1NEAA

Three-dimensional solution structure of a curaremimetic toxin from naja nigricollis venom: a proton nmr and molecular modeling study
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
61
structure length
61
Chain Sequence
b'LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of a curaremimetic toxin from Naja nigricollis venom: a proton NMR and molecular modeling study.
pubmed doi rcsb
molecule keywords TOXIN ALPHA
source organism Naja nigricollis
molecule tags Toxin
total genus 3
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1neaA00
2H62D 2MUOA 1BXPA 3NH7A 1F8UB 3HH7A 2NBTA 5DU1A 1KBAA 3BT1U 1HC9A 2CRSA 1IDHA 3QB4B 1HAAA 1MAHF 1KFHA 1CXOA 1ES7B 3NDSA 3BT2U 2PJYB 1TXBA 1JBDA 1ERAA 4BIKB 1NTXA 1RL5A 2J8BA 1LXHA 1NEAA 2BHIA 3EVSC 1CVOA 1KS6A 1ONJA 1HAJA 1LXGA 5DO6A 2ABXA 2FD6U 1B41B 1TGXA 2GOOC 3FEVA 1CXNA 1KU6B 3LAQU 2H7ZB 4LFTA 4EY8B 1FASA 1ERGA 1MR6A 2QC1A 1TXAA 3KFDI 2CDXA 1CDTA 4RUDA 1ABTA 2QJ9C 2CCXA 1IK8A 4ZQYA 1KXIA 2H64B 2JVEA 2MJYA 1W6BA 2PJYC 1VB0A 1KTZB 2QJAC 3NEQA 4OM5A 1QKEA 4AEAA 2CRTA 1NXBA 1KL8A 1CRFA 1LX5B 3EBXA 3U73U 1HC9B 1CDQA 4FAOC 1LSIA 1FFJA 2UWRA 2X8BB 2L03A 4XJJA 1DRSA 2I9BE 1CODA 5DZ5A 2K3GA 1QKDA 1FRAA 1FSCA 1FF4A 1JGKA 1H0JA 2HLQA 3U74U 1KBTA 1NYUA 1COEA 1I02A 2UX2A 4BDTB 1REWC 4UY2C 4DO8A 2H64C 6EBXA 1ZADA 1XT3A 5IMTD 1IQ9A 1YWHA 2H62C 5EBXA 1V6PA 1L4WA 1IDLA 1BTEA 3KFDE 2L5SA 1G6MA 1RGJA 1CB9A 2MUPA 4IYEA 2MJ4A 1IJCA 1HOYA 2LCRA 2CTXA 1KBSA 2OFSA 4QTIU 3VTSA 1NTNA 1CREA 1PLOA 2H8UA 2MFAA 1CHVS 4OM4A 2MHYA 1CCQA 1F94A 2H5FA 1NYSA 1KC4A 1FSSB 2ERAA 3ERAA 2HLRA 2MJ0A 1IDIA 2JQPA 2N99A 2QJBC 1CTXA 2LA1A 1UG4A 5IMYC 4P7UA 2BTXA 4HQPF 4FAOE 1NORA 2H7ZA 1M9ZA 1QM7A 1S4YA 1LJZA 1IKCA 2VLWA 3PLCA 2GOOB 1CDRA 1IDGA 1JE9A 1TFSA 1CDSA
chains in the Genus database with same CATH superfamily
