1NEEA

Structure of archaeal translation factor aif2beta from methanobacterium thermoautrophicum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
135
structure length
135
Chain Sequence
b'MDDYEKLLERAIDQLPPEVFETKRFEVPKAYSVIQGNRTFIQNFREVADALNRDPQHLLKFLLRELGTAGNLEGGRAILQGKFTHFLINERIEDYVNKFVICHECNRPDTRIIREGRISLLKCEACGAKAPLKNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable translation initiation factor 2 beta subunit
publication title Structure of the archaeal translation initiation factor aIF2beta from Methanobacterium thermoautotrophicum: Implications for translation initiation.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Translation
total genus 17
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1neeA01
1NEEA 2DCUB 2NXUA 2D74B
chains in the Genus database with same CATH superfamily
2V4JB 3JYTB 3QRQA 1R8PA 1WTFA 2KU7A 2Z0GA 2FJAB 2A6MA 5IT9U 2VFVA 3MM8A 2XMWA 7FD1A 3UQSA 1FD8A 2DHSA 2FLLA 3LP1B 4LF4F 1VR6A 2I1RA 2M70A 4IOBA 3SV3A 1BY9A 4ILMA 4X2BA 1JNRB 2G0IA 3Q8UA 1DY3A 4OJHA 3BBFA 4J9PA 4HT7A 2HHQA 2XC9A 2WW4A 1T9XA 2HWIA 4LQ3A 1PC4A 2R7UA 1GQEA 4F36A 4AQYJ 4OIXA 3OT9A 4ANEA 3GG0A 5CZVA 4OHWA 1TK5A 3UPFA 4X65F 4DG1A 2H48B 1N36J 2E9TA 2R2UA 2JZ5A 3BGUA 2Z4PA 1RTDB 4WFAQ 1PGZA 2QYCA 1QDUB 2MY8A 1VQ7S 2IMWP 2NPFA 3MMCB 3BSAA 1C4CA 4ECZA 5B09A 3AH6A 3GCXP 1T05B 2YNGB 4FF4A 2HFNA 4NEZA 1JB0C 4DV3F 3QWUA 1CS4A 3RZAA 5B0EA 4PEOA 5BXIA 3AD8C 4IDKA 3MCSA 2C3YA 1SV5A 3DDIA 2UUTA 1GMVA 3CCSS 1Q8LA 4NI2B 4ECTA 3KKFA 4NWBA 3SDEB 3KK3A 4EBEA 1HWKA 3DM2A 4I56A 4L6V3 3KK2A 5D3GA 1Y3JA 3J81Y 3TZXA 2V4RA 3ADAC 4PXDA 3NGUA 2BW7A 3WBZA 1RKIA 4G6VB 1VIOA 3QATA 1T9YA 1CJTB 2APOA 4DUTA 5J2QA 2N4CA 5EX3A 3G6XA 3OXLA 5KFXA 1Q81T 3MEEB 5HROA 3S8SA 4WFYA 3M8PB 1CJVB 2CG8A 4ETXA 1MROA 3CJTA 3WDOA 2CXEA 4KJIA 4QJVA 2E1RA 4ZOSA 1Q53A 2C3UA 3MM7B 1NKBA 2FY8A 2VH7A 5J2NA 4HTIA 3MR3A 3MEGB 5D78A 4G1IA 2YWWA 5E41A 5E3QA 1Y00A 4O23A 1EIYB 1KTVA 1KQFB 2VHGA 3GWCA 2P9GA 3ENQA 1OSDA 2MEWA 1S1VA 2PE8A 4NL5A 5EN1A 1C1CB 4B3SF 4FNIA 2DNNA 2HBYB 2ACMA 4JI5J 1WC3A 1JLBB 2KXHA 1VHIA 1KC8T 5HAOA 3P6YC 3D6HB 4OYZA 2DR7A 4ZP6A 4OZLA 1N8RT 2R7TA 3QJJA 1LFPA 4ZITA 5BYSA 5M2PA 3H59A 1SC3B 2AX1A 1HWJA 4F26A 3UN2A 4DV1J 3PX0A 1U1KA 2RUSA 2BANB 2DY9A 5A76A 1MW7A 4ZCKA 2ZHOA 3DGVA 1ZM9A 4LRAA 1B7FA 2F8MA 1HMVB 1KEKA 1HWUA 3UWTA 5L1IA 1NHUA 3ET6B 2GZOA 4LF9F 1S48A 3AA9A 3H98A 3O5TB 2HNZB 4MFBB 4X4QA 1M90T 1Y11A 1SJQA 2FVCA 4DR7F 2IAJB 2GQQA 1EX8A 3U1LA 3IR5B 2X1AA 1NJXA 2BKOA 1OYDA 4PG7A 4AXJA 3OR2B 2D74B 5KT7A 4FPIA 5D0HA 4JYAF 1WNEA 2JC0A 3H2VE 3N9UC 5T41A 2E5LJ 1FJ7A 5HMWA 1OWXA 2HK3A 3KLGA 5EX0A 3US5A 3C6UA 2HZVA 3N28A 4LF7F 2ZC3A 2H4YB 2VONA 3JYTA 1GXLA 1NO8A 1X4CA 1HR0F 3MUMP 4LF8F 5J1PA 1I94J 4RZRA 4OX9F 3AJDA 3E01B 3CVKA 2ZBCA 9ATCB 1W25A 4ZLNA 2EKYA 2DHHA 4DR4F 3SCKE 4FDFA 3MF5A 1NK6A 2RHQB 5D0RA 3NS7B 3QT7A 4Y00A 4FS2A 3CCQS 1RB0A 2DO4A 4OQJA 3UD4P 3RU0A 1XR6A 4UW2A 2RJZA 1HWLA 1G3OA 3T6JA 4OYBA 5G0RB 2VG5B 4C48A 4M63A 5KFOA 2HQ3A 1FJGJ 1S9FA 1X7VA 4LMZA 3FMBA 4KHRA 5KFLA 4DPWA 1NM2A 3QWPA 2AHOB 1XR7A 1B3TA 1RJJA 2GJIA 1OJ4A 3FGVA 3VZIA 4UY8T 1HPZB 4DU7A 4USIA 3HT3A 4QWAA 1HBNA 3AD9C 1TELA 3S01A 2C2OB 2BYCA 1T05A 1CC7A 1JMTA 1GXTA 2R2SA 4B9MA 3L95X 3GSIA 1S0OA 2QLBB 1MMDA 2GHWA 3QQCD 4U8YA 3G4SS 3SCJE 3M8QB 4Y0FA 4KE5A 4L74A 3MR7A 5BR8F 2CQIA 5KFJA 1GT8A 5IS2A 1MWQA 1UEKA 2EC2A 4NI2A 2YX1A 3SDEA 2IFXA 1RBOB 3F41A 4XIUA 4B9SA 3PYFA 1Z2ZA 4OI1A 2AJ4A 3IO1A 3WQPA 2BE2B 3EVWA 1X9MA 3FJ2A 2JLGA 3M8ZA 2VFSA 3X3UA 2ZUGA 2AJ1A 1J2VA 4KHPJ 1OQ6A 3LTOA 2OPPA 5SUHA 3AXKA 3IAS9 2FPHX 4S0MA 1M5SA 3BQ0A 1UCNA 2V67A 1GXUA 2W8KA 3GB0A 3M8PA 5ETNA 3GCWP 3UNYA 3KLFB 4QW8A 2CQBA 1VK3A 4B3RJ 1YJNS 1TKXA 1WC0A 4NASA 6FDRA 3HVRA 2B56A 4WU2A 2NSCA 1NK7A 1KS2A 1X0PA 4TYAA 2W9CB 1UP1A 1MWYA 2OPSB 2N3LA 4IYQA 3MAAB 1E6YA 4KQZA 4GO5X 1TL7B 4QIGA 1BQXA 3Q24A 2HS0A 3EPGA 2HBZB 1SPBP 1VQ6S 3CCJS 1VQYA 1IR2A 1V6HA 2W9BA 2XNRA 2OHDA 1JLBA 4WKYA 4X4NA 3DHXA 3HI9A 3M7VA 4IOCQ 2E7VA 3MM5B 3ZZPA 3I5CA 1U1PA 1YLXA 2E5IA 3Q2TC 5D4OA 1TFYA 4U95A 2QL5B 5KG5A 3UVJB 4O3OA 2Z56B 5GADU 4DQRA 2BANA 1RA7A 5EGYA 4QCLA 1O8BA 3UNGC 2OD6A 5KFRA 4HHJA 4GKJJ 5L9XA 1PKUA 1HMVA 1RQ0A 2HQDA 2GFFA 3ET6A 2YNHB 4ID8A 1Q5YA 1H2VZ 4TY8A 5A6WA 5H9FK 4ZVRB 4HHUA 2HNZA 4MFBA 3QLHB 4OZ2A 2IAJA 4LR7A 5E3CA 1HD1A 3HXMA 1WEYA 4IO1A 1WACA 3BGOP 1S6QA 1E6VB 3Q8PB 1JKHA 1NJYA 3DCAA 5THWA 3EVMA 1RCOB 1U02A 5KFNA 1Q78A 3WIUA 3CCWA 2LEBA 2MB0B 4Q44A 2XCPA 2YKPA 1F9FA 5K8MA 1U09A 1LW0A 4LUBA 4UQTA 6FD1A 1X60A 2G2ZA 4QR1A 3P3DA 4WYLA 2CIMA 2RUGA 2Q1LA 3OL6A 4MKBA 1UFLA 2CUYA 2BE9B 3DDNA 5F8NA 2FZKB 2FGCA 4CO3A 1B0PA 4C7QA 3SSRA 2X51A 2DRAA 2E5JA 2CQ1A 2HPUA 3E01A 3TQEA 1HL6A 3JSMB 1N4LA 1RAIB 2RAQA 1YJVA 2GAHC 1OO0B 2DHAA 5T7LB 3EM1A 2YX7A 3QIPB 4URQU 2FJXA 2NXEA 4F2RA 2KFZA 1IBLJ 1K8AT 1SCJB 4ED5A 2HHHF 5HVGA 1P8GA 5AXNA 5G0RA 3H5UA 1JIHA 3GFZA 2VG5A 5D0EA 3NS5A 4HH0A 3I5AA 3N79A 5KG0A 1S49A 5L9NA 3A3NB 3CPWR 2XZWA 4W92B 3DLKA 4DZDA 1B99A 3MMBB 1O6XA 1QAXA 2PA8D 3CCES 1HPZA 4CIOA 5D4LA 2MGZB 3UN3A 2RRAA 3JTOA 3U02A 4O3NA 5KFBA 4OYXA 3HKZD 3LP0A 3OSPA 