1NE8A

Ydce protein from bacillus subtilis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
LIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein YDCE
publication title Crystal structure of YdcE protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 33
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ne8A00
1M1FA 2VUBA 5CQYA 5CKFA 5CKEA 4MZPA 1UB4A 2KMTA 5CCAA 2MF2A 2C06A 4OF1A 3HPWA 4VUBA 3TCJA 1NE8A 4ME7A 5CK9A 5CO7A 3NFCA 4ELZC 4HKEA 5CKHA 5CQXA 5HK3A 4MDXA 5DLOA 3JRZA 5CKDA 4MZMA 5HK0A 3G7ZA 3JSCA 1X75C 3VUBA 5HKCA 5CR2A 1VUBA 5CKBA 4ELYC 4MZTA
chains in the Genus database with same CATH superfamily
1IHVA 1SKUB 4M78C 1VQMT 3CC2Q 3EHQA 4M78A 4A63B 5CCAA 4EMHA 3OW2P 3OBWA 2DNUA 1QCNA 2HEQA 3OYJA 4DBRA 2IVWA 2RQVA 4HCCA 1OX9A 3CCST 1VQ5Q 1OPKA 3G1JA 2J06A 2DO3A 5FU7C 4RTYA 2CREA 2RHZA 1WGSA 2YUPA 1WIEA 3EG3A 3VS0A 4DEXA 1AZEA 5KYUB 3OYMA 1QVPA 4X9DA 2ZPEB 1I0CA 1OZ2A 3CCRQ 2DIGA 2RF0A 5GMKi 5GANj 2K2MA 2DD5A 1VQ8T 4AMCA 2GQIA 2ED1A 4J83A 1V1CA 4R55A 3JB9H 2NUPB 1YHQQ 2A0FB 3PVLA 4BDZA 3L1AA 1H641 2FZGB 4FU6A 2K2VA 1VYTA 5FU6B 2P84A 2DKGA 2V8JA 3VRYA 3VJPA 1D09B 2KMTA 3VYGA 3GPLA 2MF2A 3VU3C 3QWXX 3EG9A 1TTHB 4LDUA 3JCMc 2P0PA 3OYCA 1CKBA 2DJZA 2KRSA 1NM7A 3ZL7C 2DA9A 2DRKA 2HBPA 1CSKA 5GMKl 4LE9A 2IG0A 3GF5A 1VQNA 1VQ6Q 1I5LA 4F7UB 2HKNA 3UPUA 1YITT 3NHNA 2C06A 5D7UA 3HPWA 3CMET 1E7OA 3PGGA 3BFMA 3MP8A 2YUNA 4KH0B 2JS2A 3GNFB 4IIOA 2C0IA 5I21A 4KRTA 4OMOA 2DX1A 4PKCC 2FZKB 2CT3A 1RAEB 3C12A 2EFIA 2KI7A 5GANd 4DOVA 2A7YA 4PNOA 2K7AA 2ZPBB 3TSZA 3CCLQ 4C8QG 2KVQG 2DETA 3QIIA 1AT1B 3J80E 1VQKT 1RLQC 4E7ZA 1MGQA 1YCYA 1YI2Q 2XDPA 3GIBA 2BE7D 5CK9A 3H6ZA 2DXCA 1GBRA 2CGHA 2O9VA 4EDUA 1NZ9A 1WXTA 4OMPA 1YJ9T 4DBQA 3CPWS 4XQ3A 4QVDA 3META 1VQMA 3CC2T 2MAMA 2WSEE 2RB6A 2RHIA 3A8LB 1OI1A 2R5AA 1D3BA 4D8KA 3U23A 2D1XA 4C92D 1SSHA 5KYWA 3NTKA 1P92A 2O9SA 1IHWA 2DE0X 2H8HA 1W2BS 1M90C 3CCSA 2RI2A 4BE2A 4MDWA 2RQUA 2KROA 1KIKA 1UGSB 1XQHA 2DZCA 3QJ6A 1ZSZB 2ROLA 2QQ9A 3CCMQ 3V8LA 3EAEA 4JS5A 1YWOA 1VA7A 4J9DA 2WACA 1K0SA 4FCYA 1C0MA 1MMGA 3ER0A 2KGTA 3JCMJ 1B07A 1JRIA 1VQ8A 2L89A 4IURA 4M77F 1RAIB 1G5VA 1FMKA 2LQKA 2XIDA 2K3YA 4XK8E 5KCHA 1XJWB 3M0SA 5HY6A 2EPDA 5GAN6 1RAAB 5AT1B 1N27A 1ZX6A 3SD4A 1HK9A 4HKEA 1NPRA 3VS6A 3L2ZA 1PHTA 3H0IA 4M7DF 2RQTA 1AWWA 4JZ3A 1JEGA 1U3OA 4PJOC 4PJOA 2ESWA 4AFQC 3QG1A 2F1LA 2VWFA 1B7TA 1MV3A 3CD6T 4AFZC 4QKUA 4HVUA 1X6BA 4II1A 1WJSA 4BI4A 2X3XD 4KGZB 4RG8A 4C5GA 4BI3A 4A4HA 3HHTB 1KC8C 4J9HA 2ZCFB 3VS1A 2XU8A 5KYXA 3FC3A 4JJCA 2SRCA 1G3YA 1YITA 1D0YA 2NUTA 2YUOA 1NG2A 2JW4A 3E19A 3DKMA 1JXMA 1QCOA 2DTIA 3OYYA 1OEBA 4M7AG 1K9MU 4L5GA 3NTHA 1K73U 4HA8A 1GCQC 1GCQA 2EYQA 3CCLT 2Z0WA 1A0NB 5KYYB 5A0GA 4EIKA 1YI2T 2RO0A 2FZCB 1OULA 1RLPC 4TVRA 2V1RA 4LNPA 2OTLQ 2DYIA 3OBYA 1YJ9A 4NOYA 2V8IA 1OQKA 3DB3A 5GAOp 3JAME 3CC2A 1MMDA 3VS5A 3QBYA 1ZBXA 5HKCA 2BE9B 4D6WA 5D6WA 4IUVA 2GTOA 3ULRB 1LPLA 1K73R 2JUFA 2YUQA 1ZUUA 4XTVA 2JJ9A 2D9TA 5KH6A 1VQ5A 2R57A 4PFPA 1BI2A 1Q7YU 4C92C 4RCCA 2EKHA 4C92A 4M75G 2KK4A 4M77D 1AOJA 3VRZA 5I2SA 4N4IA 2F5TX 3G7ZA 1QMCA 4E2FB 2L3QA 4KULA 1KQ1A 1WJQA 3CCMT 1RADB 1JB0E 1ZBJA 4PJNA 1RAGB 3M4GA 1QKXA 1QKWA 4FIBA 1OYXA 2GTJA 4D8DA 3CCRA 4ZTJA 3OS1A 4M7DD 3EGDA 4JLIA 3D7SB 4C0DC 1Y96B 4ZGDB 1OX8A 3MO8A 2AK5A 3SB2A 4JJNK 5GANf 3TVTA 2ZZDA 5GMKj 3FRNA 1AD5A 4OVAA 2OI3A 3RUXA 3FJPA 1X27A 2JTFA 1JO8A 1ABOA 2DXTA 4CC4B 2ZGWA 2CP7A 3OSSC 2QASA 1Q7YR 1WFWA 1WQ7A 3SFMA 3CPWA 3RKXA 1WNLA 4RTXA 1X6GA 3TU4K 3V7CA 2QK0A 2YLCA 1Y0MA 3CCEQ 3A8GB 3NMZC 2AKLA 2EQUA 8AT1B 3C0CA 2PVGB 3OQ5A 4N4HA 4JRPA 3JB9F 5HK0A 4LXCA 3CD6A 5IHKA 1FX7A 2F2WA 2JNGA 1K1ZA 2XKOC 4OB2B 4B9XA 1PSFA 4IUQA 4JJDA 3M58A 1S72T 2EAYA 3JCMV 5GAOr 1BI1A 3EFOB 4BI8B 1OU8A 4PJMA 4HCZA 2D0QB 1NJIC 3JCMW 2HKQB 2HZYA 4XTXA 2LVMA 4L59A 2VYTA 4Z89A 2EYZA 5CKEA 1I07A 3CCSQ 5GAMj 3I5RA 2JMCA 2KQWA 5IHIA 1S1NA 4AFSC 3CCLA 4C5EA 2KXDA 2LT1A 4XU3A 5LJ3j 1M1KR 2L3SA 4CRIA 2FRWA 3EG9B 1Q82C 1YI2A 1JU5C 4OMLA 2XD0A 2X4YA 3X24B 2X4WA 1AZGB 1RI0A 4BUGA 4P5NA 1G3SA 2DM1A 4J6YA 4LUDA 1I5OB 4JDSA 2O88A 4HXJA 3MJXA 5J39A 3EH1A 4C8QC 4C8QA 3NFCA 3DLMA 2DIQA 3L42A 2RQRA 1YFNA 2J7IA 2EYWA 1EFNA 2A28A 2BZXA 4HCKA 4JZ4A 4ZN3A 2WSCE 3E9FA 2DAQA 3CCMA 2FRYA 2HQEA 1HD3A 4PJOF 4ZTFA 2CT4A 3HFOA 1MV0B 2E3IA 1H8KA 4OGCA 2PVDB 1YP5A 3DB4A 2DRMA 4Y92A 1KFZA 3G4SQ 3THKA 5GAMd 3CPWP 3O5ZA 3V8JA 1YCSB 3M9QA 2LCSA 3VS7A 2Y4XA 2D0NA 1YITQ 3PMIA 3HSBA 1GBQA 3BY7A 1AWXA 3CMEQ 5LJ3d 1G83A 2OAUA 7AT1B 1SRMA 2ATCB 2AT1B 5KYWB 3JV3A 3QKJA 1N5ZA 3CQTA 1M9SA 3PMTA 1M2VB 4MZTA 2BTTA 1KG1A 3KBGA 3E2UA 4Y91A 3CCET 5D6YA 4JUVA 4ZGJB 2M02A 1VQKQ 1UEBA 1X01A 2D8JA 1BBZA 2E70A 1TUCA 1NYGA 1M2OA 1UUEA 4R0KA 1ZHIA 3J81E 5M9OA 5KE2A 2L3RA 2DEQA 1S72A 5GAMg 2DK3A 1D0XA 2B8AA 2LQ8A 1ARKA 2X3WD 5FWCA 1N8RC 2KSSA 1R0BG 3RDVA 3FJ5A 1BKBA 5LJ3g 1BI3A 4XTZA 4F14A 1AWOA 4FL6A 2CUBA 2EW3A 2ZPGB 1M1GA 3R6OA 5FWBA 1ABQA 2M0YA 4V2SA 3OS5A 1WHHA 1RACB 2E5KA 3I56T 2GNCA 4PFOA 2NWMA 3MEWA 1MNEA 1YWPA 5J26A 4J6WA 1WHGA 3UWNA 4F7UF 3JCMQ 1NE8A 4OP0A 2QYZA 2MYSA 3LGFA 3M0QA 4C92F 1WJRA 4NL3A 1RI9A 3EGXB 2M0OA 2XDBA 4JS4A 1N9RA 4M7AC 2F2VA 4M7AA 3LWIA 2OTLA 4EMKC 4EMKA 2CS7A 3RESA 1Y7XA 1SHFA 2L3PA 4M4ZA 2WSFE 2XHCA 1X43A 1UFFA 2E3HA 4LD9K 3S3MA 3S6WA 1UDLA 3SHWA 2EIFA 2LTOA 3M55A 2KY9A 4PJOD 1Y71A 1SG5A 4B6MA 3OB9A 1HXDA 2X51A 2JVVA 2OJ2A 1QW1A 2E5QA 2K5IA 2LNHB 4PLIA 1PRLC 4J9GA 1E6GA 3CCUQ 2HSPA 2HL5C 4MZPA 4HT9A 1GXIE 4IUUA 1Q86U 3CD6Q 4AFUC 2RD1A 2L2PA 3M54A 4QQGA 2CSIA 1MNDA 2VKNA 1PC0A 1KHCA 3JCMb 2EQIA 1YBYA 4QVCA 5GAOq 2CP6A 3P8HA 4M75C 4M75A 3G4ST 2M16A 1MHNA 4XTUA 2K57A 2YRDA 2O4XA 1Z9ZA 1IXDA 1QLYA 2A3LA 4FT2A 3TEEA 3QDRB 3UA7A 5GAN2 4IUPA 3QDFA 4F17A 5CVIA 4HT8A 1Q95G 3MP1A 2KE9A 1TH7A 3M0UA 1T0JA 2KAFA 1NLPC 2E12A 1TG0A 3OYIA 3PVQA 4Y28E 1UGQB 1M30A 2EGAA 1I8FA 2JTMA 1VQPT 1Q86R 4J5YA 1C1AA 3H8ZA 2D6FA 1KSWA 3CCEA 2MWPA 1VQ9T 4E7HA 2RH2A 5DLQE 1LCKA 1PRMC 1PKTA 1OOTA 2E10A 1M90R 2EGEA 2DJQA 2K5LA 1GFCA 1K76A 4E7IA 2FVUA 4J8OA 2CKKA 1WLPB 3FIFA 4J7FA 4OGEA 1AVZC 3EGDB 4EMGA 3AT1B 2RK1A 2QQBA 3A98A 1UHFA 2QQAA 1R0CB 2DLPA 5ECAA 2KRNA 1OZ3A 2FEIA 2M9UA 4M77E 4BY6C 1D1CA 1M3CA 4ME7A 4C8QF 1X2KA 1O75A 2RA2A 5CAIA 