1NEEA

Structure of archaeal translation factor aif2beta from methanobacterium thermoautrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
MDDYEKLLERAIDQLPPEVFETKRFEVPKAYSVIQGNRTFIQNFREVADALNRDPQHLLKFLLRELGTAGNLEGGRAILQGKFTHFLINERIEDYVNKFVICHECNRPDTRIIREGRISLLKCEACGAKAPLKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable translation initiation factor 2 beta subunit
publication title Structure of the archaeal translation initiation factor aIF2beta from Methanobacterium thermoautotrophicum: Implications for translation initiation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Translation
total genus 17
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1neeA01
2NXUA 1NEEA 2DCUB 2D74B
chains in the Genus database with same CATH superfamily
1S72S 4QIWD 3E3XA 3VHQA 1JLGB 1UAWA 4USKA 1NHKL 3DLHA 1IBKF 1SH0A 1RHMB 3VR1A 1U25A 1QE1B 1Q1KA 1JXEA 1X4GA 4ICLA 4CLZA 5HJXA 4Y0FA 4J9SA 4IFYB 4J7CA 1U8WA 1FNMA 3FSYA 5K8MA 2HNZB 3WHIA 4FZVA 4HDHA 3AXKA 1R8HA 1VK8A 2HZCA 3OHBA 7FDRA 4OI4A 2GIRA 2BRLA 3J7Z5 4K2JA 5C25B 3OV7A 3HVRA 4Z37A 4WK3A 1IKWA 1CEZA 4DV2F 2IYGA 2V4QA 4I2PA 5CZXA 1UWBB 2HWIA 4LF6F 3PM9A 3KLIB 2YWFA 1I3OB 4K2XA 3MR7A 2JOQA 2G4BA 3CB4A 2BUNA 4G1PA 3GE9A 4XK8C 4WYLA 1XMQF 2B51A 4F25A 2ZKUA 3NCQA 4ER8A 1BQMB 5F8LA 4OJ3A 3EDQB 3R7NB 2WVDA 5I3UA 4OL8A 1QSSA 3K59A 4KGVB 1CBKA 5HMWA 3MM9B 2N4DA 5ETVA 3FCHA 2XWXA 1V6HA 4NLXA 2IC3B 2WRMA 1H72C 3SZ2A 1X4CA 3CEDA 2M2BA 3M6UA 5B0AA 2CPZA 1TUWA 4K7QA 1RADB 1XNRJ 4Y6IA 3RB0A 2BABA 1EQ0A 2LYVA 2EFNA 2DGWA 3VV2B 1Q16B 4ZVEA 4BS2A 2AEMA 4NZ7A 4O4GB 2H54B 3HFZB 3TJ9A 4XDCA 4HACA 1M5OC 3PYDA 1LFPA 1Q8IA 2HFOA 2OFHX 4P2SA 3EX7B 4ED2A 2B6AA 1PJ7A 3FCVA 1IJEB 5M2RA 1RWVB 1E6YA 3OVAA 1PILA 3KDOA 5KAKA 2FZKB 4I1TA 1B70B 2HK3A 2ZE2B 2HHPA 3BF4A 5HATA 3TW0A 4J9UE 3OVBA 3RRGA 3TVKA 3M1VA 3RJMB 2VQEF 1K44A 2GQQA 3AD9C 2Z2LA 5L9XA 3UE2A 3GZ7A 3ET6B 4YEAA 3IC1A 3KTQA 2OO4A 5KFOA 1KR4A 4NLQA 1HMVB 1NAQA 3H2LA 2ZZMA 1U8SA 1WORA 2UV8A 1IQTA 5KG4A 1WG1A 4KTQA 5B08A 2W8LA 2JX2A 1F5AA 3CCLS 1FNOA 3B6BA 1AB8A 1NHUA 1VR6A 2IRYA 2RE1A 1IR2A 2EBGA 1HYSB 3NNHA 2B56A 1VQPS 4DFPA 4F4WA 1KEKA 2ALYB 1FRLA 1LXJA 2K8GA 2LQ5A 3PKYA 2WBMA 1VK3A 3TAQA 5D4PA 3LWMA 4DUYF 4UOFA 4TQRA 2A6OA 3T5JA 5KFJA 2JZ5A 3QFHA 2P9EA 2AHOB 2MZTA 1XNQJ 2RKIA 3F0NA 4OIXA 2ASJA 4JI7J 1Q86T 4F3OA 5HLFB 5DG7A 2CJYB 2YWGA 5L1IA 3RBEA 2H48B 2HK2A 2A18A 4X62J 1RB0A 1UFLA 2J6UA 2PC6A 2KRBA 2W24A 3SCIE 3NGKA 4B08A 3P45B 2VUGA 3L7PA 2V50A 2JDJA 3MECA 3O3LA 3HHLC 3MURP 3N9UC 4KB7A 1O0PA 1AFIA 3GV5B 4URQU 1U0SA 4E2FB 4DSIA 1SKWA 4WFBQ 2OHDA 2YVSA 3BN4A 1RQ0A 4MT1A 4X4PA 4GVBA 4YR0A 5FDLB 4CLTA 3M8WA 3H5UA 2QEXS 4CO1A 3PX6A 3MZIA 4WXOA 2ASDA 1N88A 1S7HA 2HEKA 3MEDB 2ROEA 1RA6A 5E3QA 3HD1A 5E2QA 4DSEA 1VRTA 5D3GA 4RNOA 3MF5A 4HH0A 1B7YB 2IRXA 3KLVA 4IG3A 1TAQA 4K4UA 3LH2S 3MD3A 4X4UA 4FS1A 4NLYA 2O67A 1B99A 4ZCIA 4M5GA 1F0XA 1QD1A 3Q8VA 1L3KA 3RB4A 4DV4F 4DL4A 4ZPCA 4ZVOB 3HHDA 1BQNA 1TVRA 4PUOA 3D9BA 2GHVC 1LK5A 1FEEA 3I56S 1XR6A 3VAKA 2QLXA 3W66A 2KZMA 2H4WB 4RLEA 2DNQA 4ZHRB 2VKZG 3PW0A 2RU9A 2D41A 4PG7A 2E1CA 3JSBA 1VC6A 3W63A 2R8IA 3HHNB 3OPKA 4HL9A 1WF1A 2QLWA 3A12A 2R7QA 2Z2ZA 3BSCA 5HJYA 1WC1A 1N6QB 2C28A 2DO0A 1VFJA 4HI1A 2OPSA 3RAXA 3MM7B 1KVKA 3RBDA 1FRIA 3BR8A 3S1TA 2ILZA 1P27B 3UW1A 1MU2B 4NL5A 3JAMU 2GMLA 3R5AA 4HT7A 5HROB 2CQ3A 1GX6A 3R2DJ 3POTA 2DJWA 4MYTA 2WAQD 3C15A 4EZ6A 1NK5A 3KK3A 4ALZA 2LQBA 4GO5X 2QC3A 1IBLJ 2NXUA 1VQ4S 1N8RT 1W26A 1MWYA 1WC6A 3DLEB 4IR9A 4USMA 2CA9A 2ZJPQ 3HXMA 5BR8J 2YH0A 3DXBA 5HVFA 2GQ2A 5L8RC 1NEEA 1U48A 5F8GA 2A0FB 2K7KA 2ZH4A 1W7WA 4XO0A 3IRXA 4ZLLA 1JNRB 5E5NA 1DTQA 2XEXA 1D0EA 5CCMA 4ATNA 4DQRA 4WFYA 2DR6A 3K5OA 4OX9J 2LA4A 1S1VA 3W60A 2AJQA 4NYPA 2HHWA 1GH8A 2E7XA 1VQ8S 2JWNA 1RT2B 2UUBF 2W7PA 5GAGU 3TVYA 1RAIB 4JV2A 3M32B 4O3QA 2XM3A 3TAMB 3ZZPA 3HPOA 3D1QA 1UVIA 1FFGB 4YB7A 4I4BA 3CVKA 4LF4J 1KBRA 4DFKA 2WW4A 2PFDA 2WVEA 3C16A 3U02A 2D9OA 1LXNA 3MUMP 3N4WA 1RHUB 2CKWA 4DPTA 1L3TA 2O3DA 2NPFA 1NB2A 1N5SA 5IOLA 4ZVPB 1EZZB 1U09A 3PKMA 1EX8A 3HX9A 3AH6A 2IA6A 3D6HB 2NYIA 4K5SA 4MIWA 3QGPA 4NCGA 2JLFA 2FGOA 4CLKA 2QL9B 3BS9A 2B4PA 1PIEA 2MKHA 1VRUB 3CDAA 2A2CA 1V3ZA 4G6VB 4I2QB 3EZUA 2OGUA 1NDCA 4DI6A 4CI0B 2VG5A 1WJ9A 2VZ9A 5F8MA 3C6UA 3TUIC 5ETPA 5ETSA 1ITPA 2G0JA 2DVIA 3P96A 4NLRA 1RAAB 5CCLA 1FRMA 1GMVA 5KOWA 1FVSA 4IO1A 1JXVA 4Q0BB 2KRRA 1UZDA 1CSJA 3H2UB 3DHWC 3OR1A 3ICLA 2DGVA 2W7AA 2VICA 1UL3A 1C1CB 3QO9A 4PABA 3BQ0A 4NMXA 1ZBTA 4UQTA 4B3RJ 1REGX 4DR1J 4OYWA 2W9CA 2E5LF 2MXYA 4UOGA 3OJUA 2CPXA 3M30A 4IYQA 5DGBA 2VC1A 2PN6A 1U2CA 4P10A 1U6FA 3IWLA 1KLMA 4V19X 1UETA 3IGNA 3KK2A 3NNAA 2YKMB 2VBYA 1C0UA 4W92B 4CIOA 4LF9J 2EBEA 2DEIA 3NCPA 2KI2A 1IVZA 1HNIA 1NSAA 2CIMA 2R3VA 2EWHA 1GX5A 3D6TB 4Y2CA 1NU4A 1U24A 4IOAQ 4AYBD 2E7VA 2EW9A 3R6GB 1I5OB 1QTNB 2DY9A 3BKUA 1NKEA 2L9WA 1YVFA 3I9V9 4KPCA 3RAMA 1XR7A 2KH9A 2FVPA 2ZWPA 1RT4B 2K06A 1YJNS 1D9DA 2HRUA 3PIPQ 3LA0A 4RWWA 2DNGA 3BQ2A 3MM6B 4B3TF 2VKRA 1RHQB 4BLGA 1NK0A 2MMYA 2OPPA 3UPFA 2LXUA 2YKQA 5HO4A 4EYHB 4B3MJ 1OO0B 1K47A 2PGCA 3D1HA 3EUNA 1I6JA 2J7WA 5ETOA 1HKAA 