2H62D 2MUOA 1BXPA 3NH7A 1F8UB 3HH7A 2NBTA 5DU1A 1KBAA 3BT1U 1HC9A 2CRSA 1IDHA 3QB4B 1HAAA 1MAHF 1KFHA 1CXOA 1ES7B 3NDSA 3BT2U 2PJYB 1TXBA 1JBDA 1ERAA 4BIKB 1NTXA 1RL5A 2J8BA 1LXHA 1NEAA 2BHIA 3EVSC 1CVOA 1KS6A 1ONJA 1HAJA 4KSNA 1LXGA 5DO6A 2ABXA 2FD6U 1B41B 1TGXA 2GOOC 3FEVA 1CXNA 1KU6B 3LAQU 2H7ZB 4LFTA 4EY8B 1FASA 1ERGA 1MR6A 2QC1A 1TXAA 3KFDI 2CDXA 1CDTA 4RUDA 1ABTA 2QJ9C 2CCXA 1IK8A 4ZQYA 1KXIA 2H64B 2JVEA 2MJYA 1W6BA 2PJYC 1VB0A 1KTZB 2QJAC 3NEQA 4OM5A 1QKEA 4AEAA 2CRTA 1NXBA 1KL8A 1CRFA 1LX5B 3EBXA 3U73U 1HC9B 1CDQA 4FAOC 1LSIA 1FFJA 2UWRA 2X8BB 2L03A 4XJJA 1DRSA 2I9BE 1CODA 5DZ5A 2K3GA 1QKDA 1FRAA 1FSCA 1FF4A 1JGKA 1H0JA 2HLQA 3U74U 1KBTA 1NYUA 1COEA 1I02A 2UX2A 4BDTB 1REWC 4UY2C 4DO8A 2H64C 6EBXA 1ZADA 1XT3A 5IMTD 1IQ9A 1YWHA 2H62C 5EBXA 1V6PA 1L4WA 1IDLA 1BTEA 3KFDE 2L5SA 1G6MA 1RGJA 1CB9A 2MUPA 4IYEA 2MJ4A 1IJCA 1HOYA 2LCRA 2CTXA 1KBSA 2OFSA 4QTIU 3VTSA 1NTNA 1CREA 1PLOA 2H8UA 2MFAA 1CHVS 4OM4A 2MHYA 1CCQA 1F94A 2H5FA 1NYSA 1KC4A 1FSSB 2ERAA 3ERAA 2HLRA 2MJ0A 1IDIA 2JQPA 2N99A 2QJBC 1CTXA 2LA1A 1UG4A 5IMYC 4P7UA 2BTXA 4HQPF 4FAOE 1NORA 2H7ZA 1M9ZA 1QM7A 1S4YA 1LJZA 1IKCA 2VLWA 3PLCA 2GOOB 1CDRA 1IDGA 1JE9A 1TFSA 1CDSA
chains in the Genus database with same CATH topology
2H62D 2MUOA 1BXPA 3NH7A 1F8UB 3HH7A 2NBTA 5DU1A 1KBAA 3BT1U 1HC9A 2CRSA 1IDHA 3QB4B 1HAAA 1MAHF 1KFHA 1CXOA 1ES7B 3NDSA 3BT2U 2PJYB 1TXBA 1JBDA 1ERAA 4BIKB 1NTXA 1RL5A 2J8BA 1LXHA 1NEAA 2BHIA 3EVSC 1CVOA 1KS6A 1ONJA 1HAJA 4KSNA 1LXGA 5DO6A 2ABXA 2FD6U 1B41B 1TGXA 2GOOC 3FEVA 1CXNA 1KU6B 3LAQU 2H7ZB 4LFTA 4EY8B 1FASA 1ERGA 1MR6A 2QC1A 1TXAA 3KFDI 2CDXA 1CDTA 4RUDA 1ABTA 2QJ9C 2CCXA 1IK8A 4ZQYA 1KXIA 2H64B 2JVEA 2MJYA 1W6BA 2PJYC 1VB0A 1KTZB 2QJAC 3NEQA 4OM5A 1QKEA 4AEAA 2CRTA 1NXBA 1KL8A 1CRFA 1LX5B 3EBXA 3U73U 1HC9B 1CDQA 4FAOC 1LSIA 1FFJA 2UWRA 2X8BB 2L03A 4XJJA 1DRSA 2I9BE 1CODA 5DZ5A 2K3GA 1QKDA 1FRAA 1FSCA 1FF4A 1JGKA 1H0JA 2HLQA 3U74U 1KBTA 1NYUA 1COEA 1I02A 2UX2A 4BDTB 1REWC 4UY2C 4DO8A 2H64C 6EBXA 1ZADA 1XT3A 5IMTD 1IQ9A 1YWHA 2H62C 5EBXA 1V6PA 1L4WA 1IDLA 1BTEA 3KFDE 2L5SA 1G6MA 1RGJA 1CB9A 2MUPA 4IYEA 2MJ4A 