4Z88A 5GANg 4J9EA 4OMNA 3VYHB 5IAYA 3I56A 5GAMe 3V8KA 2QXFA 3WVEB 2BUDA 3R6NA 3OMCA 4PK4A 5GAMf 4M7DE 1RUWA 2EYXA 2VGNA 5LJ3e 3L2RA 4WTOB 2HAXA 4HVWA 5LJ3f 1SEMA 1E6HA 1QVFS 2ZPIB 2X4XA 2LJ3A 2DZ9A 1IRXA 2LX9A 5LJ5j 3CBPA 2VUBA 4E7SA 5CKFA 1VQLT 1QP3A 4KBMB 1QQJA 3S3OA 4VUBA 4HVVA 3S3NA 1X6OA 1IREB 4QQ6A 2O2OA 1UG1A 2BIVA 2QDLA 2EKOA 4OMQA 5CKDA 4M78E 2CP2A 3QHSA 2A36A 3CCUT 2XI9A 1LOJA 3M57A 1BIAA 5IN1A 2QA4T 1BCMA 3QZ5B 2KR3A 4QQDA 1QWFA 4FSXA 4MMKA 2FPDA 2RMOA 2GFAA 1G3WA 3M0RA 4A53A 1S72Q 2NLUA 1AWJA 1UE9A 3JCMd 2EVRA 3G4SA 1WA7A 3SWNB 4M78G 3KUFA 2EJ9A 4BB7A 3H0HA 5KYUA 2L5QA 3CMEA 2DL3A 4KH1B 4J7IA 1VOMA 2E64A 4A4FA 1NPPA 3LH5A 4CC3A 4GBQA 3CMAT 5FLXE 1GFDA 2BZ8A 3TSWA 1GCPA 2OX7A 1VQ9A 5IXBA 4E7JA 3SEMA 5LJ5d 4MMLA 5KCOA 5CR2A 1AHJB 3OYDA 1VQKA 4OMFB 1SHGA 2KNBB 1M3AA 4C8QD 1Q81C 2AKKA 1YIJQ 3REBB 4M77B 4C0ZA 5FU6C 4LD6A 1NEGA 2LDMA 3HL8A 3L2VA 2VGMA 4M7AF 3QXEB 2DTHA 2DILA 1ZA2B 2DERA 3I5SA 3N5BB 4M7DB 3LW5E 2AHJB 1FXXA 2F5KA 4RUGA 2XG8D 4QW2A 1XNIA 2RI3A 4F7UA 5CKHA 3PT9A 1W1FA 1B34A 1K8AC 1IO6A 1PNJA 3QJYA 1QP2A 3ZFJA 6AT1B 1SRLA 1Y07A 4A54A 2PVOB 1KQSS 1KD1C 1WHJA 5GANe 1RAFB 2E4HA 4M78B 2JS0A 4FW1A 3QSUA 4M75F 4AT1B 2KT1A 1DJ7B 2X35A 1I1JA 3L2WA 1H3HA 1TS9A 5GANh 5DY9A 1NYFA 2J6KA 3JB9G 1K9MC 2ZPFB 1K73C 4FT4A 4A4GA 2FB7A 2E6ZA 2KBTA 3CCVQ 5FU7B 3CCUA 3CEYA 1HYOA 1YN8A 1AEYA 1KHIA 3LGLA 3CCQT 2MIOA 2YLBA 2QA4A 2CP3A 1M1KU 1JJ2A 1XTDA 2QEXT 1VYUA 4C5HA 1ZSZC 2FPFA 1ZSZA 1IZ6A 2JTEA 3BE3A 5J3BA 2COZA 2XK0A 4CI0C 4KGVB 3PIOA 1RAHB 3OYAA 4RTVA 1WYXA 3CC4Q 3RIRA 5IH2A 2RM4A 2RI5A 4XTYA 1T0HA 2HSEB 1UB4A 1QVFA 3I56Q 2HCKA 2QDYB 5KE3A 1Q7YC 3QO3A 1BK2A 1R8OB 2IIMA 4ESRA 1WXUA 3A1PA 3VS3A 2P4TA 4XTWA 1UHCA 4AG2C 3FLGA 4M7AD 4JRKA 1ZA1B 2PUOB 1TUGB 1WDXA 2LJ0A 4IUTA 4LDWA 3BDLA 5AYFA 2CZ6B 1YIJT 5GAN4 1KK7A 1VQOT 4PJOE 3GP8A 1RL2A 4ATOA 3NTIA 4ELZC 2JM8A 4J9CA 3GOXA 2VB6A 3GBQA 2JMAA 4OB3B 2G6FX 2HDAA 3RR6A 5LL6S 2ABLA 2EJGA 3LYIA 3JCMP 3CXCS 2X4JA 2E6NA 3DLLA 4DOWA 5FRNA 4BDYA 2RJCA 3EFRA 2VVKA 4N0AC 4PJOG 4N0AA 1PD0A 3JCMf 2FG0A 5I22A 2KRMA 4E7KA 1Z9QA 4M75D 3G71T 2RJDA 4OB1B 4Z02A 3L2UA 2Y4YA 3VS4A 1MUZA 2JN0A 2K79A 2KYBA 2YXYA 4Z8AA 5GAN8 1SPKA 3X26B 5A0LA 4ORZA 2GCXA 5L23A 3ZBDA 2R5MA 3FB9A 4BD3A 2EQKA 1D3BB 1YNZA 3M59A 3LLRA 2DL4A 5IHNA 1JJ2P 2FO0A 1U1TA 5GAOm 1VQPQ 2LNVA 3UDCA 3CCVT 2X9HA 1VQ9Q 1NLOC 1TXQA 5CQXA 3CCQA 1QCFA 4MDXA 3A8MB 3A8OB 3C94A 4KGXB 1PG5B 1UECA 3VV0A 2QEXA 4C92E 4QVZA 3I35A 1QVFP 4NS5A 3ME9A 2D8HA 3CC7Q 1OV3A 3JB9J 1BYMA 2LP5A 3X28B 2ECZA 4DQ2A 2XICA 3CC4T 1KQSA 4RKUE 3OY9A 4JJBA 4X9CA 4A4KA 3RNJA 1Y96A 3ZEHA 2RHXA 3BW1A 1M1FA 1RABB 2V26A 4C92G 3CCJQ 1NBEB 3BDUA 2W10A 3PE0A 2ZPHB 1LVKA 4PLLA 2O31A 2DVJA 4OF1A 4PJOB 4X1VA 2QQRA 5CO7A 1YJNQ 1I81A 1BCOA 2YT6A 3JCMX 2J6FA 2MCNA 1YIJA 3FDRA 1FWZA 3M5AA 3OS0A 3URGA 1VQOA 4JRIA 4F04B 1LNXA 2BZYA 4PFZA 2A37A 1W70A 4YTLA 1UJ0A 2FYKA 5KYXB 3OMGA 1VQ7Q 1VQLQ 3OYNA 2VXFA 2NUTB 3IQLA 4FYVB 2L0AA 2QGFB 4BE0A 2F69A 2CH4W 3EFOA 3X20B 2QAZA 4ZN1A 1WX6A 1H92A 1ACMB 2B86A 3MKDA 2CDTA 8ATCB 3QWYA 1PM3A 3E9GA 2PU9B 2CP0A 3OA6A 3HRTA 4DA4A 2HQHA 5HCKA 4FW2A 3VUZA 3G71A 2QA4Q 2YSQA 3EGUA 1U8RA 3RMQA 1U06A 2OTJQ 1TSFA 5I11A 1M90U 1PD1A 4Q5WA 1N6AA 3MEAA 1QVGS 3Q1JA 1FMWA 2BKDN 2LJ1A 2QQSA 2QI2A 1D0ZA 3HP9A 4IKFA 1WHLA 1W6XA 3UA6A 5GMKe 4RCBA 2R58A 2JZ2A 2XMFA 2MMPA 2VXEA 1VIEA 1M3BA 1IGQA 3CMAQ 2E1HA 3VUBA 4C8QE 5CKBA 2MPXC 2PUKB 4GLMA 4C92B 3CCVA 1B34B 5GMKh 4C5IA 3CXCA 3QYGB 2PNIA 2DF6A 1N9SA 3EFSA 4J9BA 5C0MA 4E47A 4ZNXA 2E41A 5FW9A 2Y90A 2NUZA 3JRZA 1KQSP 1BU1A 2J6OA 1X75C 1OU9A 2QTXA 2RPNA 3I55Q 2PQWA 2AZSA 2DXUA 4C0DB 3FEOA 4QT7A 2YRVA 3H0FA 3OSVA 3RKWA 5GAOn 2DTOA 4K11A 3CC7T 3T9NA 2K5FA 3HFNA 3CC4A 1JBMA 2COWA 3QUIA 2V8KA 3CBOA 1JJ2S 1M5Q1 4DBFA 1KC8U 2JXBA 3V7SA 1PKSA 3CCJT 1WQWA 1VUBA 4RMOA 2ED0A 4DBHA 2VASA 1Q86C 2G3RA 1TU0B 1YJNT 4AG1C 1FMVA 3AHUA 4M77G 1M2VA 3H9NA 4JPBW 1SSFA 4O5VA 1VQ5T 1H3ZA 5GAMh 1G2BA 3M0TA 3HRUA 1YJWQ 3LH0A 4LDYA 1V29B 3G6EQ 4RTUA 3SDZA 4EPCA 3WXMB 5LJ3h 4XU0A 1PWTA 2RQWA 1VQ7T 4M7DG 2CZ0B 2RJEA 2DD4A 1K9AA 1Q81U 2RN8A 1WHKA 3CCRT 1KC8R 1ZLMA 3KXTA 2C0TA 3MCAB 1T3SA 1UJYA 4MZMA 3MEUA 4J6XA 2LCCA 2C0OA 3OW2S 3PNWC 1BIBA 2DBMA 4A4EA 2GGRA 4RTTA 2YRCA 4CC7A 3CCQQ 5EC7A 2GQVA 2DMOA 1YHQT 2EWNA 2OTJT 4UC4A 2FL7A 3MEVA 2F2XA 2CP5A 2QEXQ 2DPPB 2ENMA 1FYNA 3OYFA 1K8AU 4LN2A 3L2QA 2KT8A 2DL5A 4C8QB 1Q81R 1M4ZA 3VS2A 2RNAA 4PJJA 3EGXA 3O8VA 3OYEA 1M8VA 1VQ4Q 2O01E 1K0XA 2DFUA 1NEBA 2K3XA 3CXCP 4FYWB 3HKSA 4WF2A 4M7AE 2RHUA 3NGPA 5DM7R 1KD1U 1F1BB 2EBPA 2M51A 3OYGA 2LT4A 5GJVB 1VQ6T 2GFUA 1VQPA 3EG0A 1PCXA 4ZGEB 1UTIA 2COYA 2HD0A 3RMSA 2NUPA 4E7LA 4OMMA 2I0NA 2JM9A 2LQNA 4M78F 4L6V5 1G3TA 1WZOA 2P0QA 2HQXA 1MMNA 1K8AR 3JCMg 4XU1A 2KYMA 5FROA 5HK3A 1VQOQ 1GRIA 2JOYA 3I55T 1CKAA 2ROTA 2SEMA 4CC2A 3CBMA 5L8RE 3CC7A 1EIFA 2DL8A 1D1AA 2I2LA 1KD1R 4N4GA 3JB9I 1ZSGA 1ZUYA 4X34A 4WCIA 4PJLA 3PTAA 4M75E 1U1SA 2HL3A 1B3QA 5GAOl 1QVGA 5GMKm 3J7AF 2M1HA 2EQMA 3RBBB 3CCJA 2CYZB 2DXBA 3UF4A 3QYHB 2XDDA 4FSSA 5LJ5g 3QPHA 4FYXB 5CIUA 3X25B 1C6VX 4KUDK 1D1BA 2L8DA 1NJIU 1WPYA 1YJNA 1TWBA 1T3LA 3G71Q 3TQ7P 2P4RA 4GLKA 3PFSA 1K9MR 3GNGA 1Y57A 1EX4A 4RG2A 4XAXB 2MWOA 2OAWA 3MP6A 3GLXA 3UT1A 2K6DA 2CUDA 1YJWT 5A0DA 4BE1A 2FHDA 2P0KA 2LC4A 3G6ET 2LX7A 1K4US 5GAN7 2K4YA 2VC8A 3EG1A 1VQ7A 1VQLA 2LMJA 3MHXA 1Q82U 4JLGA 4OB0B 1M8MA 4LDVA 2CSQA 1ZUKA 1XOVA 1VQNQ 1JXOA 3QZ9B 3P8BB 3UATA 4J9IA 1NJIR 3A8HB 1BB9A 1VIFA 3RKYA 3OS2A 4C0FA 1UGPB 1R77A 5KYNA 4JRQA 1YHQA 2YWWA 2OTJA 1MMAA 1VYVA 4GY5A 4NL2A 4XU2A 2DBKA 2YDLA 2W0ZA 2DL7A 5A2QE 3REAB 4R56A 3HTRA 4HCBA 2QGGA 4M7AB 4FYYB 2HMAA 4EMKB 2EYYA 2KDSA 1Q82R 2PZ1A 5DLOA 1SF9A 2V1QA 1IGUA 2A08A 4C0GA 3V7RA 1KJWA 5IT9E 1VQ4T 4PL6A 4M78D 2MOXA 1W2BA 1TOVA 4LUEA 1KQ2A 3VKIA 3LWHA 3C95A 1X69A 2E65A 4DEYA 3CMAA 1VQ6A 1VQMQ 1U5SA 4B9WA 2NYSA 4E6RA 2MK5A 2CZ7B 3HRSA 3OYBA 2J05A 2JT4A 2IPOB 3ASKA 3PIPA 1W4SA 3M53A 2RK2A 3EH2A 3C4SA 1O9SA 1WHMA 3CPFA 3H41A 3RERA 3NPFA 2K9GA 3OW2A 4O6JA 3OYKA 5C6SA 3I55A 1QVGP 4M75B 5FRMA 1M27C 2KEAA 1UGRB 2O4XB 4RTZA 2DEUA 2PTKA 1BI0A 1GL5A 3M0PA 2AZVA 2OTLT 3I9QA 1VQ8Q 3SWNC 3JCMe 3SWNA 1LJOA 1N8RU 3TCJA 3M4YA 3TREA 2LCLA 1WI7A 3MPUB 2ZAEA 2EQJA 5GAN5 1ZQ1A 2KXCA 3E1SA 1EZZB 5IXFA 1I4K1 2CZ1B 1M1KC 3OYHA 2K3BA 3JCMh 2H3JA 3F70A 2LZ6B 2VV5A 4BACA 4IIMA 1YJWA 5GJWB 5KYYA 4RTWA 3G6EA 5LJ5e 5EG2A 1G8XA 4ANJA 4F16A 1V76A 1TUDA 4J9FA 3P8DA 4M77C 5LJ5f 4M77A 2RHYA 2EJFA 3A5ZB 4KT0E 4FM4B 4BY6B 9ATCB 1N8RR 1QWEA 3EHRA 4ELYC 2QTVA 5CQYA 2LQWA 5I2MA 1VQNT 3EG2A 5LJ5h 1PSEA 4LDXA 3JB9D 1JQQA 4M7DC 4M7DA 1WXBA 2FPEA 3JSCA 3KFVA 2CH4A 1HJDA 1W2BP 2DVEA 3WVDB 2RJFA 4F7UE 4KUIA 1OPLA 2HNIA 1J3TA 3LX7A 2YHTA 1UGVA 5D6XA 2H3EB 2QG9B 2MI6A 5GAN3 3INZA 2HBWA 1HSQA 2GF7A 1VQ4A 2LRQA 1X2QA 2EGCA 3M56A 2DYBA 2AIRB 1YJ9Q 2GBQA 3OYLA 1IB8A 4F7UG