1T9TA 4K0KJ 3HJFA 4UUXA 2CNOB 4OHZA 2I5JB 3BGLA 3MPVA 4V19J 2E1PA 2GJ2A 3NGUA 3OUYA 2G1DA 3A8KA 2L41A 4PR6A 2RSQA 3LP1A 2YKNA 1FTCA 1W2BR 1B3TA 3KUEA 4ES1A 1PAUB 2BJ9A 3HSJA 2KXHA 1JXLA 3D0HE 2F8MA 4IDKA 4ZVSB 1TL3A 3U27A 4OLPA 2V2ZA 5DDRC 5HSPA 5A0YB 5AXMA 4X65F 2CWXA 1CJVB 3DRSB 3LOUA 3JSYA 1Q8KA 3JQJA 2OPQA 2MLXA 2D3OR 1MW7A 1S6QA 1U45A 3HFKA 3HMJG 2XI3A 1SUQA 3PIOQ 2ZNYA 1HBOB 2VPXB 4RW8A 5KFAA 2BM0A 1Z2ZA 3T19A 2IMOA 2XLJA 1NMEB 1Q8BA 5CYQB 3OR2A 4PQAA 2XYGB 5DZ7A 2DY1A 3ZC4A 3MMBB 3OVSA 4A8QA 4FS2A 2AEJA 1OYEA 3CC4S 5CD4H 1RP5A 1IKVB 1FRKA 1WKJA 1SQFA 1R0AA 3F73A 3LP2A 3UDLA 1UW4A 4BBYA 2VG6B 5B09A 5C42B 4NOHA 3MMCA 1KKHA 3KNGA 3UDCA 3TZZA 4K4VA 3G6XA 2X3GA 1DHMA 3KK1A 1NDKA 2DR9A 3TNVA 1YHQS 1WI8A 5EWEA 1FTRA 3WQPA 5KT4A 2W2NP 1S9GA 4ILRA 3VGVA 4KGMA 4ICLB 3EXCX 4WP9A 5B7WA 1S1UB 2C3MA 5IWAF 8ATCB 4ETXA 3R5BA 2PA8D 2UUAF 3SXLA 4ZVUB 3HP6A 2ZHBA 4LR8A 5EN1A 1NPKA 4U67Q 2HAIA 5E3CA 2MZSA 1Q5YA 7FD1A 3OL8A 3Q23A 4CO5A 1HWLA 2NSBA 3CJKB 5DDOC 4JI2F 3FRYA 3EPGA 2APOA 2QN6B 4CTAB 4ZOSA 1IKWB 2ZUGA 2HQ3A 2AGQA 1IBMJ 4LF7F 2DGTA 3D6FB 3EPIA 3MM8A 4N56A 2ZOMA 4CO3A 3PCOB 3W62A 3Q83A 1KRPA 4PWDA 1SL2A 2NUHA 2JHEA 1C1BA 2MSSA 3QLHB 1U2RA 2XY7A 2CQDA 2Q43A 1PG5B 4WP3A 2VJUA 2EFVA 1UZHA 3OW2R 4TLQA 2VFSA 1Q95G 1VQSA 5LMUF 3D54A 1U7LA 3V4IA 2UVRA 3FBEA 5I3UB 4DN9A 3IAS9 3OXLA 2K1RA 2B9YA 1K9MT 3EVOA 3DC2A 2P9CA 4KH0B 1G7CB 4J9KA 3CJ8A 4Q8EA 2Y8WA 2ALZA 1QM9A 1BGXT 3KLGA 4H54A 4CLWA 5M2PA 3AOCA 2ZH3A 4HACB 4DX6A 5I4MA 2P5VA 1E6VA 2QE5A 4LQ3A 1JMTA 5K14A 4ECUA 1R7IA 2B6AB 3NWRA 3CJQA 1ZETA 2GAGC 4L75A 2R7XA 1EJ7L 4ZVHA 1D9AA 1TL5A 4USJC 3RZAA 2HRTA 2EFOA 4OMFG 2W7OA 2CQ4A 4UF4A 1Q7YT 1LQ9A 2QA2A 3H59A 4P6QA 4QWBA 1U6BA 2R42A 4AQYF 8RUCA 2Z8QA 3NCRA 3M1VB 4CT9A 4CM2A 4DV3F 1SI9A 2IJFA 2RH3A 4YR2A 5K20B 2XTJP 1KS2A 1T05A 2KZZA 1MMDA 3L4BC 5LJ3Y 4DQSA 4IO9Q 5LJ5Y 2X3DA 4PXEA 3RU0A 3EXYA 3GG0A 6FD1A 4DN0A 3BH6B 2DT9A 1IXKA 2MZ1A 3PYFA 4Y65A 2HGNA 1SJ4P 1NJYA 5DQHA 5DQGA 4YHHJ 4LFCJ 2OI2A 2GA7A 3TANA 1U47A 2BQRA 3MXHP 3GR0A 4JOUA 1VJWA 1M1GA 4PG4A 2CQHA 4AT1B 2RIJA 2GX8A 3M8PA 1WG4A 4AFFA 1AYEA 1ZYQA 2HS0A 2CJ9A 4BCAA 4X2BA 3K5LA 1X0FA 2H3EB 3A13A 4LFBJ 2PI4A 2RKIB 3PRDA 2DK2A 4ZIVA 1X4DA 3B54A 4LF8F 1XTZA 1NDPA 3VZHA 4AL5A 3PTWA 4EBCA 4J9LA 1N34F 2N4CA 4TYAA 4RW4B 4A8XA 3JAMY 3IR5B 3TAPA 1RJJA 2XS5A 2GCFA 3RAQA 1S79A 5CYMA 2V2VA 5AJ3J 1V3SA 4U8YA 4CRJA 5HMXA 4A8WA 2QT7A 2RUGA 3R5DA 3J7ZT 2MZRA 3MECB 4I56A 2M5YA 2IJNA 1G1XA 1HD0A 2NUUG 3G71S 1WI6A 3PZPA 3DLGA 2C2DA 3R8YA 4DL3A 4IQMA 4Y3CA 2B9XA 4F0HA 1FEHA 2J9DE 3T9NA 4B9MA 3TUPA 2E7WA 4QU6A 3ILOA 2ZC4A 4KHMA 2VIHA 2ACMA 1YJUA 4GVBB 3RW7A 1DBDA 1QUVA 5IC6B 2JJ4D 4GRSA 2CFXA 1SBRA 3EM1A 3BSAA 3DLKA 4NLWA 3Q8PB 3G87A 1U1OA 2YWHA 2JEIA 3LAMA 2HW3A 1VRTB 5D3GB 1RBOB 3T6JA 2YNHA 4IG3B 3ZTRA 5ITHA 3L09A 2DCLA 5J2QA 1N5VA 3FZ2A 5MLCV 2PIIA 2ZOFA 2HQGA 3D1OA 2IBOA 1VS3A 5C24A 3QRQA 2UXDJ 1QJHA 1BQNB 2E1MC 1TVRB 2R7TA 5LXRA 3C8YA 3TR5A 4XTTA 1F3VA 1R0CB 3PY8A 3HHLA 1D3WA 3IWXA 1F3FA 1AA1B 2DITA 1KNZA 4NLVA 1SC4B 1P9YA 3OTBA 1FRHA 5HVGA 4EGLA 4RUAA 2VOOA 4UUWA 1YG0A 2MJNA 3T41A 4YR3A 4ZVGA 2XYHB 1XMBA 3HHLD 4F7VA 4OJHA 1KFSA 3C2PA 1S7IA 2WSEC 1Y4ZB 4I67A 2OMOA 1L5UA 1FJ7A 4FDFA 1QAYA 2HYIB 2ZWOA 3HSZA 2AGPA 2A3JA 3Q24A 2NZ4A 4LUBA 1M5SA 2KYZA 4LRCA 3POTB 2W25A 1ZZNA 3KK3B 5KFUA 5C2GA 4B02A 4ANDA 1RYSA 5IQ6A 3U1MA 3UI3A 2MKSA 3BH7B 4P9SA 2JEGA 2J76E 2JC1A 1TKTB 3OSPA 2N82B 4NRUA 3C6TA 3MEKA 2P6SA 2LLZA 2CQGA 3ILIA 5A8KB 3IRXB 1SH2A 2UXBJ 1Z4UA 3K5PA 2HHHJ 3U1NA 2LECA 2R7SA 1TMJA 2B7BB 2DNOA 2GIFA 2F5GA 1S1VB 3K17A 4DV0F 1FERA 2YWWA 3CCUS 1FWKA 2DH8A 2CPJA 1PAEX 3DDIA 1NH8A 3UCZP 2DHXA 4DXLA 2VL1A 1ULRA 2RS2A 4KFBA 1IM6A 3OL7A 1SPBP 2H5IB 1N36J 5D0HA 1UFKA 4Z2XA 4GKJF 4NXMF 1DTTB 2PE8A 1RKJA 3R5JB 3OSNA 1FJGF 4A8OA 1A6LA 1TKXB 4OZNA 5E3PA 3C16B 5U47A 4IOBA 2IA0A 4ZVFA 1T9XA 1ZM2A 4O3SA 2PEHA 1H98A 4RW9B 1HWKA 2YNGB 3BBFA 4WKRA 2XCAA 2A6MA 2NQPA 1CULB 1UWBA 4YY3F 2O66A 3UO0A 3DLJA 4NCGB 2EEYA 2G2YA 2C3YA 4M8LA 4CZCA 1DAXA 1H38A 3CTRA 1YJ7A 1OS5A 3ISND 2RS8A 2XBPA 1HI1A 2Q1LA 4JI3J 5HP1B 1YJTA 2YKAA 3MM9A 1URNA 3ETMA 3CCMS 4DV7J 3C6UB 1J5EF 2B3TB 2PMWA 4MKVA 1H6KX 4HI2A 1OY8A 2UU9F 3R5CA 1I94F 3SMZA 2AX1A 4LF5J 1IJFB 2ZM6F 1HL6A 1WKLA 5BJRA 2FJXA 5J2MA 2KXFA 3HI9A 5BYRA 3BBCA 3OR1B 2DHHA 2FYXA 3OTEA 2CADA 4RBTA 4MKBA 2DNRA 3CW2C 4NMLA 1VQYA 5GMEA 3GSDA 5LT5A 1FNXH 2OKQA 2ZE2A 2PMHA 4JI5J 1YRXA 2MEWA 1RAOA 4E0DA 2W9CB 2BKOA 1EARA 3R1LA 2KG1A 3M30B 1KOOA 3O8WA 4DR4J 1MSWD 4C9DA 3PX4A 3KK2B 1M5HA 4YB1P 2A1BA 3HLUA 4JI4F 3K57A 1C0UB 4DV6F 3LF0A 1NH7A 4MFBA 2QL7B 1RWOB 1HNIB 1U1PA 2WVCA 4QYRA 1TFWA 3O1LA 3RBZA 3E8OA 3UR3C 1EETA 4OZ1A 1NK6A 4ECVA 3I87A 1RT3A 3CXCR 1BMQB 2QV6A 4OYPA 1H3DA 2RRNA 4LMZA 2E5IA 1KP6A 4AD6A 4RBVA 4N8OA 1IWGA 2VQFJ 3PFEA 1HNVB 3JYTA 3Q8RB 4OI6A 3MMAA 3QGHA 4DFMA 3ZTSA 3GIRA 4I7FA 1WOOA 2NXNA 3TO8A 3GJSB 3VAGA 3H7HB 4DR2F 1MLAA 4DV5J 2AYBA 2OJ3A 2OPPB 2FDNA 5DO2A 2DPJA 2HWTA 4C6AA 4EBDA 3THPA 4QWDA 2GGPA 2FVSA 2FC9A 3LPYA 3HHEA 2KJWA 1F2GA 3D67A 1LFWA 3RYLA 3RRHA 3OUYB 5KFCA 2C2MB 2C2NA 1RT1A 1WHXA 1NDLA 2CQBA 