1IJCA 1HOYA 2LCRA 2CTXA 1KBSA 2OFSA 4QTIU 3VTSA 1NTNA 1CREA 1PLOA 2H8UA 2MFAA 1CHVS 4OM4A 2MHYA 1CCQA 1F94A 2H5FA 1NYSA 1KC4A 1FSSB 2ERAA 3ERAA 2HLRA 2MJ0A 1IDIA 2JQPA 2N99A 2QJBC 1CTXA 2LA1A 1UG4A 5IMYC 4P7UA 2BTXA 4HQPF 4FAOE 1NORA 2H7ZA 1M9ZA 1QM7A 1S4YA 1LJZA 1IKCA 2VLWA 3PLCA 2GOOB 1CDRA 1IDGA 1JE9A 1TFSA 1CDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H62 D;  2MUO A;  1BXP A;  3NH7 A;  1F8U B;  3HH7 A;  2NBT A;  5DU1 A;  1KBA A;  3BT1 U;  1HC9 A;  2CRS A;  1IDH A;  3QB4 B;  1HAA A;  1MAH F;  1KFH A;  1CXO A;  1ES7 B;  3NDS A;  3BT2 U;  2PJY B;  1TXB A;  1JBD A;  1ERA A;  4BIK B;  1NTX A;  1RL5 A;  2J8B A;  1LXH A;  1NEA A;  2BHI A;  3EVS C;  1CVO A;  1KS6 A;  1ONJ A;  1HAJ A;  1LXG A;  5DO6 A;  2ABX A;  2FD6 U;  1B41 B;  1TGX A;  2GOO C;  3FEV A;  1CXN A;  1KU6 B;  3LAQ U;  2H7Z B;  4LFT A;  4EY8 B;  1FAS A;  1ERG A;  1MR6 A;  2QC1 A;  1TXA A;  3KFD I;  2CDX A;  1CDT A;  4RUD A;  1ABT A;  2QJ9 C;  2CCX A;  1IK8 A;  4ZQY A;  1KXI A;  2H64 B;  2JVE A;  2MJY A;  1W6B A;  2PJY C;  1VB0 A;  1KTZ B;  2QJA C;  3NEQ A;  4OM5 A;  1QKE A;  4AEA A;  2CRT A;  1NXB A;  1KL8 A;  1CRF A;  1LX5 B;  3EBX A;  3U73 U;  1HC9 B;  1CDQ A;  4FAO C;  1LSI A;  1FFJ A;  2UWR A;  2X8B B;  2L03 A;  4XJJ A;  1DRS A;  2I9B E;  1COD A;  5DZ5 A;  2K3G A;  1QKD A;  1FRA A;  1FSC A;  1FF4 A;  1JGK A;  1H0J A;  2HLQ A;  3U74 U;  1KBT A;  1NYU A;  1COE A;  1I02 A;  2UX2 A;  4BDT B;  1REW C;  4UY2 C;  4DO8 A;  2H64 C;  6EBX A;  1ZAD A;  1XT3 A;  5IMT D;  1IQ9 A;  1YWH A;  2H62 C;  5EBX A;  1V6P A;  1L4W A;  1IDL A;  1BTE A;  3KFD E;  2L5S A;  1G6M A;  1RGJ A;  1CB9 A;  2MUP A;  4IYE A;  2MJ4 A;  1IJC A;  1HOY A;  2LCR A;  2CTX A;  1KBS A;  2OFS A;  4QTI U;  3VTS A;  1NTN A;  1CRE A;  1PLO A;  2H8U A;  2MFA A;  1CHV S;  4OM4 A;  2MHY A;  1CCQ A;  1F94 A;  2H5F A;  1NYS A;  1KC4 A;  1FSS B;  2ERA A;  3ERA A;  2HLR A;  2MJ0 A;  1IDI A;  2JQP A;  2N99 A;  2QJB C;  1CTX A;  2LA1 A;  1UG4 A;  5IMY C;  4P7U A;  2BTX A;  4HQP F;  4FAO E;  1NOR A;  2H7Z A;  1M9Z A;  1QM7 A;  1S4Y A;  1LJZ A;  1IKC A;  2VLW A;  3PLC A;  2GOO B;  1CDR A;  1IDG A;  1JE9 A;  1TFS A;  1CDS A; 