2I5JB 3D0IE 1XERA 4DL0C 2QLFB 2WVCA 1A6LA 2HQFA 1DZ5A 3M8QA 2Q6BA 4J9VA 2HS3A 2DXEA 2ZKTA 3KHGA 1AB8A 4OZ1A 2C2ZB 2HYIB 2ZVSA 1UJ6A 3KXDA 5I3QA 2AGQA 3KK1A 4Q7AA 3DKDA 1HNZJ 4WP9A 3R7NB 2KZZA 1IJEB 4PXCA 2CQ2A 4NZ7A 4P75A 5K20B 3BJYA 2YTCA 4X4PA 4JV2A 4PWWA 1SC6A 3BO3A 2BE2A 2Y1JA 2NYIA 3B78A 3J80U 2GS8A 1U0SA 2X1FA 1PJ5A 1RT7B 2L3MA 1YJ9S 4ER8A 5D4PA 2VODA 3H2LA 3NAIA 4LF6F 3M8SA 3PY8A 3WC0A 1R0AB 5CQGA 4IG3B 1VRTB 4PWUA 3KLFA 2PEBA 5BJRA 4K50A 5E3PA 1RXOB 1I6JA 5F9LA 2R3VA 1J27A 2FHKA 3ZTPA 4X4OA 5HJYA 2U1AA 2VA2A 2XWYA 5AJ3J 2QN6B 3HPOA 1DQAA 2EFPA 1ZOTA 2YWKA 1S57A 3QMQA 2W9CA 2HLTA 4H4MB 2OPSA 2XI2A 4YQWA 1FX2A 2DH7A 2BJ8A 2ZBRA 4YR0A 1ZZNA 1TUGB 3DGPB 1NDCA 1RCXB 4J9RA 4MK7A 3QO9A 2EEYA 1BGXT 2XSJB 2ZD1B 1NHVA 3H42A 3D3BJ 1HHQA 3OPKA 4R0JA 2NUHA 2CDQA 2UZAA 5IFMA 1V5IB 4CDIA 4WIIA 3EMTA 5IT4A 4QZVB 4OV1A 1Q5VA 3BGRB 2WBMA 4JI2F 1S6PB 1WHVA 5AT1B 2IA6A 4XPEA 3BDEA 4DCOB 3FQKA 5K8NA 4LT6A 5H9EK 1RYSA 3MM5A 2FJEB 1B70B 3G82B 3MEDA 3VGVA 5HSPA 4CP5A 5HLFB 3EXYA 4UOGA 5K8PA 2AMCB 2JVRA 4OMFG 1NPPA 2HK2A 3UVJA 2P2CB 2G1HA 4AQYF 5D77A 1S9EA 2OSQA 2LQBA 4TVAB 2HLUA 3PR5B 4DV5F 5D4NA 4DR5F 1N36F 4OJGA 3M30B 3PACA 4UY85 2AYBA 4ZP9A 2LVWA 1TUVA 4DPXA 1IBKJ 3TZYA 2N7CA 1VJWA 1E6VA 2QX0A 3VGUA 4M1KA 1JLFA 1FJCA 2KZMA 3I31A 4XTTA 9RUBA 4I2QA 3GG1A 3NWRA 3D3CJ 3W2VB 2QMUB 4A4JA 1N5YB 4R5PB 1LOUA 3BN7A 1HYSB 4QPTA 1T94A 3I55S 1VYAA 3Q2SC 4UUWA 3W66A 2F4VF 2F7VA 4DL3A 2J76E 3PYGA 3G87A 2LXUA 4FXWA 1UEUA 2WW8A 4H4OA 3KLIB 4PXEA 3U27A 4PPZA 2C2MB 1UZDA 1GMUA 4WJBA 5L39A 2LDIA 1LFWA 5DGAA 3PZPA 4FXDA 3TP2A 1HNWF 1L3SA 3LGHA 2DR5A 3TNVA 2VL1A 1TL5A 5T7LA 3QIPA 1VQKS 4USTA 2HFOA 3M32B 2YNIA 2BA9A 2UUAJ 4WTOB 2ERRA 5ADZA 3JSBA 2D69A 4ZJQA 4CO2A 3NNHA 3HHEA 2ZNZA 3ETOA 1PCAA 5F8IA 1K9MT 1SC1B 2MY7A 2DNRA 2BACA 3DXBA 4KGVB 2GVDB 4DDFA 3R7SB 1VQLS 1YI2S 2F40A 2LDYA 4IH5A 1FKPB 1V5VA 2YWGA 4F2SA 3TUIC 4BC7A 2HHXA 4I2PB 3PFOA 2IMOA 3RRKA 1T9TA 3MMBA 2WHOA 5BYRA 1BQMB 1WC1A 1RAJA 2AYMA 2MGZA 2F8HA 3MOJB 3H8YA 2AX0A 3SSQA 2E1AA 2I5JA 5CYJA 4CLSA 4LFCJ 4OI3A 1WKKA 2DGTA 4LRCA 1HW8A 2DNZA 1EETA 5KG7A 3H4BA 2KXFA 5GADI 4DR3F 2Q3PA 3IWLA 4W4MA 4ES1A 2QIFA 3CO9A 3CJ8A 3PIOQ 2KTQA 1B7YB 2BM1A 3OFFA 2UUBJ 1KN6A 4WP3A 4K7QA 2MSTA 2YBVA 5CYMB 3T5LA 1S1UB 1F6TA 2UXBJ 2XMJA 1R8AA 2ZBIA 4OZ5A 5KT4A 4ELTA 2UUCF 3POTB 4CNYA 1HI8A 2XYGB 4DV4J 2XYHB 2KRRA 2ZZTA 3FRYA 5HATA 1I51B 2E44A 1RT7A 1YRUA 4B08A 1JLAB 2ZDOA 3R5JB 3BYPA 3NEKA 4IG3A 1VRTA 2QC3A 3UDLA 1OMSA 1CULB 3QT6A 4ZKAA 2CQPA 1UW9A 4TXSA 5KFUA 1Q8KA 2FHOB 2HVHA 4ZJOA 1R89A 3IM9A 4ANCA 1EHWA 2I0XA 2J0XA 4YR2A 3M2VB 4EWTA 3MFHA 3M2RB 4UT4A 1HFEL 2NXJA 2OP5A 4IFVB 4F50A 1H74A 4YB1P 1G4CA 3MD3A 4LR8A 2EG2A 1S7IA 3M6XA 2XSJA 2ZD1A 1AZSA 4G65A 3BSNA 2HEKA 4OYPA 1PILA 3NP5A 1R27B 1U2CA 1JK9B 3BYRA 3HHDA 2Y0SD 1HA1A 3BGRA 4OHYA 3R5BA 3CE8A 1S6PA 2HZCA 2DNGA 1SJ4P 1W2IA 2BX6A 5HBMB 3THPA 3W63A 2LMIA 4MJKA 3MPDA 3LGMA 1R7IA 1RKJA 2KM8C 1V3SA 2WVDA 1DAXA 2CPFA 3GV5B 3K89A 1X9WA 3RBXA 1G2EA 4CH0S 4DSJA 1IR0A 4JI8F 1KQKA 1CQMA 4P9SA 3GIMA 4JBCA 2MKSA 3IMQJ 3NOGA 5E5NA 1FJGF 1VC6A 1HHSA 2VPWB 4M5MA 1OY9A 4EBDA 1YZ7A 4DX8H 2A2CA 1NK9A 2GO9A 4CO1A 4JV1A 3UE2A 5L1JA 1U1MA 1UPMB 4RWXA 2OO4A 2KDOA 2DPIA 3GJSB 1HI0P 1VFJA 5DO2A 5IV3A 2F5GA 2AYGA 4OJ3A 5HO4A 2RU3A 3BF4A 4QBUA 3W2VA 1CLFA 4X66J 2Z8QA 5GAEU 2R7XA 3T1YF 3R2DJ 1GTEA 1N5YA 2BKNA 5KG1A 3G6YA 4ZHRB 3D9BA 3PFEA 4ZPBA 3B4DA 4ALZA 1QLNA 3MM9A 1I3OB 5MLCV 1TQLA 3DMJA 1URNA 3KLIA 3LAKA 2DRDA 3IS9A 1HQUB 1XWLA 2DPJA 2VF3A 5KFGA 1C2PA 5J1EB 4ECWA 2CNKB 4QYZJ 2WVBA 3D1HA 2NSBA 2HBQB 4PQAA 4O4GB 2HHUA 1WDTA 2A18A 2HKEA 2MHNA 3M32A 1QSYA 4JP8A 4KRWA 3K58A 3M2UB 4YFUA 2OTJS 4DMZA 1WOPA 1PSDA 4O3PA 3AOCA 4CT8A 1FI4A 5B0FA 2KRBA 3JQJA 1LV5A 2B4VA 2G0JA 2GVDA 2DNQA 3M1VB 1RP5A 2DNKA 1FKPA 2ZZNA 1OS5A 2BQ3A 3GP9A 1C4AA 3UO0A 3ZXWA 3GFYA 3FMWA 4I2PA 1U47A 2GGPA 4ED2A 2DVIA 2W4DA 3CCUS 2MQNA 1HBOB 3TAQA 3EGVA 3AJ2A 2DR9A 2DTJA 2VA3A 3FBFA 3K17A 2O1PA 1SKSA 3TX8A 4M5DA 3OV7A 1JXEA 3ZZRA 1Q4RA 2FVPA 4MKYA 5GAHU 2D7SA 1MG7A 1D8ZA 3D1OA 1CC8A 4ECRA 1D09B 2GIFA 2EWHA 3EDQB 2VU5A 4LF4J 3RTVA 3TX0A 3SXLA 3CJ2A 3QRRA 1ROFA 3CEDA 2B5JA 4K5RA 1UVMA 4GC7A 4DQSA 4KIAA 5DLFA 5CYMA 1Q1KA 2PDAA 3MOZA 3ENAA 4X4UA 5DQIA 2HGMA 3K5OA 1BWEA 7FDRA 1TVRB 4URSA 3JQMA 1RTHB 2DISA 5IZHA 3PEJA 1FNMA 1LWCB 2UU9F 2ZWPA 4X65J 2AV5A 3ZZ0A 3RR7A 3VV2B 2JL9A 2LU2A 1Q7LB 4RBVA 1JLAA 4NLOA 3W60A 2B0GA 3IBWA 3CC7S 1RAHB 2H3EB 3GPAA 1NJZA 5BYQA 3VCDA 1G6BA 1CULA 2NREA 1JJ4A 1SQGA 5AE1A 4NRUA 2KL8A 2KG1A 1RLCL 1YJRA 1U49A 3GONA 1IM6A 3VAFA 1L5UA 3HK2A 4DV3J 2E9ZA 3FZ2A 3M2RA 3HFKA 1FEHA 5I3PA 3W61A 1GTHA 2AZ1A 5CABA 3Q8RB 2DKOB 3BBBA 1C0TB 5C2GA 1PC5A 4G3IA 3VHQA 1X9SA 3LA0A 4L3KA 3GIIA 5IT9Y 2OGUA 3NNCA 2C42A 2AIRB 2BJDA 5ETLA 1UVKA 5HBMA 4DQIA 3D68A 4PZVA 4OFZA 4LIRA 4ENOA 3CJSA 2W01A 2MKJA 3DRYA 2M3DA 2XMTA 1FNOA 5LXRA 3RB0A 4DX7A 5K8OA 2IHR1 5HQLA 2A1BA 2V8HA 1X0FA 2RNEA 2MQ8A 3DLHA 2ASYA 1WEXA 2D9OA 3PXGa 4ZMMA 2D41A 3Q89A 2B9WA 4QR2A 2JEJA 3B82A 4ZP8A 4ZJLA 1IWAA 2MZRA 2E9RX 3W5ZA 2Z57B 3C15B 3ENVA 2VG7B 4DSLA 5B0BA 2FLOA 5KFIA 3PRDA 1WORA 4ES3A 