3LP1B 4WJBA 2YKNB 2R7OA 2VA2A 3WDOA 2C3UA 2XZTB 5KFLA 3SDEA 3VZIA 4TXSA 1P8GA 3SSQA 1ZM4A 2BJEA 2FZGB 2IHR1 4X4NA 2GQCA 1FO1A 3DRYA 4IDKB 1YWXA 2E5JA 1UA0A 5CYJA 2V8HA 3CCTA 3K5NA 4FVCA 3MM5A 1ZAVA 5J1NA 3IMQJ 1YBTA 5GAHI 5DG8A 3UN2A 4EBEA 1WDDA 2Y1IA 1H73A 1UP1A 4DR7J 4PWWA 4TY8B 3DYAA 2DNPA 1D1UA 4I6AA 2VONA 2BQUA 2OPQB 3PHTA 4C0HA 1U1KA 3MEDA 3KHRA 2MQMA 3GIJA 4ES3A 1S6QB 4DG1A 1SUQB 4PXDA 4B9UA 4CO2A 4RW8B 2VPZB 3ITHB 5KFGA 1CPZA 4DEZA 2LA6A 3QIPB 2R8KA 2P9GA 1GQEA 2OIHA 2HIYA 4DMZA 2CPHA 1GEHA 2D9PA 4A48A 1Y5NB 1R0AB 1YJWS 3LP2B 3DRXA 3R1HA 3MMCB 3FRZA 5LM7E 3B82A 5A8RB 4DX5A 2YX4A 1SJ3P 1U02A 1FKAF 2OAUA 4Y2AA 2WVBA 5SZTA 3JSMA 2IYIA 5J1EA 4TY9A 1RABB 3IGVA 1TUVA 2KM8B 2V8DA 3H90A 2ASYA 4N76A 2GS8A 2LEAA 2RQ4A 4F67A 1ELOA 3M2UB 2XY5A 4W4MA 4JBCA 1SKUB 2HS4A 5FD1A 1M5PC 4CCHA 3AQPA 3M9NB 4PZVA 4F4XA 5LSRA 2R2RA 4ITSA 3FKBA 4LRBA 4LRDA 2ZC3A 4FYVB 3L9ZA 2HVZA 5H1SV 2XGPA 2GFFA 1KOHA 5KFEA 1FHTA 2FPHX 3PHEA 2HGMA 4OV1A 1TK5A 1BUXA 5LXYA 4RJVA 4EO6A 1CS4B 3MM8B 5KG5A 3TWZA 1DFDA 1C4AA 1Q5VA 1SVDA 5HL7Q 4PWDB 1C1BB 2L48A 3P6YC 5DS7A 4MKYA 2CRLA 4CP5A 3KLHB 3EYZA 2XHCA 5KT3A 1U4BA 4DUTA 2BJ3A 3T1AA 7AT1B 4OYZA 3V4IB 3FDSA 2Z2MA 1UJ5A 1RTDA 2K1RB 3C66A 2R8GA 1AW0A 4L3KA 3PVXA 3CGIA 5KFIA 4NXNJ 4LVNP 2J6TA 4ETZA 3QMQA 2FJEB 1RT2A 2XMTA 3UNGC 3BDEA 1JLEA 1X9MA 4I64A 3W2VA 5IV3A 1HR0F 2C2OB 2D1CA 1E6VB 1HQ2A 3DN9A 3NS6A 4KIAA 2KT2A 1NJXA 3SCKE 3QAUA 3SV4A 2FJDB 1FWPA 4X66J 2R7UA 3IP0A 2MQLA 2K3IA 3C46A 3A8IA 2DISA 4M5KA 2Q6BA 4ECQA 2HVIA 1ZZFA 1HHTP 3QT8A 4BC7A 4IRKA 5J1PA 5EX3A 2RRBA 3MAHA 1FA0A 2EFGA 2B9EA 2MZQA 1PJ5A 1BY9A 2RMLA 3PEJA 1NUEA 1UEKA 1L3UA 1T05B 3M7VA 2F7VA 4IUFA 4H4OB 2Q3PA 2JSXA 3FSIA 4ELUA 3Q22A 1TP7A 2DNMA 2IBKA 2I2YA 5D0EA 2VC0A 1RCXB 1VRUA 3H25A 1YGYA 5CH7B 4EUVA 3IM8A 4R25A 5A8WB 1Y5LB 2CZ4A 2IJRA 1UPMB 1WNEA 5KFHA 2RUSA 4HT5A 4UOCA 3CC7S 3B4MA 2BW7A 2Z58B 2F65A 3K5MA 3EJMA 2AT1B 5DM7Q 2RF2A 2I6WA 3HD2A 1DJ0A 2XQCA 4NA2A 3HSGA 4DCOB 5RUBA 1RT6A 3N28A 2OTLS 4B3SJ 4C2MA 1IKYB 4PXBA 3H5YA 2Y1JA 4BWMA 2XMMA 2NCKL 4TKTA 2QLBB 2X7IA 4YP3A 1C1CA 1P1TA 4FYDA 2AZ1A 1X9SA 1F6TA 1S1XA 2HHVA 1WEXA 1N5TA 2KJVA 3N79A 4I6WA 2MY7A 1ZM9A 3RTVA 1SV5B 1NXIA 2GVDB 4JI8J 3EGVA 1RISA 2DHAA 4A8MP 4KR0B 4Q43A 4B3OB 4A4JA 1T03A 1PYSB 4ED1A 3ZFVA 4C0BA 2BACA 2H65B 1BWEA 3A8EA 3BBBA 4A8KA 4CT8A 2YKMA 3FEXB 1GAOA 2BA9A 3DLGB 2Q79A 4UY85 4O3NA 3MCSA 3LWLA 2LQJA 1T9YA 5ETKA 2XSFA 1K1SA 3CUNA 1NK4A 3H4DA 4K8RA 4ELTA 1NK7A 4RNNA 2M7SA 4P73A 1XNRF 3SQOP 4OHVA 3TP2A 3BGUA 1IUJA 3PJ9A 3N01A 3NMRA 4WFZA 4Q2LA 5ETNA 3VVUA 2YNHB 2XMWA 1UFWA 1NKBA 3OJSA 1G2EA 2IFXA 1NKCA 2OEJA 5J2QB 2HZVA 2ROGA 3QYYA 5K5MA 4UTGA 1R43A 2HVEA 3FNNA 2WOMB 1C2PA 2M8DB 1RAEB 1TR0A 2F63A 2XYPB 3BR9A 1TKDA 4I0WA 2I5JA 2E1AA 3ISZA 2FGCA 2ZHOA 2E9TA 4ED4A 1SH3A 4XAKA 9ATCB 4DLGA 4KHPJ 3HHLB 4TYBA 3CCVS 4QU7A 3NEKA 2JNJA 1RT5A 1KTVA 1D09B 3KUGA 1DZ5A 3QJLA 2X1GA 2MSTA 5A0YA 3PW7A 1BE4A 3GFZA 4CH7A 4C98A 4ZJQA 4BHQA 4C8NA 2LKZA 1N5QA 1OJ4A 3DRSA 3G82A 2IY5B 3DDKA 1L3SA 2ZH8A 2KVIA 4WE1B 4KY3A 5F9LA 2XC9A 4Z7YA 3DNCA 3R7SB 4TU9A 3IFEA 4DV1J 4NEYA 4Y2IA 1LW2A 4YN3B 2V63A 1UVLA 1S6OA 3C6TB 1XNQF 3CNQP 2WK4A 2DCUB 1LWEB 5HK4A 3J80U 2VJVA 4DSJA 4JI7F 5KFMA 5K9FA 4NA1A 3M6VA 3T1HJ 4X62F 5DZ6A 1CQNA 2AZ3A 3BGFA 2XZWA 2D3UA 5DGAA 4H4KC 1X4BA 5HMYA 1NJIT 4ZPDA 1OIAA 4K4WA 5IM0A 4USTA 3IR7B 1VQNS 3ZZUA 1WHYA 1S1UA 2ASLA 5KTQA 4OX8A 4KFBB 4MK9A 2DH7A 3NS7B 4DS4A 2R9LA 3DOMB 1OSDA 2B8PA 1M1HA 4CM0A 4IFVA 1TK8A 1RAJA 2CZVC 4ZCLA 5LL6d 3LGHA 3OTOJ 5MAOA 4OI2A 3CJKA 5E3RA 1JLQA 2D3ZA 4CTAA 4J9MA 5B0GA 5THWA 2DNLA 4P2MA 1S49A 2BANB 2FVRA 3F56A 2XS2A 3QLHA 4ERDA 2NPIA 2ZJRQ 2IRUA 3ILJA 3IM9A 3GR1A 3MUTP 5K8PA 3UDVA 3W7BA 5C5JA 1N32J 3P5TL 3GYNA 3J81U 1FCAA 2I38A 1I51B 1P9QC 1TL1B 1VHIA 1RTHA 1HHQA 4DZ6A 2EPIA 1ZS6A 4NEZA 1YJVA 3M9OB 3MI7X 3GMGA 4GMKA 1X60A 1WWHA 2HFUA 2NREA 2WCXA 1W25A 1Q78A 1EHWA 2LVWA 3NG8A 1JIHA 1UVNA 4YOEA 4NLTA 2B0GA 4GKKJ 5J2MB 4Q5VA 3AD8C 5GAHU 2OD6A 4OHYA 2CZ9A 1DQ9A 3CO0P 4MKAA 4QIVA 4C48A 2BMBA 4NYZA 1FDAA 2MQNA 1Y9OA 4MAKA 1GNKA 1NHVA 4NLSA 2U1AA 3MPYA 4WZMA 4TLRA 3UR0A 2UV8G 1IBLF 3IO1A 3V6HA 1FF2A 2OMLA 1TQLA 1WELA 3ZZZA 1FDNA 5BR8F 1YI2S 4U6PA 4FKYA 2QYGA 1WC3A 3D3CJ 3ILLA 2WHOA 1TL4A 4ZCMA 2ZBQA 3KG0A 4MFBB 4QR0A 3WBZA 2Y0BB 1GXUA 4MYUA 3CCWA 4FPIA 4AL6A 2QFJA 4UOHA 4OX9F 2MGZA 1VCTA 2J8SA 1EETB 3W64A 2OELA 1PO6A 1RT3B 2EG2A 3G96A 4MK7A 4P2XA 3L7OA 1RUSA 1FESA 2ATCB 4QR2A 3VGUA 5F8NA 4KQZA 3MWBA 4WFAQ 1OSCA 2CJXB 4K4XA 4PEOA 2Z2YB 3M8RA 3JYTB 3MMAB 3KHLA 4ED0A 2DGXA 1UEUA 3SFUA 4LF4F 5EUHA 4I7FB 4M5MA 1WG5A 5I42B 3BKFA 1HBMA 3SSSA 1T0TV 5D4NA 2YPZA 3V2UC 2LQ9A 2MZJA 4QOTA 5CQGA 5F3TA 1RCOB 1FDDA 1QVGR 3TQ1A 4KO0A 1ZOTA 3I55S 5D77A 1WOSA 3W1YC 4QBUA 2RRAA 4X84A 2GGPB 4DQPA 2EK6A 2JC0A 3L95X 2W1BA 2BVZA 3EGZA 1RE1B 4P71A 3JTOA 1WACA 1TTHB 4RW4A 2Y8YA 1RT1B 2J9CA 2VDHA 1GMWA 3D68A 2JEJA 4L3NA 3FC9A 3SDEB 1T11A 3TZXA 1VQMS 1UMJA 4TU8A 5DETA 2R4FA 4RWXA 4OZ3A 4ID8A 1NBEB 2Y1LB 3WC0A 4RO0A 4ECRA 3MM5B 2FLOA 2HQDA 5EX0A 3SEOA 1EP4A 1GMWD 4FYWB 4ZLNA 3OQ2A 1CLFA 3NGSA 2RQCA 1FX4A 2BEFA 2XG8A 