#chains in the Genus database with same CATH topology
 2H62 D;  2MUO A;  1BXP A;  3NH7 A;  1F8U B;  3HH7 A;  2NBT A;  5DU1 A;  1KBA A;  3BT1 U;  1HC9 A;  2CRS A;  1IDH A;  3QB4 B;  1HAA A;  1MAH F;  1KFH A;  1CXO A;  1ES7 B;  3NDS A;  3BT2 U;  2PJY B;  1TXB A;  1JBD A;  1ERA A;  4BIK B;  1NTX A;  1RL5 A;  2J8B A;  1LXH A;  1NEA A;  2BHI A;  3EVS C;  1CVO A;  1KS6 A;  1ONJ A;  1HAJ A;  4KSN A;  1LXG A;  5DO6 A;  2ABX A;  2FD6 U;  1B41 B;  1TGX A;  2GOO C;  3FEV A;  1CXN A;  1KU6 B;  3LAQ U;  2H7Z B;  4LFT A;  4EY8 B;  1FAS A;  1ERG A;  1MR6 A;  2QC1 A;  1TXA A;  3KFD I;  2CDX A;  1CDT A;  4RUD A;  1ABT A;  2QJ9 C;  2CCX A;  1IK8 A;  4ZQY A;  1KXI A;  2H64 B;  2JVE A;  2MJY A;  1W6B A;  2PJY C;  1VB0 A;  1KTZ B;  2QJA C;  3NEQ A;  4OM5 A;  1QKE A;  4AEA A;  2CRT A;  1NXB A;  1KL8 A;  1CRF A;  1LX5 B;  3EBX A;  3U73 U;  1HC9 B;  1CDQ A;  4FAO C;  1LSI A;  1FFJ A;  2UWR A;  2X8B B;  2L03 A;  4XJJ A;  1DRS A;  2I9B E;  1COD A;  5DZ5 A;  2K3G A;  1QKD A;  1FRA A;  1FSC A;  1FF4 A;  1JGK A;  1H0J A;  2HLQ A;  3U74 U;  1KBT A;  1NYU A;  1COE A;  1I02 A;  2UX2 A;  4BDT B;  1REW C;  4UY2 C;  4DO8 A;  2H64 C;  6EBX A;  1ZAD A;  1XT3 A;  5IMT D;  1IQ9 A;  1YWH A;  2H62 C;  5EBX A;  1V6P A;  1L4W A;  1IDL A;  1BTE A;  3KFD E;  2L5S A;  1G6M A;  1RGJ A;  1CB9 A;  2MUP A;  4IYE A;  2MJ4 A;  1IJC A;  1HOY A;  2LCR A;  2CTX A;  1KBS A;  2OFS A;  4QTI U;  3VTS A;  1NTN A;  1CRE A;  1PLO A;  2H8U A;  2MFA A;  1CHV S;  4OM4 A;  2MHY A;  1CCQ A;  1F94 A;  2H5F A;  1NYS A;  1KC4 A;  1FSS B;  2ERA A;  3ERA A;  2HLR A;  2MJ0 A;  1IDI A;  2JQP A;  2N99 A;  2QJB C;  1CTX A;  2LA1 A;  1UG4 A;  5IMY C;  4P7U A;  2BTX A;  4HQP F;  4FAO E;  1NOR A;  2H7Z A;  1M9Z A;  1QM7 A;  1S4Y A;  1LJZ A;  1IKC A;  2VLW A;  3PLC A;  2GOO B;  1CDR A;  1IDG A;  1JE9 A;  1TFS A;  1CDS A; 
