1NEUA

Structure of myelin membrane adhesion molecule p0
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
115
Chain Sequence
b'IVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCDVKNVGKTSQVTLYVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYELIN P0 PROTEIN
publication title Crystal structure of the extracellular domain from P0, the major structural protein of peripheral nerve myelin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 24
structure length 115
sequence length 119
ec nomenclature
pdb deposition date 1996-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1neuA00
1QBBA 5IVXB 1RIHL 2P47B 4J3SA 4PG9B 2F5BL 3FHQA 4PRAB 2AABL 4PRPE 1DL7L 1TVHA 5EDXA 1FZMB 2VDQH 3BKJL 4YGAB 2IFFL 2PYFB 1T22B 5I1KL 4PJBB 2I9TA 3GHBH 1EBPA 3TCXA 3ZYJA 3LSOB 1K4DB 3IRZA 4XP1H 1A3RL 2O61B 4UILH 1AC6A 3QFJA 5IJVB 1CD0A 4NN7C 3RUGE 1WZKA 3V4UL 4PLJC 5ICZB 2BVOB 3TBVA 2BFVH 5IB4B 3I84A 1XGQA 3HNSL 2X7LB 1MAMH 5D7KE 1KCLA 2EC9T 4WTZA 1SEBB 2OI9C 1FNEB 4HIXL 1MUJB 3AGVA 3D39A 4NO0B 1WBZB 3B4NA 3RVXC 1W8OA 3RZCA 1FDLH 3WN5B 5FYLE 2L4OA 1QEWA 1CI5A 3KYNB 1UM4L 5E8OA 3AVEA 4WO4B 5I6XC 3BYYA 4MX7B 3MRDA 4Y19E 5SWZB 4YXKL 1U8LB 2GJZA 4RMRA 1DANU 4L8BB 1DSFL 5L88L 4X98A 5IVNA 2VABA 5C0CA 4X7FC 3U1SH 3P30L 3ECBB 1OTUD 3U30C 5BVPL 1FL3A 3BIKB 2ED9A 3DXAD 4FZEH 4ZDHA 3QDMA 1YPZF 3C9NB 1N64H 1UWGH 4U7KA 3T1WA 3O6LH 3Q3GA 1FZKB 2X1PA 4OTXL 5JHLL 4F7CB 3RIFK 3RDTB 4N0CD 4R7DB 4KJQD 5DD6B 5D6CB 4C58B 1ZT7A 1NMCB 2I5YH 2MMXA 5BZWA 2OP4L 4U6YA 2QQNH 3DRQA 1WICA 2ITCB 1FO0B 4JAMA 3GSQA 1KT2B 1NCNA 4YBLB 5T3ZH 4IEFB 4K7PL 1FLRH 4NM4H 4LRNH 4PTTB 3VXNA 4LVEA 4WVRA 2ARJQ 2L7UA 4YXHL 3EYQC 1I9EA 4WFHE 4KZDH 2UVEA 1JTOA 3DV6A 1A0QL 3KYOA 4NYLA 1A7NL 1CGVA 2I9LA 1QZ1A 3GMRA 1RZGA 2Y5TB 5GGVY 4K3DH 4D0DB 4LNRA 3TVMC 5IKCA 2IBGA 2MQ0A 4HUNB 1QQDA 4NRYA 4MS8D 