1NEKD

Complex ii (succinate dehydrogenase) from e. coli with ubiquinone bound
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
b'SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein subunit
publication title Architecture of succinate dehydrogenase and reactive oxygen species generation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/electron transport
total genus 47
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2002-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1nekD01
3CIRC 2WDQD 3AEBC 3P4RC 3AEAD 1QLBC 2BS2C 3VR9D 4YTPD 1ZP0C 1L0VC 5C3JD 3VRAD 2WU2C 4YSZC 2BS3C 3AE7D 1YQ3C 2FBWC 1KFYD 2WQYC 2WDRC 2WDVC 3VRBD 4YTMC 3AEED 3AE8D 3AE4C 2B76C 3VR8D 3AEDD 3AEFD 4YTND 4YT0C 4YSYD 1NEKC 3AE5D 3ABVC 3AE2D 3AE3C 2WS3C 2H89C 4YXDD 4YSXD 3AE1D 4KX6C 3AE6C 1YQ4D 3P4SC 1NENC 1ZOYC 3P4QC 3SFDC 2WU5D 3AEGC 1KF6D 2WP9D 2H88C 3SFED 5C2TC 2WDQC 2ACZD 3AEAC 3AE9D 3AECD 4YTPC 3VR9C 4YXDC 5C3JC 3VRAC 3AE7C 3CIRD 3AEBD 3P4RD 1KFYC 3VRBC 1ZP0D 3AEEC 1L0VD 2WP9C 3AE8C 2WU2D 4YSZD 3VR8C 3AEDC 1YQ3D 2FBWD 2BS4C 3AEFC 2WQYD 4YTNC 2WDVD 4YTMD 4YSYC 3AE4D 2B76D 3AE5C 3AE2C 1E7PC 3P4PD 4YSXC 3AE1C 4YT0D 1YQ4C 1NEKD 3ABVD 3AE3D 2WS3D 2WU5C 2H89D 1KF6C 3SFEC 4KX6D 2ACZC 3AE6D 3AE9C 3P4SD 3AECC 1NEND 1ZOYD 3P4QD 2WDRD 3SFDD 3AEGD 3P4PC 2H88D 5C2TD
chains in the Genus database with same CATH superfamily
3CIRC 2WDQD 3AEBC 3P4RC 3AEAD 1QLBC 2BS2C 3VR9D 4YTPD 1ZP0C 1TFFA 1L0VC 5C3JD 3VRAD 2WU2C 4YSZC 2BS3C 4DDIA 4I6LA 3AE7D 1YQ3C 2FBWC 1KFYD 2WQYC 2WDRC 2WDVC 3VRBD 4YTMC 3AEED 2ZFYA 4DHZA 3AE8D 3AE4C 2B76C 3VR8D 3AEDD 4DDGA 3AEFD 4DHIB 4YTND 4YT0C 4YSYD 1NEKC 3AE5D 3ABVC 3AE2D 3AE3C 2WS3C 2H89C 4YXDD 4YSXD 3AE1D 4KX6C 3AE6C 1YQ4D 3P4SC 4FJVA 1NENC 1ZOYC 3P4QC 3SFDC 2WU5D 3AEGC 1KF6D 2WP9D 2H88C 3SFED 5C2TC 2WDQC 2ACZD 3AEAC 3AE9D 3AECD 4YTPC 3VR9C 3VONA 4YXDC 5C3JC 3VRAC 3AE7C 3CIRD 4DHJA 3AEBD 3P4RD 1KFYC 3VRBC 1ZP0D 3AEEC 1L0VD 2WP9C 3AE8C 2WU2D 4YSZD 3VR8C 3AEDC 1YQ3D 2FBWD 2BS4C 3AEFC 2WQYD 4YTNC 2WDVD 4YTMD 4YSYC 3AE4D 2B76D 3AE5C 3AE2C 4LDTA 1E7PC 3P4PD 4YSXC 3AE1C 4YT0D 1YQ4C 1NEKD 3ABVD 3AE3D 2WS3D 2WU5C 2H89D 1KF6C 3SFEC 4KX6D 2ACZC 3AE6D 3AE9C 3P4SD 3AECC 1NEND 1ZOYD 3P4QD 2WDRD 3SFDD 3AEGD 3P4PC 2H88D 5C2TD
chains in the Genus database with same CATH topology