#chains in the Genus database with same CATH homology
 2H62 D;  2MUO A;  1BXP A;  3NH7 A;  1F8U B;  3HH7 A;  2NBT A;  5DU1 A;  1KBA A;  3BT1 U;  1HC9 A;  2CRS A;  1IDH A;  3QB4 B;  1HAA A;  1MAH F;  1KFH A;  1CXO A;  1ES7 B;  3NDS A;  3BT2 U;  2PJY B;  1TXB A;  1JBD A;  1ERA A;  4BIK B;  1NTX A;  1RL5 A;  2J8B A;  1LXH A;  1NEA A;  2BHI A;  3EVS C;  1CVO A;  1KS6 A;  1ONJ A;  1HAJ A;  4KSN A;  1LXG A;  5DO6 A;  2ABX A;  2FD6 U;  1B41 B;  1TGX A;  2GOO C;  3FEV A;  1CXN A;  1KU6 B;  3LAQ U;  2H7Z B;  4LFT A;  4EY8 B;  1FAS A;  1ERG A;  1MR6 A;  2QC1 A;  1TXA A;  3KFD I;  2CDX A;  1CDT A;  4RUD A;  1ABT A;  2QJ9 C;  2CCX A;  1IK8 A;  4ZQY A;  1KXI A;  2H64 B;  2JVE A;  2MJY A;  1W6B A;  2PJY C;  1VB0 A;  1KTZ B;  2QJA C;  3NEQ A;  4OM5 A;  1QKE A;  4AEA A;  2CRT A;  1NXB A;  1KL8 A;  1CRF A;  1LX5 B;  3EBX A;  3U73 U;  1HC9 B;  1CDQ A;  4FAO C;  1LSI A;  1FFJ A;  2UWR A;  2X8B B;  2L03 A;  4XJJ A;  1DRS A;  2I9B E;  1COD A;  5DZ5 A;  2K3G A;  1QKD A;  1FRA A;  1FSC A;  1FF4 A;  1JGK A;  1H0J A;  2HLQ A;  3U74 U;  1KBT A;  1NYU A;  1COE A;  1I02 A;  2UX2 A;  4BDT B;  1REW C;  4UY2 C;  4DO8 A;  2H64 C;  6EBX A;  1ZAD A;  1XT3 A;  5IMT D;  1IQ9 A;  1YWH A;  2H62 C;  5EBX A;  1V6P A;  1L4W A;  1IDL A;  1BTE A;  3KFD E;  2L5S A;  1G6M A;  1RGJ A;  1CB9 A;  2MUP A;  4IYE A;  2MJ4 A;  1IJC A;  1HOY A;  2LCR A;  2CTX A;  1KBS A;  2OFS A;  4QTI U;  3VTS A;  1NTN A;  1CRE A;  1PLO A;  2H8U A;  2MFA A;  1CHV S;  4OM4 A;  2MHY A;  1CCQ A;  1F94 A;  2H5F A;  1NYS A;  1KC4 A;  1FSS B;  2ERA A;  3ERA A;  2HLR A;  2MJ0 A;  1IDI A;  2JQP A;  2N99 A;  2QJB C;  1CTX A;  2LA1 A;  1UG4 A;  5IMY C;  4P7U A;  2BTX A;  4HQP F;  4FAO E;  1NOR A;  2H7Z A;  1M9Z A;  1QM7 A;  1S4Y A;  1LJZ A;  1IKC A;  2VLW A;  3PLC A;  2GOO B;  1CDR A;  1IDG A;  1JE9 A;  1TFS A;  1CDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...