1NEAA

Three-dimensional solution structure of a curaremimetic toxin from naja nigricollis venom: a proton nmr and molecular modeling study
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIN ALPHA
publication title Three-dimensional solution structure of a curaremimetic toxin from Naja nigricollis venom: a proton NMR and molecular modeling study.
pubmed doi rcsb
source organism Naja nigricollis
molecule tags Toxin
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1neaA00
1FFJA 1NYUA 2BHIA 1QKEA 1LXGA 1XT3A 4AEAA 2JQPA 1KL8A 4FAOE 5EBXA 1IKCA 3PLCA 1G6MA 1ABTA 1FSSB 1IDIA 4IYEA 5IMYC 1FF4A 1NTNA 2FD6U 5DZ5A 1HC9B 2UWRA 1ERGA 2MJYA 1ES7B 1JBDA 1KBSA 3KFDI 1IQ9A 4FAOC 1CB9A 1FSCA 2H5FA 4ZQYA 1CTXA 1H0JA 1BXPA 2OFSA 1COEA 1DRSA 1QKDA 2L5SA 1LXHA 4OM5A 3NEQA 2QJ9C 1M9ZA 2J8BA 3ERAA 2QJBC 1REWC 1LJZA 1F94A 2QC1A 1ZADA 2CDXA 2HLQA 1YWHA 1CREA 1TFSA 1W6BA 2CTXA 1I02A 1S4YA 4QTIU 4OM4A 2MUPA 5IMTD 2H7ZA 2BTXA 2MUOA 4BIKB 2H62D 1NORA 3BT1U 1CXOA 3LAQU 1IDGA 2LCRA 3U73U 3U74U 1KFHA 2UX2A 3FEVA 4BDTB 1IDLA 1CODA 1KS6A 1QM7A 1TXAA 2H8UA 3QB4B 4LFTA 1V6PA 4DO8A 1KC4A 4UY2C 2H7ZB 2ERAA 1ERAA 1IK8A 2N99A 1KBAA 4HQPF 1LX5B 1PLOA 3EBXA 4XJJA 1RL5A 1KXIA 3VTSA 1BTEA 1CDTA 2H64C 1IDHA 2CRSA 5DU1A 6EBXA 1CCQA 1F8UB 2NBTA 3HH7A 1TXBA 2MJ0A 2JVEA 1CRFA 1UG4A 3KFDE 2H62C 2HLRA 4EY8B 1LSIA 2X8BB 1CDRA 1ONJA 1HAAA 1MAHF 2LA1A 3EVSC 3NDSA 2QJAC 1CDQA 2H64B 1CXNA 2GOOB 1FASA 2MHYA 4P7UA 1JE9A 2L03A 1CVOA 1CHVS 2MFAA 1CDSA 1VB0A 1JGKA 2CRTA 2VLWA 3NH7A 1KBTA 2PJYC 1KU6B 1NYSA 1NTXA 1NXBA 1HAJA 1FRAA 2ABXA 2GOOC 1MR6A 3BT2U 1KTZB 1B41B 2I9BE 1HC9A 1L4WA 1NEAA 1RGJA 2CCXA 2PJYB 2MJ4A 4RUDA 2K3GA 1IJCA 1TGXA 5DO6A 1HOYA
chains in the Genus database with same CATH superfamily