chains in the Genus database with same CATH topology
4L59A 2VYTA 3FEOA 2YRVA 3OSVA 4OMFB 3RKWA 4M78C 5CKEA 1VQMT 4M78A 4C8QD 5GAOn 2DTOA 5CCAA 5GAMj 4EMHA 3T9NA 1Q81C 3OBWA 3CC7T 2KQWA 2K5FA 3HFNA 4M77B 4C0ZA 5FU6C 3CC4A 3OYJA 4LD6A 1JBMA 3CCLA 2LDMA 4C5EA 3QUIA 3HL8A 2IVWA 3L2VA 2LT1A 2V8KA 4XU3A 5LJ3j 3CBOA 1JJ2S 4CRIA 4HCCA 2VGMA 1M5Q1 1Q82C 4M7AF 1KC8U 3QXEB 2DTHA 1YI2A 3V7SA 3CCJT 3CCST 2XD0A 1WQWA 1VUBA 2X4YA 3X24B 4RMOA 2DO3A 5FU7C 2X4WA 1RI0A 3N5BB 4BUGA 4P5NA 4M7DB 1G3SA 1Q86C 2G3RA 2RHZA 3LW5E 4J6YA 1WGSA 2AHJB 1YJNT 1FXXA 2F5KA 4JDSA 2XG8D 4QW2A 5J39A 4C8QC 1XNIA 2RI3A 4C8QA 3AHUA 4F7UA 3NFCA 4M77G 5CKHA 3DLMA 3PT9A 2DIQA 1SSFA 3L42A 4O5VA 1VQ5T 1H3ZA 3OYMA 5GAMh 1QVPA 1B34A 4X9DA 2ZPEB 1K8AC 1OZ2A 3QJYA 1QP2A 2DIGA 3HRUA 5GMKi 3LH0A 5GANj 4LDYA 1V29B 2DD5A 1VQ8T 3ZFJA 3SDZA 4EPCA 3WXMB 5LJ3h 4XU0A 1Y07A 4J83A 4A54A 1VQ7T 2PVOB 4M7DG 1KQSS 4ZN3A 2CZ0B 4R55A 2RJEA 2DD4A 3JB9H 1KD1C 2WSCE 1Q81U 5GANe 3CCRT 3KXTA 3MCAB 3E9FA 2DAQA 3CCMA 4BDZA 3L1AA 2HQEA 1H641 4MZMA 4M78B 3MEUA 4PJOF 3QSUA 4FU6A 4ZTFA 4J6XA 2LCCA 3HFOA 3OW2S 3PNWC 1BIBA 4OGCA 4M75F 2PVDB 2K2VA 3DB4A 5FU6B 4A4EA 2V8JA 2DKGA 1DJ7B 2X35A 3L2WA 3VJPA 5GAMd 2GQVA 2KMTA 3VYGA 3GPLA 2MF2A 3V8JA 5GANh 3M9QA 5DY9A 2EWNA 3VU3C 1YHQT 2OTJT 3JB9G 4LDUA 2Y4XA 2FL7A 2ZPFB 3MEVA 4UC4A 3JCMc 1K9MC 1K73C 3HSBA 3PMIA 2P0PA 4FT4A 4A4GA 2DPPB 3OYCA 2DJZA 2FB7A 2E6ZA 3BY7A 5FU7B 5LJ3d 3CCUA 3CEYA 2OAUA 3OYFA 1KHIA 1K8AU 2HBPA 3LGLA 3CCQT 5GMKl 2YLBA 3L2QA 2IG0A 3GF5A 1VQNA 2QA4A 3QKJA 4C8QB 1I5LA 1M4ZA 4F7UB 4MZTA 1M9SA 3PMTA 1M1KU 3O8VA 1JJ2A 1XTDA 3OYEA 1M8VA 3UPUA 1YITT 2O01E 2QEXT 3KBGA 4C5HA 1KG1A 4Y91A 2C06A 2K3XA 5D6YA 3CCET 3HPWA 3CMET 3HKSA 3PGGA 4JUVA 4WF2A 4M7AE 3BFMA 2RHUA 3MP8A 5DM7R 1KD1U 3GNFB 4ZGJB 1IZ6A 5I21A 5J3BA 1UEBA 3OYGA 1X01A 2E70A 2LT4A 2XK0A 4PKCC 4CI0C 1VQ6T 2GFUA 1VQPA 3C12A 4ZGEB 2EFIA 3PIOA 5GANd 4DOVA 3OYAA 2HD0A 3RMSA 1ZHIA 2A7YA 4PNOA 3J81E 4E7LA 5M9OA 5KE2A 2L3RA 2DEQA 3RIRA 1S72A 5GAMg 2DK3A 2RM4A 2RI5A 2ZPBB 4XTYA 2B8AA 2LQ8A 4C8QG 2KVQG 4M78F 3QIIA 1N8RC 3J80E 2KSSA 1UB4A 4L6V5 1VQKT 1G3TA 1MGQA 1QVFA 2QDYB 1YCYA 5KE3A 1Q7YC 3CCSA 2P0QA 1BKBA 3QO3A 1R8OB 2HQXA 2XDPA 5CK9A 5LJ3g 3JCMg 3GIBA 1BI3A 4XTZA 3H6ZA 2DXCA 2P4TA 4FL6A 4XTWA 4XU1A 2CGHA 4EDUA 2ZPGB 5FROA 5HK3A 1M1GA 1NZ9A 3R6OA 3FLGA 4M7AD 1YJ9T 4JRKA 2JOYA 3I55T 2PUOB 3CPWS 4V2SA 4XQ3A 4QVDA 3META 3CBMA 3OS5A 5L8RE 1VQMA 3CC2T 2MAMA 3I56T 4IUTA 3CC7A 1EIFA 2I2LA 2RB6A 2RHIA 2WSEE 3BDLA 2CZ6B 3MEWA 4LDWA 3A8LB 5AYFA 1YIJT 1OI1A 2R5AA 4N4GA 5GAN4 3JB9I 4X34A 1D3BA 5J26A 4J6WA 4C92D 3UWNA 1VQOT 4PJOE 4F7UF 3JCMQ 1NE8A 4OP0A 3GP8A 1RL2A 3NTKA 3PTAA 1P92A 4ATOA 4M75E 1U1SA 5GAOl 3NTIA 4ELZC 1QVGA 1W2BS 4C92F 3LGFA 5GMKm 2M1HA 2EQMA 3J7AF 3GOXA 1M90C 1WJRA 4NL3A 4OB3B 3CCJA 2CYZB 2DXBA 2M0OA 2RI2A 3QYHB 5LJ5g 2XDDA 3QPHA 5CIUA 3X25B 4BE2A 4MDWA 5LL6S 4JS4A 2XDBA 1N9RA 2EJGA 3LYIA 3JCMP 4KUDK 3CXCS 4M7AA 4M7AC 3LWIA 2X4JA 2L8DA 1UGSB 1NJIU 1WPYA 1XQHA 2DZCA 3QJ6A 4EMKC 1YJNA 4EMKA 2QQ9A 2CS7A 4GLKA 3RESA 1Y7XA 2E6NA 3PFSA 3EAEA 3V8LA 4DOWA 3DLLA 4JS5A 5FRNA 4BDYA 2WSFE 2XHCA 3GNGA 4RG2A 4XAXB 2MWOA 2RJCA 4LD9K 2WACA 3S3MA 3EFRA 3S6WA 4N0AC 4PJOG 4N0AA 3MP6A 3JCMf 3ER0A 2EIFA 3GLXA 2LTOA 3M55A 3UT1A 2KY9A 4PJOD 1YJWT 4E7KA 5A0DA 1Y71A 3JCMJ 4BE1A 2FHDA 1JRIA 3OB9A 2P0KA 1HXDA 2LC4A 4M75D 2L89A 4IURA 3G6ET 3G71T 1VQ8A 4M77F 2RJDA 2JVVA 5GAN7 1QW1A 2E5QA 2K4YA 2K5IA 2VC8A 4OB1B 4PLIA 4Z02A 3L2UA 1VQ7A 1VQLA 1G5VA 2Y4YA 3MHXA 1Q82U 2JN0A 4JLGA 2LQKA 2XIDA 4OB0B 2K3YA 4XK8E 4LDVA 5KCHA 5GAN8 4MZPA 4HT9A 5HY6A 3X26B 1GXIE 4IUUA 5GAN6 5A0LA 1Q86U 1XOVA 2GCXA 2RD1A 3M54A 1N27A 4QQGA 3QZ9B 3SD4A 2R5MA 3P8BB 3FB9A 3ZBDA 1HK9A 4HKEA 1NPRA 4M7DF 1KHCA 3L2ZA 3A8HB 3JCMb 4BD3A 2EQKA 1VIFA 1YBYA 4QVCA 3RKYA 5GAOq 3OS2A 4C0FA 1D3BB 1UGPB 4PJOC 4PJOA 3M59A 3P8HA 4M75C 4M75A 3LLRA 3QG1A 3G4ST 2M16A 1MHNA 4XTUA 3CD6T 2K57A 4JRQA 1YHQA 2O4XA 2OTJA 1U1TA 4GY5A 5GAOm 2A3LA 4FT2A 4NL2A 4XU2A 3TEEA 3QDRB 5GAN2 4IUPA 4II1A 2LNVA 5A2QE 1WJSA 5CVIA 3UDCA 3MP1A 4BI4A 4R56A 3CCVT 4HT8A 4HCBA 1TH7A 4M7AB 4RG8A 4C5GA 4BI3A 4EMKB 2KAFA 5CQXA 2KDSA 3CCQA 4A4HA 3HHTB 4MDXA 5DLOA 3A8MB 3A8OB 1KC8C 3C94A 2E12A 4C0GA 3V7RA 3OYIA 2ZCFB 4Y28E 2XU8A 3FC3A 1UGQB 2JTMA 5IT9E 1I8FA 1G3YA 4PL6A 4M78D 3VV0A 2QEXA 1VQ4T 1YITA 4J5YA 1VQPT 1W2BA 3H8ZA 2D6FA 3CCEA 4C92E 2MWPA 4QVZA 4E7HA 1VQ9T 1KQ2A 2RH2A 3E19A 5DLQE 3VKIA 3DKMA 3LWHA 3C95A 4NS5A 4XTXA 3ME9A 2DTIA 2E10A 2E65A 3CMAA 1VQ6A 3OYYA 4B9WA 2K5LA 4M7AG 1K9MU 3JB9J 1BYMA 4L5GA 3X28B 3NTHA 1K73U 4HA8A 2CZ7B 2XICA 2FVUA 4J8OA 4DQ2A 3CC4T 2CKKA 3HRSA 4E7IA 4RKUE 1KQSA 2EYQA 3FIFA 3OY9A 4J7FA 4OGEA 3CCLT 4X9CA 3OYBA 4A4KA 4EMGA 3ASKA 5A0GA 1Y96A 3PIPA 2RK1A 3ZEHA 1VQKA 1W4SA 2RHXA 3M53A 3BW1A 1M1FA 2QQBA 2RK2A 1YI2T 4C92G 2QQAA 3C4SA 3BDUA 1O9SA 3CPFA 2ZPHB 2RO0A 3RERA 1OZ3A 4PLLA 3OW2A 4TVRA 4OF1A 2M9UA 4M77E 4PJOB 4O6JA 4BY6C 4ME7A 4C8QF 2QQRA 3OYKA 3OBYA 5CO7A 5C6SA 1YJ9A 3I55A 4NOYA 2V8IA 1O75A 4M75B 1I81A 2RA2A 5FRMA 5CAIA 3DB3A 1UGRB 2O4XB 5GAOp 5GANg 3VYHB 3JAME 3CC2A 5IAYA 3JCMX 3I56A 5GAMe 3V8KA 3QBYA 1YIJA 1ZBXA 5HKCA 3FDRA 1FWZA 2QXFA 1BI0A 2BUDA 3M5AA 3OMCA 5D6WA 3URGA 3WVEB 4D6WA 3OS0A 4IUVA 1VQOA 5GAMf 4M7DE 2OTLT 4JRIA 2VGNA 5LJ3e 3SWNC 3JCMe 3SWNA 1LNXA 3L2RA 1LJOA 2JUFA 1N8RU 4YTLA 4XTVA 3TCJA 2D9TA 2FYKA 3M4YA 3TREA 5KH6A 3OMGA 2HAXA 1VQ5A 2R57A 1BI2A 2LCLA 1Q7YU 5LJ3f 3OYNA 4C92C 2VXFA 4RCCA 4C92A 4M75G 2KK4A 4M77D 2EQJA 5GAN5 4BE0A 2F69A 1ZQ1A 5I2SA 4N4IA 2F5TX 3G7ZA 4KULA 1QVFS 3E1SA 1KQ1A 1WJQA 2ZPIB 2X4XA 3X20B 5LJ5f 