5DMGC 4H1LG 1VADA 5JZ7D 2KBGA 3L5WA 3MRBB 4HC1L 1FZOA 3NABH 1HQRB 2BNQE 2IALA 3BVNA 4G8EB 4M5ZL 4HBCH 3I50L 3TIDB 2HFTA 5FYJL 5TGBB 4G8FB 4F80A 5IQ9B 3PGCA 1V7NH 3MACL 5GRUL 1BGXL 4RQQB 1T04A 4C83A 4K8RH 1FCCA 2HN7A 3U7YL 1MCCA 2E7BA 3NCJL 4F8QA 2IAMB 5DXWA 4GXUM 2IQ9H 3WSQL 5AZ2L 5IVZA 3FT3B 4KKLC 2J8UF 5SX4H 5EOCJ 4XRCB 3QIBD 3M45A 4JFFA 3FQUB 1HHIB 2BVUA 4XNXL 3RZCC 2E9WA 4NKDB 2NYYD 2DL9A 3ARTA 2EXWD 1U36A 4ZYKB 5DJDB 3VFWB 1ZVSA 1KENH 4L8DA 1P69B 2R2EA 5DRXB 1Z5LB 1QUNA 1KLUA 1EK3A 2AXFA 5TDOA 1IQDB 4ZPTB 3U4EB 5FYLH 1NLDH 5I1HL 4TUJA 2HVJA 1MJUL 5GRYA 1NGZA 1KCSL 3WL9A 4BH8A 1EFXB 1LP9F 3SPVB 5TE6H 4P4KB 1WK0A 1T5WB 1T66C 1KG0A 1D5XA 3UTZA 1RUPL 1HSBA 4KKBC 3HUJF 5HHOB 1IL1B 4K94C 1N5YL 4JHZA 4DGIH 3TJEL 2CK0H 4QRUB 4RGNC 2FEDD 2DQTH 4HUUA 4NQTA 2D31A 1SJVA 4M03A 1O5DT 2MQCA 3BKCH 4NWUL 2UYLA 5GRJH 3VFSA 1HWHB 3CX5K 3FQNB 4ELKA 5KZCB 1NSNH 1DQLL 4E0RA 3QHZL 1F13A 2MHAB 4UB0L 1N0XL 2PXYD 4BFIA 3HI5L 3QIWD 2WUBH 4EN3C 3TLRA 4MD5B 4WNQA 4YE4H 4I18B 5E6YA 1TCRA 3KPRA 1ZEAL 5FOBA 2GUOA 4PGJA 4GG8B 2CLVB 1I7ZB 5EA0H 3B2UC 3B3IA 5CEZL 2Z0BA 5K33A 5MI0C 5B4MC 4Z7UF 4NFCA 3WS3A 2GQHA 3PQYB 1F3JA 3KXFE 5F7MC 2YBRB 5L2KA 4EI6A 3A6CL 5LAXA 2B1HH 1ZA6A 2IPKA 2VZSA 3TWCH 3GI8L 1NBVH 3L3JB 3RGVD 5H94B 4M6NH 3RVTD 3GMPA 3UJTH 4MDIB 4G6FB 5B38A 4OZ4A 1WZMA 1ED3A 5AYUL 1X5FA 3VE0B 4W6YB 2ZSVB 5F7KC 3T4AB 3WE6A 3P9LB 1KN2L 3DUUB 4P2QA 4ZOEA 3EJJX 3PWPA 4LBEB 5IB2B 4FQ2H 4QHUA 3BPLB 3DGGA 3MZTA 5FHAH 3RFZC 3WLBB 3BXNB 4HXBL 4WTXA 1B4JL 3UTPE 2DD8H 4Y7MA 1AR2A 3ZSSA 1I1AB 2WLYA 4LHUD 2K7PA 5EOCH 2X1WL 2OJEA 4MNGE 3UJIH 5FCSH 1IC4H 1G6RL 1NAMA 4TQEL 4X4YB 2VXVH 4JG1L 1EDQA 3QDGA 4LPXA 5DFTA 4HWEL 4OLVL 5KTEL 1Q9WA 3I02A 1OTTC 1JJUA 1G9MC 2BVPA 2FH6A 2J88H 4YDLC 3MV7D 3FZUD 4I48A 5I15L 1LEGA 2W65A 4G6JH 1MRDH 5DD5H 2GTZB 5EN2B 1RFDH 3X11B 1WBXA 1S8DB 