3DYAB 3G6ES 3PR5B 1KWMA 5E0OA 1B64A 4DG1B 4NA3A 1R3NA 3KOAA 4Z7CA 3H4BA 5B0EA 4WCEQ 2BW2A 3ZTOA 4FF4A 4PQUB 4G1QB 5BYSA 4RW6A 2G2ZA 3TUJC 2X1AA 1APSA 5AXLA 1U1LA 1CJKA 1VIOA 3E01B 3IG1A 3NBPA 2ZITA 1YX2A 2BE2B 1UVKA 1YZ7A 3PNIA 4B3RF 5KFFA 2XWYA 4DR1F 3DXSX 2XS7A 4YY3J 1RLCL 4ILLA 1YQHA 2E66A 1ZA2B 4WTYA 2JVOA 1KD1T 3L3CA 4LF2A 3U1LA 3OFEA 4LSNA 1VC5A 2CJAA 3JSMB 4B9LA 5J1EB 5DLFA 2FJBB 3R3TA 2HVDA 4JI0J 3MUVP 4LF9F 2ZBPA 4RUCA 2LXIA 4E8UA 2OH2A 5KFQA 3QJPA 5HAOA 1VI7A 3MR5A 4L6V3 1T8EA 4JI6J 1SC6A 4LREA 5KFBA 3V4MA 1QDUB 1UA1A 1U26A 2WZ1A 4IRDA 5E41A 2P6TA 3U7JA 5E7OB 3CJ0A 3E2EA 1PKUA 4L73A 3MAAA 2UUCJ 4O0NA 4OI0A 3MPUB 4J9PA 3H42A 1TV6A 3EMTA 2YQ0A 4QZVB 1RHKB 5L39A 1CC8A 1A0OB 4X4QA 2C2ZB 2LU1A 5A2QY 3M8SA 2WW8A 3G8QA 1Y5IB 3VGTA 4WF9Q 1RT7B 2RVJA 2HWHA 1T3NA 1NJWA 1Y7PA 2VFTA 1MMLA 1FRXA 2QMWA 1S6UA 3C14A 1KTQA 3WX4A 2M52A 4OJ1A 1TKTA 4J9QA 3N6NA 1HLWA 2DYAA 3K7RA 4K0KF 1DARA 2MHEA 5A8KA 1HNWJ 1RU1A 4A8FA 2MY8A 4F04B 2M8HA 3S8SA 1HA1A 3DM2A 4C8YA 4MK8A 1H0HB 1RTDB 4CWBA 2D69A 3CE8A 3UWTA 2HURA 1S76D 2L3MA 5B0CA 4LBPA 1KONA 2HBQB 2GC8A 2ZVIA 4CYUB 5M2UA 2MQ8A 5BYQA 2DNHA 1VYAA 1JLEB 2D7SA 3VAIA 3W2VB 3I0RA 3PR4A 4DL0C 2LDIA 1DTTA 3M6XA 2MKIA 2P2CB 2GW8A 1VJQA 3UD3P 3MD1A 4PAAA 4E98A 4J9NA 1TKXA 3QPIA 4EI2A 2AF6A 2IAJA 1S97A 4RPFA 2AD9A 1T7PA 4ZA1A 4RW9A 4ZK7M 2DXDA 5LSLA 2YNGA 2FHKA 2UVUA 4R5PA 3NGRA 3CCZA 4PYAA 1CULA 4QW9A 3A3OB 2B5JA 1FX2A 1X5TA 2B9WA 5L9NA 3BJYA 4RNMA 3H40A 1SXLA 3QGIA 1PBAA 3QNWB 3W61A 3SQGB 3IWNC 3UNYA 1M0SA 4RW7A 3FQLA 2W8KA 1CQMA 5IT0A 4ZP8A 3S6EA 5HP1A 3DGPA 2GVZB 5AT1B 2C42A 3D2WA 2IIHA 2ADCA 2F8EX 5E33A 2VF3A 2QL5B 5F8JA 2V67A 2OSQA 1RK8A 2RDJA 1Q4RA 1CG2A 4GVLA 2G13A 4N41A 2DNZA 3DRRB 5LOQA 1F1BB 1RAHB 4OV6A 2RF2B 1S5ZA 3DMJA 1DURA 1RHJB 2MYFA 2UXCJ 2DXFA 2LU2A 1RT6B 2F8HA 3LGNA 1YRTA 1C0TA 5KT5A 2X51A 2QFIA 1VQ5S 1N33J 1QUPA 2B4VA 2M3DA 1S1XB 4DHVA 1NSKL 4I69A 5DG9A 1OMSA 3M05A 1JJ4A 1NNDA 4JV0A 2AU0A 1BLUA 3QGGA 2OLWA 1IBMF 1T3OA 4F4AA 2CQ0A 5KFVA 2KL8A 1RTIA 4FF1A 3ENWA 3W9IA 2KFZA 2R8JA 1T03B 2Y1RI 1SKSA 3HT0A 2MLYA 3WIVA 2C1EB 2ZDOA 1RYRA 2ZZTA 3QSYB 5KOXA 2XB2D 4FYYB 1RWWB 3J80Y 4IQXA 4LT6A 1FKOA 3QBCA 3MOJB 2ZBRA 1EKRA 3AT1B 4UZBA 1FKPA 4DSLA 2FTRA 2KXNB 1YKWA 3CD7A 3KNAA 3Q8UA 1U1RA 3M2RA 4KC5A 5T41A 4ZN3A 4WFXA 2XZDB 3LANA 3LALA 3AB2B 4YUDA 5L46A 3SCJE 1HBUA 2KG0A 4R0JA 1HNVA 3AFGA 1X4FA 4ZS6A 2R7RA 1WF2A 3W2WA 1JX4A 2MDAA 3FEYB 2OP5A 2KT3A 1HWIA 2AJ1A 1GTHA 2K7JA 2RILA 4AXIA 2LP4A 1HNZJ 5IC4B 4X4SA 1QAXA 1VQLS 3BYRA 1Y00A 4H4MA 3NY0A 3FQKA 6FDRA 1FFSB 2MQPA 1S59A 1S12A 2MLZA 3JQKA 2AEFA 2IM3A 4FKXA 4Y2KA 2XMJA 4DR6J 4ECZA 2FZCB 2EFQA 1KFDA 2C3OA 3A3PB 3R5GA 4OYXA 3HO1A 1TELA 1NCLA 2KT5A 1VLYA 2GJIA 2R7WA 3P5BP 4Y34A 4URGA 2ACYA 1Q8LA 3N5FA 3KYLA 4KE5A 3OFFA 1RT5B 3KLEB 3I6PA 2ZD1A 1ROFA 3KXDA 4OYIA 3W9JA 3DGVA 1KQKA 4JP8A 3H5SA 5DRKA 4CO4A 3V81A 5AXNA 5KFWA 3PJXA 3PJWA 4YHHF 1FWLA 3V6DA 4EK2A 4OX6A 4LFCF 4TY8A 3G82B 2IDEA 3IN5A 3HDSA 3OTDA 2VFRA 4QQBA 3BN7A 3J81Y 3CD6S 2YX1A 5CA5A 2YPYA 3RR8A 3ITHA 4LRAA 3FZBA 3TI0A 3VCDA 2MKYA 3ZTQA 4HH1A 5F9NA 3G4SS 4ZPTR 1K0VA 3QIPA 2B4UA 1VBXA 2V6AA 2KU7A 1LW2B 1RAGB 3T1YJ 4LFBF 5KFYA 4RZRA 4JI1J 1RWKB 2F40A 2YNIA 3EICA 2W4PA 5LMNJ 2HBYB 2HNDA 3GIKA 2LQ8A 4D3GA 5A8RA 3CIMA 4OLOA 2ZOGA 1TFYA 3S7RA 2ZEJA 3R7BB 5AJ3F 4JUZA 2BXJA 4HTIA 3AA9A 3MR3A 3MAQA 5IM0B 3ZO7A 2J9DA 1GFWB 1LWCA 3CMQA 4LFAJ 3ZNUA 2R7VA 3BSOA 1V5VA 4EEYA 1VIXA 4DFJA 1T94A 4OZJA 3O6QA 4KPYA 1UCNA 3M2UA 3JS9A 1RWNB 5JVHQ 3NOGA 1VLOA 1HWUA 2CPDA 2DRBA 3VF0B 2AKWB 3EVWA 3FMBA 2PDAA 4N7TA 4ECSA 1Z1ZA 1VQ9S 3HKWA 4IFVB 4ZPVR 2OSRA 6AT1B 4UT4A 1JQGA 3GILA 1WTFA 4C3MA 2F4VJ 3K0JA 3AJ2A 3ADAC 3CJ5A 4ED7A 3T5HA 2GO9A 4IR1A 4B9VA 2CUYA 2EFPA 1NRKA 3H8YA 5J2PA 3I5BA 1JLQB 5H9EJ 2ABYA 1UVMA 3DI6B 4C11B 4UY8T 5CZVA 1CS4A 5D6GA 5DJBA 1AZSA 4ZVQB 3DOLA 3FK4A 3PX0A 3AHPA 1YIJS 4DPWA 1T95A 3THVA 4F3QA 1HNXJ 4ZJLA 2PEBA 4LRFA 5F8IA 4YB5A 4C7QA 1RBLA 3KLHA 2UXDF 3FSXA 4HDGA 3V6JA 3BSNA 1PCAA 4CH1A 4GC7A 3HM9A 4H4KA 5ETMA 5KT2A 3CCSS 1O8BA 1WEYA 4PCQA 4J90A 1GXTA 3QRPA 1LNQA 1JLBA 3CDEA 3IBCB 3VQTA 1RTHB 3TEGA 1X31C 4MIBA 3I4PA 4CNZA 1WC0A 3UDEA 4N47A 3H5XA 3H0PA 2DR8A 1FVQA 2NXCA 5LSOA 3P8BB 4ZP9A 2G2OA 3OLAA 4RU2A 3IBFB 3H2VE 2W9BA 4OQJA 4F2SA 5IXUA 4X4VA 3BO2A 1WDTA 2CG4A 4DUZJ 2Q66A 2RDIA 1JLCA 4X64J 3D66A 4J37A 2FY8A 3ZZRA 4O44A 3BO4A 2AJ2A 1IWAA 2IVFB 1K73T 3GIMA 3CDWA 5CAAA 3CCRS 3NKYA 5IQQA 2JRSA 4JYAJ 3US5A 4CLLA 3M8QB 3I9ZA 3TX0A 4H4OA 4DPOA 5JMNA 2MHNA 1S48A 5KT7A 1FE0A 1MN7A 2Z57B 1V5IB 2GMJA 2UXBF 1M5KC 2HHHF 3G8TA 2KB2A 5I3PA 2DGQA 2XI2A 4PYDA 2MGZB 3GCWP 3D3BJ 4B17A 5A8WA 1T02A 1RTJA 1OQ3A 2A10A 5K8OA 3ZZTA 4N77A 3WIUA 2CNLB 2BE9B 4EZ9A 2AW0A 2D74B 4XIUA 3NNCA 2CPYA 4USVA 4DR5J 5KG7A 4ID5A 1N36F 1RXOB 1JLAB 5CHCB 3CT9A 1S99A 3VAJA 2V8GA 1ICEB 4DQIA 3UD5A 1HBMB 1IKYA 2MQQA 2W4CA 1VQKS 3NWGA 4G1IA 4LF1A 1HQUA 2FQQB 2QA4G 4KO0B 4ZDNA 2HKEA 3AOAA 3BYPA 2AV5A 3M9MB 4HVZA 4G3IA 1SV5A 1K0TA 2DXEA 2HBZB 2GVDA 3LP0A 4QW8A 3N6MA 2GJFA 1HI8A 2GV1A 1PGZA 1TAUA 2BV3A 4OHWA 4B3OA 3G6YA 5JUMA 4KV8A 3W5XA 3FFIB 4YDXA 3WC2A 1SQEA 