1FFJA 1NYUA 2BHIA 1QKEA 1LXGA 4KSNA 1XT3A 4AEAA 2JQPA 1KL8A 4FAOE 5EBXA 1IKCA 3PLCA 1G6MA 1ABTA 1FSSB 1IDIA 4IYEA 5IMYC 1FF4A 1NTNA 2FD6U 5DZ5A 1HC9B 2UWRA 1ERGA 2MJYA 1ES7B 1JBDA 1KBSA 3KFDI 1IQ9A 4FAOC 1CB9A 1FSCA 2H5FA 4ZQYA 1CTXA 1H0JA 1BXPA 2OFSA 1COEA 1DRSA 1QKDA 2L5SA 1LXHA 4OM5A 3NEQA 2QJ9C 1M9ZA 2J8BA 3ERAA 2QJBC 1REWC 1LJZA 1F94A 2QC1A 1ZADA 2CDXA 2HLQA 1YWHA 1CREA 1TFSA 1W6BA 2CTXA 1I02A 1S4YA 4QTIU 4OM4A 2MUPA 5IMTD 2H7ZA 2BTXA 2MUOA 4BIKB 2H62D 1NORA 3BT1U 1CXOA 3LAQU 1IDGA 2LCRA 3U73U 3U74U 1KFHA 2UX2A 3FEVA 4BDTB 1IDLA 1CODA 1KS6A 1QM7A 1TXAA 2H8UA 3QB4B 4LFTA 1V6PA 4DO8A 1KC4A 4UY2C 2H7ZB 2ERAA 1ERAA 1IK8A 2N99A 1KBAA 4HQPF 1LX5B 1PLOA 3EBXA 4XJJA 1RL5A 1KXIA 3VTSA 1BTEA 1CDTA 2H64C 1IDHA 2CRSA 5DU1A 6EBXA 1CCQA 1F8UB 2NBTA 3HH7A 1TXBA 2MJ0A 2JVEA 1CRFA 1UG4A 3KFDE 2H62C 2HLRA 4EY8B 1LSIA 2X8BB 1CDRA 1ONJA 1HAAA 1MAHF 2LA1A 3EVSC 3NDSA 2QJAC 1CDQA 2H64B 1CXNA 2GOOB 1FASA 2MHYA 4P7UA 1JE9A 2L03A 1CVOA 1CHVS 2MFAA 1CDSA 1VB0A 1JGKA 2CRTA 2VLWA 3NH7A 1KBTA 2PJYC 1KU6B 1NYSA 1NTXA 1NXBA 1HAJA 1FRAA 2ABXA 2GOOC 1MR6A 3BT2U 1KTZB 1B41B 2I9BE 1HC9A 1L4WA 1NEAA 1RGJA 2CCXA 2PJYB 2MJ4A 4RUDA 2K3GA 1IJCA 1TGXA 5DO6A 1HOYA
chains in the Genus database with same CATH topology
1FFJA 1NYUA 2BHIA 1QKEA 1LXGA 4KSNA 1XT3A 4AEAA 2JQPA 1KL8A 4FAOE 5EBXA 1IKCA 3PLCA 1G6MA 1ABTA 1FSSB 1IDIA 4IYEA 5IMYC 1FF4A 1NTNA 2FD6U 5DZ5A 1HC9B 2UWRA 1ERGA 2MJYA 1ES7B 1JBDA 1KBSA 3KFDI 1IQ9A 4FAOC 1CB9A 1FSCA 2H5FA 4ZQYA 1CTXA 1H0JA 1BXPA 2OFSA 1COEA 1DRSA 1QKDA 2L5SA 1LXHA 4OM5A 3NEQA 2QJ9C 1M9ZA 2J8BA 3ERAA 2QJBC 1REWC 1LJZA 1F94A 2QC1A 1ZADA 2CDXA 2HLQA 1YWHA 1CREA 1TFSA 1W6BA 2CTXA 1I02A 1S4YA 4QTIU 4OM4A 2MUPA 5IMTD 2H7ZA 2BTXA 2MUOA 4BIKB 2H62D 1NORA 3BT1U 1CXOA 3LAQU 1IDGA 2LCRA 3U73U 3U74U 1KFHA 2UX2A 3FEVA 4BDTB 1IDLA 1CODA 1KS6A 1QM7A 1TXAA 2H8UA 3QB4B 4LFTA 1V6PA 4DO8A 1KC4A 4UY2C 2H7ZB 2ERAA 1ERAA 1IK8A 2N99A 1KBAA 4HQPF 1LX5B 1PLOA 3EBXA 4XJJA 1RL5A 1KXIA 3VTSA 1BTEA 1CDTA 2H64C 1IDHA 2CRSA 5DU1A 6EBXA 1CCQA 1F8UB 2NBTA 3HH7A 1TXBA 2MJ0A 2JVEA 1CRFA 1UG4A 3KFDE 2H62C 2HLRA 4EY8B 1LSIA 2X8BB 1CDRA 1ONJA 1HAAA 1MAHF 2LA1A 3EVSC 3NDSA 2QJAC 1CDQA 