2ADIA 4J1UB 1NBYB 4PJIA 2JB5H 1WFTA 3C09C 4UQ2B 1YEGH 4LCCB 1CLZH 4X4XA 3VXSE 3VXUA 2IG2H 2R15A 1CXKA 4CADA 3BP4A 1UXSB 1JPTL 4P2RA 5I30H 3RWIA 1A7PL 2XWTA 2F19H 1IVLA 3FCTA 4RIRB 5CP7B 5GSRA 5HHXL 4AH2A 2F54B 4YFDB 4GFTB 4KV5E 3WDJA 1A47A 2YKLL 4U1JA 1JNLH 4OD2A 2BC4B 1NPUA 3CFCL 3VMOA 4V1DD 2B4CH 4ODVL 4BSWB 3CK0H 2J8UA 3JTTB 3GGWB 3W2DH 2D03H 2VR5A 5DJ2B 5JHDD 5ABDE 1FNGA 3LAFA 4YIQA 1WCQA 4V2BA 3UTSB 4JZJC 5IW1B 1MCWM 2QQKL 4CVZA 4LSUL 5KS9F 3F12B 3IFOA 4BUHA 1YECH 4LCIH 3BP6A 5HD8D 5JOEA 1MLBA 4R0LB 1RZIB 2PKDA 5GXBB 5GRXG 3BPNC 4ZO9A 3KS0H 1TQBC 1AI1L 5MEND 1LP9A 3K2UH 3MRHB 1XF1A 5ALBL 3STZB 1K8IA 3EJZD 1OARL 3OX8A 4NKIL 4DVRH 2VIRA 3HUJA 1YUHA 3SQOL 2YPLB 1ZWIA 2W0PA 5HPOA 2O5YL 3U36B 1CFBA 5E95B 4ALAL 1Z6JT 4NRZA 3ZSTA 5I1EH 3GFUA 3QDJE 5SWSB 4ZSOB 1UA6L 4HK3J 4HH9A 1JWUB 4Y4HA 3TBYA 3DJ9A 3V4PL 4P99A 2WBWB 3TO2A 1A4JA 3C60B 1QFUH 5BW7A 2OTWA 3HZMA 3DARA 5KW9L 2OXGA 2H8PB 4LCUB 2X9YA 15C8L 1B0GA 2JIXD 4HS3B 3V6ZB 4L3AA 3A67H 5BS0B 2PTTB 4PJFB 2DLGA 3ULSB 5T1LD 2HFFA 3WUZA 1I7UB 1T1ZA 5B21A 5TPWH 1Q9KA 4NO3A 1MFBL 2R8SL 2P5WB 1GGIL 3O8XB 2HJKA 4OM0H 4Z7UA 4UV4L 4NQDE 5L7XH 2CR6A 4NZUL 3OG6B 2V7HA 1EO7A 5D1ZB 4LCYB 2AK1L 5MP6H 4K9EL 5SX5K 3GMQB 5D5MB 1VACA 2H3NB 5E5MA 1GSMA 5DDHA 2YXMA 5FO8B 5TE7L 3UDWA 1YA5A 2XT1B 4J8RB 3PGDA 4RGOL 4Y1AA 4PJCE 4KJYA 1MHHA 3VD5A 2HJLA 4H8WL 1U8QA 1PYWA 5GSVA 5J0BA 1CL7H 3KPMB 4TVPD 3MLSH 3WO3B 1T0NA 1KFAH 2HKHL 1UC6A 5CUSL 5I1GL 3BIBX 4LGSB 3FOMA 4LSRH 1GC1H 1MRFL 5DUPH 4F58L 1TVBA 2A0LC 3H3PH 5DC9B 3ILQC 5LQBL 4OLYH 4PJ5D 1JZ7A 2X44D 4PRPB 4JVWA 1P9MA 4PR5B 2ATKA 1YNLL 1CICB 5E2WH 4ERSL 2XQYK 4KK8D 3TBSB 4AMKH 8FABA 3P0VL 3DXAA 5B3JE 3SKOA 4PJAE 3VFVA 2ZUUA 2PO6B 2A6IA 2FJGB 3GJFB 4GKSB 3W0WD 3OGOE 1FSKC 1FL6B 1JGUH 4U1LA 4HX1B 3JXAA 2VE6A 3FFDA 3DSFH 1JHLH 1ZA3A 2GFBA 3RA7H 3D3VB 1XF3A 2DQJH 