3CIRC 2WDQD 3AEBC 3P4RC 3AEAD 1QLBC 2BS2C 3VR9D 4YTPD 1ZP0C 1L0VC 5C3JD 3VRAD 2WU2C 4YSZC 2BS3C 3AE7D 1YQ3C 2FBWC 1KFYD 2WQYC 2WDRC 2WDVC 3VRBD 4YTMC 3AEED 3AE8D 3AE4C 2B76C 3VR8D 3AEDD 3AEFD 4YTND 4YT0C 4YSYD 1NEKC 3AE5D 3ABVC 3AE2D 3AE3C 2WS3C 2H89C 4YXDD 4YSXD 3AE1D 4KX6C 3AE6C 1YQ4D 3P4SC 1NENC 1ZOYC 3P4QC 3SFDC 2WU5D 3AEGC 1KF6D 2WP9D 2H88C 3SFED 5C2TC 2WDQC 2ACZD 3AEAC 3AE9D 3AECD 4YTPC 3VR9C 4YXDC 5C3JC 3VRAC 3AE7C 3CIRD 3AEBD 3P4RD 1KFYC 3VRBC 1ZP0D 3AEEC 1L0VD 2WP9C 3AE8C 2WU2D 4YSZD 3VR8C 3AEDC 1YQ3D 2FBWD 2BS4C 3AEFC 2WQYD 4YTNC 2WDVD 4YTMD 4YSYC 3AE4D 2B76D 3AE5C 3AE2C 1E7PC 3P4PD 4YSXC 3AE1C 4YT0D 1YQ4C 1NEKD 3ABVD 3AE3D 2WS3D 2WU5C 2H89D 1KF6C 3SFEC 4KX6D 2ACZC 3AE6D 3AE9C 3P4SD 3AECC 1NEND 1ZOYD 3P4QD 2WDRD 3SFDD 3AEGD 3P4PC 2H88D 5C2TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIR C;  2WDQ D;  3AEB C;  3P4R C;  3AEA D;  1QLB C;  2BS2 C;  3VR9 D;  4YTP D;  1ZP0 C;  1L0V C;  5C3J D;  3VRA D;  2WU2 C;  4YSZ C;  2BS3 C;  3AE7 D;  1YQ3 C;  2FBW C;  1KFY D;  2WQY C;  2WDR C;  2WDV C;  3VRB D;  4YTM C;  3AEE D;  3AE8 D;  3AE4 C;  2B76 C;  3VR8 D;  3AED D;  3AEF D;  4YTN D;  4YT0 C;  4YSY D;  1NEK C;  3AE5 D;  3ABV C;  3AE2 D;  3AE3 C;  2WS3 C;  2H89 C;  4YXD D;  4YSX D;  3AE1 D;  4KX6 C;  3AE6 C;  1YQ4 D;  3P4S C;  1NEN C;  1ZOY C;  3P4Q C;  3SFD C;  2WU5 D;  3AEG C;  1KF6 D;  2WP9 D;  2H88 C;  3SFE D;  5C2T C;  2WDQ C;  2ACZ D;  3AEA C;  3AE9 D;  3AEC D;  4YTP C;  3VR9 C;  4YXD C;  5C3J C;  3VRA C;  3AE7 C;  3CIR D;  3AEB D;  3P4R D;  1KFY C;  3VRB C;  1ZP0 D;  3AEE C;  1L0V D;  2WP9 C;  3AE8 C;  2WU2 D;  4YSZ D;  3VR8 C;  3AED C;  1YQ3 D;  2FBW D;  2BS4 C;  3AEF C;  2WQY D;  4YTN C;  2WDV D;  4YTM D;  4YSY C;  3AE4 D;  2B76 D;  3AE5 C;  3AE2 C;  1E7P C;  3P4P D;  4YSX C;  3AE1 C;  4YT0 D;  1YQ4 C;  1NEK D;  3ABV D;  3AE3 D;  2WS3 D;  2WU5 C;  2H89 D;  1KF6 C;  3SFE C;  4KX6 D;  2ACZ C;  3AE6 D;  3AE9 C;  3P4S D;  3AEC C;  1NEN D;  1ZOY D;  3P4Q D;  2WDR D;  3SFD D;  3AEG D;  3P4P C;  2H88 D;  5C2T D; 
#chains in the Genus database with same CATH topology