2H64B 1CXNA 2GOOB 1FASA 2MHYA 4P7UA 1JE9A 2L03A 1CVOA 1CHVS 2MFAA 1CDSA 1VB0A 1JGKA 2CRTA 2VLWA 3NH7A 1KBTA 2PJYC 1KU6B 1NYSA 1NTXA 1NXBA 1HAJA 1FRAA 2ABXA 2GOOC 1MR6A 3BT2U 1KTZB 1B41B 2I9BE 1HC9A 1L4WA 1NEAA 1RGJA 2CCXA 2PJYB 2MJ4A 4RUDA 2K3GA 1IJCA 1TGXA 5DO6A 1HOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFJ A;  1NYU A;  2BHI A;  1QKE A;  1LXG A;  1XT3 A;  4AEA A;  2JQP A;  1KL8 A;  4FAO E;  5EBX A;  1IKC A;  3PLC A;  1G6M A;  1ABT A;  1FSS B;  1IDI A;  4IYE A;  5IMY C;  1FF4 A;  1NTN A;  2FD6 U;  5DZ5 A;  1HC9 B;  2UWR A;  1ERG A;  2MJY A;  1ES7 B;  1JBD A;  1KBS A;  3KFD I;  1IQ9 A;  4FAO C;  1CB9 A;  1FSC A;  2H5F A;  4ZQY A;  1CTX A;  1H0J A;  1BXP A;  2OFS A;  1COE A;  1DRS A;  1QKD A;  2L5S A;  1LXH A;  4OM5 A;  3NEQ A;  2QJ9 C;  1M9Z A;  2J8B A;  3ERA A;  2QJB C;  1REW C;  1LJZ A;  1F94 A;  2QC1 A;  1ZAD A;  2CDX A;  2HLQ A;  1YWH A;  1CRE A;  1TFS A;  1W6B A;  2CTX A;  1I02 A;  1S4Y A;  4QTI U;  4OM4 A;  2MUP A;  5IMT D;  2H7Z A;  2BTX A;  2MUO A;  4BIK B;  2H62 D;  1NOR A;  3BT1 U;  1CXO A;  3LAQ U;  1IDG A;  2LCR A;  3U73 U;  3U74 U;  1KFH A;  2UX2 A;  3FEV A;  4BDT B;  1IDL A;  1COD A;  1KS6 A;  1QM7 A;  1TXA A;  2H8U A;  3QB4 B;  4LFT A;  1V6P A;  4DO8 A;  1KC4 A;  4UY2 C;  2H7Z B;  2ERA A;  1ERA A;  1IK8 A;  2N99 A;  1KBA A;  4HQP F;  1LX5 B;  1PLO A;  3EBX A;  4XJJ A;  1RL5 A;  1KXI A;  3VTS A;  1BTE A;  1CDT A;  2H64 C;  1IDH A;  2CRS A;  5DU1 A;  6EBX A;  1CCQ A;  1F8U B;  2NBT A;  3HH7 A;  1TXB A;  2MJ0 A;  2JVE A;  1CRF A;  1UG4 A;  3KFD E;  2H62 C;  2HLR A;  4EY8 B;  1LSI A;  2X8B B;  1CDR A;  1ONJ A;  1HAA A;  1MAH F;  2LA1 A;  3EVS C;  3NDS A;  2QJA C;  1CDQ A;  2H64 B;  1CXN A;  2GOO B;  1FAS A;  2MHY A;  4P7U A;  1JE9 A;  2L03 A;  1CVO A;  1CHV S;  2MFA A;  1CDS A;  1VB0 A;  1JGK A;  2CRT A;  2VLW A;  3NH7 A;  1KBT A;  2PJY C;  1KU6 B;  1NYS A;  1NTX A;  1NXB A;  1HAJ A;  1FRA A;  2ABX A;  2GOO C;  1MR6 A;  3BT2 U;  1KTZ B;  1B41 B;  2I9B E;  1HC9 A;  1L4W A;  1NEA A;  1RGJ A;  2CCX A;  2PJY B;  2MJ4 A;  4RUD A;  2K3G A;  1IJC A;  1TGX A;  5DO6 A;  1HOY A; 