2GO8A 1L3UA 2K7JA 3DLEB 2OIHA 2XO6A 5AXMA 2HIQA 3DU6A 4DFKA 4K4YA 4P7VA 1LKZA 4A8YA 3W2WB 1Q86T 2HS4A 2W1BA 3FNNA 2R2RA 1ZA1B 3DOKB 1VBKA 3NAHA 1HARA 4B3SJ 4MMOA 4ZHRA 1RT3B 3X1LB 4C0BA 3RW6A 2B9YA 1VC5A 1JJHA 2MKKA 3ZZTA 2PFFB 2ALZA 1R8CA 4BBYA 2JLFA 5KFFA 4PUOB 2BABA 2IA0A 5K14B 1RT5B 4LVNP 3WHIA 5J1EA 3T41A 4IFYA 1FDBA 1RAAB 1LK7A 1FWKA 1NPKA 4D3GA 2AP6A 1AUSL 2LCWA 4O0NA 3R8YA 4LF9J 1FT8A 4I4BA 1H3DA 3BGLA 1FFWB 1F5BA 2AQ4A 2HNDB 1RLDA 1KVIA 1IR1A 3BKFA 4I6YA 2XCAA 1RT4A 3K5PA 4DR7J 1Y7PA 4AL5A 1Q7YT 4LSZB 2DYAA 4CYUA 3HHLD 2KHCA 1S12A 5AJ3F 4ETZA 4EEYA 3M1VA 2ASLA 4NLUA 1BQNB 2F9JA 4YP3A 1OY6A 2QRRA 4JYAJ 2MKYA 4IOAQ 4LRBA 1CBKA 3HZGA 4ZPTR 1HBOA 2R8HA 3NCRA 5LSRA 4GRSA 3EX7B 4NCGB 3UDVA 2C2NA 4LRDA 4LF7J 4EBCA 2J5AA 3EZOA 2EK1A 4NLRA 2J0SD 2CQCA 3BDPA 3GIKA 2C2RA 1HR0J 4LF8J 3EWGA 4L76A 5CCMA 4M5GA 1KDNA 4C6AA 1FXRA 3LF0A 1UVIA 4LBIA 2KN4A 3OW2R 2ZJRQ 4FBTA 4CLPA 1IKVA 3BZQA 4K59A 1WWHA 2H5IB 1S0VA 3EGNA 3MPWA 2UV8G 1ZA2B 1UEVA 3P8BB 2A2DA 3GJRB 2VPZB 3FBCA 4J90A 3OVAA 3KJQB 2MKCA 4DLGA 5ETKA 2V8DA 1TVRA 1DQ9A 1RTHA 5KFAA 1UPPA 2O3DA 2C1EB 3IA0A 4HR2A 4KB7A 1NRKA 5CZXA 4A48A 2BDPA 1RHQB 5GAEI 1TUWA 4NA3A 1QE1B 1ZBTA 2JEIA 1HI1A 3T9ZA 1ZM2A 4JV0A 1IKYA 2DNYA 3GIRA 2JHEA 4GVBA 4QWDA 1EP4A 1KWMA 5G4DA 3BPDA 2WB4A 5DGBA 3TAMB 2U2FA 5EWGA 3TOQA 1TP7A 5AE3A 4DEZA 4Q0BB 3A8EA 2AJFE 3MCNA 5L38A 3KUHA 3Q8VA 1TKDA 2B9EA 4USVA 3ENWA 4YDXA 1S97A 1WG1A 3LWMA 5BR8J 3J7YI 1Q82T 2QT7A 3V4IA 3W1YC 4RUCA 1C0TA 1TAQA 1URRA 3RBZA 4LF1A 1N56A 2X3DA 2XG8A 2OPQB 1VQ4S 5DM7Q 2YQ0A 5DG7A 3HT0A 3AA8A 1H72C 2XEXA 1GK8A 3QT8A 4C98A 3KMSA 2X7IA 4DL5A 3FUYA 3M9NB 3SQGB 4M94A 2MQOA 4CLFA 3C6TB 3FBEA 3CNQP 2GX8A 3MDFA 2XYPB 4DX5A 5H1SV 4FKXA 2ZHBA 3T5KA 3D7SB 4A8WA 4FYXB 4PABA 5C2CA 2FHJA 2C2EA 3NY0A 3MM6B 3KG0A 3EPIA 4B17A 3AOBA 3SCIE 4RL1A 4QU7A 1OY8A 2RB7A 4ATNA 1Y4ZB 5KTQA 3DOLB 3FFIB 4KO0B 4K4WA 3R5GA 2R8IA 8AT1B 5GAHI 2IDLA 1VI7A 3DLEA 1XMBA 1QY7A 3F56A 4ZVHA 1VISA 4EMDA 1RUSA 4ZK7M 3B8HA 3KG1A 2HQIA 4C0OC 1T03A 5GMKa 3DOKA 4RX6A 1S7HA 3HSJA 3WX4A 1RT3A 1S1XB 1QAJA 5I3UA 5DG8A 1RZMA 1N32F 2UUBF 1WG5A 3OVBA 4Q2LA 4RNFA 5GMDA 2UXBF 3GYGA 2VKRA 2YH0A 2MMYA 2G0CA 3KHHA 2ZOMA 5ETQA 4OZJA 3G6VA 2OI2A 3JSRA 3OR1B 5IM0A 5EHHA 4U9RA 1D1UA 2IRUA 4O44A 3ZZUA 3ZTQA 1QD1A 1RHKB 2C2DA 2DCUB 3HKWA 4KR0B 4BLGA 2R7WA 4BWJA 2HNDA 3BO2A 4GVLA 4ZPAA 4PCQA 3DLBA 3LOUA 2MJNA 1IKXA 4LF5F 1H2UX 2FLNA 5HANA 3FQLA 1VQOS 3CD5A 5J1NA 2VFUA 3G9CA 5J2MA 1NJWA 3GFXA 1FRXA 3SSSA 1UVNA 4NLSA 2BRLA 2FQQB 1BQNA 3GYNA 4UZCA 4EYHB 1CS4B 2VIHA 4F7VA 3Q83A 4IDKB 4KSEB 1Q8IA 3DYAA 1NKCA 2OTLS 1CEZA 1KD1T 3Q8YA 4NCGA 4K5SA 5H9FJ 2EXUA 4QWEA 3KK3B 4F4ZA 3DM2B 2NZ4A 3DLLQ 3KK2B 5KFPA 3TRGA 1UWAA 2Z2ZA 1M1HA 3ILLA 4CO5A 1ACMB 2WSEC 1VRUB 4NXMF 2DGWA 1U0HA 5GAGU 3LUYA 1RAFB 2IJRA 1RI7A 4RUAA 1OYEA 4WWSA 2Y1IA 2KB2A 3U1NA 4C8MA 5LSOA 2JWNA 2MDAA 3OFHA 1KQSR 5F3TA 3BBCA 1N5SA 5M2UA 2HZAA 1PBAA 4DL6A 2HHHJ 3SQOP 1RHRB 2LEPA 4OI6A 1RT1B 5B0AA 1DARA 1UL3A 1YHQS 1D0EA 1S77D 2IRXA 3NNAA 2QFJA 2GV1A 4JI7F 2DGOA 1L3TA 3DRPA 2XMKA 3ISND 4USKA 2FC8A 1JLCB 1DURA 1T9VA 5F0UA 3RR8A 2Q43A 2KO1A 2KYXA 1Q8BA 4DHVA 1RDRA 3CD0A 4X64F 4E2FB 2VC0A 1HBUB 3C14A 2ZC4A 3QGGA 4CZCA 1D9DA 4AUKA 4HDGA 3VAIA 4F4YA 5IT0A 2XGPA 2M4MA 4CTAB 3CC4S 2XHCA 3BB5A 1NDPA 3OL7A 2W7AA 2FUG9 4CT9A 2IC3A 1UFKA 4K0KF 2VC1A 4RLEA 2MZQA 5ETOA 1FESA 2VQFJ 3TJAA 2CWXA 2CQ4A 5KG6A 1VGYA 2LQJA 4JUZA 4H4KC 3Q8SB 2DR6A 2RVJA 2V63A 2WSFC 2P5VA 3ZZYA 3IWNC 4KH1B 3R97A 1VQSA 4OI4A 3E3XA 1EAYC 1R0BG 1FKOB 5KFCA 1EKRA 4LF6J 1YK9A 2VDHA 3MM6A 1RE1B 2UVUA 3MPVA 2J0QD 4F8RA 4F0KA 3VALA 2E7XA 2JDJA 4I6WA 1X4HA 2Z2MA 2PC6A 4N76A 4LFAF 1Q95G 2PSZA 2E5GA 1FXLA 3FFIA 2YKMB 4U96A 4FYYB 3K5LA 3PJXA 3C6UB 3OXFA 3CD7A 3CF5Q 1WI8A 5IV4A 4CNZA 4EZ6A 3RGIA 3KHLA 4IRCA 3ISZA 2GIRA 1P9YA 3A8KA 4NMLA 2WTFA 1RYRA 1ZAWA 1HNIB 2HWHA 3N6MA 4ED7A 1S1XA 1CVJA 4JI2J 4MIAA 4ZS6A 3DXSX 3GIJA 1SIZA 3GMGA 2HQCA 2JEFA 1AA1B 2XI3A 1S5ZA 4MH8A 2ZUAA 2L9NA 2HURA 1UMJA 2MXYA 3KTQA 3OR1A 4RW6B 2JFKA 2AF6A 3HLUA 3HDSA 3J80Y 1CJUB 1N88A 5KFWA 3EGWB 4DV5J 4DSKA 3IC1A 4H4KA 4OHXA 4DR5J 1FCAA 1UWBA 2CNLB 2J9DE 2VJUA 3H25A 1XEZA 2YX4A 4QOTA 3T1AA 2WB1D 4KC5A 4DFJA 2DGXA 2HHTA 3BN4A 2EPIA 4CRJA 4DV6F 1HBNB 1JJCB 4IR9A 2ZE2B 4HYKA 1QSLA 3I96A 3QAEA 4RU2A 2ZM6F 2E1MC 4HLBA 2PEHA 2VG6B 3RRGA 1K1QA 1PO6A 2FJBB 1UKUA 1IQZA 3CW2C 2QA4S 2RQMA 3I9ZA 2F4VJ 2QYGA 3S7RA 1B0VA 4CH1A 1OPZA 1KOHA 1NBEB 4U67Q 3KHRA 1GEHA 3A3OB 4OJ1A 4FS1A 2FIUA 4EO8A 5KG2A 1CSJA 4MYUA 1AROP 1RTIB 2HWTA 1VRUA 5FJ4A 1HNWJ 2HSEB 2CJQA 1YKWA 2K3KA 3MMAB 4TQRA 2OPPB 3U7JA 3MAHA 4TKTA 2V34A 1BMQB 3IGVA 4FF3A 3B4MA 2XY7A 4EZ9A 4RW8B 1YRXA 4I7FA 2C3OA 2JRSA 3BO4A 3CDEA 1TKXB 1XBWA 1YTYA 5DZ7A 4URGA 2B43A 3AD7C 1LK5A 1RT1A 4NA1A 3D0HE 2KT3A 1RABB 3K57A 1FE4A 4PWDB 1IKWB 2W8LA 1RBLA 1PJ7A 1E6YB 2VD3A 3I6PA 2XGQA 3T1HF 2B7BB 2VBYA 3PW0A 4OLPA 3JAMY 4UQGA 2L08A 1OPIA 2GCFA 2G2OA 3V6KA 1RWVB 2ZVIA 1RU2A 4H54A 1PIEA 4N77A 1JLCA 1X4BA 1NSAA 1VC0A 2QJ3A 2W9BB 3KYLA 3KNGA 2WCXA 1HBUA 4I67A 3IGNA 5J2PB 4DR3J 3KDOA 2X1GA 5KFKA 5IQ6A 4BWMA 4OZNA 4WZMA 4NXNF 4F4WA 4YB6A 1IQTA 