3CCMT 4ZN1A 1JB0E 2DZ9A 1I4K1 2CZ1B 2LX9A 5LJ5j 1M1KC 3CBPA 3OYHA 3M4GA 3JCMh 2VUBA 4FIBA 1OYXA 5CKFA 1VQLT 1QP3A 3E9GA 2OTLA 2H3JA 2PU9B 4KBMB 3F70A 3OA6A 2VV5A 3HRTA 3CCRA 4DA4A 3S3OA 4VUBA 4BACA 4ZTJA 3OS1A 1YJWA 4M7DD 3VUZA 4JLIA 3S3NA 4C0DC 3G71A 3G6EA 1Y96B 1X6OA 4ZGDB 1IREB 5EG2A 5LJ5e 1U8RA 3RMQA 4QQ6A 3MO8A 2BIVA 2EKOA 3SB2A 4JJNK 5GANf 5CKDA 4M78E 2ZZDA 5GMKj 1M90U 3P8DA 4M77C 3FRNA 4M77A 3QHSA 4OVAA 3RUXA 2RHYA 2EJFA 2JTFA 3A5ZB 3FJPA 4Q5WA 4KT0E 3CCUT 2XI9A 1LOJA 1N6AA 2DXTA 4FM4B 4BY6B 3MEAA 4ELYC 2ZGWA 3Q1JA 1QVGS 2BKDN 3M57A 3OSSC 2QQSA 5CQYA 2QI2A 1BIAA 1WQ7A 5I2MA 5IN1A 1VQNT 3HP9A 2QA4T 3QZ5B 4QQDA 3SFMA 3CPWA 4IKFA 3RKXA 1WNLA 4FSXA 4MMKA 5GMKe 3TU4K 4RCBA 3V7CA 5LJ5h 1PSEA 2GFAA 2R58A 1G3WA 2YLCA 4A53A 4LDXA 2NLUA 3JB9D 3A8GB 4M7DC 4M7DA 3JCMd 2EQUA 2JZ2A 2VXEA 2MMPA 3G4SA 2PVGB 3OQ5A 4N4HA 4JRPA 1VIEA 5HK0A 3JSCA 3JB9F 3SWNB 3CD6A 4M78G 3KUFA 2E1HA 3VUBA 2EJ9A 2DVEA 3WVDB 4BB7A 1FX7A 5CKBA 2JNGA 2RJFA 4C8QE 2XKOC 4OB2B 4F7UE 4B9XA 1PSFA 4IUQA 2PUKB 4KUIA 4C92B 3CCVA 2L5QA 3CMEA 1B34B 5GMKh 4J7IA 2HNIA 3M58A 2EAYA 2E64A 3JCMV 1S72T 5GAOr 4C5IA 4A4FA 1NPPA 3LX7A 3CXCA 1BI1A 2YHTA 3QYGB 5D6XA 4BI8B 1N9SA 3EFSA 2MI6A 5C0MA 4E47A 5GAN3 2E41A 3INZA 3CMAT 2Y90A 5FLXE 3JRZA 2GF7A 4HCZA 1VQ4A 2LRQA 2D0QB 1NJIC 3M56A 1X75C 3JCMW 1VQ9A 4E7JA 2QTXA 5LJ5d 4MMLA 5KCOA 5CR2A 3OYLA 2PQWA 2DXUA 2LVMA 4C0DB 4F7UG 1AHJB 3OYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1F A;  2VUB A;  5CQY A;  5CKF A;  5CKE A;  4MZP A;  1UB4 A;  2KMT A;  5CCA A;  2MF2 A;  2C06 A;  4OF1 A;  3HPW A;  4VUB A;  3TCJ A;  1NE8 A;  4ME7 A;  5CK9 A;  5CO7 A;  3NFC A;  4ELZ C;  4HKE A;  5CKH A;  5CQX A;  5HK3 A;  4MDX A;  5DLO A;  3JRZ A;  5CKD A;  4MZM A;  5HK0 A;  3G7Z A;  3JSC A;  1X75 C;  3VUB A;  5HKC A;  5CR2 A;  1VUB A;  5CKB A;  4ELY C;  4MZT A; 
#chains in the Genus database with same CATH topology
 1IHV A;  1SKU B;  4M78 C;  1VQM T;  3CC2 Q;  3EHQ A;  4M78 A;  4A63 B;  5CCA A;  4EMH A;  3OW2 P;  3OBW A;  2DNU A;  1QCN A;  2HEQ A;  3OYJ A;  4DBR A;  2IVW A;  2RQV A;  4HCC A;  1OX9 A;  3CCS T;  1VQ5 Q;  1OPK A;  3G1J A;  2J06 A;  2DO3 A;  5FU7 C;  4RTY A;  2CRE A;  2RHZ A;  1WGS A;  2YUP A;  1WIE A;  3EG3 A;  3VS0 A;  4DEX A;  1AZE A;  5KYU B;  3OYM A;  1QVP A;  4X9D A;  2ZPE B;  1I0C A;  1OZ2 A;  3CCR Q;  2DIG A;  2RF0 A;  5GMK i;  5GAN j;  2K2M A;  2DD5 A;  1VQ8 T;  4AMC A;  2GQI A;  2ED1 A;  4J83 A;  1V1C A;  4R55 A;  3JB9 H;  2NUP B;  1YHQ Q;  2A0F B;  3PVL A;  4BDZ A;  3L1A A;  1H64 1;  2FZG B;  4FU6 A;  2K2V A;  1VYT A;  5FU6 B;  2P84 A;  2DKG A;  2V8J A;  3VRY A;  3VJP A;  1D09 B;  2KMT A;  3VYG A;  3GPL A;  2MF2 A;  3VU3 C;  3QWX X;  3EG9 A;  1TTH B;  4LDU A;  3JCM c;  2P0P A;  3OYC A;  1CKB A;  2DJZ A;  2KRS A;  1NM7 A;  3ZL7 C;  2DA9 A;  2DRK A;  2HBP A;  1CSK A;  5GMK l;  4LE9 A;  2IG0 A;  3GF5 A;  1VQN A;  1VQ6 Q;  1I5L A;  4F7U B;  2HKN A;  3UPU A;  1YIT T;  3NHN A;  2C06 A;  5D7U A;  3HPW A;  3CME T;  1E7O A;  3PGG A;  3BFM A;  3MP8 A;  2YUN A;  4KH0 B;  2JS2 A;  3GNF B;  4IIO A;  2C0I A;  5I21 A;  4KRT A;  4OMO A;  2DX1 A;  4PKC C;  2FZK B;  2CT3 A;  1RAE B;  3C12 A;  2EFI A;  2KI7 A;  5GAN d;  4DOV A;  2A7Y A;  4PNO A;  2K7A A;  2ZPB B;  3TSZ A;  3CCL Q;  4C8Q G;  2KVQ G;  2DET A;  3QII A;  1AT1 B;  3J80 E;  1VQK T;  1RLQ C;  4E7Z A;  1MGQ A;  1YCY A;  1YI2 Q;  2XDP A;  3GIB A;  2BE7 D;  5CK9 A;  3H6Z A;  2DXC A;  1GBR A;  2CGH A;  2O9V A;  4EDU A;  1NZ9 A;  1WXT A;  4OMP A;  1YJ9 T;  4DBQ A;  3CPW S;  4XQ3 A;  4QVD A;  3MET A;  1VQM A;  3CC2 T;  2MAM A;  2WSE E;  2RB6 A;  2RHI A;  3A8L B;  1OI1 A;  2R5A A;  1D3B A;  4D8K A;  3U23 A;  2D1X A;  4C92 D;  1SSH A;  5KYW A;  3NTK A;  1P92 A;  2O9S A;  1IHW A;  2DE0 X;  2H8H A;  1W2B S;  1M90 C;  3CCS A;  2RI2 A;  4BE2 A;  4MDW A;  2RQU A;  2KRO A;  1KIK A;  1UGS B;  1XQH A;  2DZC A;  3QJ6 A;  1ZSZ B;  2ROL A;  2QQ9 A;  3CCM Q;  3V8L A;  3EAE A;  4JS5 A;  1YWO A;  1VA7 A;  4J9D A;  2WAC A;  1K0S A;  4FCY A;  1C0M A;  1MMG A;  3ER0 A;  2KGT A;  3JCM J;  1B07 A;  1JRI A;  1VQ8 A;  2L89 A;  4IUR A;  4M77 F;  1RAI B;  1G5V A;  1FMK A;  2LQK A;  2XID A;  2K3Y A;  4XK8 E;  5KCH A;  1XJW B;  3M0S A;  5HY6 A;  2EPD A;  5GAN 6;  1RAA B;  5AT1 B;  1N27 A;  1ZX6 A;  3SD4 A;  1HK9 A;  4HKE A;  1NPR A;  3VS6 A;  3L2Z A;  1PHT A;  3H0I A;  4M7D F;  2RQT A;  1AWW A;  4JZ3 A;  1JEG A;  1U3O A;  4PJO C;  4PJO A;  2ESW A;  4AFQ C;  3QG1 A;  2F1L A;  2VWF A;  1B7T A;  1MV3 A;  3CD6 T;  4AFZ C;  4QKU A;  4HVU A;  1X6B A;  4II1 A;  1WJS A;  4BI4 A;  2X3X D;  4KGZ B;  4RG8 A;  4C5G A;  4BI3 A;  4A4H A;  3HHT B;  1KC8 C;  4J9H A;  2ZCF B;  3VS1 A;  2XU8 A;  5KYX A;  3FC3 A;  4JJC A;  2SRC A;  1G3Y A;  1YIT A;  1D0Y A;  2NUT A;  2YUO A;  1NG2 A;  2JW4 A;  3E19 A;  3DKM A;  1JXM A;  1QCO A;  2DTI A;  3OYY A;  1OEB A;  4M7A G;  1K9M U;  4L5G A;  3NTH A;  1K73 U;  4HA8 A;  1GCQ C;  1GCQ A;  2EYQ A;  3CCL T;  2Z0W A;  1A0N B;  5KYY B;  5A0G A;  4EIK A;  1YI2 T;  2RO0 A;  2FZC B;  1OUL A;  1RLP C;  4TVR A;  2V1R A;  4LNP A;  2OTL Q;  2DYI A;  3OBY A;  1YJ9 A;  4NOY A;  2V8I A;  1OQK A;  3DB3 A;  5GAO p;  3JAM E;  3CC2 A;  1MMD A;  3VS5 A;  3QBY A;  1ZBX A;  5HKC A;  2BE9 B;  4D6W A;  5D6W A;  4IUV A;  2GTO A;  3ULR B;  1LPL A;  1K73 R;  2JUF A;  2YUQ A;  1ZUU A;  4XTV A;  2JJ9 A;  2D9T A;  5KH6 A;  1VQ5 A;  2R57 A;  4PFP A;  1BI2 A;  1Q7Y U;  4C92 C;  4RCC A;  2EKH A;  4C92 A;  4M75 G;  2KK4 A;  4M77 D;  1AOJ A;  3VRZ A;  5I2S A;  4N4I A;  2F5T X;  3G7Z A;  1QMC A;  4E2F B;  2L3Q A;  4KUL A;  1KQ1 A;  1WJQ A;  3CCM T;  1RAD B;  1JB0 E;  1ZBJ A;  4PJN A;  1RAG B;  3M4G A;  1QKX A;  1QKW A;  4FIB A;  1OYX A;  2GTJ A;  4D8D A;  3CCR A;  4ZTJ A;  3OS1 A;  4M7D D;  3EGD A;  4JLI A;  3D7S B;  4C0D C;  1Y96 B;  4ZGD B;  1OX8 A;  3MO8 A;  2AK5 A;  3SB2 A;  4JJN K;  5GAN f;  3TVT A;  2ZZD A;  5GMK j;  3FRN A;  1AD5 A;  4OVA A;  2OI3 A;  3RUX A;  3FJP A;  1X27 A;  2JTF A;  1JO8 A;  1ABO A;  2DXT A;  4CC4 B;  2ZGW A;  2CP7 A;  3OSS C;  2QAS A;  1Q7Y R;  1WFW A;  1WQ7 A;  3SFM A;  3CPW A;  3RKX A;  1WNL A;  4RTX A;  1X6G A;  3TU4 K;  3V7C A;  2QK0 A;  