#chains in the Genus database with same CATH topology
 1FFJ A;  1NYU A;  2BHI A;  1QKE A;  1LXG A;  4KSN A;  1XT3 A;  4AEA A;  2JQP A;  1KL8 A;  4FAO E;  5EBX A;  1IKC A;  3PLC A;  1G6M A;  1ABT A;  1FSS B;  1IDI A;  4IYE A;  5IMY C;  1FF4 A;  1NTN A;  2FD6 U;  5DZ5 A;  1HC9 B;  2UWR A;  1ERG A;  2MJY A;  1ES7 B;  1JBD A;  1KBS A;  3KFD I;  1IQ9 A;  4FAO C;  1CB9 A;  1FSC A;  2H5F A;  4ZQY A;  1CTX A;  1H0J A;  1BXP A;  2OFS A;  1COE A;  1DRS A;  1QKD A;  2L5S A;  1LXH A;  4OM5 A;  3NEQ A;  2QJ9 C;  1M9Z A;  2J8B A;  3ERA A;  2QJB C;  1REW C;  1LJZ A;  1F94 A;  2QC1 A;  1ZAD A;  2CDX A;  2HLQ A;  1YWH A;  1CRE A;  1TFS A;  1W6B A;  2CTX A;  1I02 A;  1S4Y A;  4QTI U;  4OM4 A;  2MUP A;  5IMT D;  2H7Z A;  2BTX A;  2MUO A;  4BIK B;  2H62 D;  1NOR A;  3BT1 U;  1CXO A;  3LAQ U;  1IDG A;  2LCR A;  3U73 U;  3U74 U;  1KFH A;  2UX2 A;  3FEV A;  4BDT B;  1IDL A;  1COD A;  1KS6 A;  1QM7 A;  1TXA A;  2H8U A;  3QB4 B;  4LFT A;  1V6P A;  4DO8 A;  1KC4 A;  4UY2 C;  2H7Z B;  2ERA A;  1ERA A;  1IK8 A;  2N99 A;  1KBA A;  4HQP F;  1LX5 B;  1PLO A;  3EBX A;  4XJJ A;  1RL5 A;  1KXI A;  3VTS A;  1BTE A;  1CDT A;  2H64 C;  1IDH A;  2CRS A;  5DU1 A;  6EBX A;  1CCQ A;  1F8U B;  2NBT A;  3HH7 A;  1TXB A;  2MJ0 A;  2JVE A;  1CRF A;  1UG4 A;  3KFD E;  2H62 C;  2HLR A;  4EY8 B;  1LSI A;  2X8B B;  1CDR A;  1ONJ A;  1HAA A;  1MAH F;  2LA1 A;  3EVS C;  3NDS A;  2QJA C;  1CDQ A;  2H64 B;  1CXN A;  2GOO B;  1FAS A;  2MHY A;  4P7U A;  1JE9 A;  2L03 A;  1CVO A;  1CHV S;  2MFA A;  1CDS A;  1VB0 A;  1JGK A;  2CRT A;  2VLW A;  3NH7 A;  1KBT A;  2PJY C;  1KU6 B;  1NYS A;  1NTX A;  1NXB A;  1HAJ A;  1FRA A;  2ABX A;  2GOO C;  1MR6 A;  3BT2 U;  1KTZ B;  1B41 B;  2I9B E;  1HC9 A;  1L4W A;  1NEA A;  1RGJ A;  2CCX A;  2PJY B;  2MJ4 A;  4RUD A;  2K3G A;  1IJC A;  1TGX A;  5DO6 A;  1HOY A; 