4AL7A 1LXNA 4QYRA 4CTAA 1X4AA 4DS4A 3N6LA 2YQ1A 2BQRA 4CLKA 1X5SA 1ZETA 1BC6A 3UD5A 1NMEB 2UUCJ 1REVA 3ETMA 2D3ZA 3GTYX 1KKHA 4I1TA 4A8QA 4TY8B 3C3LA 1APSA 3J7ZT 2C3MA 4PYAA 1ZM3A 1KTQA 3T3FA 1FKOA 3MTJA 3HHLC 1S6QB 1JKHB 3WX8A 4Y2MA 5AE2A 1WJ9A 4YDDB 1FFSB 1RK8A 1CG2A 4B9LA 3B54A 4CWBA 1RTJA 2MTLA 5B0GA 4WXOA 4UF4A 3BREA 1LW0B 2RD5C 4DL2A 2YKMA 2GHPA 2NS1B 3GZ7A 3FDSA 1FHTA 3I0SA 3R9LA 2CVIA 1RWKB 2MQQA 1KR4A 4A46A 5RUBA 4DPTA 2OMOA 3EZ5A 3M05A 2DHXA 4BS2A 4L75A 3MI7X 1HNIA 1SIWB 2WSCC 4JI4F 1EQ0A 2ZH5A 4DLEA 4AD6A 3FEZA 5DQGA 2FD2A 3NS6A 3HO1A 3FCWA 2XB2D 4ZIWA 1YIJS 3D5MA 2HHWA 3R1HA 4JI0J 4RW9B 5KAKA 2I9SA 3QJLA 3LAMA 3N01A 3PX4A 5JXSA 1YQHA 4CH7A 1TL4A 4ZPCA 4A8OA 4Z2XA 4RW6A 2M5YA 4E8UA 3GSDA 4JI8J 1JQGA 2MJUA 3R3TA 1CJUA 1NDLA 3CTRA 2DT9A 4MTPA 4I64A 3TR5A 4JOUA 1J5OB 1OIAA 4M5LA 4DSEA 2BJ7A 3D6FB 5E3RA 4C97A 1D9FA 3AFGA 3TA0A 3DLKB 3D67A 4LVOP 5LMNF 1ICEB 3HHLA 1HBMB 2ZE2A 3OTEA 2E66A 3LP0B 4WIQA 3O3LA 4NLYA 1RACB 2GA7A 2YKOA 2POKA 4R8UA 3G2XA 2B8QA 1H73A 1AFJA 3QAUA 2VG6A 3KUEA 3T1YJ 3H0PA 3CT9A 2UXDF 5KFYA 4N7TA 4EO6A 1B0TA 5LL6d 1S0NA 4LQ9A 1MN9A 1NZAA 3RYLA 2GQCA 3I56S 4NCAA 2DIUA 2DITA 1RHUB 3KK1B 2UXCJ 4OX6A 3HM9A 3IG1A 3T5HA 4HH1A 3JTPA 3OTOF 3CCRS 1IXKA 4JI6F 1RTIA 4BCAA 2OSRA 4B3OA 4TU7A 2BVZA 4F0MA 2ZH6A 3L3CA 1XNRF 3MMAA 1IUJA 4Q8FA 5ETMA 2B7CB 2QMXA 4A8SA 3SV4A 2IPOB 4RW8A 1WHXA 3UD3P 2MKIA 1H38A 1S99A 4DFPA 4PYDA 2N3OA 1TV6B 3UI3A 1FFGB 3MCOA 4IQMA 2VPYB 2QE5A 1N48A 1IWGA 3MZIA 2WRMA 2CAJA 2DBBA 4KBIA 3IFEA 3RUBL 4PWDA 1IKWA 3HSDA 5HVHA 4M5NA 1S6UA 2Y9HA 2IM3A 1HWIA 3QO9B 3MTKA 1PJ6A 1H0HB 1SVDA 4F4AA 1RWPB 3DC2A 1X8DA 4LSLB 2O67A 3S6EA 3AY0A 3QPIA 2Z2YB 5J2PA 3ZNUA 2YKNB 1VQMS 2Y3YA 5DRKA 3A8IA 3UDCA 1VIXA 3MEDB 3MUTP 3AT1B 2XS7A 1YWXA 1IBMF 4C11B 3EXCX 3UN5A 1XTZA 2QLXA 2DB1A 2Y0BB 1S9EB 3TYTA 2K1RA 2DNPA 3W9JA 2OELA 4FKYA 4J9KA 3GYXB 2ACYA 4X4TA 3NWGA 1LW2A 1RBAA 3KLHB 4DS5A 1J5EF 4J9LA 2UU9J 2GVZA 2V8PA 1FD2A 1RWWB 1S10A 1A0OB 2V2VA 4Y2IA 3MHYA 3K5NA 4KGXB 3KJVA 1JLFB 2YNFB 2VPXB 4Z37A 4L73A 2IJFA 1DTTA 1S72S 4I2QB 2IVMA 1U1RA 3TZWA 2NCKL 5A8WA 3OLAA 2H4WB 2HGLA 1SI9A 2ZBQA 3TVYA 1T3NA 3R2CJ 2UUWA 1UA1A 2BJ9A 4X4VA 2NUUG 3CC2S 3DLGA 3GJTB 2Z30B 4ED6A 4R25A 2N4DA 4H4OB 1M1KT 2DGUA 1Y9OA 2LP4A 2QG9B 2W2NP 2AW0A 3P5BP 1YRTA 4B9VA 1TL3B 3AB4B 2PGCA 4ES2A 5F3ZA 5EDWA 5SZTA 2XQCA 4J9UE 2CQDA 2ZOFA 3CO0P 4F3QA 3HZEA 2J6SA 5HI7A 4X4SA 3V2UC 4F02A 1MU2B 3THVA 2B4UA 2DGSA 2YNIB 4DFMA 1UFWA 4RW9A 5KFVA 4QR0A 4DF4A 2H5JB 4USUA 4C8LA 2AT1B 3DDKA 3R5DA 1WSVA 3MFIA 1WC6A 2G1DA 2AEJA 4ID5B 2JEGA 3IBCB 2YWFA 3RAQA 2BEFA 1UA0A 3W9HA 4HT5A 3TZZA 5F41A 3G86A 1GMWD 1J5OA 2MPUA 1FWPA 2RS8A 2YH1A 3ZFVA 5KFZA 2RMLA 3HD1A 1NAQA 1P1TA 1WKJA 2CQHA 3VAGA 2VBXA 4P74A 3D54A 3ISNC 5ETSA 1Y10A 3BEGB 2RE1A 1HBMA 3ZTRA 3BKUA 4D3HA 1MWZA 3CDBA 2XZTB 1VQPS 4ZVOB 2W7OA 1GX6A 1PYOB 4ILLA 3O8WA 2MQMA 1NKEA 4NLTA 4AL6A 3CDWA 1UAWA 1LWFB 2I8EA 1EETB 4CLYA 3D28A 2CPDA 4QYZK 3AXMA 3LO3A 2ZJPQ 4UTGA 2Z2LA 3AQPA 1MNEA 3RRHA 3FVYA 4ED0A 2V2KA 2FZCB 4KT0C 3BH7B 1KRPA 1TL1A 1NUEA 4HVZA 4ZN1A 4PG8A 3MEKA 3QFHA 2VQFF 4R0EA 4WPAA 3J7Z5 3DN9A 1JLQB 3QRPA 2R7QA 2KFYA 4M5IA 3PYEA 4K4XA 4O3RA 1Q16B 3DOMA 4PAAA 2RIJA 4FZVA 2B4OA 2OEMA 4P7TA 4UOCA 3PV8A 3CJKB 3IRWP 3OFEA 1Z1ZA 2WBRA 2JLEA 4Q43A 3PM9A 2P6SA 5C42B 3VAMA 5LMUF 3UCGA 1TV6A 3R6LB 3KDNA 3W9IA 4MKVA 2ILZA 2AJ0A 5GMEA 2QA2A 3HHKA 5FD1A 3BR8A 1WF2A 4DV2J 4ZVTB 2IBKA 1H7XA 1KOOA 2EG1A 1AZSB 3J7A1 3VZHA 3QNWB 2XMVA 5KT2A 4WF9Q 2KG0A 1M5PC 2LQ9A 4B3MF 4GO7X 1WUUA 4LSLA 3T6BA 5FLXU 1QUPA 3VGTA 3MXHP 1I5OB 2J9DA 3VAJA 2QL7B 2YKNA 2VFTA 2QLWA 4DR6F 2DHGA 4C3MA 4DR1F 2QV6A 1ZZFA 2F1FA 3ILJA 2R2TA 3OXGA 1N6QA 1F1BB 4C11A 1M1GA 2CJBA 1KHVA 1VRQC 2CPIA 3OUYB 2YPYA 3RG6A 1N5TA 5C25B 2XLIA 2RU9A 4O3SA 1NSQA 3DRXA 1R6VA 1UTAA 1W26A 4P72A 3KLHA 4IRDA 2CKWA 4N56A 3CJ4A 4G1QA 3OFGA 3N5FA 4DCJB 4DPYA 2FLPA 3L7OA 1K44A 4RNHA 3FBBA 2P6TA 1GH8A 4DCPB 3QZ7A 1B4SA 1VLOA 2YNFA 1HW9A 4F0HA 1KLNA 4YHHF 1FE0A 4CLZA 2ZH2A 3DI6A 2HRUA 2V2QA 4C8OA 1KVKA 3GR1A 1R31A 1Y5NB 2PN6A 4FNHA 4WFZA 3E51A 1VCTA 4PPDA 3TWZA 3QSIA 2DJWA 1GX5A 3MM9B 3A12A 4HACA 1MMLA 3O44A 4ECSA 4J9NA 3DMJB 3T5JA 5JMNA 3IS9B 3CULA 4KHMA 4OYWA 3MR5A 2M8HA 5B0CA 2DXFA 2YKQA 2RQKA 1VDHA 1TL3A 1NCLA 1PYTA 2ZITA 2WZ1A 2CNNB 1X5TA 5KG4A 2RRNA 2R7VA 2NR0A 1MU2A 1FX4A 1V3ZA 3PG9A 5C24A 1TTHB 1QTNB 4TYBA 2KM8B 3MD1A 2GQ2A 4Z7YA 4RKUC 5F9NA 1XNQF 1UETA 3ZTOA 4ID5A 4HHHA 1R3NA 1F5CA 2BUNA 3ILOA 2FVQA 3N5BA 3BH6B 4KAIA 1SKUB 3DFEA 1JX4A 3NLCA 4QIWD 3EVOA 4C2MA 3K7RA 3NCQA 2GGPB 3L7UA 4M8LA 2LA6A 3C16A 4P52A 4N8OA 3ZTSA 4WZQA 3BQ1A 3E8OA 3C8YA 1AW0A 2XY5A 1JLGB 2RILA 1TKZB 4YOEA 2MZTA 2QSWA 4M5DB 3AHPA 3CDAA 4NZ0A 1LWFA 5E7OB 3BGFA 1F2HA 2FJDB 1X4GA 1DTQA 2FHMA 2Y1RI 3VTIA 2YKAA 2D9PA 1A7GE 1N32J 3CJQA 2B5JB 5A6PA 1P1LA 3I0RA 2BMBA 1WEZA 2UV8A 2HMIA 4IR1A 2DEJA 2WVFA 3VAHA 5ETRA 2IDEA 2C28A 4KPYA 1OQ3A 1FTCA 3PW2A 1S9GB 4MIBA 1GFWB 1XMQJ 1JLQA 4ZVFA 1FJEB 4B9TA 2PMZD 4K2JA 5B0DA 1IVZA 3PIPQ 2YXLA 3VGSA 2LKZA 1N0VC 5A2QY 1BE4A 1U1QA 3WC2A 4I68A 1HHTP 1U2FA 3K59A 3RW7A 3TUPA 3CJKA 3BSCA 3OTBA 2B8PA 5KFEA 