3DHXA 5L38A 4A8YA 1WOPA 2E5GA 2OUGA 3J7AN 3EZOA 4JI3F 3CCJS 3T5KA 1IBKJ 3OD2A 1SQGA 3BKTA 3I96A 2FHJA 2B7CB 1M5VC 1X4HA 2B43A 4DV7F 4IH6A 3TA2A 1EP4B 3QT5A 2CPFA 2HLUA 3OFHA 1YDLA 4Q45A 1MWZA 1TL7A 2BE7D 2XO7A 2BJ7A 2ZNZA 2LXFA 4LF5F 4FXVA 3HKZD 2HHQA 4WWSA 1LV5A 2FHJD 3W8GA 1T9VA 1XQIA 3GFYA 2ZZNA 3LPEA 2VBXA 4NYOA 1F9HA 1WF0A 2VD3A 1KC8T 2UZAA 4RW6B 1VRQC 4DSFA 3MCNA 1CJKB 1EKSA 1ZA1B 4KGZB 3IG1B 3NBPB 1X5SA 4OYBA 4DV2J 4JV5F 1J27A 2J0QD 2WOMA 4JI5F 4AUKA 4LF6J 2DNNA 4ZP6A 1HD1A 1BQXA 3BGOP 1QLNA 9RUBA 4QIGA 1RGVA 3GWCA 2DBBA 1XMQJ 4DR4F 1HIYA 1WC4A 2U2FA 4LSNB 4OYAA 3B8HA 4ZPBA 4P74A 2FIUA 1T9WA 5FJ4A 2R2SA 4EMDA 3GU0A 3AD7C 3C19A 1R8BA 2UP1A 1HI0P 4HHUA 3VTIA 2J0SD 2FHMA 2XNQA 4ZLPA 4D3HA 1HHSA 2KHDA 3FCWA 2AGOA 3LGMA 3LTOA 3QIDA 2YQ1A 3MAAB 2CDQA 3IS9A 4URSA 2HG4A 1TV6B 2FY1A 2XY6A 2HFZA 2UVVA 2VQFF 5HQLA 3RRKA 1SB6A 4WE1A 2AP6A 4UW2A 2R2TA 2V9KA 2HFNA 2NLWA 2OEKA 3BM7A 4RX6A 1I1GA 1Z2LA 4DSKA 2B8QA 3MR6A 4DV5F 2DRDA 1REVA 3C14B 2X1FA 1HPZA 1UVJA 4QYZJ 1LWEA 4B9SA 2AX0A 3DRPA 1S0MA 4QJVA 3I5CA 3ISNC 1HARA 3K8WA 2VQEJ 4C3LA 4ILMA 4ECXA 4M95A 4F2RA 2BJ1A 3A8JA 3BEGB 2PO4A 2UVWA 4XDDA 3GFHA 4M94A 4KT0C 1N56A 4OZ2A 3ZXWA 2F9JA 3DM2B 2DNYA 2JEFA 2W2MP 3TZYA 3MGJA 3I31A 2BYCA 1H2UX 1R31A 4C8MA 4M5NA 4A47A 1YBAA 2XULA 1RLDA 5AXKA 2W2PP 3ZTPA 4KKOA 1S1WA 3DU5A 2HGLA 4Q44A 1RSCA 1VMBA 5D4LA 2RD5C 1U6ZA 3I0RB 3DOMA 4F4ZA 3HHKA 2H5JB 2QLFB 3CDUA 2DHGA 5J2NA 4DR7F 4WZQA 3PRVA 3SSRA 3D0IE 2CVIA 4XPCA 2RHQB 4U7CA 1S0VA 4O4RA 2XCPA 1TKZB 4S0MA 3MFHA 2IAJB 4NCAA 2AYGA 1SL1A 4DUYJ 2VPWB 4Q2MA 2IM0A 3J7YI 3ONQA 3MEEA 2CWKA 3D6MB 4R5PB 3VGSA 1PSDA 3CJ4A 3FBCA 4M5HA 2OTJS 2V0NA 2CQPA 2BANA 2B5JB 2R8HA 4KH1B 5CD4A 3V6KA 2V2KA 4RW7B 1B0PA 2QTWA 1VISA 4J91A 1KVJA 3KJVA 4TVAB 3DGPB 4HR2A 2IVMA 1CVJA 1TL1A 2IM1A 5KFZA 4QWEA 1DRZA 3AODA 3GSIA 4O0IA 1HBNA 4YQWA 3HVTA 1XBWA 2V4JB 1VBZA 2HSEB 1JLFB 4EFAC 5HMZA 3SV3A 2AMCB 3ZZ0A 4C8KA 3DMJB 2YXLA 3CJ3A 3W3SA 4R0EA 5F0WA 1F9FA 3M8ZA 2EVZA 4CLSA 3RB6A 1R8AA 1C0TB 1FD8A 4DR3F 4MMOA 2J0XA 4L76A 2VPYB 5G0RB 4IH5A 1MG7A 1H7XA 3N5BA 2N7CA 5AE3A 3PO4A 3PV8A 3GCXP 1H7WA 4C3KA 2CG8A 2W2OP 1A7GE 1GMUA 1RTIB 1RWUA 4LSLA 1TU0B 3HFVA 3ENVA 4DV4J 2YNFA 1S9FA 3IBWA 3JSRA 3QT6A 2F1FA 5L1KA 3TOQA 4QIEA 4TQSA 2NS1B 1F5BA 2I0XA 2J6SA 4OHXA 5JVGQ 5KG0A 2R2UA 4OZ0A 4IG0B 2HQFA 2V5HG 2ZJQQ 4WYWA 2M4MA 4PPZA 5F0UA 2XMKA 1L3VA 1FKOB 2ZFHA 2RDDA 4FF3A 1FKPB 4QPXA 4NXNF 3NL0A 2XSJA 3M2RB 1ZAXA 1YITS 1S0NA 3HVAA 5IT9U 5H9EK 1SCJB 4ZVRB 2E9ZA 5HBMA 4UZCA 1HBUB 4M5DB 2BBEA 1N5YA 1KQSR 2DR5A 2PT0A 5I3QA 3KMQA 4J9VA 8AT1B 1V3RA 3TEHB 4ELVA 4FNIA 3W2WB 1IR1A 3SIPB 4ZMMA 2HHSA 2DH9A 5I42A 1X5PA 3DU6A 3W8PA 3D5MA 2GMHA 3B4DA 2YY3A 4I6YA 4HHHA 2HMIB 4DS5A 4X66F 3M6WA 1IKXA 4MTPA 4KGXB 4KRWA 2V69A 2XLKA 2W9AA 2G9OA 4H4MB 3C3LA 5T7LA 1VHFA 2V8PA 2WONA 4AL7A 2AJ4A 2I9SA 2CAJA 2AJFE 2N3OA 2BJDA 4LR7A 5D4OA 2Y0SD 1CJUA 1YJRA 3KLFB 5KFRA 1OWXA 2HBRB 4LBIA 1XJWB 2CQ2A 1ZAWA 2KTQA 1Y3JA 3GG1A 3P3DA 4C8LA 2ZD1B 2UUBJ 4ZN1A 4NCBA 4KSEB 2UUTA 3V81B 5ETQA 2QIFA 4YMEA 5FLXU 3V6DB 3SYZA 3BZQA 3K89A 3T6BA 3GIIA 2JLGA 3UVJA 2LFVA 4K4ZA 2BZ2A 1W2IA 1XMOF 3IRWP 3CJ2A 1DQAA 1RWMB 1TZ0A 5HI7A 3QRRA 2PMZD 3MEGA 3ZZOA 4B3SF 2AJ0A 4DL5A 3RW6A 4PQUA 4G1QA 1EQMA 2GNKA 4Q8FA 3MCOA 3MMJA 1M90T 2QO3A 3ETOA 3E01A 2KYXA 2YNIB 3O2IA 4HYKA 1G4CA 1JWWA 2I8EA 2BE2A 3PG9A 2OPRB 2HNDB 1YBUA 4JI8F 3BV8A 3R9LA 1LW0A 4CLYA 1K1QA 1VQOS 1UEVA 4HHJA 2V68A 3OLBA 5T14A 1URRA 2QA1A 2P8IA 1WEZA 3GP9A 1RWPB 3S01A 1R27B 3GTYX 3H20A 4LIWA 2NYHA 4FN5A 4DPUA 1VGYA 4WK1A 1LWCB 3D28A 3F44A 2E5HA 3RUBL 2Y3YA 4W98A 1Q79A 2RB7A 2KKHA 4R8UA 1JJCB 2AIRB 3HULA 2KO1A 1ZH5A 3HSDA 3PDNA 3VAFA 2AWZA 2E44A 2BQ3A 5D8HB 2J8AA 2C2RA 5DDPC 3P49B 3ZZYA 5E3AA 1NPRA 5GAEI 4MIAA 2HZAA 1P1LA 3HVWA 1DLOA 1QSLA 3Q0AA 4FF2A 2DGSA 4WKYA 4CLUA 5KFNA 4ZPWR 2HHTA 1YRUA 3BPDA 1NM2A 1KSPA 5IS2A 1OPZA 4EO8A 1YZ6A 5J2PB 3TX8A 4QPTA 3I5AA 4RR5A 2X1BA 4KAIA 1RT7A 1FD2A 5AE1A 1SC1B 4DDFA 2NZCA 4BC9A 1N54B 4NLUA 1AZSB 4N8NA 2RQKA 2I1RA 4K5RA 3DOLB 3HF5A 4CLPA 4FXDA 2N7YA 1LOUA 2E5LJ 2CQCA 4L72B 4PXCA 4I2PB 3RGIA 3IAM9 4UQGA 2C3PA 2QMXA 4QIFA 2LEPA 5CABA 4NRTA 1Y0HA 3QWUA 2BOAA 2RU3A 3I0SA 2QA4S 3CMES 1B7FA 1O6XA 2YWKA 2FB0A 1JLBB 3BO3A 4KHPF 4ZP7A 1YJ9S 5ETTA 1CJTA 1OY9A 4X4OA 2DRAA 1ZPVA 2ZH5A 4X4RA 3G6VA 3FBBA 1D9FA 4PG8A 4M5IA 5D78A 4WP8A 3GJQB 2MQOA 4F4YA 1NZAA 1O5JA 4CYUA 4ZLJA 2V8VA 3CC2S 4LR9A 2W01A 3I32A 1H2TZ 4N5SA 3QSIA 2W2QP 4FVMA 2W9BB 4NASA 1OPIA 4ZIWA 4RUBA 2HVHA 1RAFB 3PRBA 1OYDA 2IM2A 1S57A 3FJ2A 1JLCB 4B3TJ 4C97A 3QFWA 1R8CA 3G9CA 1E6YB 2V4RA 4O44B 4P2FA 1X9WA 2HFVA 2K2PA 4DV1F 3MTKA 2GHWA 2M88A 3TRGA 4DX8H 1GK8A 2HHXA 3GJTB 5A6PA 2KDOA 2XO6A 3AQOA 4ECWA 4M5LA 2V9WA 3HCXA 2C22A 5AE2A 4NLDA 2QSFA 3T1HF 3SQGA 4J9OA 5HQMA 5KFTA 3PW2A 2BR0A 3HZGA 1JK9B 4K59A 5D15A 2XGQA 2GVZA 5KFKA 1FFWB 4ZVTB 1RTJB 2ZVSA 4TNOA 3PFOA 1M1KT 1GXLA 3KUHA 2HRYA 2J9EA 2FD2A 3QWPA 3Q8QB 4NX9A 3HJVA 3F41A 1AUSL 3DOKA 2Z30B 2GZOA 4X65J 4QWCA 3DRRA 2XMUA 2BKNA 2ZKTA 1KQFB 5DM6Q 1QAIA 3OXGA 3ZNJ1 3CWJA 4F26A 4ID5B 2EC0A 4CNYA 2CVEA 4QYZK 1KVIA 4P72A 1XN9A 4K4SA 1H74A 