#chains in the Genus database with same CATH homology
 1FFJ A;  1NYU A;  2BHI A;  1QKE A;  1LXG A;  4KSN A;  1XT3 A;  4AEA A;  2JQP A;  1KL8 A;  4FAO E;  5EBX A;  1IKC A;  3PLC A;  1G6M A;  1ABT A;  1FSS B;  1IDI A;  4IYE A;  5IMY C;  1FF4 A;  1NTN A;  2FD6 U;  5DZ5 A;  1HC9 B;  2UWR A;  1ERG A;  2MJY A;  1ES7 B;  1JBD A;  1KBS A;  3KFD I;  1IQ9 A;  4FAO C;  1CB9 A;  1FSC A;  2H5F A;  4ZQY A;  1CTX A;  1H0J A;  1BXP A;  2OFS A;  1COE A;  1DRS A;  1QKD A;  2L5S A;  1LXH A;  4OM5 A;  3NEQ A;  2QJ9 C;  1M9Z A;  2J8B A;  3ERA A;  2QJB C;  1REW C;  1LJZ A;  1F94 A;  2QC1 A;  1ZAD A;  2CDX A;  2HLQ A;  1YWH A;  1CRE A;  1TFS A;  1W6B A;  2CTX A;  1I02 A;  1S4Y A;  4QTI U;  4OM4 A;  2MUP A;  5IMT D;  2H7Z A;  2BTX A;  2MUO A;  4BIK B;  2H62 D;  1NOR A;  3BT1 U;  1CXO A;  3LAQ U;  1IDG A;  2LCR A;  3U73 U;  3U74 U;  1KFH A;  2UX2 A;  3FEV A;  4BDT B;  1IDL A;  1COD A;  1KS6 A;  1QM7 A;  1TXA A;  2H8U A;  3QB4 B;  4LFT A;  1V6P A;  4DO8 A;  1KC4 A;  4UY2 C;  2H7Z B;  2ERA A;  1ERA A;  1IK8 A;  2N99 A;  1KBA A;  4HQP F;  1LX5 B;  1PLO A;  3EBX A;  4XJJ A;  1RL5 A;  1KXI A;  3VTS A;  1BTE A;  1CDT A;  2H64 C;  1IDH A;  2CRS A;  5DU1 A;  6EBX A;  1CCQ A;  1F8U B;  2NBT A;  3HH7 A;  1TXB A;  2MJ0 A;  2JVE A;  1CRF A;  1UG4 A;  3KFD E;  2H62 C;  2HLR A;  4EY8 B;  1LSI A;  2X8B B;  1CDR A;  1ONJ A;  1HAA A;  1MAH F;  2LA1 A;  3EVS C;  3NDS A;  2QJA C;  1CDQ A;  2H64 B;  1CXN A;  2GOO B;  1FAS A;  2MHY A;  4P7U A;  1JE9 A;  2L03 A;  1CVO A;  1CHV S;  2MFA A;  1CDS A;  1VB0 A;  1JGK A;  2CRT A;  2VLW A;  3NH7 A;  1KBT A;  2PJY C;  1KU6 B;  1NYS A;  1NTX A;  1NXB A;  1HAJ A;  1FRA A;  2ABX A;  2GOO C;  1MR6 A;  3BT2 U;  1KTZ B;  1B41 B;  2I9B E;  1HC9 A;  1L4W A;  1NEA A;  1RGJ A;  2CCX A;  2PJY B;  2MJ4 A;  4RUD A;  2K3G A;  1IJC A;  1TGX A;  5DO6 A;  1HOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...