 3CIR C;  2WDQ D;  3AEB C;  3P4R C;  3AEA D;  1QLB C;  2BS2 C;  3VR9 D;  4YTP D;  1ZP0 C;  1TFF A;  1L0V C;  5C3J D;  3VRA D;  2WU2 C;  4YSZ C;  2BS3 C;  4DDI A;  4I6L A;  3AE7 D;  1YQ3 C;  2FBW C;  1KFY D;  2WQY C;  2WDR C;  2WDV C;  3VRB D;  4YTM C;  3AEE D;  2ZFY A;  4DHZ A;  3AE8 D;  3AE4 C;  2B76 C;  3VR8 D;  3AED D;  4DDG A;  3AEF D;  4DHI B;  4YTN D;  4YT0 C;  4YSY D;  1NEK C;  3AE5 D;  3ABV C;  3AE2 D;  3AE3 C;  2WS3 C;  2H89 C;  4YXD D;  4YSX D;  3AE1 D;  4KX6 C;  3AE6 C;  1YQ4 D;  3P4S C;  4FJV A;  1NEN C;  1ZOY C;  3P4Q C;  3SFD C;  2WU5 D;  3AEG C;  1KF6 D;  2WP9 D;  2H88 C;  3SFE D;  5C2T C;  2WDQ C;  2ACZ D;  3AEA C;  3AE9 D;  3AEC D;  4YTP C;  3VR9 C;  3VON A;  4YXD C;  5C3J C;  3VRA C;  3AE7 C;  3CIR D;  4DHJ A;  3AEB D;  3P4R D;  1KFY C;  3VRB C;  1ZP0 D;  3AEE C;  1L0V D;  2WP9 C;  3AE8 C;  2WU2 D;  4YSZ D;  3VR8 C;  3AED C;  1YQ3 D;  2FBW D;  2BS4 C;  3AEF C;  2WQY D;  4YTN C;  2WDV D;  4YTM D;  4YSY C;  3AE4 D;  2B76 D;  3AE5 C;  3AE2 C;  4LDT A;  1E7P C;  3P4P D;  4YSX C;  3AE1 C;  4YT0 D;  1YQ4 C;  1NEK D;  3ABV D;  3AE3 D;  2WS3 D;  2WU5 C;  2H89 D;  1KF6 C;  3SFE C;  4KX6 D;  2ACZ C;  3AE6 D;  3AE9 C;  3P4S D;  3AEC C;  1NEN D;  1ZOY D;  3P4Q D;  2WDR D;  3SFD D;  3AEG D;  3P4P C;  2H88 D;  5C2T D; 
#chains in the Genus database with same CATH homology
 3CIR C;  2WDQ D;  3AEB C;  3P4R C;  3AEA D;  1QLB C;  2BS2 C;  3VR9 D;  4YTP D;  1ZP0 C;  1L0V C;  5C3J D;  3VRA D;  2WU2 C;  4YSZ C;  2BS3 C;  3AE7 D;  1YQ3 C;  2FBW C;  1KFY D;  2WQY C;  2WDR C;  2WDV C;  3VRB D;  4YTM C;  3AEE D;  3AE8 D;  3AE4 C;  2B76 C;  3VR8 D;  3AED D;  3AEF D;  4YTN D;  4YT0 C;  4YSY D;  1NEK C;  3AE5 D;  3ABV C;  3AE2 D;  3AE3 C;  2WS3 C;  2H89 C;  4YXD D;  4YSX D;  3AE1 D;  4KX6 C;  3AE6 C;  1YQ4 D;  3P4S C;  1NEN C;  1ZOY C;  3P4Q C;  3SFD C;  2WU5 D;  3AEG C;  1KF6 D;  2WP9 D;  2H88 C;  3SFE D;  5C2T C;  2WDQ C;  2ACZ D;  3AEA C;  3AE9 D;  3AEC D;  4YTP C;  3VR9 C;  4YXD C;  5C3J C;  3VRA C;  3AE7 C;  3CIR D;  3AEB D;  3P4R D;  1KFY C;  3VRB C;  1ZP0 D;  3AEE C;  1L0V D;  2WP9 C;  3AE8 C;  2WU2 D;  4YSZ D;  3VR8 C;  3AED C;  1YQ3 D;  2FBW D;  2BS4 C;  3AEF C;  2WQY D;  4YTN C;  2WDV D;  4YTM D;  4YSY C;  3AE4 D;  2B76 D;  3AE5 C;  3AE2 C;  1E7P C;  3P4P D;  4YSX C;  3AE1 C;  4YT0 D;  1YQ4 C;  1NEK D;  3ABV D;  3AE3 D;  2WS3 D;  2WU5 C;  2H89 D;  1KF6 C;  3SFE C;  4KX6 D;  2ACZ C;  3AE6 D;  3AE9 C;  3P4S D;  3AEC C;  1NEN D;  1ZOY D;  3P4Q D;  2WDR D;  3SFD D;  3AEG D;  3P4P C;  2H88 D;  5C2T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...