4NLPA 1MROA 4PPDA 3TA1A 2K3KA 2MPUA 5EWGA 3OTOF 1HQUB 3R27A 3LQVA 3GONA 2VG7A 5KFDA 1RI7A 3VAHA 2RAQA 1J2VA 2VOPA 2HNYA 1D8ZA 1RTZA 1VOMA 1SIZA 3VQSA 2C2EA 3LO3A 5IT4A 3LP0B 3NGTA 1BWVA 3ENQA 3KWMA 1CC7A 2QX0A 3K2YA 1O51A 1T9UA 2YQ3A 3JQMA 3UN5A 4WFNQ 1F5CA 1LWFA 5HANA 1HQEA 2VBWA 4KV8B 3LAKA 4MJKA 1MNEA 5GVQA 3TJ8A 1S0OA 1SJFA 3LW5C 1N32F 5FIIA 2V94A 2W4DA 5GADI 1P6TA 3GB0A 4P7TA 3MCMA 4WU2A 2XLIA 4WXWA 2ZH9A 1ACMB 2MKJA 3BGRA 5ADZA 2MKKA 4DF8A 1FXDA 1JJ2R 1UPPA 1U0HA 5IWAJ 1TL7B 3BPSP 2PD1A 2WB1D 2BKPA 2UUAJ 2HS3A 1EB0A 3QQCD 2RHSB 1Y10A 2FLNA 3T5LA 4YFUA 3BREA 2E1RA 4GKKF 1J5OA 1PYOB 1B4SA 3BB5A 3KFWX 3IXQA 4JI2J 3RBXA 3GQCA 1JKHA 4TU7A 2ZUAA 2VHGA 1S1TA 4HTJA 2AQ4A 1F60B 2VBZA 4LF7J 4LSZB 2ZH2A 1X8DA 2EXUA 4PRFA 1PC5A 2RQMA 4AE5A 3J7YU 4AXJA 3PACA 1S9EA 4LBHA 2ROPA 2ZHAA 2YBVA 3SCLE 1FDBA 5LMUJ 4PUOB 3JTNA 2WB4A 1F2HA 1FRJA 3KHGA 3KJFB 4GO7X 3W5ZA 3EZ5A 4P52A 4FP9A 1UKUA 2ZBCA 1NSQA 1R6YA 1UJ6A 2L08A 4NI2A 2LMIA 1JNZB 2EKYA 2GIQA 3G2XA 1YTYA 2DPIA 3LUYA 3KLEA 3CJRA 3M2VA 3QT7A 1RHRB 2GHPA 1K8AT 3V5RA 2VA3A 1FJEB 2VV5A 2WVFA 3X1LB 2O01C 3IS9B 1VBKA 1S6PA 2OPSB 3AOBA 3MR2A 4I68A 1FXRA 1AXQA 4F50A 1IQZA 1Q81T 3CCES 4X4TA 3Q89A 1HW8A 3EWGA 2DIVA 2KFNA 2DGUA 3OT9A 2DR7A 1FK9A 3EVMA 3AJDA 3C15B 1REVB 3CPWR 4NLOA 1HPZB 3BDPA 2NSCA 3M4XA 4AQYJ 3NP5A 4OZ5A 4YB6A 1S4FA 2ZBIA 2JH3A 3DRPB 3KHHA 4DV3J 4GC6A 2NR0A 3MPDA 5D0RA 2Z56B 5HVHA 3AJ1A 1DY3A 1KHVA 2WBRA 2MJUA 5GMKa 2OFGX 4WBFA 4HKQA 3GV8B 2HQCA 3PEHA 1DTQB 4ZJOA 1FXLA 2F4FA 5EGYA 2DNKA 1JLGA 3TVZA 4DPYA 4ECYA 2EKNA 5C7PA 5CXTA 5K8NA 1SKRA 2PA3A 3THTA 4USWA 4KKOB 1S1WB 2EG1A 2MTLA 1QE1A 1VQ7S 2A2DA 2D3O1 4O3PA 4EWTA 4IFYA 1BD6A 2OD4A 5J2NB 4YDDB 2DHSA 4U7UK 4KJIA 2HNZA 4USHA 2DKOB 5H9FJ 3GLJA 2M0GB 1BHNA 1VQ6S 4DOZA 3CF5Q 3OXFA 1N48A 2HQIA 3N0VA 4DJBA 4ZKAA 2IVYA 3TA0A 1UW9A 5C25A 4DWIA 3ENAA 3DI6A 3MEEB 4ZCKA 4EU0A 4C11A 5IT9Y 4M1KA 4DZDA 2HIQA 2J7KA 4NZ0A 2PI5A 1GT8A 3EDRB 4LF8J 1N0VC 3SBMA 3NGDA 4NZ6A 5F3ZA 4O3RA 4RL1A 2UUWA 1VC0A 2PSZA 1N34J 4FBUA 3A1YG 1PBUA 1G3OA 2CPIA 3KLIA 1WC5A 3KG4A 3OBIA 4WU3A 1QVFR 2YKPA 4IH7A 3KJVB 2HFSA 3PYGA 3J81j 3T3FA 2RT3A 2FUG9 2B4OA 1BQMA 4WIQA 1XIQA 5HN0A 4DLEA 2LDYA 2JLEA 2KHCA 4JI0F 1R8PA 1OY6A 3KG1A 4WPAA 1HBNB 4ZITA 5KFPA 3N6LA 3D4JA 3HVTB 1EIYB 4CO0A 2VG5B 2FLPA 4JI6F 2DEJA 4Y2MA 4NLGA 2IC3A 2RNEA 3OFGA 1ZPWX 2CQ1A 3CIZA 3CJTA 3UN3A 3RB3A 3O44A 3WX8A 2UUCF 4FPRA 3GYGA 1UJ4A 1D8YA 1V9OA 4O4GA 3DDNA 4IOCQ 1PC4A 1RU2A 3Q2SC 3G8SA 4FBTA 3R97A 2Z0GA 2WSCC 5KG2A 2FVQA 3QAEA 2V2QA 5C2CA 3MFIA 1Y3KA 3CDBA 3SI8A 4A46A 1KHWA 5FLXY 3QO9B 2YX7A 4JV5J 4LSLB 4DBQA 1HFEL 5A6WA 4WIIA 2YNFB 4USUA 1RA7A 3GJRB 3M8QA 1HNWF 1KLMB 1MN9A 3CJSA 3D7SB 3ET6A 1HMVA 2QJ3A 1XEZA 1VDHA 1S10A 2FJAB 5KG6A 2ZH7A 1EAYC 2OEMA 3NS5A 3TARA 4RBUA 3CMAS 2XSJB 4W90B 3AXMA 2ZH1A 1XR5A 4LIRA 1GTEA 3NXZA 5HBMB 2G1HA 2VU5A 4RNFA 1N5YB 4PWUA 1WSRA 4ES2A 2GO8A 3NRBA 2RJZA 1JLAA 3AB4B 1HYSA 2Z4PA 5G4DA 5GAEU 2L9NA 2VH7A 4OYMA 4ANEA 2CYYA 4DCPB 1R0BG 4A8SA 5L1LA 4O3OA 1TK0A 1IKXB 1RBAA 1UTAA 3JB9k 1RWXB 1XWLA 4U95A 2BOPA 3O5TB 4ED6A 4EYIB 1WHVA 5T7LB 1KLNA 1RACB 3PW4A 2WONB 1SL0A 5HLFA 2KN4A 2Q6CA 1F9EB 4LJMA 1ZTTA 2QMUB 5BXIA 3W65A 1SJQA 1HW9A 4FNHA 1CJUB 4IRCA 5KT6A 1Q82T 2CJBA 1KN6A 3MDFA 3FFIA 3DLBA 4USIA 1X4AA 5EDWA 1LEOA 1ZM3A 3M8YA 2M70A 3UQSA 4C8ZA 2BRKA 4DV0J 4YS2A 3KMSA 1NB7A 1NPPA 3Q8YA 4NPOA 4LQ9A 4ZPAA 2M9KA 1KQGB 1TL3B 2HPUA 2ZDPA 2H51B 3UVJB 4GKJJ 3JXOA 3MTJA 4Y00A 3AAWB 4NXMJ 4PG5A 5FDLA 2DIUA 1PJ6A 2QLJB 2YKOA 5KFSA 1FJGJ 3JTPA 2UXCF 2ILYA 3MEGB 4QCLA 3A3NB 3X3UA 1Q7LB 3I4HX 2CNKB 3RR7A 1N33F 4XPEA 2CJQA 2J5AA 3OR2B 3FGVA 1S4EA 3DKDA 3T9ZA 3CO9A 1LK7A 2BM1A 2E9RX 1B0VA 1NK9A 3E51A 4RNHA 5F41A 1LW0B 4K50A 2HAFA 1HWJA 4U7UD 1SJ1A 2G0IA 3IA0A 1KDNA 2IMWP 1NJZA 3VALA 3J7A1 3OL6A 4JV1A 4B9NA 5A76A 3KK1B 4U9RA 4R8UB 4ZHRA 3GYXB 1WD6A 2WSFC 1G6BA 2Y9HA 1S9GB 1J5EJ 1Q0NA 3P4UB 4QWAA 3DFEA 2VFVA 3RG6A 1FE4A 1QY7A 2UU9J 2MKCA 1Q53A 1I94J 1U1MA 1TUGB 1DLOB 1U1QA 1N6QA 4F0KA 2JFKA 1NSPA 5L1JA 1YLXA 2ZM6J 1AUDA 3Q8SB 3NLCA 3KDNA 3MM7A 3IR6B 4DR3J 4KBIA 2JL9A 4DU8A 2CNNB 2YH1A 5KG1A 1MU2A 2H4YB 2V34A 4C0OC 3PXGa 5HROA 3HZEA 2DO4A 3GV7B 2C2KB 1OQ6A 2BDPA 3FEZA 2NXEA 2NXJA 4OI1A 4B3MF 1HNZF 1XC9A 5B0DA 1SIWB 2QYCA 3KJQB 1YK9A 3DLEA 1Y11A 3QZ8A 3OL9A 3UFCX 3PYEA 1WKKA 3W5YA 1NK8A 5DDQC 4ED3A 4DR6F 4JI4J 3HT3A 3I0SB 4DV6J 1BC6A 4OFZA 5EHHA 1CJTB 1FI4A 1XERA 2BJ8A 2JFDA 4V1Ak 4M63A 3DLLQ 3W9HA 1TMMA 1NLKL 1WSVA 1AT1B 4G65A 2QZ8A 2J0WA 4DU7A 2ZH6A 5GADU 4PG6A 3A4TA 3ELHA 4F02A 4NE9C 4J5OA 1BXNA 4OJGA 3M32A 4QR1A 3KLGB 3VAMA 3OHAA 1QAJA 3TAMA 1SJRA 2IDLA 5K14B 1TKZA 4DL6A 3D0GE 3CSKA 4KYZA 4ANCA 2H5EA 3I82A 4DR2J 4Q7AA 1X4EA 2XMAA 1FT8A 2VDIA 5B0BA 2H9ZA 4KHRA 5IZHA 3TYTA 4K4YA 3T1YF 3EE3A 4RUHA 2L9DA 1U2FA 4JI1F 3MHYA 5LMNF 4F36A 1UWAA 4P75A 4CQ1A 2F3JA 1R89A 4WTOB 2DB1A 3NMAA 3AA8A 5F8HA 3B78A 4C4WA 4DL2A 4F8RA 5DQIA 1ZTWA 2J7UA 4FYXB 3EGWB 2EC2A 2YTCA 2AYMA 4LFAF 2QG9B 4I2QA 4FXWA 3WZ0A 1B0TA 5A2QU 2DTJA 1RZMA 2XNRA 2IPOB 3DOKB 2V4JA 3CD5A 3Q2TC 1JLFA 3FUYA 1NZ8A 2XHWA 4RKUC 2HLTA 1FJCA 2VFUA 3FBFA 3KJNB 1S77D 