2YLC A;  1Y0M A;  3CCE Q;  3A8G B;  3NMZ C;  2AKL A;  2EQU A;  8AT1 B;  3C0C A;  2PVG B;  3OQ5 A;  4N4H A;  4JRP A;  3JB9 F;  5HK0 A;  4LXC A;  3CD6 A;  5IHK A;  1FX7 A;  2F2W A;  2JNG A;  1K1Z A;  2XKO C;  4OB2 B;  4B9X A;  1PSF A;  4IUQ A;  4JJD A;  3M58 A;  1S72 T;  2EAY A;  3JCM V;  5GAO r;  1BI1 A;  3EFO B;  4BI8 B;  1OU8 A;  4PJM A;  4HCZ A;  2D0Q B;  1NJI C;  3JCM W;  2HKQ B;  2HZY A;  4XTX A;  2LVM A;  4L59 A;  2VYT A;  4Z89 A;  2EYZ A;  5CKE A;  1I07 A;  3CCS Q;  5GAM j;  3I5R A;  2JMC A;  2KQW A;  5IHI A;  1S1N A;  4AFS C;  3CCL A;  4C5E A;  2KXD A;  2LT1 A;  4XU3 A;  5LJ3 j;  1M1K R;  2L3S A;  4CRI A;  2FRW A;  3EG9 B;  1Q82 C;  1YI2 A;  1JU5 C;  4OML A;  2XD0 A;  2X4Y A;  3X24 B;  2X4W A;  1AZG B;  1RI0 A;  4BUG A;  4P5N A;  1G3S A;  2DM1 A;  4J6Y A;  4LUD A;  1I5O B;  4JDS A;  2O88 A;  4HXJ A;  3MJX A;  5J39 A;  3EH1 A;  4C8Q C;  4C8Q A;  3NFC A;  3DLM A;  2DIQ A;  3L42 A;  2RQR A;  1YFN A;  2J7I A;  2EYW A;  1EFN A;  2A28 A;  2BZX A;  4HCK A;  4JZ4 A;  4ZN3 A;  2WSC E;  3E9F A;  2DAQ A;  3CCM A;  2FRY A;  2HQE A;  1HD3 A;  4PJO F;  4ZTF A;  2CT4 A;  3HFO A;  1MV0 B;  2E3I A;  1H8K A;  4OGC A;  2PVD B;  1YP5 A;  3DB4 A;  2DRM A;  4Y92 A;  1KFZ A;  3G4S Q;  3THK A;  5GAM d;  3CPW P;  3O5Z A;  3V8J A;  1YCS B;  3M9Q A;  2LCS A;  3VS7 A;  2Y4X A;  2D0N A;  1YIT Q;  3PMI A;  3HSB A;  1GBQ A;  3BY7 A;  1AWX A;  3CME Q;  5LJ3 d;  1G83 A;  2OAU A;  7AT1 B;  1SRM A;  2ATC B;  2AT1 B;  5KYW B;  3JV3 A;  3QKJ A;  1N5Z A;  3CQT A;  1M9S A;  3PMT A;  1M2V B;  4MZT A;  2BTT A;  1KG1 A;  3KBG A;  3E2U A;  4Y91 A;  3CCE T;  5D6Y A;  4JUV A;  4ZGJ B;  2M02 A;  1VQK Q;  1UEB A;  1X01 A;  2D8J A;  1BBZ A;  2E70 A;  1TUC A;  1NYG A;  1M2O A;  1UUE A;  4R0K A;  1ZHI A;  3J81 E;  5M9O A;  5KE2 A;  2L3R A;  2DEQ A;  1S72 A;  5GAM g;  2DK3 A;  1D0X A;  2B8A A;  2LQ8 A;  1ARK A;  2X3W D;  5FWC A;  1N8R C;  2KSS A;  1R0B G;  3RDV A;  3FJ5 A;  1BKB A;  5LJ3 g;  1BI3 A;  4XTZ A;  4F14 A;  1AWO A;  4FL6 A;  2CUB A;  2EW3 A;  2ZPG B;  1M1G A;  3R6O A;  5FWB A;  1ABQ A;  2M0Y A;  4V2S A;  3OS5 A;  1WHH A;  1RAC B;  2E5K A;  3I56 T;  2GNC A;  4PFO A;  2NWM A;  3MEW A;  1MNE A;  1YWP A;  5J26 A;  4J6W A;  1WHG A;  3UWN A;  4F7U F;  3JCM Q;  1NE8 A;  4OP0 A;  2QYZ A;  2MYS A;  3LGF A;  3M0Q A;  4C92 F;  1WJR A;  4NL3 A;  1RI9 A;  3EGX B;  2M0O A;  2XDB A;  4JS4 A;  1N9R A;  4M7A C;  2F2V A;  4M7A A;  3LWI A;  2OTL A;  4EMK C;  4EMK A;  2CS7 A;  3RES A;  1Y7X A;  1SHF A;  2L3P A;  4M4Z A;  2WSF E;  2XHC A;  1X43 A;  1UFF A;  2E3H A;  4LD9 K;  3S3M A;  3S6W A;  1UDL A;  3SHW A;  2EIF A;  2LTO A;  3M55 A;  2KY9 A;  4PJO D;  1Y71 A;  1SG5 A;  4B6M A;  3OB9 A;  1HXD A;  2X51 A;  2JVV A;  2OJ2 A;  1QW1 A;  2E5Q A;  2K5I A;  2LNH B;  4PLI A;  1PRL C;  4J9G A;  1E6G A;  3CCU Q;  2HSP A;  2HL5 C;  4MZP A;  4HT9 A;  1GXI E;  4IUU A;  1Q86 U;  3CD6 Q;  4AFU C;  2RD1 A;  2L2P A;  3M54 A;  4QQG A;  2CSI A;  1MND A;  2VKN A;  1PC0 A;  1KHC A;  3JCM b;  2EQI A;  1YBY A;  4QVC A;  5GAO q;  2CP6 A;  3P8H A;  4M75 C;  4M75 A;  3G4S T;  2M16 A;  1MHN A;  4XTU A;  2K57 A;  2YRD A;  2O4X A;  1Z9Z A;  1IXD A;  1QLY A;  2A3L A;  4FT2 A;  3TEE A;  3QDR B;  3UA7 A;  5GAN 2;  4IUP A;  3QDF A;  4F17 A;  5CVI A;  4HT8 A;  1Q95 G;  3MP1 A;  2KE9 A;  1TH7 A;  3M0U A;  1T0J A;  2KAF A;  1NLP C;  2E12 A;  1TG0 A;  3OYI A;  3PVQ A;  4Y28 E;  1UGQ B;  1M30 A;  2EGA A;  1I8F A;  2JTM A;  1VQP T;  1Q86 R;  4J5Y A;  1C1A A;  3H8Z A;  2D6F A;  1KSW A;  3CCE A;  2MWP A;  1VQ9 T;  4E7H A;  2RH2 A;  5DLQ E;  1LCK A;  1PRM C;  1PKT A;  1OOT A;  2E10 A;  1M90 R;  2EGE A;  2DJQ A;  2K5L A;  1GFC A;  1K76 A;  4E7I A;  2FVU A;  4J8O A;  2CKK A;  1WLP B;  3FIF A;  4J7F A;  4OGE A;  1AVZ C;  3EGD B;  4EMG A;  3AT1 B;  2RK1 A;  2QQB A;  3A98 A;  1UHF A;  2QQA A;  1R0C B;  2DLP A;  5ECA A;  2KRN A;  1OZ3 A;  2FEI A;  2M9U A;  4M77 E;  4BY6 C;  1D1C A;  1M3C A;  4ME7 A;  4C8Q F;  1X2K A;  1O75 A;  2RA2 A;  5CAI A;  4Z88 A;  5GAN g;  4J9E A;  4OMN A;  3VYH B;  5IAY A;  3I56 A;  5GAM e;  3V8K A;  2QXF A;  3WVE B;  2BUD A;  3R6N A;  3OMC A;  4PK4 A;  5GAM f;  4M7D E;  1RUW A;  2EYX A;  2VGN A;  5LJ3 e;  3L2R A;  4WTO B;  2HAX A;  4HVW A;  5LJ3 f;  1SEM A;  1E6H A;  1QVF S;  2ZPI B;  2X4X A;  2LJ3 A;  2DZ9 A;  1IRX A;  2LX9 A;  5LJ5 j;  3CBP A;  2VUB A;  4E7S A;  5CKF A;  1VQL T;  1QP3 A;  4KBM B;  1QQJ A;  3S3O A;  4VUB A;  4HVV A;  3S3N A;  1X6O A;  1IRE B;  4QQ6 A;  2O2O A;  1UG1 A;  2BIV A;  2QDL A;  2EKO A;  4OMQ A;  5CKD A;  4M78 E;  2CP2 A;  3QHS A;  2A36 A;  3CCU T;  2XI9 A;  1LOJ A;  3M57 A;  1BIA A;  5IN1 A;  2QA4 T;  1BCM A;  3QZ5 B;  2KR3 A;  4QQD A;  1QWF A;  4FSX A;  4MMK A;  2FPD A;  2RMO A;  2GFA A;  1G3W A;  3M0R A;  4A53 A;  1S72 Q;  2NLU A;  1AWJ A;  1UE9 A;  3JCM d;  2EVR A;  3G4S A;  1WA7 A;  3SWN B;  4M78 G;  3KUF A;  2EJ9 A;  4BB7 A;  3H0H A;  5KYU A;  2L5Q A;  3CME A;  2DL3 A;  4KH1 B;  4J7I A;  1VOM A;  2E64 A;  4A4F A;  1NPP A;  3LH5 A;  4CC3 A;  4GBQ A;  3CMA T;  5FLX E;  1GFD A;  2BZ8 A;  3TSW A;  1GCP A;  2OX7 A;  1VQ9 A;  5IXB A;  4E7J A;  3SEM A;  5LJ5 d;  4MML A;  5KCO A;  5CR2 A;  1AHJ B;  3OYD A;  1VQK A;  4OMF B;  1SHG A;  2KNB B;  1M3A A;  4C8Q D;  1Q81 C;  2AKK A;  1YIJ Q;  3REB B;  4M77 B;  4C0Z A;  5FU6 C;  4LD6 A;  1NEG A;  2LDM A;  3HL8 A;  3L2V A;  2VGM A;  4M7A F;  3QXE B;  2DTH A;  2DIL A;  1ZA2 B;  2DER A;  3I5S A;  3N5B B;  4M7D B;  3LW5 E;  2AHJ B;  1FXX A;  2F5K A;  4RUG A;  2XG8 D;  4QW2 A;  1XNI A;  2RI3 A;  4F7U A;  5CKH A;  3PT9 A;  1W1F A;  1B34 A;  1K8A C;  1IO6 A;  1PNJ A;  3QJY A;  1QP2 A;  3ZFJ A;  6AT1 B;  1SRL A;  1Y07 A;  4A54 A;  2PVO B;  1KQS S;  1KD1 C;  1WHJ A;  5GAN e;  1RAF B;  2E4H A;  4M78 B;  2JS0 A;  4FW1 A;  3QSU A;  4M75 F;  4AT1 B;  2KT1 A;  1DJ7 B;  2X35 A;  1I1J A;  3L2W A;  1H3H A;  1TS9 A;  5GAN h;  5DY9 A;  1NYF A;  2J6K A;  3JB9 G;  1K9M C;  2ZPF B;  1K73 C;  4FT4 A;  4A4G A;  2FB7 A;  2E6Z A;  2KBT A;  3CCV Q;  5FU7 B;  3CCU A;  3CEY A;  1HYO A;  1YN8 A;  1AEY A;  1KHI A;  3LGL A;  3CCQ T;  2MIO A;  2YLB A;  2QA4 A;  2CP3 A;  1M1K U;  1JJ2 A;  1XTD A;  2QEX