQ B;  1FX7 A;  5A0D A;  3KXT A;  4B9X A;  3M54 A;  2VXE A;  5CQY A;  5LJ5 d;  4BB7 A;  3CCQ A;  5LJ5 f;  1N8R U;  1HK9 A;  1H3Z A;  4C92 E;  4LD6 A;  5GAN 5;  2GFA A;  4C8Q G;  3OW2 S;  3DB4 A;  3OSS C;  4C92 A;  1D3B A;  2HD0 A;  5KE2 A;  1BI1 A;  1QW1 A;  4HCZ A;  4M75 E;  2QA4 A;  4GLK A;  4NL2 A;  2I2L A;  3QXE B;  4N4G A;  4M7D G;  2P0Q A;  4XTV A;  3OBY A;  2DVE A;  3O8V A;  4F7U E;  2DJZ A;  4BY6 C;  3ZEH A;  3FLG A;  1VQ9 A;  1OZ2 A;  4M75 A;  3OYC A;  2LTO A;  1YHQ T;  2Y4Y A;  3RIR A;  1YI2 T;  3TRE A;  4C0Z A;  5GMK m;  3P8D A;  3BFM A;  2K3X A;  4XTZ A;  5J3B A;  3H6Z A;  1JB0 E;  4QVZ A;  5CK9 A;  4ME7 A;  4PL6 A;  1VQ5 T;  5DY9 A;  2K5L A;  1RI0 A;  3SB2 A;  1KQ2 A;  2RJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...