3HP6A 2ZH3A 1TMMA 2DGQA 4QIVA 3GQCA 2XULA 4LF5J 1DLOB 5C42A 1SL0A 3QGPA 1PYSB 2OJ3A 2LYVA 1KFDA 1VQ8S 5KT6A 4YY3F 2EBEA 2I6WA 2J0WA 3HVTA 2ZH1A 2ZNYA 3R6GB 3D4JA 3K8WA 1ZTWA 4QIEA 1KHWA 2RDIA 4EFAC 5F8HA 5IC6B 4ZCIA 3CCVS 4JI1J 4LFBF 2RKIB 2VICA 3MR6A 4RJVA 4C3KA 1NEEA 4DL7A 2R7OA 1QM9A 4MK8A 1FERA 1EKSA 3SI8A 2KJVA 2EK6A 2Q79A 2IM2A 1WSRA 3H40A 1WF1A 1X4DA 2KYZA 2V4JA 2BV3A 3KFWX 3CGIA 5IOLA 4JI0F 1ZTTA 4NXMJ 4UUXA 3I4HX 1X4EA 4OYIA 2XMUA 2HAIA 2BOPA 3ZZZA 4DV7F 5KFHA 3LP1A 2V5HG 2E7WA 2DNOA 5U47A 3OUYA 4NEYA 5C25A 2XLKA 2OUGA 4X62F 3NGDA 4PR6A 5ETPA 3RB4A 1F9HA 2V6AA 1N54B 1T95A 4N8NA 2K8GA 2VDIA 1Z2LA 5E33A 1SH2A 4RR5A 5DETA 3D1QA 2MYFA 3W65A 1UVJA 1T9UA 3CMES 3EZUA 3TANA 4JI7J 4AE5A 3D6TB 1UZHA 2BXJA 1OSCA 1HQEB 4USWA 2IVYA 1WHYA 2PMHA 4ZCLA 5HK4A 2OPRB 2O01C 1RHJB 1RTDA 3FK4A 2A0FB 1VBZA 4ZLJA 2MLZA 4DR2J 3F0NA 3H5XA 5B08A 2V50A 2ZH7A 1NH8A 4X64J 3SMZA 2ZH8A 5HP1B 3MMCA 4CLUA 5HMYA 2ATLA 4V19J 1KBRA 2YNGA 3QYYA 2UXCF 1VK8A 2BRKA 4RNOA 1U1LA 2HRTA 2DNHA 3W5YA 5K9FA 2V8VA 3GE9A 1WELA 2NXNA 4IFYB 2CA9A 2RDJA 4K0KJ 5LJ3Y 4ZCMA 4FVMA 3KMQA 4XK8C 4JV5F 1NLKL 4OHVA 3LH2S 3BSOA 2GMHA 3N0VA 5LOQA 4C9DA 3MURP 2AWZA 8RUCA 4DSFA 2HIYA 2DNLA 1NK4A 1KP6A 1WC4A 2D3OR 1ELOA 4N5SA 1U1NA 2YVSA 2OFGX 1RT4B 2VZ9A 4HKQA 2QO3A 1ITPA 4OZ0A 3JQKA 1RISA 1HNXF 2IIHA 4CYUB 3OL8A 1CJTA 2FDNA 3OBIA 4QWCA 4ANDA 4K4UA 4DF8A 3NKYA 1H2TZ 4P73A 1EZZB 2GJFA 3MEEA 3TJ8A 4C0HA 3ZC4A 3PRVA 1CJVA 3LWLA 5KFTA 4LFAJ 1AFIA 2C22A 1WKLA 3Q8QB 3QGIA 2HVEA 1EQMA 3JTNA 2DIVA 1JLGA 1U6ZA 5E2QA 3MM7A 1VJQA 3IRXB 1TKZA 3MEGA 4KYZA 2JJ4D 3P96A 4TLRA 2W2MP 2KHDA 4AYBD 4FP9A 1F2GA 4K2XA 4LSNB 6AT1B 1VBXA 1RWNB 2PA3A 1IKVB 3NL0A 3HULA 3FSIA 3PX6A 1C1CA 2AZ3A 3IR6B 5ITHA 4K4TA 1S9GA 2G4BA 1WOOA 2CPZA 2V8GA 3CJ0A 2W25A 2NZCA 1RA6A 5HQ8A 3LPYA 2DO0A 1XK8A 4LREA 1YBTA 4RNMA 3W5XA 3PO5A 4DUYF 2ZOGA 2J6UA 3H20A 3M9MB 4IUFA 3QIDA 4HL9A 1TK8A 2H9ZA 4PG5A 1SBRA 2BOAA 4P2FA 2BZ2A 4ZPVR 3ZO7A 1IKYB 2HHSA 4GVBB 1DLOA 4F3MA 1EP4B 1ZPVA 2AU0A 1DFDA 1FEEA 3CJ3A 2KT2A 4DV6J 1SH0A 3LGNA 1IN0A 2KH9A 2Z58B 2ZM6J 3UR3C 3CCZA 5L8RC 1O5JA 3ULHA 1BUXA 3OR2A 3WIVA 2ZBPA 1S1TB 5DLGA 1YX2A 1D3WA 1NHKL 3V4IB 1YJWS 5JVHQ 2RKIA 3MAQA 3MGJA 3IM8A 1FRJA 2RQ4A 1Y3KA 3M6UA 3T19A 3I82A 4ZPWR 1R0CB 2F8EX 2W24A 3VAKA 2M9KA 4XDDA 3RAXA 3V4MA 4XPCA 1DRZA 1BHNA 4O0IA 1UW4A 4NYOA 4PXBA 1EB0A 3P5TL 1RADB 3I87A 2XHWA 1M0SA 2B6AB 2PT0A 1MN7A 2ZDPA 1RT6B 3ONQA 4LJMA 2OFHX 3NGKA 2NLWA 4CM0A 1YJTA 2R4FA 3BV8A 3E2EA 2WOMB 4B3TF 3TA2A 4ILRA 2OD4A 4DUZF 1WF0A 3VWSA 3Q86A 2L41A 4TU9A 2Q66A 2QFIA 5I4MA 2XS2A 3PNIA 2V9WA 1ZS6A 5JJBA 2AEMA 1M5VC 2XS5A 2EFNA 3T1HJ 4U8VA 4HI1A 4NLWA 4J9MA 2F63A 2V0NA 4KGMA 3SIPB 3MR2A 2UP1A 4DQPA 1BD6A 1HQEA 2QA1A 1YVFA 1KSPA 2EBGA 1RTZA 1SXLA 1A9NB 1T03B 1UVLA 2OPRA 1MSWD 2ATCB 1JJ2R 2PI4A 4KFBB 3C46A 3TVZA 5KFMA 5I3UB 3EGZA 5HP1A 3EE3A 1ZM4A 4TQSA 4HTJA 4Y34A 2AYEA 4N41A 1WI6A 4NXNJ 1SJ1A 5LT5A 2KKHA 1JXVA 4KGKA 3CUNA 2M52A 2L48A 5AXKA 5KFQA 5IM0B 2AKWB 2W4PA 4TNOA 3N6NA 1N52B 4AXIA 4O44B 1T9WA 1H98A 3TJ9A 2CNOB 4JI3F 1MLAA 1QVGR 4PG4A 2K06A 1FXDA 1FKAF 1O0PA 1IKXB 1DBDA 5EWEA 2LU1A 2EC0A 3RAMA 5J2MB 2RS2A 3SFGA 1N34J 4WCEQ 2J7WA 4Y2AA 4F25A 1YBAA 1QSSA 4NMXA 4QPXA 4DV2F 5EUHA 4DL4A 1GMWA 4NLPA 5FDLB 5C5JA 3HVWA 1WOSA 5FIIA 4M5KA 2ASJA 3DYAB 3KJNB 1TFWA 4WXWA 3RB3A 4NYPA 2DK2A 5E0OA 1XQIA 4DV0F 2GNKA 3QGHA 3IRXA 2BR0A 3OL9A 1RU1A 1QAYA 2EVZA 4OI2A 3MAAA 3CSKA 3PTWA 1LQ9A 4NLXA 1TL7A 4RBTA 4F67A 1NK5A 4LSNA 4JI4J 3R27A 3IAM9 4FVCA 3OVSA 1U0HB 3J81j 2MHEA 4DWIA 2HVZA 3J81U 4RO0A 1N33J 2FVSA 1T3OA 1FA0A 4QWBA 3IXQA 1JLEB 4RUHA 2VOPA 4ECQA 2LQ8A 2WK4A 1TZ0A 1F5AA 2CADA 3CMQA 4DPOA 2XLJA 4K4SA 3FEYB 1TR0A 3EICA 4V1Ak 1HNVB 2PI5A 3Q0AA 2WAQD 3DRSB 3G8TA 2DR8A 1R43A 2FHJD 2IM1A 1KVJA 3S1TA 3DRPB 2YNHA 4ED4A 5KOXA 5DDRC 4RWWA 1FO1A 5LMNJ 2R8KA 4ECVA 3ZZOA 5DDPC 2VJVA 3QLHA 5IWAJ 5HVFA 3TUZC 5L1LA 1N5QA 1NDKA 3D66A 3JAMU 3KG4A 2LECA 2C2KB 3KUGA 4N47A 2B3TB 3C14B 2UXDJ 4NYZA 2IVFB 1S1TA 2IM0A 5F8LA 2H54B 4TY9A 2HRYA 5CHCB 3M9OB 3MPYA 2VBWA 3D6MB 5IXUA 5L1KA 2IC3B 1PBUA 2XMMA 2I2YA 2LFVA 1NB2A 4P10A 3OTOJ 2PD1A 2OEKA 2XSFA 2CYYA 3J7AN 4JI6J 3CD6S 4WTYA 2MZJA 1P27B 4EU0A 4TU8A 2NQPA 4YEAA 4V19X 3W7BA 1XNRJ 3W64A 2CJAA 2K2PA 1NZ8A 4FXVA 4KY3A 4K8RA 4Y6IA 1PG5B 3LQVA 2GHVC 2B6AA 3DRRB 2RRBA 1RT6A 2PO4A 3JSMA 2V2ZA 2B51A 3SZ2A 2M7SA 4ZPDA 1RWOB 2NXUA 2XMAA 2WOMA 2RDDA 4Y65A 3PJ9A 2E5HA 4A8XA 4RW7B 1YITS 2KT5A 2BE7D 2UVVA 4I69A 3P49B 3W3SA 4W90B 2XY6A 2IYIA 2AGOA 2N7YA 2ADBA 3BKTA 5CYQB 1FVSA 3BS9A 2LEAA 2CG4A 4KFBA 2QTWA 2HFUA 2CPEA 3TQ1A 1Z4UA 2FTRA 3V6DB 3OSNA 3I9V9 4U7UD 4JI5F 4ECUA 5F8MA 1CQNA 2R9LA 2ALYB 3JSYA 4IO9Q 3KNAA 4C8YA 1U6FA 3PR4A 1XMQF 1IBMJ 2NXCA 7AT1B 4USHA 1FDDA 3H4DA 4HI2A 4Q2MA 3EYZA 3NG8A 4DV1F 1VQ9S 5A8KB 1UWBB 4M5HA 4NLVA 1J5EJ 4L72B 4X84A 3CWJA 1T11A 5LJ5Y 3FRZA 4RBUA 3QJPA 2CWKA 4DSIA 2VASA 4C4WA 1G7CB 1X4FA 1SB6A 1D8YA 1WG4A 2LLZA 1QUVA 2BKPA 5FDLA 2X1BA 3PDNA 2J8AA 1ZH5A 2CVEA 1R0AA 4ZN3A 2P9CA 4CI0B 3PHTA 2CQGA 1S0MA 4JI1F 3QFWA 3MECB 2MQLA 2VUGA 4P6QA 1WHWA 1U2RA 3PEHA 2E5LF 2R7RA 4MT1A 2CJKA 1KNZA 2VQEJ 4H4MA 