T;  1VYU A;  4C5H A;  1ZSZ C;  2FPF A;  1ZSZ A;  1IZ6 A;  2JTE A;  3BE3 A;  5J3B A;  2COZ A;  2XK0 A;  4CI0 C;  4KGV B;  3PIO A;  1RAH B;  3OYA A;  4RTV A;  1WYX A;  3CC4 Q;  3RIR A;  5IH2 A;  2RM4 A;  2RI5 A;  4XTY A;  1T0H A;  2HSE B;  1UB4 A;  1QVF A;  3I56 Q;  2HCK A;  2QDY B;  5KE3 A;  1Q7Y C;  3QO3 A;  1BK2 A;  1R8O B;  2IIM A;  4ESR A;  1WXU A;  3A1P A;  3VS3 A;  2P4T A;  4XTW A;  1UHC A;  4AG2 C;  3FLG A;  4M7A D;  4JRK A;  1ZA1 B;  2PUO B;  1TUG B;  1WDX A;  2LJ0 A;  4IUT A;  4LDW A;  3BDL A;  5AYF A;  2CZ6 B;  1YIJ T;  5GAN 4;  1KK7 A;  1VQO T;  4PJO E;  3GP8 A;  1RL2 A;  4ATO A;  3NTI A;  4ELZ C;  2JM8 A;  4J9C A;  3GOX A;  2VB6 A;  3GBQ A;  2JMA A;  4OB3 B;  2G6F X;  2HDA A;  3RR6 A;  5LL6 S;  2ABL A;  2EJG A;  3LYI A;  3JCM P;  3CXC S;  2X4J A;  2E6N A;  3DLL A;  4DOW A;  5FRN A;  4BDY A;  2RJC A;  3EFR A;  2VVK A;  4N0A C;  4PJO G;  4N0A A;  1PD0 A;  3JCM f;  2FG0 A;  5I22 A;  2KRM A;  4E7K A;  1Z9Q A;  4M75 D;  3G71 T;  2RJD A;  4OB1 B;  4Z02 A;  3L2U A;  2Y4Y A;  3VS4 A;  1MUZ A;  2JN0 A;  2K79 A;  2KYB A;  2YXY A;  4Z8A A;  5GAN 8;  1SPK A;  3X26 B;  5A0L A;  4ORZ A;  2GCX A;  5L23 A;  3ZBD A;  2R5M A;  3FB9 A;  4BD3 A;  2EQK A;  1D3B B;  1YNZ A;  3M59 A;  3LLR A;  2DL4 A;  5IHN A;  1JJ2 P;  2FO0 A;  1U1T A;  5GAO m;  1VQP Q;  2LNV A;  3UDC A;  3CCV T;  2X9H A;  1VQ9 Q;  1NLO C;  1TXQ A;  5CQX A;  3CCQ A;  1QCF A;  4MDX A;  3A8M B;  3A8O B;  3C94 A;  4KGX B;  1PG5 B;  1UEC A;  3VV0 A;  2QEX A;  4C92 E;  4QVZ A;  3I35 A;  1QVF P;  4NS5 A;  3ME9 A;  2D8H A;  3CC7 Q;  1OV3 A;  3JB9 J;  1BYM A;  2LP5 A;  3X28 B;  2ECZ A;  4DQ2 A;  2XIC A;  3CC4 T;  1KQS A;  4RKU E;  3OY9 A;  4JJB A;  4X9C A;  4A4K A;  3RNJ A;  1Y96 A;  3ZEH A;  2RHX A;  3BW1 A;  1M1F A;  1RAB B;  2V26 A;  4C92 G;  3CCJ Q;  1NBE B;  3BDU A;  2W10 A;  3PE0 A;  2ZPH B;  1LVK A;  4PLL A;  2O31 A;  2DVJ A;  4OF1 A;  4PJO B;  4X1V A;  2QQR A;  5CO7 A;  1YJN Q;  1I81 A;  1BCO A;  2YT6 A;  3JCM X;  2J6F A;  2MCN A;  1YIJ A;  3FDR A;  1FWZ A;  3M5A A;  3OS0 A;  3URG A;  1VQO A;  4JRI A;  4F04 B;  1LNX A;  2BZY A;  4PFZ A;  2A37 A;  1W70 A;  4YTL A;  1UJ0 A;  2FYK A;  5KYX B;  3OMG A;  1VQ7 Q;  1VQL Q;  3OYN A;  2VXF A;  2NUT B;  3IQL A;  4FYV B;  2L0A A;  2QGF B;  4BE0 A;  2F69 A;  2CH4 W;  3EFO A;  3X20 B;  2QAZ A;  4ZN1 A;  1WX6 A;  1H92 A;  1ACM B;  2B86 A;  3MKD A;  2CDT A;  8ATC B;  3QWY A;  1PM3 A;  3E9G A;  2PU9 B;  2CP0 A;  3OA6 A;  3HRT A;  4DA4 A;  2HQH A;  5HCK A;  4FW2 A;  3VUZ A;  3G71 A;  2QA4 Q;  2YSQ A;  3EGU A;  1U8R A;  3RMQ A;  1U06 A;  2OTJ Q;  1TSF A;  5I11 A;  1M90 U;  1PD1 A;  4Q5W A;  1N6A A;  3MEA A;  1QVG S;  3Q1J A;  1FMW A;  2BKD N;  2LJ1 A;  2QQS A;  2QI2 A;  1D0Z A;  3HP9 A;  4IKF A;  1WHL A;  1W6X A;  3UA6 A;  5GMK e;  4RCB A;  2R58 A;  2JZ2 A;  2XMF A;  2MMP A;  2VXE A;  1VIE A;  1M3B A;  1IGQ A;  3CMA Q;  2E1H A;  3VUB A;  4C8Q E;  5CKB A;  2MPX C;  2PUK B;  4GLM A;  4C92 B;  3CCV A;  1B34 B;  5GMK h;  4C5I A;  3CXC A;  3QYG B;  2PNI A;  2DF6 A;  1N9S A;  3EFS A;  4J9B A;  5C0M A;  4E47 A;  4ZNX A;  2E41 A;  5FW9 A;  2Y90 A;  2NUZ A;  3JRZ A;  1KQS P;  1BU1 A;  2J6O A;  1X75 C;  1OU9 A;  2QTX A;  2RPN A;  3I55 Q;  2PQW A;  2AZS A;  2DXU A;  4C0D B;  3FEO A;  4QT7 A;  2YRV A;  3H0F A;  3OSV A;  3RKW A;  5GAO n;  2DTO A;  4K11 A;  3CC7 T;  3T9N A;  2K5F A;  3HFN A;  3CC4 A;  1JBM A;  2COW A;  3QUI A;  2V8K A;  3CBO A;  1JJ2 S;  1M5Q 1;  4DBF A;  1KC8 U;  2JXB A;  3V7S A;  1PKS A;  3CCJ T;  1WQW A;  1VUB A;  4RMO A;  2ED0 A;  4DBH A;  2VAS A;  1Q86 C;  2G3R A;  1TU0 B;  1YJN T;  4AG1 C;  1FMV A;  3AHU A;  4M77 G;  1M2V A;  3H9N A;  4JPB W;  1SSF A;  4O5V A;  1VQ5 T;  1H3Z A;  5GAM h;  1G2B A;  3M0T A;  3HRU A;  1YJW Q;  3LH0 A;  4LDY A;  1V29 B;  3G6E Q;  4RTU A;  3SDZ A;  4EPC A;  3WXM B;  5LJ3 h;  4XU0 A;  1PWT A;  2RQW A;  1VQ7 T;  4M7D G;  2CZ0 B;  2RJE A;  2DD4 A;  1K9A A;  1Q81 U;  2RN8 A;  1WHK A;  3CCR T;  1KC8 R;  1ZLM A;  3KXT A;  2C0T A;  3MCA B;  1T3S A;  1UJY A;  4MZM A;  3MEU A;  4J6X A;  2LCC A;  2C0O A;  3OW2 S;  3PNW C;  1BIB A;  2DBM A;  4A4E A;  2GGR A;  4RTT A;  2YRC A;  4CC7 A;  3CCQ Q;  5EC7 A;  2GQV A;  2DMO A;  1YHQ T;  2EWN A;  2OTJ T;  4UC4 A;  2FL7 A;  3MEV A;  2F2X A;  2CP5 A;  2QEX Q;  2DPP B;  2ENM A;  1FYN A;  3OYF A;  1K8A U;  4LN2 A;  3L2Q A;  2KT8 A;  2DL5 A;  4C8Q B;  1Q81 R;  1M4Z A;  3VS2 A;  2RNA A;  4PJJ A;  3EGX A;  3O8V A;  3OYE A;  1M8V A;  1VQ4 Q;  2O01 E;  1K0X A;  2DFU A;  1NEB A;  2K3X A;  3CXC P;  4FYW B;  3HKS A;  4WF2 A;  4M7A E;  2RHU A;  3NGP A;  5DM7 R;  1KD1 U;  1F1B B;  2EBP A;  2M51 A;  3OYG A;  2LT4 A;  5GJV B;  1VQ6 T;  2GFU A;  1VQP A;  3EG0 A;  1PCX A;  4ZGE B;  1UTI A;  2COY A;  2HD0 A;  3RMS A;  2NUP A;  4E7L A;  4OMM A;  2I0N A;  2JM9 A;  2LQN A;  4M78 F;  4L6V 5;  1G3T A;  1WZO A;  2P0Q A;  2HQX A;  1MMN A;  1K8A R;  3JCM g;  4XU1 A;  2KYM A;  5FRO A;  5HK3 A;  1VQO Q;  1GRI A;  2JOY A;  3I55 T;  1CKA A;  2ROT A;  2SEM A;  4CC2 A;  3CBM A;  5L8R E;  3CC7 A;  1EIF A;  2DL8 A;  1D1A A;  2I2L A;  1KD1 R;  4N4G A;  3JB9 I;  1ZSG A;  1ZUY A;  4X34 A;  4WCI A;  4PJL A;  3PTA A;  4M75 E;  1U1S A;  2HL3 A;  1B3Q A;  5GAO l;  1QVG A;  5GMK m;  3J7A F;  2M1H A;  2EQM A;  3RBB B;  3CCJ A;  2CYZ B;  2DXB A;  3UF4 A;  3QYH B;  2XDD A;  4FSS A;  5LJ5 g;  3QPH A;  4FYX B;  5CIU A;  3X25 B;  1C6V X;  4KUD K;  1D1B A;  2L8D A;  1NJI U;  1WPY A;  1YJN A;  1TWB A;  1T3L A;  3G71 Q;  3TQ7 P;  2P4R A;  4GLK A;  3PFS A;  1K9M R;  3GNG A;  1Y57 A;  1EX4 A;  4RG2 A;  4XAX B;  2MWO A;  2OAW A;  3MP6 A;  3GLX A;  3UT1 A;  2K6D A;  2CUD A;  1YJW T;  5A0D A;  4BE1 A;  2FHD A;  2P0K A;  2LC4 A;  3G6E T;  2LX7 A;  1K4U S;  5GAN 7;  2K4Y A;  2VC8 A;  3EG1 A;  1VQ7 A;  1VQL A;  2LMJ A;  3MHX A;  1Q82 U;  4JLG A;  4OB0 B;  1M8M A;  4LDV A;  2CSQ A;  1ZUK A;  1XOV A;  1VQN Q;  1JXO A;  3QZ9 B;  3P8B B;  3UAT A;  4J9I A;  1NJI R;  3A8H B;  1BB9 A;  1VIF A;  3RKY A;  3OS2 A;  4C0F A;  1UGP B;  1R77 A;  5KYN A;  4JRQ A;  1YHQ A;  2YWW A;  2OTJ A;  1MMA A;  1VYV A;  4GY5 A;  4NL2 A;  4XU2 A;  2DBK A;  2YDL A;  2W0Z A;  2DL7 A;  5A2Q E;  3REA