4IOSD 1KTDA 3GHBL 2Q7YA 3B8SA 1HKFA 4XP1L 4UILL 2ZSWA 4F7EB 4MA1C 1ZGLA 3NCCB 3HNTL 3CU7A 4NUGH 3EZ8A 4PYGA 2BFVL 3DI2B 2A77H 1O0VA 3ULUD 1KIUA 1MAML 3LN5A 3Q5OA 5TJWK 4Y4HC 1XZ0A 3M1BA 3QEQA 5FM5O 4GW4B 3QJFA 5BW7C 2G75A 4RZCB 4M61A 5D2NA 1FDLL 1OT2A 4Y19B 5F9DC 3KPOB 1WC7A 1O7VA 1EHXA 4ZXBC 3OR6A 1CLCA 3ZKNC 3OAYH 5HYSA 5EORH 1JK8B 3MJ8A 4U6TA 4ZS6D 4OGZA 2VDNH 3RKPA 3OKMB 3VFNB 3ZDYF 3GM0A 4OF5A 4QOKA 5K9KB 5EBLA 3M8OH 3OHXB 1FYHB 3BZ4A 1MRCH 4CNIB 2HVKB 3TCLB 2VWEC 3EOBA 3OAUH 1E4XI 4NCDA 4FZEL 4Z7VF 1SJHA 5J57B 2NW2A 1BVZA 1SYVB 3AREB 1N64L 1UWGL 1ODAA 5DHVA 3O6LL 5FCUH 4XPBH 1MWAA 2GYSA 4YGVB 3HNVL 2ARJA 1T1YB 4P5MB 1R3JA 4HDIA 4AYFA 4X4ZA 2BXYA 4L9DA 3P0GB 1OP3H 2I5YL 2NX5D 4KDTC 5FGCE 1I85A 4HLJA 2QQNL 5KAQF 1EJ6A 4PJ9C 5T3ZL 2GT9A 2G5BB 2ZPKH 4NM4L 1UH4A 3VI4E 4LRNL 5F7DA 1LE5A 2Z4QA 4BQ6A 4KZDL 5J12B 2FDBP 2ZZUT 4Y5XB 5IMOB 1P9MC 1GGTA 1UKQA 2RJMA 3IU3B 4RRPG 4K3DL 4CJ1A 1RHHB 1NDMB 2IGFH 1HHJB 4GKNB 4FNLH 4BUGA 4QHNA 1HINH 5FEBA 3NABL 3BEWA 3ZKMD 1DQJA 1G7JB 2CIKA 1G0DA 2J5LC 3OKOB 2XZQH 4HBCL 3FO9A 3GSNH 1IJ9A 1I8IB 1Q94B 2EIDA 2PXYA 43C9B 2H6PB 4EI5D 5DT1L 1V7NL 2JE8A 4QTIH 4K8RL 2CIIA 1M05A 4P5TA 3GKZA 1T1WB 2IQ9L 2JB6A 5IUSA 2ZOKA 1TTUA 1UGNA 4ZTPL 1S5HA 1A9BB 4M93C 1VCAA 2AXGA 3CSYA 5D2NC 1GIGH 4U6VH 5J13C 4I3SL 3TP4A 1KENL 2ZUYA 3REVA 1UCBH 1NQBA 1RZFH 1S9YB 4PV9A 2P8MB 1OCWH 5JZ7C 4JRYD 3RGVA 4E42A 1P53A 4N8PA 4JGUA 3SCMB 5FYLL 1FCGA 1NLDL 2CK2A 1I9IL 5C0BA 1U8NB 1NC4B 2VLJE 4OFVA 5TE6L 1R3LA 2DQFA 1JGVH 4CJ0A 1RV6X 3OJVC 2A9MH 1BBJA 3BMVA 2DQUH 5C3LD 2XOTA 4DGIL 5FYKD 4XVSH 2DQTL 5DLML 1OL0A 2YS4A 5HDOA 5I17A 1NFDB 1PVHA 4P9HH 1AO7A 3LKNB 5IF0A 2EYTB 4OF3A 1FNLA 3BKCL 5GRJL 2CKBB 1F6AA 3BZEB 4LHUA 5IK3B 4P2CG 1NSNL 4M9OA 1PX4A 5D2LF 2NYYC 4Z7QF 2BVEA 4HSQA 2LTQC 2E8YA 2X4TB 3C08H 1HI6A 3S36H 2WUBL 5EH1A 4YE4L 3HE6D 