4KH0B 3DGPA 1V9OA 2GW8A 2AJ2A 4O3QA 3NMRA 4WFNQ 2KFNA 2MKHA 2JC1A 1L3VA 1I94F 4NCBA 2BM0A 2CQ3A 3L09A 1VQ5S 1XMOJ 3PO4A 4ED8A 3D0GE 1N0UA 1JLEA 3HD2A 5HMXA 3BQ2A 5B7WA 4I7FB 4JB8B 1LWXA 4ZLLA 4RPFA 3M8YA 2XZDB 2LXFA 4YUDA 3G82A 5HLFA 2V69A 3QBCA 1SQEA 2W9AA 1VS3A 1TU0B 3K2YA 2JH3A 1Q0NA 5F8JA 2A3JA 1S4EA 3Q23A 1HNVA 3UCUP 3CJ5A 3DRSA 2ZFHA 3KLVA 4Q45A 2N82B 1HIYA 3IBFB 3K5MA 2BJ3A 1Y0HA 2VV5A 3G96A 1FDAA 3A13A 4B02A 4RUBA 3M30A 4Y2CA 4E98A 2ASDA 2JOQA 2XO7A 4DU8A 4KV8B 4X4RA 5F8GA 2QA4G 4DR2F 3FSYA 3PVXA 3PHEA 3M4XA 4YB5A 3D2WA 4ZIVA 1TK0A 1JXLA 3V81B 3BPSP 2Y8WA 4R5PA 3QZ8A 4MKAA 3KJFB 2GAGC 3CCLS 1HYSA 4W98A 2H51B 1RAGB 1L3KA 4GKKJ 4CO4A 1XR5A 3NCPA 1NSPA 5DDQC 1REVB 2O5DA 3R1LA 2QLJB 2C3PA 2XTJP 2K7KA 1F3VA 4WK1A 3DRRA 3HMJG 3TEGA 3GJQB 3J7YU 2ZEJA 2H1YA 4MYTA 1JWWA 4KHPF 2ROGA 3TVKA 2E29A 3PCOB 2OMLA 5LMUJ 4WKRA 1NK8A 2KXNB 4BDPA 4WE1B 2OLWA 2MZ1A 1T8EA 5I42B 2GIQA 1EJ7L 3LANA 2OAUA 4RW7A 1FVQA 2ZZMA 1RTJB 3B6BA 3ITHB 4J9SA 5D0GA 3GILA 4B3RF 3LP2B 4ED1A 1FWLA 2BBEA 2HAFA 2HHPA 4IG0B 3I0SB 2WVEA 2EI5A 2M8DB 2HBRB 2BJ1A 5CYQA 1Q79A 2OH2A 3GFHA 3LW5C 4QU6A 1FRKA 4Y28C 4B3MJ 2W2PP 2MZSA 4ZVEA 1BQMA 4EI2A 1RSCA 2Y1LB 3MMJA 2G13A 2CJXB 1R8HA 3V6DA 4NE9C 2YY3A 4ELUA 1VBYA 4DR6J 4DR1J 1FTRA 2AGPA 1WDDA 2MLXA 3CIMA 5DDOC 2EFOA 1F0XA 2DXDA 2VKZG 2AD9A 2J9CA 3NOCA 4U6PA 2JFDA 4FN5A 2VB6A 1YG0A 5JVGQ 2ROEA 4TN2A 2RF2B 3AOAA 5DS7A 1S1UA 5A8KA 4EK2A 3H7HB 2KVQE 1ZPWX 4NX9A 2J6TA 4GKJF 3PKYA 3OJUA 3FSXA 3POTA 4C3LA 2YWEA 1NJIT 2CZ9A 5LM7E 2D3UA 5H9EJ 2CJ9A 3HHLB 3K8VA 3AAWB 4CLWA 4DI6A 3M6VA 4YHHJ 1VQNS 3TA1A 4R8UB 2I38A 1H7WA 3VQTA 1S6OA 2X3GA 1LWEB 2GJ2A 5LXYA 5E3AA 3VR1A 1K0TA 4F04B 5DZ6A 1W2BR 1WD6A 3MECA 3G8SA 3CDUA 2OKQA 4NA2A 3CXCR 1C0UB 3A8JA 2XNQA 3KLEB 3M2VA 2HHVA 2RH3A 4I0WA 3IG1B 3HFVA 3TEHB 1U25A 4IFVA 1TMJA 1KFSA 2OEJA 5T14A 5FLXY 3T9NA 4B3OB 4F4KA 1CJKB 3TW0A 3O2IA 3H5SA 2JNJA 1G1XA 4PG6A 1FK9B 1U4BA 2YQ3A 1SJRA 4J7CA 1U1OA 1SJFA 4CCHA 4FYVB 2M0GB 4LF2A 2Y8YA 3OLBA 2V4QA 1RAEB 2ZH4A 1XNQJ 4DJBA 4P2XA 4WP8A 1TAUA 4OYAA 1REGX 3FCHA 3FZBA 2BJEA 2EW9A 4O4RA 2G2YA 3THTA 2ZKUA 2GC8A 4NOHA 4ECYA 1VHFA 4UZBA 4NLGA 3GR0A 3SCLE 2J8SA 1IBLF 2F3JA 4PRFA 2BW2A 3IWXA 1TKTB 3A1YG 2PMWA 1R6YA 4CQ1A 5CXTA 2EFGA 3JB9k 4C8ZA 2RT3A 3ICLA 2M2BA 1WTBA 3CCMS 3EDRB 1M5HA 3PKMA 1VMBA 2R8JA 4KKOB 1S4FA 2KJWA 4KV8A 2IRYA 3JS9A 1NU4A 2VFRA 1KLMB 3HF5A 3HJFA 3HCXA 4QQBA 3KOAA 1YJ7A 3RB6A 3QSYB 4DPUA 3K0JA 1RT2B 3M8WA 2RSQA 1AYEA 4WFXA 1FNXH 4DBQA 3W8GA 4YMEA 2FYXA 1JNZB 2DRBA 3RBDA 3V81A 2DCLA 5L46A 3FCVA 1V3RA 2VBZA 4F4XA 5EWFA 1CPZA 2DEIA 4IKAA 5MAOA 1FRLA 4ITSA 1K1SA 2BQUA 1HQ2A 3I4PA 2GMLA 1UJ4A 3OHBA 2K1RB 2FC9A 4C8KA 3CIZA 4DX6A 1DHMA 1S59A 2GMJA 2ZWOA 1HNZF 3DU5A 1LW2B 4CM2A 4NPOA 3VF0B 4P2SA 1HQUA 4CO0A 2GVZB 4YB7A 1FRIA 4BC9A 1FRHA 3A3PB 1N34F 3IP0A 2R42A 2P9EA 3KJVB 1K47A 5IQQA 4UOFA 4O4GA 3NBPB 1DTTB 4ZA1A 4WE1A 5I42A 5A8WB 3M2UA 4YY3J 2PIIA 3ITHA 3LP2A 4HDHA 3OQ2A 2R7SA 2L9DA 3V5RA 4ZDNA 4EUVA 3AJ1A 3IR7B 2V68A 3NGSA 2W2QP 4IG0A 3CMAS 4RW4B 3DLGB 2FJWA 1C1BB 5GAGI 3AODA 3KWMA 2XBPA 4LFBJ 3OHAA 3MCMA 4KTQA 3VQSA 2H5EA 3O6QA 2HGNA 3G6ES 2M88A 3OD2A 1SKWA 2EKNA 1ZAVA 4IQXA 2COLA 4UOHA 1BWVA 4FF1A 1U8WA 3TUJC 1W7WA 1N33F 2FB0A 2V9KA 1NNDA 4EYIB 2EFVA 2B9XA 4A8KA 2ZH9A 4Y3CA 5AXLA 4A47A 3A4TA 4QIFA 2JX2A 1LNQA 4DV7J 3ILIA 3PW7A 4OX9J 4KPCA 3M6WA 3P4UB 1B64A 4ZLPA 2ILYA 3DNCA 4USJC 4X62J 2RF2A 1M5OC 3HSGA 4DR4J 2LA4A 2RQCA 4DQQA 1O51A 4NZ6A 1ZAXA 4OLOA 4ELVA 4FBUA 2CPJA 4AFFA 2MQPA 3G8QA 4XO0A 2J7UA 3JXOA 4CLTA 1P9QC 1RGVA 2JSXA 2CJYB 2CPYA 2FGOA 3OTDA 5A8RB 3C66A 2NPIA 4IH7A 2DD8S 2ADCA 1LWCA 1S76D 1ULRA 1IBKF 3FC9A 5IWAF 4WK3A 4QW9A 3BR9A 5M2RA 1RAOA 1LWEA 3SBMA 4CLLA 4K4VA 2HVDA 1RWUA 1P6TA 1YGYA 3QT5A 2E1CA 1K73T 3VVUA 3ELHA 1S1WB 4DZ6A 2DH8A 4DN9A 2YPZA 2D1CA 2LQ5A 1C0UA 1SKRA 4OL8A 1TL1B 3TO8A 3KLEA 2QEXS 2V94A 2F4FA 1FRMA 3AQOA 2QZ8A 1YSJA 3PYDA 3SEOA 4PKDB 3NGRA 2G9OA 2K3IA 2W7PA 3CJRA 4FYWB 5DJBA 3RBEA 1CJKA 1HLWA 1NB7A 4MIWA 3DOMB 5C7PA 1UJ5A 1SL2A 1BXNA 2HNYB 2NYHA 3W8PA 5A0YB 2ABYA 1FK9A 5HL7Q 4JV5J 1VOMA 1T0TV 5CH7B 1S79A 3GV7B 4FYDA 4ZVQB 1QTMA 1AUDA 4OX8A 4J91A 5KT3A 3R7BB 3NXZA 5DG9A 2HFSA 1HKAA 4ED3A 4NRTA 1XJWB 4XDCA 3PJWA 2IJNA 4L3NA 4LBPA 3RJMB 5KFSA 5A2QU 2MLYA 4YN3B 3CB4A 2UUAF 4ZVGA 1HNXJ 1GNKA 3ZNJ1 2CZ4A 4M95A 1SUQB 2KVIA 4PQUB 2CFXA 2HFZA 3DHWC 2HW3A 3H90A 4I6AA 2CZVC 2E1PA 1TKTA 1RHMB 3BM7A 1ZYQA 4TLQA 3V6JA 2AJQA 1RWXB 2WONB 4ICLB 2QL9B 4YR3A 4WU3A 3UR0A 1AXQA 4J9OA 4K4ZA 2J9EA 2W2OP 3UDEA 1F3FA 4KKOA 2VOOA 1IJFB 1LXJA 2HFVA 3C15A 3IN5A 2VG7A 1U26A 1KLMA 4OX7A 1PAUB 1QJHA 3MWBA 4Q8EA 4ZVPB 1RT2A 2F9DA 3H5YA 1KQGB 3AB2B 1U7LA 4LFCF 3HVAA 4XAKA 3W2WA 1SL1A 2ZJQQ 3MM8B 1H6KX 1N6QB 1I1GA 4DN0A 4U7UK 2ZHAA 3L9ZA 5KFDA 3SYZA 2YWHA 2D3O1 3SFUA 5GVQA 4MAKA 4Y2KA 3FKBA 3GU0A 3N4WA 1AT1B 2ROPA 3U1MA 4PUOA 5HN0A 2FZGB 3C19A 4OI0A 1DQ8A 4IH6A 5K14A 1RT5A 4DUYJ 4G1QB 3R5AA 3HSZA 4DV4F 3L7PA 3HJVA 3WZ0A 1XN9A 2QGFB 4ZP7A 1HD0A 4RNNA 4DG1B 5JUMA 3NBPA 3DI6B 1QVFR 5CA5A 2LXIA 2J7KA 4USMA 2IY5B 1PAEX 4DOZA 4LBHA 1U8SA 4M5JA 2IBOA 2R8GA 1NK0A 3PRBA 4GC6A 4KGZB 2KI2A 