B;  4R56 A;  3HTR A;  4HCB A;  2QGG A;  4M7A B;  4FYY B;  2HMA A;  4EMK B;  2EYY A;  2KDS A;  1Q82 R;  2PZ1 A;  5DLO A;  1SF9 A;  2V1Q A;  1IGU A;  2A08 A;  4C0G A;  3V7R A;  1KJW A;  5IT9 E;  1VQ4 T;  4PL6 A;  4M78 D;  2MOX A;  1W2B A;  1TOV A;  4LUE A;  1KQ2 A;  3VKI A;  3LWH A;  3C95 A;  1X69 A;  2E65 A;  4DEY A;  3CMA A;  1VQ6 A;  1VQM Q;  1U5S A;  4B9W A;  2NYS A;  4E6R A;  2MK5 A;  2CZ7 B;  3HRS A;  3OYB A;  2J05 A;  2JT4 A;  2IPO B;  3ASK A;  3PIP A;  1W4S A;  3M53 A;  2RK2 A;  3EH2 A;  3C4S A;  1O9S A;  1WHM A;  3CPF A;  3H41 A;  3RER A;  3NPF A;  2K9G A;  3OW2 A;  4O6J A;  3OYK A;  5C6S A;  3I55 A;  1QVG P;  4M75 B;  5FRM A;  1M27 C;  2KEA A;  1UGR B;  2O4X B;  4RTZ A;  2DEU A;  2PTK A;  1BI0 A;  1GL5 A;  3M0P A;  2AZV A;  2OTL T;  3I9Q A;  1VQ8 Q;  3SWN C;  3JCM e;  3SWN A;  1LJO A;  1N8R U;  3TCJ A;  3M4Y A;  3TRE A;  2LCL A;  1WI7 A;  3MPU B;  2ZAE A;  2EQJ A;  5GAN 5;  1ZQ1 A;  2KXC A;  3E1S A;  1EZZ B;  5IXF A;  1I4K 1;  2CZ1 B;  1M1K C;  3OYH A;  2K3B A;  3JCM h;  2H3J A;  3F70 A;  2LZ6 B;  2VV5 A;  4BAC A;  4IIM A;  1YJW A;  5GJW B;  5KYY A;  4RTW A;  3G6E A;  5LJ5 e;  5EG2 A;  1G8X A;  4ANJ A;  4F16 A;  1V76 A;  1TUD A;  4J9F A;  3P8D A;  4M77 C;  5LJ5 f;  4M77 A;  2RHY A;  2EJF A;  3A5Z B;  4KT0 E;  4FM4 B;  4BY6 B;  9ATC B;  1N8R R;  1QWE A;  3EHR A;  4ELY C;  2QTV A;  5CQY A;  2LQW A;  5I2M A;  1VQN T;  3EG2 A;  5LJ5 h;  1PSE A;  4LDX A;  3JB9 D;  1JQQ A;  4M7D C;  4M7D A;  1WXB A;  2FPE A;  3JSC A;  3KFV A;  2CH4 A;  1HJD A;  1W2B P;  2DVE A;  3WVD B;  2RJF A;  4F7U E;  4KUI A;  1OPL A;  2HNI A;  1J3T A;  3LX7 A;  2YHT A;  1UGV A;  5D6X A;  2H3E B;  2QG9 B;  2MI6 A;  5GAN 3;  3INZ A;  2HBW A;  1HSQ A;  2GF7 A;  1VQ4 A;  2LRQ A;  1X2Q A;  2EGC A;  3M56 A;  2DYB A;  2AIR B;  1YJ9 Q;  2GBQ A;  3OYL A;  1IB8 A;  4F7U G; 
#chains in the Genus database with same CATH homology
 4L59 A;  2VYT A;  3FEO A;  2YRV A;  3OSV A;  4OMF B;  3RKW A;  4M78 C;  5CKE A;  1VQM T;  4M78 A;  4C8Q D;  5GAO n;  2DTO A;  5CCA A;  5GAM j;  4EMH A;  3T9N A;  1Q81 C;  3OBW A;  3CC7 T;  2KQW A;  2K5F A;  3HFN A;  4M77 B;  4C0Z A;  5FU6 C;  3CC4 A;  3OYJ A;  4LD6 A;  1JBM A;  3CCL A;  2LDM A;  4C5E A;  3QUI A;  3HL8 A;  2IVW A;  3L2V A;  2LT1 A;  2V8K A;  4XU3 A;  5LJ3 j;  3CBO A;  1JJ2 S;  4CRI A;  4HCC A;  2VGM A;  1M5Q 1;  1Q82 C;  4M7A F;  1KC8 U;  3QXE B;  2DTH A;  1YI2 A;  3V7S A;  3CCJ T;  3CCS T;  2XD0 A;  1WQW A;  1VUB A;  2X4Y A;  3X24 B;  4RMO A;  2DO3 A;  5FU7 C;  2X4W A;  1RI0 A;  3N5B B;  4BUG A;  4P5N A;  4M7D B;  1G3S A;  1Q86 C;  2G3R A;  2RHZ A;  3LW5 E;  4J6Y A;  1WGS A;  2AHJ B;  1YJN T;  1FXX A;  2F5K A;  4JDS A;  2XG8 D;  4QW2 A;  5J39 A;  4C8Q C;  1XNI A;  2RI3 A;  4C8Q A;  3AHU A;  4F7U A;  3NFC A;  4M77 G;  5CKH A;  3DLM A;  3PT9 A;  2DIQ A;  1SSF A;  3L42 A;  4O5V A;  1VQ5 T;  1H3Z A;  3OYM A;  5GAM h;  1QVP A;  1B34 A;  4X9D A;  2ZPE B;  1K8A C;  1OZ2 A;  3QJY A;  1QP2 A;  2DIG A;  3HRU A;  5GMK i;  3LH0 A;  5GAN j;  4LDY A;  1V29 B;  2DD5 A;  1VQ8 T;  3ZFJ A;  3SDZ A;  4EPC A;  3WXM B;  5LJ3 h;  4XU0 A;  1Y07 A;  4J83 A;  4A54 A;  1VQ7 T;  2PVO B;  4M7D G;  1KQS S;  4ZN3 A;  2CZ0 B;  4R55 A;  2RJE A;  2DD4 A;  3JB9 H;  1KD1 C;  2WSC E;  1Q81 U;  5GAN e;  3CCR T;  3KXT A;  3MCA B;  3E9F A;  2DAQ A;  3CCM A;  4BDZ A;  3L1A A;  2HQE A;  1H64 1;  4MZM A;  4M78 B;  3MEU A;  4PJO F;  3QSU A;  4FU6 A;  4ZTF A;  4J6X A;  2LCC A;  3HFO A;  3OW2 S;  3PNW C;  1BIB A;  4OGC A;  4M75 F;  2PVD B;  2K2V A;  3DB4 A;  5FU6 B;  4A4E A;  2V8J A;  2DKG A;  1DJ7 B;  2X35 A;  3L2W A;  3VJP A;  5GAM d;  2GQV A;  2KMT A;  3VYG A;  3GPL A;  2MF2 A;  3V8J A;  5GAN h;  3M9Q A;  5DY9 A;  2EWN A;  3VU3 C;  1YHQ T;  2OTJ T;  3JB9 G;  4LDU A;  2Y4X A;  2FL7 A;  2ZPF B;  3MEV A;  4UC4 A;  3JCM c;  1K9M C;  1K73 C;  3HSB A;  3PMI A;  2P0P A;  4FT4 A;  4A4G A;  2DPP B;  3OYC A;  2DJZ A;  2FB7 A;  2E6Z A;  3BY7 A;  5FU7 B;  5LJ3 d;  3CCU A;  3CEY A;  2OAU A;  3OYF A;  1KHI A;  1K8A U;  2HBP A;  3LGL A;  3CCQ T;  5GMK l;  2YLB A;  3L2Q A;  2IG0 A;  3GF5 A;  1VQN A;  2QA4 A;  3QKJ A;  4C8Q B;  1I5L A;  1M4Z A;  4F7U B;  4MZT A;  1M9S A;  3PMT A;  1M1K U;  3O8V A;  1JJ2 A;  1XTD A;  3OYE A;  1M8V A;  3UPU A;  1YIT T;  2O01 E;  2QEX T;  3KBG A;  4C5H A;  1KG1 A;  4Y91 A;  2C06 A;  2K3X A;  5D6Y A;  3CCE T;  3HPW A;  3CME T;  3HKS A;  3PGG A;  4JUV A;  4WF2 A;  4M7A E;  3BFM A;  2RHU A;  3MP8 A;  5DM7 R;  1KD1 U;  3GNF B;  4ZGJ B;  1IZ6 A;  5I21 A;  5J3B A;  1UEB A;  3OYG A;  1X01 A;  2E70 A;  2LT4 A;  2XK0 A;  4PKC C;  4CI0 C;  1VQ6 T;  2GFU A;  1VQP A;  3C12 A;  4ZGE B;  2EFI A;  3PIO A;  5GAN d;  4DOV A;  3OYA A;  2HD0 A;  3RMS A;  1ZHI A;  2A7Y A;  4PNO A;  3J81 E;  4E7L A;  5M9O A;  5KE2 A;  2L3R A;  2DEQ A;  3RIR A;  1S72 A;  5GAM g;  2DK3 A;  2RM4 A;  2RI5 A;  2ZPB B;  4XTY A;  2B8A A;  2LQ8 A;  4C8Q G;  2KVQ G;  4M78 F;  3QII A;  1N8R C;  3J80 E;  2KSS A;  1UB4 A;  4L6V 5;  1VQK T;  1G3T A;  1MGQ A;  1QVF A;  2QDY B;  1YCY A;  5KE3 A;  1Q7Y C;  3CCS A;  2P0Q A;  1BKB A;  3QO3 A;  1R8O B;  2HQX A;  2XDP A;  5CK9 A;  5LJ3 g;  3JCM g;  3GIB A;  1BI3 A;  4XTZ A;  3H6Z A;  2DXC A;  2P4T A;  4FL6 A;  4XTW A;  4XU1 A;  2CGH A;  4EDU A;  2ZPG B;  5FRO A;  5HK3 A;  1M1G A;  1NZ9 A;  3R6O A;  3FLG A;  4M7A D;  1YJ9 T;  4JRK A;  2JOY A;  3I55 T;  2PUO B;  3CPW S;  4V2S A;  4XQ3 A;  4QVD A;  3MET A;  3CBM A;  3OS5 A;  5L8R E;  1VQM A;  3CC2 T;  2MAM A;  3I56 T;  4IUT A;  3CC7 A;  1EIF A;  2I2L A;  2RB6 A;  2RHI A;  2WSE E;  3BDL A;  2CZ6 B;  3MEW A;  4LDW A;  3A8L B;  5AYF A;  1YIJ T;  1OI1 A;  2R5A A;  4N4G A;  5GAN 4;  3JB9 I;  4X34 A;  1D3B A;  5J26 A;  4J6W A;  4C92 D;  3UWN A;  1VQO T;  4PJO E;  4F7U F;  3JCM Q;  1NE8 A;  4OP0 A;  3GP8 A;  1RL2 A;  3NTK A;  3PTA A;  1P92 A;  4ATO A;  4M75 E;  1U1S A;  5GAO l;  3NTI A;  4ELZ C;  1QVG A;  1W2B S;  4C92 F;  3LGF A;  5GMK m;  2M1H A;  2EQM A;  3J7A F;  3GOX A;  1M90 C;  1WJR A;  4NL3 A;  4OB3 B;  3CCJ A;  2CYZ B;  2DXB A;  2M0O A;  2RI2 A;  3QYH B;  5LJ5 g;  2XDD A;  3QPH A;  5CIU A;  3X25 B;  4BE2 A;  4MDW A;  5LL6 S;  4JS4 A;  2XDB A;  