1XMOJ 5IV4A 5SUHA 4RU9A 2LCWA 1MROB 5DLGA 3M8PB 4Q0BA 2ADBA 2F4VF 2BX6A 2VG7B 2GAHC 1XK8A 3DCAA 2FLLA 5G0RA 4DX7A 1PYTA 3NOCA 3GPAA 3NAIA 4DQQA 2HNYB 1WUUA 3CULA 1JB0C 4DF4A 2SXLA 3BQ1A 1H2VZ 2YWEA 4M5JA 5D0GA 4ECTA 3R2CJ 1IM4A 1MMNA 1N52B 2FHOB 4LVOP 1DQ8A 4KGKA 3TJAA 4TN2A 1LWFB 5JJBA 3K58A 4BDPA 1HNXF 2CJKA 1HQEB 4HEA9 2AYEA 4HLBA 2FVCA 5CYMB 4DCJB 5ETLA 4BWJA 2O5DA 4DPXA 4L74A 1YSJA 4IG0A 2VASA 1WTBA 3HK2A 5GAGI 1U49A 5H9FK 3BGRB 4MH8A 1QSYA 3TZWA 4F4KA 4O23A 2E29A 4OZLA 4OX7A 2MB0B 1R6VA 2CXEA 2CQIA 3FMWA 1U0HB 4NWBA 1U1NA 3NAHA 2FC8A 4OI3A 4U96A 2EK1A 3PW5A 4M5DA 4K4TA 1LKZA 3QATA 3DLKB 2HHUA 1AFJA 3QJJA 5EWFA 2FJVA 1J5OB 2DGOA 1A9NB 1RT4A 1X5OA 4DUZF 2CDRB 1SC3B 3QZ7A 3K8VA 1JKHB 3FVYA 3ULHA 4X64F 3G86A 2FJWA 2HMIA 1X0PA 3VWSA 3MM6A 2ERRA 1S1TB 3KKFA 3Q86A 1MWQA 4OYOA 2QRRA 2XMVA 1C4CA 3UCUP 3MOZA 1S9EB 1LWXA 5C24B 3PO5A 1NO8A 2N3LA 4JYAF 2O1PA 1QTMA 5IFMA 2COLA 5GMDA 1N4LA 2G0CA 1IR0A 3KLFA 3CD0A 1IBCB 2VB6A 2WTFA 4C8OA 5ETRA 2QGFB 2F9DA 4U8VA 3VVTA 4IKAA 4J9RA 4NI2B 3UCGA 4CLFA 1AROP 3M2VB 2KM8C 4Y28C 2DD8S 4DL7A 3GFXA 2EI5A 3UD4P 3SFGA 3TQEA 3AY0A 5KG3A 1S6PB 3L7UA 1X7VA 1HR0J 5JXSA 2CPEA 2QSWA 1N0UA 1CJVA 4DR5F 2H1YA 4ED5A 3H98A 3R6LB 1JJHA 1RDRA 1RKIA 5HQ8A 1WHWA 1HBOA 1FK9B 1VBYA 4CH0S 4ENOA 3CCQS 4F0MA 1IN0A 5CYQA 2PFFB 2ATLA 2KFYA 3MMBA 2POKA 3OTCA 4P7VA 2JVRA 4CDIA 5KFXA 2OPRA 4B9TA 3MPWA 2VODA 1IKVA 4F3MA 5B0FA 2KVQE 4ED8A 2LEBA 3TUZC 2VG6A 4JB8B 5C42A 4PKDB 3EGNA
chains in the Genus database with same CATH topology
2J8AA 1S72S 2J76E 2JC1A 1TKTB 3OSPA 4QIWD 4NRUA 2N82B 5DDPC 2LU1A 3C6TA 3ZZYA 2C2RA 3MEKA 3E3XA 3P49B 5E3AA 5A2QY 3M8SA 2P6SA 1JLGB 2WW8A 1UAWA 1Y5IB 3G8QA 5GAEI 4MIAA 4WF9Q 2LLZA 1P1LA 1RT7B 2RVJA 2CQGA 1DLOA 2HWHA 3HVWA 3Q0AA 1T3NA 1QSLA 4FF2A 1NJWA 3DLHA 2DGSA 5A8KB 4WKYA 1Y7PA 2VFTA 5KFNA 1IBKF 1MMLA 1FRXA 4ZPWR 2HHTA 1YRUA 1SH0A 2QMWA 1S6UA 3VR1A 1U25A 1QE1B 1Q1KA 1JXEA 1KTQA 3IRXB 1X4GA 1KSPA 3WX4A 5IS2A 1OPZA 2M52A 4ICLA 4OJ1A 1TKTA 4J9QA 1SH2A 4EO8A 3N6NA 1Z4UA 3K5PA 4Y0FA 4J9SA 5J2PB 3TX8A 4IFYB 3U1NA 2LECA 4QPTA 2R7SA 3I5AA 2B7BB 3K7RA 2DNOA 2X1BA 4KAIA 1RT7A 1FD2A 1FNMA 4K0KF 3FSYA 1DARA 5K8MA 1S1VB 5AE1A 2MHEA 2HNZB 5A8KA 4DV0F 4DDFA 1FERA 4BC9A 1N54B 4NLUA 4N8NA 3CCUS 2RQKA 4FZVA 4A8FA 2MY8A 2I1RA 4HDHA 3DOLB 3HF5A 4K5RA 2DH8A 1R8HA 2CPJA 1VK8A 2HZCA 3OHBA 2M8HA 1NH8A 7FDRA 3UCZP 4FXDA 3S8SA 4OI4A 1HA1A 2N7YA 2GIRA 3DM2A 2DHXA 1LOUA 2CQCA 2VL1A 1ULRA 4C8YA 4L72B 4MK8A 4PXCA 2BRLA 1H0HB 4I2PB 3J7Z5 1RTDB 2RS2A 3IAM9 4KFBA 4UQGA 2C3PA 2QMXA 3OL7A 3CE8A 5C25B 4QIFA 2LEPA 3UWTA 3OV7A 4Z2XA 4GKJF 1S76D 2L3MA 5B0CA 3HVRA 4NXMF 1KONA 1DTTB 4Z37A 4NRTA 1Y0HA 2PE8A 1RKJA 4WK3A 3QWUA 3OSNA 1IKWA 1CEZA 2RU3A 2GC8A 1FJGF 4A8OA 1A6LA 3I0SA 2QA4S 2IYGA 5M2UA 4DV2F 1TKXB 5BYQA 2V4QA 4OZNA 3CMES 2DNHA 1B7FA 5E3PA 5U47A 4I2PA 5CZXA 1JLEB 1JLBB 1UWBB 2D7SA 2FB0A 2HWIA 2YWKA 4ZP7A 3BO3A 1YJ9S 4KHPF 4IOBA 4LF7F 3VAIA 4LF6F 3W2VB 3PM9A 2IA0A 4ZVFA 1ZM2A 4X4OA 2DRAA 3I0RA 3PR4A 4O3SA 3KLIB 1ZPVA 2YWFA 2ZH5A 4K2XA 4DL0C 2JOQA 2PEHA 4X4RA 3G6VA 1H98A 2G4BA 2LDIA 1DTTA 3M6XA 2MKIA 3CB4A 2GW8A 2BUNA 4RW9B 1D9FA 4PG8A 4G1PA 3GE9A 3UD3P 4XK8C 1HWKA 4WYLA 1XMQF 5D78A 2B51A 2YNGB 2MQOA 4F4YA 3MD1A 4F25A 1NZAA 2ZKUA 4E98A 1O5JA 3NCQA 4J9NA 4WKRA 1TKXA 2XCAA 1BQMB 3QPIA 5F8LA 4OJ3A 2AF6A 2NQPA 1UWBA 2IAJA 2V8VA 4YY3F 3CC2S 5I3UA 1S97A 2O66A 4OL8A 1QSSA 2AD9A 1T7PA 4ZA1A 3DLJA 4NCGB 3I32A 3K59A 1H2TZ 4N5SA 5HMWA 3MM9B 4FVMA 2N4DA 3FCHA 2W9BB 2XWXA 1V6HA 2C3YA 4M8LA 4RW9A 4CZCA 4NLXA 4ZK7M 5LSLA 1OPIA 2IC3B 2WRMA 2YNGA 1DAXA 2FHKA 1H38A 4R5PA 2UVUA 3SZ2A 3PRBA 2HVHA 1X4CA 3CTRA 3CEDA 2M2BA 1OS5A 3M6UA 3ISND 5B0AA 2IM2A 3FJ2A 2RS8A 1JLCB 3CCZA 2CPZA 2XBPA 4C97A 1HI1A 4QW9A 2Q1LA 1R8CA 4Y6IA 3G9CA 3RB0A 2BABA 1E6YB 5HP1B 1YJTA 2YKAA 2LYVA 2V4RA 2B5JA 2EFNA 2DGWA 4O44B 1X5TA 2B9WA 1Q16B 4ZVEA 5L9NA 4BS2A 4NZ7A 1X9WA 3BJYA 4RNMA 3H40A 1SXLA 3MM9A 3QGIA 4O4GB 1URNA 4XDCA 1M5OC 3CCMS 1LFPA 2K2PA 1Q8IA 2HFOA 2OFHX 3C6UB 4DV1F 3MTKA 1J5EF 2B3TB 3SQGB 3IWNC 2GHWA 2M88A 4P2SA 1M0SA 3TRGA 4DX8H 4RW7A 3FQLA 2HHXA 3EX7B 4ED2A 1H6KX 2B6AA 4HI2A 2W8KA 1IJEB 1CQMA 5M2RA 5IT0A 4ZP8A 2UU9F 3R5CA 3S6EA 1I94F 3SMZA 1E6YA 2AX1A 5HP1A 5A6PA 3DGPA 1PILA 2KDOA 3OVAA 2FJWA 5KAKA 3AQOA 4ECWA 2C42A 3D2WA 4I1TA 2V9WA 1IJFB 2ZM6F 2ADCA 1HL6A 2C22A 2F8EX 5AE2A 5E33A 5BJRA 4NLDA 2QSFA 2ZE2B 5F8JA 3T1HF 2FJXA 2HHPA 3SQGA 4J9OA 2OSQA 5J2MA 2KXFA 3HI9A 3BF4A 3TW0A 1RK8A 2RDJA 5BYRA 5KFTA 1Q4RA 1CG2A 3PW2A 3OR1B 3OVBA 2G13A 3RRGA 2DNZA 3DRRB 2BR0A 3HZGA 4N41A 3TVKA 1JK9B 3M1VA 4K59A 2RF2B 2XGQA 2VQEF 3OTEA 5KFKA 3DMJA 4RBTA 4MKBA 2DNRA 2GQQA 1DURA 1RTJB 2ZVSA 1VQYA 4NMLA 2Z2LA 4TNOA 2MYFA 3PFOA 5L9XA 3UE2A 1M1KT 3GZ7A 4YEAA 3IC1A 3GSDA 3KTQA 5LT5A 2LU2A 2OO4A 1GXLA 5KFOA 2HRYA 1KR4A 2J9EA 1RT6B 1FNXH 2OKQA 2ZE2A 2F8HA 4NLQA 3LGNA 1HMVB 2FD2A 2PMHA 1NAQA 1YRTA 3H2LA 1YRXA 3QWPA 4NX9A 3Q8QB 4E0DA 1C0TA 5KT5A 2W9CB 1U8SA 2ZZMA 2X51A 3F41A 3DOKA 4QWCA 3DRRA 2UV8A 2XMUA 2ZKTA 1KQFB 5DM6Q 1VQ5S 3R1LA 2KG1A 5KG4A 1QAIA 1IQTA 3OXGA 1QUPA 3M30B 1KOOA 2B4VA 3O8WA 3CWJA 1WG1A 4ID5B 4F26A 