4YS2A 4J37A 2CPXA 5DM6Q 1T02A 4HACB 1SJ3P 3GLJA 4RW4A 3NMAA 4U7CA 1WC5A 1GAOA 2W4CA 1C1BA 3MUVP 2VQEF 2B4PA 4RU9A 2XM3A 1F60B 5D8HB 3M8RA 4NLQA 4HEA9 4OZ3A 1NXIA 4WYWA 1RWMB 1SV5B 1NSKL 1YDLA 2XWXA 2CPHA 3HHNB 3CCTA 2DNMA 1XMOF 1DJ0A 5C24B 5D3GB 2F65A 1Y5IB 4OV6A 1KONA 3NRBA 1T7PA 5LSLA 4A8FA 4WBFA 3I5BA 5HJXA 4LR9A 5DQHA 5J2QB 3G71S 2CDRB 3W62A 5CAAA 1YBUA 1X5PA 2FY1A 3O1LA 4OHZA 4ZVUB 3VVTA 3TARA 1U6BA 1Y5LB 2A10A 5HROB 2A6OA 8ATCB 3OJSA 4B3TJ 3HFZB 5K5MA 1BLUA 4FF2A 1MROB 5ETVA 4DUZJ 1LEOA 3C16B 5HMZA 3MPUB 3UCZP 4C8NA 5A8RA 1X31C 4GMKA 2HVIA 2DH9A 4AT1B 5J2NB 2HQGA 1K0VA 2H65B 1D9AA 1FDNA 2AEFA 4WFBQ 2UVWA 4ERDA 3TI0A 3UW1A 1SH3A 2IYGA 1QE1A 1VLYA 4BHQA 5KG3A 2CRLA 4OYMA 2FVRA 4J9QA 4IRKA 3TAPA 1DTQB 2MSSA 2PFDA 3EUNA 4X66F 1S1WA 1N5VA 1IM4A 4LRFA 1IBCB 5F0WA 1S1VB 1XIQA 2O66A 3TAMA 4MK9A 5KT5A 3I0RB 1FF2A 4G1PA 2HMIB 2QMWA 4Q0BA 2SXLA 4GKKF 2HG4A 4FPRA 1MMNA 2Q6CA 4EGLA 3I32A 1X5OA 2DGVA 3NGTA 1EARA 3UFCX 5KOWA 3EJMA 1U48A 2FJVA 2UVRA 1NPRA 5CD4H 2JVOA 5CD4A 2HNYA 3C2PA 5A0YA 4JI3J 2OPQA 3P45B 3FEXB 2L9WA 2QSFA 5IC4B 1R8BA 2DY1A 1U24A 4J5OA 4ECXA 1XC9A 3LPEA 1YJUA 4A8MP 1F9EB 3F44A 1YZ6A 3DLJA 3OTCA 2CQ0A 4F3OA 3LALA 4Q5VA 1SUQA 3SQGA 2P8IA 2RHSB 3H2UB 4PQUA 3C6TA 3GV8B 4E0DA 3HVTB 5HQMA 2EFQA 1U45A 1NH7A 4B9NA 2WONA 4P2MA 4ICLA 4ZVSB 3PW4A 4Z7CA 4DXLA 4P71A 3L4BC 3V6HA 1SC4B 5ETTA 3F73A 3Q22A 1M5KC 1QAIA 4DV0J 4B9UA 4NLDA 3PW5A 5D6GA 3DOLA 5D15A 4KO0A 3R5CA 3KLGB 4OYOA 4LIWA 3HX9A 1SQFA 5CCLA
chains in the Genus database with same CATH topology
4DMZA 2V4JB 3JYTB 1HNVB 2PI5A 1R8PA 2DIUA 4NCAA 3Q0AA 2WAQD 3DRSB 1PSDA 1WTFA 2DITA 2KU7A 1R43A 3G8TA 2Z0GA 2DR8A 4O3PA 2FHJD 2FJAB 2IM1A 4CT8A 2VFVA 3MM8A 2XMWA 5B0FA 1KVJA 3S1TA 3KK1B 2KRBA 4OX6A 7FD1A 3DRPB 3HM9A 1LV5A 3IG1A 2YNHA 1FD8A 2DHSA 4HH1A 3UQSA 3T5HA 3JTPA 2FLLA 3OTOF 2B4VA 5KOXA 3CCRS 3LP1B 5DDRC 1IXKA 4RWWA 1FO1A 2DNQA 4JI6F 3M1VB 2R8KA 4ECVA 4LF4F 1RTIA 3ZZOA 5DDPC 2I1RA 1RP5A 2DNKA 4BCAA 1FKPA 2ZZNA 1OS5A 2BQ3A 1C4AA 2M70A 4IOBA 2OSRA 3QLHA 3GFYA 4B3OA 4TU7A 3SV3A 1BY9A 3FMWA 4ILMA 3TUZC 4X2BA 4I2PA 1JNRB 2BVZA 2ZH6A 1U47A 3L3CA 5L1LA 1XNRF 2GGPA 1N5QA 4OJHA 3MMAA 1IUJA 4ED2A 3KG4A 2W4DA 2B7CB 2LECA 2DVIA 4Q8FA 4N47A 3CCUS 2B3TB 2QMXA 2MQNA 1HBOB 4NYZA 3TAQA 4J9PA 2IVFB 4A8SA 4HT7A 2HHQA 3AJ2A 2XC9A 2DR9A 1S1TA 2IM0A 3SV4A 2DTJA 2HWIA 4LQ3A 5F8LA 1PC4A 2VA3A 4RW8A 2R7UA 1WHXA 1GQEA 2O1PA 1SKSA 4OIXA 4TY9A 3TX8A 3UD3P 2MKIA 2HRYA 1H38A 3GG0A 5CHCB 1S99A 5CZVA 3M9OB 4M5DA 4OHWA 3OV7A 3MPYA 4DFPA 1JXEA 3ZZRA 1Q4RA 2FVPA 4MKYA 2VBWA 5L1KA 5IXUA 3UPFA 2N3OA 5GAHU 1TK5A 1TV6B 2D7SA 2IC3B 3UI3A 4X65F 4DG1A 2XMMA 1D8ZA 3D1OA 4IQMA 2VPYB 1CC8A 2I2YA 4ECRA 2PD1A 2QE5A 2XSFA 1N48A 2E9TA 2EWHA 2CYYA 2R2UA 2JZ5A 3CD6S 3BGUA 4WTYA 2MZJA 1P27B 3MZIA 2Z4PA 3RTVA 2WRMA 4EU0A 2DBBA 3CJ2A 4KBIA 3SXLA 4TU8A 3IFEA 1RTDB 4PWDA 1IKWA 1ROFA 2NQPA 3CEDA 2B5JA 4K5RA 4WFAQ 1S6UA 1UVMA 1PGZA 2QYCA 4GC7A 2IM3A 4YEAA 1HWIA 2MY8A 4DQSA 3I56S 4KIAA 5DLFA 4V19X 5CYMA 3W7BA 1Q1KA 1VQ7S 2CJAA 2IMWP 2K2PA 3QO9B 4FXVA 4Y6IA 2NPFA 2PDAA 3MMCB 3LQVA 3MOZA 3BSAA 4X4UA 1C4CA 2GHVC 3MTKA 4ECZA 5DQIA 5B09A 2HGMA 3AH6A 1T05B 2B6AA 2YNGB 4FF4A 2HFNA 3DRRB 1H0HB 1JB0C 2RRBA 1RT6A 3K5OA 1BWEA 2PO4A 4DV3F 3QWUA 3JSMA 3RZAA 2B51A 7FDRA 5B0EA 3SZ2A 2M7SA 4ZPDA 3DC2A 1TVRB 1X8DA 4URSA 1RTHB 4LSLB 2DISA 2O67A 2NXUA 5IZHA 3S6EA 2WOMA 3PEJA 1FNMA 3AY0A 1LWCB 3QPIA 4IDKA 4Y65A 3MCSA 2UU9F 5J2PA 2AV5A 1VQMS 2YKNB 3ZZ0A 2C3YA 3RR7A 1SV5A 2E5HA 2JL9A 2UUTA 3CCSS 2LU2A 1Q7LB 1Q8LA 4RBVA 1JLAA 4NLOA 5DRKA 3UDCA 4A8XA 1VIXA 3MEDB 4RW7B 3MUTP 1YITS 4ECTA 3KKFA 2B0GA 3IBWA 2KT5A 4NWBA 3CC7S 2XS7A 3SDEB 1NJZA 3KK3A 2UVVA 4I69A 1YWXA 4EBEA 1HWKA 3P49B 3W3SA 5BYQA 3VCDA 1IBMF 3DM2A 4I56A 1G6BA 4L6V3 4C11B 2XY6A 4W90B 3EXCX 3KK2A 5D3GA 1Y3JA 2IYIA 3J81Y 2NREA 1JJ4A 2AGOA 2N7YA 2V4RA 5AE1A 1XTZA 4NRUA 2ADBA 4PXDA 2QLXA 2KG1A 2DB1A 1S9EB 1YJRA 1U49A 3WBZA 3TYTA 1RKIA 5CYQB 2K1RA 2DNPA 4G6VB 3VAFA 1VIOA 1L5UA 1FVSA 3BS9A 3HK2A 2APOA 4J9KA 2LEAA 2CG4A 2ACYA 3GYXB 3FZ2A 3M2RA 4KFBA 3HFKA 2E9ZA 5J2QA 2N4CA 4X4TA 1FEHA 3NWGA 5EX3A 1LW2A 3G6XA 3KLHB 4DS5A 2CPEA 1J5EF 4J9LA 5I3PA 3TQ1A 1GTHA 3OXLA 5KFXA 1Q81T 1Z4UA 3MEEB 5HROA 2FTRA 3S8SA 3Q8RB 4WFYA 3M8PB 3V6DB 1FD2A 4ETXA 1MROA 3OSNA 3I9V9 1S10A 1C0TB 1PC5A 4JI5F 3WDOA 4ECUA 4Y2IA 5F8MA 4G3IA 4KJIA 1CQNA 4QJVA 2R9LA 1X9SA 2E1RA 3JSYA 3MHYA 3K5NA 4ZOSA 3GIIA 5IT9Y 4IO9Q 3KJVA 3KNAA 4C8YA 2YNFB 1JLFB 1U6FA 2VPXB 4Z37A 1Q53A 3PR4A 1XMQF 3NNCA 2C42A 2IJFA 2BJDA 1DTTA 2C3UA 1S72S 4I2QB 3MM7B 2IVMA 4USHA 1FDDA 1NKBA 2VH7A 1U1RA 5J2NA 4HTIA 5A8WA 3MR3A 3OLAA 3H4DA 3MEGB 1UVKA 5HBMA 2HGLA 5D78A 4G1IA 4HI2A 4Q2MA 5E41A 1SI9A 3EYZA 3NG8A 4DQIA 5E3QA 4DV1F 1Y00A 4O23A 3TVYA 1VQ9S 1T3NA 5A8KB 4OFZA 1UWBB 4LIRA 4NLVA 2UUWA 1KTVA 4L72B 1KQFB 4X84A 2MKJA 3GWCA 3DRYA 2M3DA 1UA1A 4X4VA 2P9GA 2XMTA 3ENQA 1OSDA 3CWJA 1S1VA 2NUUG 3CC2S 1FNOA 3DLGA 5LXRA 3RB0A 2PE8A 4NL5A 5K8OA 2IHR1 5EN1A 5LJ5Y 4ED6A 4R25A 2N4DA 4H4OB 3FRZA 4RBUA 3QJPA 2A1BA 1M1KT 1C1CB 2DGUA 2V8HA 1X0FA 2RNEA 4FNIA 3DLHA 1Y9OA 4B3SF 2DNNA 2VASA 4DSIA 4C4WA 2AW0A 2ASYA 1WEXA 