1N9R A;  2EJG A;  3LYI A;  3JCM P;  4KUD K;  3CXC S;  4M7A A;  4M7A C;  3LWI A;  2X4J A;  2L8D A;  1UGS B;  1NJI U;  1WPY A;  1XQH A;  2DZC A;  3QJ6 A;  4EMK C;  1YJN A;  4EMK A;  2QQ9 A;  2CS7 A;  4GLK A;  3RES A;  1Y7X A;  2E6N A;  3PFS A;  3EAE A;  3V8L A;  4DOW A;  3DLL A;  4JS5 A;  5FRN A;  4BDY A;  2WSF E;  2XHC A;  3GNG A;  4RG2 A;  4XAX B;  2MWO A;  2RJC A;  4LD9 K;  2WAC A;  3S3M A;  3EFR A;  3S6W A;  4N0A C;  4PJO G;  4N0A A;  3MP6 A;  3JCM f;  3ER0 A;  2EIF A;  3GLX A;  2LTO A;  3M55 A;  3UT1 A;  2KY9 A;  4PJO D;  1YJW T;  4E7K A;  5A0D A;  1Y71 A;  3JCM J;  4BE1 A;  2FHD A;  1JRI A;  3OB9 A;  2P0K A;  1HXD A;  2LC4 A;  4M75 D;  2L89 A;  4IUR A;  3G6E T;  3G71 T;  1VQ8 A;  4M77 F;  2RJD A;  2JVV A;  5GAN 7;  1QW1 A;  2E5Q A;  2K4Y A;  2K5I A;  2VC8 A;  4OB1 B;  4PLI A;  4Z02 A;  3L2U A;  1VQ7 A;  1VQL A;  1G5V A;  2Y4Y A;  3MHX A;  1Q82 U;  2JN0 A;  4JLG A;  2LQK A;  2XID A;  4OB0 B;  2K3Y A;  4XK8 E;  4LDV A;  5KCH A;  5GAN 8;  4MZP A;  4HT9 A;  5HY6 A;  3X26 B;  1GXI E;  4IUU A;  5GAN 6;  5A0L A;  1Q86 U;  1XOV A;  2GCX A;  2RD1 A;  3M54 A;  1N27 A;  4QQG A;  3QZ9 B;  3SD4 A;  2R5M A;  3P8B B;  3FB9 A;  3ZBD A;  1HK9 A;  4HKE A;  1NPR A;  4M7D F;  1KHC A;  3L2Z A;  3A8H B;  3JCM b;  4BD3 A;  2EQK A;  1VIF A;  1YBY A;  4QVC A;  3RKY A;  5GAO q;  3OS2 A;  4C0F A;  1D3B B;  1UGP B;  4PJO C;  4PJO A;  3M59 A;  3P8H A;  4M75 C;  4M75 A;  3LLR A;  3QG1 A;  3G4S T;  2M16 A;  1MHN A;  4XTU A;  3CD6 T;  2K57 A;  4JRQ A;  1YHQ A;  2O4X A;  2OTJ A;  1U1T A;  4GY5 A;  5GAO m;  2A3L A;  4FT2 A;  4NL2 A;  4XU2 A;  3TEE A;  3QDR B;  5GAN 2;  4IUP A;  4II1 A;  2LNV A;  5A2Q E;  1WJS A;  5CVI A;  3UDC A;  3MP1 A;  4BI4 A;  4R56 A;  3CCV T;  4HT8 A;  4HCB A;  1TH7 A;  4M7A B;  4RG8 A;  4C5G A;  4BI3 A;  4EMK B;  2KAF A;  5CQX A;  2KDS A;  3CCQ A;  4A4H A;  3HHT B;  4MDX A;  5DLO A;  3A8M B;  3A8O B;  1KC8 C;  3C94 A;  2E12 A;  4C0G A;  3V7R A;  3OYI A;  2ZCF B;  4Y28 E;  2XU8 A;  3FC3 A;  1UGQ B;  2JTM A;  5IT9 E;  1I8F A;  1G3Y A;  4PL6 A;  4M78 D;  3VV0 A;  2QEX A;  1VQ4 T;  1YIT A;  4J5Y A;  1VQP T;  1W2B A;  3H8Z A;  2D6F A;  3CCE A;  4C92 E;  2MWP A;  4QVZ A;  4E7H A;  1VQ9 T;  1KQ2 A;  2RH2 A;  3E19 A;  5DLQ E;  3VKI A;  3DKM A;  3LWH A;  3C95 A;  4NS5 A;  4XTX A;  3ME9 A;  2DTI A;  2E10 A;  2E65 A;  3CMA A;  1VQ6 A;  3OYY A;  4B9W A;  2K5L A;  4M7A G;  1K9M U;  3JB9 J;  1BYM A;  4L5G A;  3X28 B;  3NTH A;  1K73 U;  4HA8 A;  2CZ7 B;  2XIC A;  2FVU A;  4J8O A;  4DQ2 A;  3CC4 T;  2CKK A;  3HRS A;  4E7I A;  4RKU E;  1KQS A;  2EYQ A;  3FIF A;  3OY9 A;  4J7F A;  4OGE A;  3CCL T;  4X9C A;  3OYB A;  4A4K A;  4EMG A;  3ASK A;  5A0G A;  1Y96 A;  3PIP A;  2RK1 A;  3ZEH A;  1VQK A;  1W4S A;  2RHX A;  3M53 A;  3BW1 A;  1M1F A;  2QQB A;  2RK2 A;  1YI2 T;  4C92 G;  2QQA A;  3C4S A;  3BDU A;  1O9S A;  3CPF A;  2ZPH B;  2RO0 A;  3RER A;  1OZ3 A;  4PLL A;  3OW2 A;  4TVR A;  4OF1 A;  2M9U A;  4M77 E;  4PJO B;  4O6J A;  4BY6 C;  4ME7 A;  4C8Q F;  2QQR A;  3OYK A;  3OBY A;  5CO7 A;  5C6S A;  1YJ9 A;  3I55 A;  4NOY A;  2V8I A;  1O75 A;  4M75 B;  1I81 A;  2RA2 A;  5FRM A;  5CAI A;  3DB3 A;  1UGR B;  2O4X B;  5GAO p;  5GAN g;  3VYH B;  3JAM E;  3CC2 A;  5IAY A;  3JCM X;  3I56 A;  5GAM e;  3V8K A;  3QBY A;  1YIJ A;  1ZBX A;  5HKC A;  3FDR A;  1FWZ A;  2QXF A;  1BI0 A;  2BUD A;  3M5A A;  3OMC A;  5D6W A;  3URG A;  3WVE B;  4D6W A;  3OS0 A;  4IUV A;  1VQO A;  5GAM f;  4M7D E;  2OTL T;  4JRI A;  2VGN A;  5LJ3 e;  3SWN C;  3JCM e;  3SWN A;  1LNX A;  3L2R A;  1LJO A;  2JUF A;  1N8R U;  4YTL A;  4XTV A;  3TCJ A;  2D9T A;  2FYK A;  3M4Y A;  3TRE A;  5KH6 A;  3OMG A;  2HAX A;  1VQ5 A;  2R57 A;  1BI2 A;  2LCL A;  1Q7Y U;  5LJ3 f;  3OYN A;  4C92 C;  2VXF A;  4RCC A;  4C92 A;  4M75 G;  2KK4 A;  4M77 D;  2EQJ A;  5GAN 5;  4BE0 A;  2F69 A;  1ZQ1 A;  5I2S A;  4N4I A;  2F5T X;  3G7Z A;  4KUL A;  1QVF S;  3E1S A;  1KQ1 A;  1WJQ A;  2ZPI B;  2X4X A;  3X20 B;  5LJ5 f;  3CCM T;  4ZN1 A;  1JB0 E;  2DZ9 A;  1I4K 1;  2CZ1 B;  2LX9 A;  5LJ5 j;  1M1K C;  3CBP A;  3OYH A;  3M4G A;  3JCM h;  2VUB A;  4FIB A;  1OYX A;  5CKF A;  1VQL T;  1QP3 A;  3E9G A;  2OTL A;  2H3J A;  2PU9 B;  4KBM B;  3F70 A;  3OA6 A;  2VV5 A;  3HRT A;  3CCR A;  4DA4 A;  3S3O A;  4VUB A;  4BAC A;  4ZTJ A;  3OS1 A;  1YJW A;  4M7D D;  3VUZ A;  4JLI A;  3S3N A;  4C0D C;  3G71 A;  3G6E A;  1Y96 B;  1X6O A;  4ZGD B;  1IRE B;  5EG2 A;  5LJ5 e;  1U8R A;  3RMQ A;  4QQ6 A;  3MO8 A;  2BIV A;  2EKO A;  3SB2 A;  4JJN K;  5GAN f;  5CKD A;  4M78 E;  2ZZD A;  5GMK j;  1M90 U;  3P8D A;  4M77 C;  3FRN A;  4M77 A;  3QHS A;  4OVA A;  3RUX A;  2RHY A;  2EJF A;  2JTF A;  3A5Z B;  3FJP A;  4Q5W A;  4KT0 E;  3CCU T;  2XI9 A;  1LOJ A;  1N6A A;  2DXT A;  4FM4 B;  4BY6 B;  3MEA A;  4ELY C;  2ZGW A;  3Q1J A;  1QVG S;  2BKD N;  3M57 A;  3OSS C;  2QQS A;  5CQY A;  2QI2 A;  1BIA A;  1WQ7 A;  5I2M A;  5IN1 A;  1VQN T;  3HP9 A;  2QA4 T;  3QZ5 B;  4QQD A;  3SFM A;  3CPW A;  4IKF A;  3RKX A;  1WNL A;  4FSX A;  4MMK A;  5GMK e;  3TU4 K;  4RCB A;  3V7C A;  5LJ5 h;  1PSE A;  2GFA A;  2R58 A;  1G3W A;  2YLC A;  4A53 A;  4LDX A;  2NLU A;  3JB9 D;  3A8G B;  4M7D C;  4M7D A;  3JCM d;  2EQU A;  2JZ2 A;  2VXE A;  2MMP A;  3G4S A;  2PVG B;  3OQ5 A;  4N4H A;  4JRP A;  1VIE A;  5HK0 A;  3JSC A;  3JB9 F;  3SWN B;  3CD6 A;  4M78 G;  3KUF A;  2E1H A;  3VUB A;  2EJ9 A;  2DVE A;  3WVD B;  4BB7 A;  1FX7 A;  5CKB A;  2JNG A;  2RJF A;  4C8Q E;  2XKO C;  4OB2 B;  4F7U E;  4B9X A;  1PSF A;  4IUQ A;  2PUK B;  4KUI A;  4C92 B;  3CCV A;  2L5Q A;  3CME A;  1B34 B;  5GMK h;  4J7I A;  2HNI A;  3M58 A;  2EAY A;  2E64 A;  3JCM V;  1S72 T;  5GAO r;  4C5I A;  4A4F A;  1NPP A;  3LX7 A;  3CXC A;  1BI1 A;  2YHT A;  3QYG B;  5D6X A;  4BI8 B;  1N9S A;  3EFS A;  2MI6 A;  5C0M A;  4E47 A;  5GAN 3;  2E41 A;  3INZ A;  3CMA T;  2Y90 A;  5FLX E;  3JRZ A;  2GF7 A;  4HCZ A;  1VQ4 A;  2LRQ A;  2D0Q B;  1NJI C;  3M56 A;  1X75 C;  3JCM W;  1VQ9 A;  4E7J A;  2QTX A;  5LJ5 d;  4MML A;  5KCO A;  5CR2 A;  3OYL A;  2PQW A;  2DXU A;  2LVM A;  4C0D B;  4F7U G;  1AHJ B;  3OYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...