4KTQA 2M3DA 2EC0A 1S1XB 4CNYA 4DHVA 5DG9A 4I69A 5B08A 2CVEA 2W8LA 2JX2A 3M05A 1F5AA 3CCLS 1KVIA 1MSWD 4C9DA 3PX4A 1XN9A 3KK2B 1JJ4A 1FNOA 1M5HA 1NNDA 4JV0A 4YB1P 1BLUA 2AU0A 3QGGA 2A1BA 4K4SA 3HLUA 4NLPA 2OLWA 4JI4F 1IBMF 3K57A 1MROA 1T3OA 4PPDA 3TA1A 2K3KA 1C0UB 1NHUA 3LF0A 1NH7A 2MPUA 4DV6F 2CQ0A 5KFVA 5EWGA 3OTOF 1RTIA 4MFBA 4FF1A 1HQUB 3ENWA 3R27A 3LQVA 2IRYA 2RE1A 1HNIB 2KFZA 2EBGA 2VG7A 5KFDA 1U1PA 1RI7A 3VAHA 4QYRA 2R8JA 1TFWA 1T03B 2Y1RI 1SKSA 1J2VA 2VOPA 2HNYA 1D8ZA 3O1LA 1HYSB 3E8OA 3NNHA 3UR3C 1VOMA 2B56A 1SIZA 3VQSA 1VQPS 2C2EA 1EETA 3LO3A 4DFPA 2ZDOA 4F4WA 1KEKA 5IT4A 3LP0B 4OZ1A 1NK6A 1FRLA 1LXJA 2K8GA 3ENQA 4ECVA 3KWMA 3I87A 2LQ5A 1RT3A 3CXCR 3PKYA 1CC7A 3K2YA 1RYRA 2WBMA 1VK3A 2QV6A 5KOXA 1O51A 1H3DA 2XB2D 3TAQA 5D4PA 2YQ3A 2RRNA 4LMZA 2E5IA 4WFNQ 3J80Y 4IQXA 3LWMA 1F5CA 4DUYF 4TQRA 1LWFA 3T5JA 5KFJA 1HQEA 2JZ5A 4RBVA 4N8OA 4LT6A 1FKOA 2VBWA 4KV8B 3LAKA 2P9EA 3PFEA 4MJKA 3MOJB 2MZTA 1HNVB 1MNEA 3JYTA 5GVQA 2RKIA 1FKPA 4OIXA 3Q8RB 4OI6A 3MMAA 3QGHA 2ASJA 2FTRA 4DFMA 4DSLA 2KXNB 3CD7A 3KNAA 1U1RA 3M2RA 4I7FA 3TO8A 4KC5A 5T41A 1Q86T 1S0OA 3VAGA 4WFXA 4F3OA 5HLFB 1SJFA 3LANA 4DR2F 5DG7A 3LALA 3LW5C 1N32F 5FIIA 2AYBA 2OJ3A 2YWGA 2OPPB 2V94A 2W4DA 3AB2B 5GADI 1P6TA 4YUDA 5L1IA 3SCJE 1HBUA 3GB0A 2FDNA 4P7TA 2KG0A 3RBEA 4R0JA 4WU2A 2XLIA 2A18A 4WXWA 2ZH9A 2MKJA 3BGRA 5ADZA 2MKKA 1UFLA 5DO2A 4DF8A 1HNVA 4ZS6A 1X4FA 1FXDA 2DPJA 2PC6A 2J6UA 2KRBA 2HWTA 2R7RA 4EBDA 1JJ2R 3THPA 1WF2A 3W2WA 2W24A 1JX4A 4QWDA 3SCIE 3NGKA 2MDAA 4B08A 2VUGA 3L7PA 2GGPA 2JDJA 2PD1A 2WB1D 2FVSA 2FC9A 3LPYA 2HS3A 3FEYB 3MECA 3HHEA 2OP5A 3HHLC 3O3LA 2KT3A 1HWIA 2AJ1A 1GTHA 2K7JA 2KJWA 2RILA 4AXIA 3MURP 3N9UC 1F2GA 4KB7A 2FLNA 1LFWA 1O0PA 3RYLA 1AFIA 3GV5B 3T5LA 3RRHA 3OUYB 5KFCA 4YFUA 3BREA 1RT1A 1WHXA 4URQU 2E1RA 4X4SA 4GKKF 1QAXA 1J5OA 2CQBA 3LP1B 1VQLS 4WJBA 2YKNB 4DSIA 1SKWA 1Y00A 2R7OA 4H4MA 4WFBQ 2VA2A 3WDOA 3FQKA 3BB5A 3KFWX 6FDRA 2YVSA 3BN4A 1RQ0A 2C3UA 5KFLA 3IXQA 4X4PA 3SDEA 3VZIA 4TXSA 1P8GA 2MQPA 3GQCA 3SSQA 4YR0A 1JKHA 1ZM4A 5FDLB 3H5UA 4TU7A 2QEXS 2BJEA 2IHR1 4CO1A 2IM3A 4X4NA 2GQCA 1FO1A 3PX6A 3MZIA 1S1TA 4Y2KA 4HTJA 4WXOA 2XMJA 1F60B 3DRYA 1YWXA 4IDKB 1N88A 2VBZA 1S7HA 2E5JA 2ASDA 3MEDB 1UA0A 5CYJA 2ROEA 4ECZA 1RA6A 2EFQA 1KFDA 2C3OA 2ZH2A 2V8HA 3CCTA 5E3QA 1X8DA 3K5NA 4FVCA 4PRFA 3MM5A 1PC5A 1ZAVA 5J1NA 2RQMA 4AE5A 3HO1A 5E2QA 4DSEA 3J7YU 4AXJA 1VRTA 3PACA 5D3GA 5GAHI 5DG8A 4RNOA 1S9EA 2KT5A 3MF5A 4EBEA 1VLYA 2GJIA 4HH0A 2R7WA 2Y1IA 2IRXA 3KLVA 1UP1A 4Y34A 4IG3A 2ROPA 4URGA 1TAQA 4TY8B 2ZHAA 3DYAA 4K4UA 2ACYA 1Q8LA 2DNPA 3N5FA 3KYLA 3LH2S 1D1UA 4I6AA 3MD3A 3SCLE 2VONA 4KE5A 2BQUA 2OPQB 3OFFA 4X4UA 1RT5B 3KLEB 4C0HA 1U1KA 3MEDA 3I6PA 2ZD1A 1ROFA 4FS1A 1FDBA 2MQMA 3KHRA 4NLYA 4PUOB 3GIJA 4ES3A 1S6QB 1KQKA 4DG1A 1SUQB 3H5SA 4PXDA 3JTNA 5DRKA 4CO4A 2WB4A 3V81A 4B9UA 2O67A 1FRJA 4RW8B 4CO2A 4ZCIA 5AXNA 2VPZB 3ITHB 5KFWA 5KFGA 3KHGA 1CPZA 4GO7X 3EZ5A 1F0XA 1UKUA 4FP9A 3PJXA 3PJWA 4YHHF 4DEZA 3V6DA 1L3KA 2LA6A 2ZBCA 4OX6A 3RB4A 4DV4F 4LFCF 4TY8A 1R6YA 3QIPB 1UJ6A 2R8KA 2L08A 3IN5A 4DL4A 2LMIA 4ZPCA 3HDSA 1JNZB 3OTDA 2EKYA 2GIQA 2P9GA 1GQEA 3HHDA 1YTYA 2DPIA 1BQNA 2VFRA 3LUYA 1TVRA 4QQBA 3BN7A 3KLEA 3M2VA 3J81Y 4PUOA 2OIHA 2GHPA 3CD6S 2YX1A 5CA5A 4DMZA 2GHVC 2CPHA 1LK5A 1K8AT 3RR8A 1FEEA 3V5RA 1XR6A 2D9PA 3I56S 3ITHA 4A48A 3VAKA 2QLXA 1FJEB 2VA3A 2VV5A 3X1LB 1Y5NB 3FZBA 1R0AB 2KZMA 3TI0A 4RLEA 2O01C 3VCDA 3IS9B 2DNQA 4ZHRB 1YJWS 3KMQA 2VKZG 3PW0A 3LP2B 4HH1A 1S6PA 5F9NA 2RU9A 3DRXA 4ZPTR 3G4SS 2OPSB 1K0VA 3QIPA 3MR2A 2B4UA 2D41A 3MMCB 3R1HA 1VBXA 3FRZA 4I68A 4PG7A 3B82A 5A8RB 2KU7A 1FXRA 1AXQA 2E1CA 1LW2B 3JSBA 1VC6A 4F50A 2YX4A 4LFBF 2R8IA 3HHNB 3OPKA 1IQZA 4HL9A 1SJ3P 1WF1A 5KFYA 4RZRA 2F40A 1Q81T 2YNIA 2QLWA 3CCES 2R7QA 3BSCA 2W4PA 1FKAF 2OAUA 4Y2AA 5SZTA 3JSMA 4X4TA 2IYIA 1N6QB 2C28A 1HW8A 2DO0A 5J1EA 2DIVA 2HNDA 4TY9A 3GIKA 1VFJA 2KFNA 2DGUA 3IGVA 2DR7A 1FK9A 1TUVA 4HI1A 2OPSA 2KM8B 2V8DA 1REVB 2ASYA 4NLOA 3CPWR 3RAXA 4N76A 2LEAA 3MM7B 4D3GA 5A8RA 2RQ4A 4F67A 1HPZB 3BDPA 1ELOA 3RBDA 2NSCA 3CIMA 3M4XA 3M2UB 1FRIA 3NP5A 2ZOGA 4OLOA 4OZ5A 2XY5A 3S7RA 1TFYA 4JBCA 4YB6A 2HS4A 3BR8A 1S4FA 5FD1A 3S1TA 5AJ3F 2ILZA 4JUZA 2BXJA 2ZBIA 2JH3A 3DRPB 3KHHA 1P27B 1M5PC 4HTIA 3AQPA 4CCHA 3AA9A 3M9NB 3UW1A 1MU2B 4NL5A 3MR3A 3MAQA 2GMLA 4GC6A 5IM0B 3R5AA 4F4XA 5LSRA 2R2RA 4HT7A 4ITSA 5HROB 2J9DA 1LWCA 2NR0A 2CQ3A 1GX6A 2R7VA 3BSOA 2ZC3A 3POTA 2DJWA 4MYTA 2WAQD 4EEYA 1VIXA 4DFJA 4EZ6A 1NK5A 3AJ1A 2HVZA 3KK3A 1KHVA 1T94A 2WBRA 2MJUA 5GMKa 2OFGX 5H1SV 4ALZA 2XGPA 4OZJA 3O6QA 2GFFA 2LQBA 4KPYA 4GO5X 3M2UA 3GV8B 4HKQA 1KOHA 5KFEA 5JVHQ 3PEHA 1DTQB 1FHTA 2NXUA 1VQ4S 1N8RT 1HWUA 2FPHX 2CPDA 1MWYA 1FXLA 3DLEB 2DRBA 4IR9A 5EGYA 2DNKA 3VF0B 3PHEA 2HGMA 1JLGA 3FMBA 3TVZA 3HXMA 2ZJPQ 4OV1A 1TK5A 2PDAA 2YH0A 3DXBA 4ECYA 5CXTA 4ECSA 2GQ2A 5L8RC 5LXYA 1NEEA 1Z1ZA 5K8NA 1U48A 4EO6A 1SKRA 1VQ9S 2PA3A 5F8GA 3HKWA 4IFVB 4ZPVR 3THTA 2OSRA 4KKOB 2K7KA 3MM8B 1S1WB 2ZH4A 2EG1A 5KG5A 3GILA 1DFDA 1C4AA 1WTFA 1QE1A 4C3MA 4XO0A 3IRXA 1VQ7S 2A2DA 3K0JA 1JNRB 3AJ2A 5E5NA 1DTQA 5HL7Q 4PWDB 3CJ5A 4ED7A 2XEXA 3T5H