1YRTA 1G7CB 2D9OA 1X4FA 1JLBB 3PXGa 4ZMMA 2D41A 1SB6A 4B9VA 1TL3B 2B9WA 1WG4A 2PGCA 3AB4B 4QR2A 2KXHA 1D8YA 2JEJA 3B82A 4ZP8A 4ES2A 2MZRA 5F3ZA 2E9RX 5EDWA 2LLZA 1KC8T 5SZTA 2CQDA 2ZOFA 3P6YC 1QUVA 4F3QA 3HZEA 2DR7A 4ZP6A 4OZLA 2J6SA 3ENVA 2VG7B 5FDLA 2X1BA 3PDNA 5HI7A 4X4SA 4DSLA 2J8AA 3V2UC 1ZH5A 5B0BA 2CVEA 1N8RT 2FLOA 5KFIA 4F02A 2R7TA 3QJJA 1R0AA 1MU2B 3PRDA 3THVA 2B4UA 1LFPA 4ES3A 2DGSA 2GO8A 1L3UA 5BYSA 2P9CA 5M2PA 2K7JA 3H59A 3DLEB 2YNIB 2AX1A 2OIHA 4CI0B 4DFMA 1HWJA 1UFWA 4RW9A 5KFVA 4F26A 2CQGA 4QR0A 3PX0A 1U1KA 1S0MA 2BANB 5AXMA 4DF4A 2HIQA 4JI1F 3MECB 2MQLA 2VUGA 3DU6A 4DFKA 4K4YA 1MW7A 4C8LA 3DDKA 4P6QA 1WHWA 4P7VA 3R5DA 2ZHOA 4ZCKA 1ZM9A 3MFIA 1U2RA 2G1DA 2F8MA 1LKZA 3PEHA 1HMVB 1B7FA 4ID5B 3W2WB 2R7RA 4A8YA 1KEKA 2E5LF 2JEGA 1HWUA 3UWTA 1Q86T 2CJKA 5L1IA 2HS4A 1KNZA 2YWFA 3FNNA 1NHUA 2R2RA 4LF9F 3DOKB 3NAHA 3RAQA 1HARA 4H4MA 1S48A 1UA0A 4MMOA 4ZHRA 1RT3B 3X1LB 4C0BA 3RW6A 3AA9A 4HT5A 2B9YA 3DGPA 3H98A 1V9OA 5F41A 3O5TB 2HNZB 4MFBB 2GW8A 1VC5A 3G86A 4X4QA 1M90T 1JJHA 1SJQA 1J5OA 4O3QA 3NMRA 2MPUA 2FVCA 2MKKA 3ZZTA 2IAJB 4WFNQ 4DR7F 2GQQA 2RS8A 2PFFB 2YH1A 3U1LA 5KFZA 3ZFVA 2ALZA 3IR5B 2RMLA 2X1AA 2KFNA 2MKHA 1NJXA 1R8CA 1NAQA 1P1TA 2CQHA 4BBYA 3VAGA 2JLFA 2JC1A 4PG7A 5KFFA 2VBXA 4AXJA 1L3VA 1I94F 4PUOB 3OR2B 3D54A 3ISNC 4NCBA 2D74B 2BABA 2BM0A 2CQ3A 3L09A 1VQ5S 2IA0A 5K14B 1RT5B 3PO4A 4LVNP 3BEGB 2RE1A 4ED8A 3D0GE 5KT7A 1N0UA 1HBMA 1JLEA 5HMXA 5J1EA 3BQ2A 4D3HA 1MWZA 4IFYA 3CDBA 1VQPS 1FDBA 5B7WA 4I7FB 4JYAF 1LK7A 2W7OA 1GX6A 1WNEA 4ILLA 3O8WA 2JC0A 3H2VE 3N9UC 2MQMA 2LXFA 5T41A 1NKEA 4D3GA 4YUDA 4NLTA 4AL6A 2AP6A 3CDWA 5HLFA 1FJ7A 1UAWA 1LWFB 5HMWA 2LCWA 2I8EA 1OWXA 1EETB 1SQEA 2W9AA 1VS3A 3D28A 2CPDA 3KLGA 1FT8A 5EX0A 4I4BA 1H3DA 3BGLA 3K2YA 2JH3A 3US5A 3LO3A 2ZJPQ 1F5BA 3C6UA 3N28A 2AQ4A 5F8JA 2HNDB 4LF7F 2Z2LA 2A3JA 2ZC3A 3AQPA 1MNEA 3RRHA 1KVIA 3FVYA 3Q23A 2VONA 4I6YA 3JYTA 4ED0A 1HNVA 2V2KA 3UCUP 3CJ5A 1GXLA 2XCAA 3DRSA 1RT4A 4KT0C 3K5PA 1NO8A 2ZFHA 1KRPA 3KLVA 1Y7PA 1TL1A 4Q45A 1Q7YT 4AL5A 2N82B 1X4CA 1HR0F 3MUMP 4LF8F 5J1PA 3K5MA 3HHLD 4HVZA 1Y0HA 2KHCA 2VV5A 4RZRA 4PG8A 3G96A 5AJ3F 1FDAA 4ETZA 4OX9F 3MEKA 4EEYA 3M1VA 4B02A 2VQFF 4R0EA 3J7Z5 3M30A 4Y2CA 4E98A 2ASDA 2ASLA 2JOQA 3DN9A 1JLQB 4NLUA 1BQNB 2F9JA 3E01B 2R7QA 2XO7A 3CVKA 2ZBCA 4YP3A 4KV8B 2KFYA 4X4RA 5F8GA 2QRRA 2QA4G 1W25A 2EKYA 4DR2F 4K4XA 3FSYA 4O3RA 1Q16B 4DR4F 3SCKE 3MF5A 4IOAQ 1NK6A 3DOMA 3PVXA 3PHEA 2RIJA 3M4XA 4FZVA 2B4OA 3HZGA 4P7TA 4YB5A 3D2WA 4ZPTR 1HBOA 2R8HA 3NCRA 5LSRA 1TK0A 4UOCA 3PV8A 3CJKB 3EX7B 1JXLA 3IRWP 4NCGB 4Y00A 3V81B 3OFEA 1Z1ZA 4FS2A 3CCQS 2DO4A 4OQJA 4EBCA 2WBRA 3UD4P 3RU0A 1XR6A 4UW2A 2J5AA 2RJZA 2JLEA 2EK1A 4NLRA 1HWLA 4R5PA 1G3OA 3QZ8A 2J0SD 2CQCA 4MKAA 4Q43A 3BDPA 3PM9A 2P6SA 3T6JA 5C42B 3GIKA 3VAMA 5LMUF 2C2RA 5G0RB 3UCGA 3CCLS 1HYSA 1TV6A 2VG5B 2ILZA 1L3KA 2AJ0A 4M63A 5CCMA 5KFOA 2HQ3A 1S9FA 1X7VA 1FXRA 4CO4A 4LMZA 3LF0A 3FMBA 2QA2A 4KHRA 5KFLA 1UVIA 3HHKA 1XR5A 2KN4A 3NCPA 5FD1A 3BR8A 3OW2R 2ZJRQ 1WF2A 4FBTA 5DDQC 1REVB 3QWPA 1XR7A 2O5DA 1IKVA 1RJJA 3BZQA 4K59A 2GJIA 3R1LA 2IBKA 1WWHA 3FGVA 1H7XA 1S0VA 1KOOA 3EGNA 3VZIA 3MPWA 2UV8G 4UY8T 1HPZB 4USIA 3HT3A 1UEVA 2EG1A 2A2DA 4QWAA 2VPZB 1HBNA 2C3PA 2K7KA 3S01A 2BYCA 1T05A 3J7A1 3OVAA 1CC7A 4WK1A 3VZHA 1JMTA 1GXTA 3DRRA 3HMJG 2R2SA 2XMVA 4B9MA 3L95X 5KT2A 3J7YU 4WF9Q 2MKCA 4MYTA 4DLGA 2KG0A 1S0OA 1M5PC 1JWWA 4KHPF 1MMDA 2LQ9A 2ROGA 2GHWA 2V8DA 1TVRA 4B3MF 4GO7X 1DQ9A 1RTHA 4LSLA 3TVKA 3G4SS 5KFAA 2E29A 3T6BA 2O3DA 3IA0A 3SCJE 4KB7A 2OMLA 3M8QB 4Y0FA 1NRKA 1QUPA 3MXHP 4KE5A 4WKRA 1NK8A 2J9DA 5CZXA 4A48A 5BR8F 2KXNB 3VAJA 4BDPA 2YKNA 2OLWA 4WE1B 2VFTA 2QLWA 2MZ1A 2CQIA 5I42B 1T8EA 2GIQA 5KFJA 2BDPA 1GT8A 5IS2A 4DR6F 2DHGA 5GAEI 4C3MA 3LANA 2OAUA 2YX1A 4DR1F 4RW7A 1FVQA 2QV6A 1RTJB 2ZZMA 1ZZFA 2F1FA 4NA3A 2R2TA 3ITHB 1QE1B 3SDEA 2IFXA 4J9SA 1ZBTA 2JEIA 3GILA 1HI1A 4B3RF 3LP2B 3OXGA 4ED1A 2BBEA 3T9ZA 1ZM2A 3F41A 4JV0A 1N6QA 1IKYA 4XIUA 4C11A 2DNYA 2CJBA 2JHEA 4QWDA 1KHVA 1EP4A 4B9SA 1Z2ZA 4OI1A 2HHPA 5G4DA 2CPIA 2AJ4A 4IG0B 3I0SB 3OUYB 2WB4A 3IO1A 2EI5A 1N5TA 5DGBA 2M8DB 3TAMB 2U2FA 5C25B 2XLIA 5EWGA 2RU9A 3TOQA 4O3SA 5CYQA 2BE2B 1Q79A 1TP7A 1X9MA 5AE3A 2OH2A 3GFHA 4DEZA 3DRXA 3LW5C 4Q0BB 3A8EA 3FJ2A 2JLGA 2AJFE 4QU6A 1FRKA 2VFSA 3X3UA 5L38A 2ZUGA 2AJ1A 1J2VA 1OQ6A 4Y28C 2OPPA 3KLHA 5SUHA 4IRDA 3IAS9 2FPHX 2MZSA 4ZVEA 2CKWA 1BQMA 1M5SA 1TKDA 4N56A 3BQ0A 1GXUA 3ENWA 4YDXA 3MMJA 2G13A 3CJ4A 1S97A 1WG1A 3LWMA 4G1QA 2W8KA 3GB0A 1R8HA 3OFGA 3M8PA 3N5FA 3J7YI 3V6DA 1Q82T 2QT7A 3V4IA 2YY3A 4ELUA 4RUCA 1VBYA 1C0TA 2FLPA 1TAQA 1URRA 3L7OA 4RNHA 1FTRA 2P6TA 1N56A 2AGPA 1GH8A 2XG8A 3QZ7A 2OPQB 1VQ4S 3CIMA 3KLFB 4QW8A 2CQBA 1VK3A 2YNFA 5DM7Q 1HW9A 1TKXA 1YJNS 5DDOC 1KLNA 2EFOA 4YHHF 1FE0A 5DG7A 1F0XA 6FDRA 3HVRA 2VKZG 2ZH2A 2B56A 2AD9A 4WU2A 3DI6A 2J9CA 2NSCA 2HRUA 4C8OA 3AA8A 1NK7A 4U6PA 3GR1A 1KS2A 2JFDA 4FN5A 1X0PA 2VB6A 2XEXA 1R31A 1YG0A 1Y5NB 5JVGQ 4TYAA 2W9CB 1UP1A 4C98A 3KMSA 1MWYA 2OPSB 2PN6A 2ROEA 4FNHA 2RF2B 2N3LA 4TN2A 4IYQA 4DL5A 4WFZA 1E6YA 3E51A 5DS7A 4KQZA 4GO5X 4PPDA 3M9NB 3SQGB 4QIGA 4M94A 1BQXA