2VN7A 1NGPH 4LVHC 1I1RA 2R56H 3KXFB 3KYKH 4JO4L 3VXTB 5IT2H 3P11H 1RPQA 4G9DB 5JLZB 5EA0L 1NJ9B 2AEIT 1ZLUK 1CGWA 4PRID 1AGFA 3HG1E 3HMWL 5DUBA 3QWRA 3RHWF 3PL6B 2GTWA 4KDVA 1Q9LB 3MNWA 2Z31D 2V2TB 2NY3C 3CZFA 5EU3B 1I7RB 9CGTA 2IQAB 2B1HL 4ENED 4U1IA 1KNOB 3TWCL 1V3LA 1NBVL 4KROD 3OKYA 3WEXB 1QSED 3UJTL 4KQ4H 3N1PC 1I3GL 3MV11 3RIAF 5I8KL 1XAUA 2J6EA 3U6RA 4E41E 4PJDF 2I27N 2X4QA 4Z7VA 3F62A 3VFUB 3FT4A 2YUZA 2F58H 4ONHB 4QRQB 3L3HA 4O58H 1OLZA 3L3IA 4FQ2L 4XP4H 5FHAL 4P5TC 4H1LH 5E2VH 5EC1A 1CS6A 3MRKA 3BO8A 2HRLA 3PWUB 1EUTA 3LMJH 2DD8L 1K2DB 5E94B 4RBPK 5LG1A 3VGAC 2VSDA 3ULVE 3I9GH 4JFQA 5EOCL 3O9WA 2NY5C 4H5SA 2DWDA 1IC4L 4JRXB 5FIEA 4HUVA 3H8NA 4XCYB 4LF3B 3VGFA 4YQXH 3NZ8B 2VXVL 4FG6D 2UWEF 4X6EB 1NBZA 4ESKA 4MDJB 3H9SA 2ICWB 5I8CA 5IB5B 5JPNA 1BQLH 1N6UA 2J88L 5CSBA 4G8GA 1MRDL 5D1QD 1RFDL 5AYQA 4K3EH 4X6CB 2JB5L 1FZJB 1H15B 2EDOA 4UT6H 4XWOC 5JDSB 4JN2B 1YEGL 1CLZL 3WIHH 1VFBB 5IBTH 1OGAB 3DVNB 4NQXB 2IANA 1BFOA 3KPLA 4CMMB 5ISZD 1F58L 5E9DA 1BJMA 4M7KH 4OKVA 3HAEG 5I30L 5J9PA 3BP7A 5DJ8B 2XXCB 4PJEF 3QQ4B 4XPTH 4OFYD 2HH0H 2CJUH 2MOVA 5A16B 5BQ7A 2WIMA 1AQKH 5DHYB 4X7EC 5MHSE 1JNLL 1S7UB 4NQSB 1SMAA 5CHNB 1D5IH 4NUJA 4U0RB 1BIIA 2QADD 1K4CA 5T1LA 1G7QB 4XMPH 2B4CL 3C6LB 1N59A 2P24B 3W2DL 5CGYC 1EAPA 2D03L 5IG7B 4NQVA 3U7AA 4IMKA 3T3ME 3VRJB 1CBVH 4WW1A 1KPVA 4EDXB 4WHTB 1I3RA 3E6HA 5ID0A 4ZD3H 2CLZA 5ESAA 1YECL 4LCIL 2Y7QB 1JZ5A 4WV1B 2ICEA 4G6KH 4YDVB 4QEGA 4WIQA 1WLHA 3I6GA 3QDJB 1C5DB 4XBGA 1OHQA 3MV8B 2NCMA 3D9AH 3GSWB 3I75B 1KXQE 4GQPH 1JGLH 4NZJA 4DVRL 4JZNB 3MTRA 4CBPA 3HC0B 5FFLA 2R9HC 5DMKA 5L8JB 3NIFE 5I1EL 2VXSH 5EO1B 3SJVE 5TDNB 5E1AB 3OXRA 5HYJE 4YHYB 2H9GA 1QFUL 4PJ5A 5D2LA 2JCCE 5JUEH 4LCWB 5F7EH 1EO8H 2ZOLA 4NQDB 3O9WC 3A67L 4BQ8A 4NO0D 4JGMA 3W9EB 4HKJB 4MLIA 1I1FB 4NNXB 2X1OA 2XFXB 5TPWL 3W0WA 5K9OA 3SKJH 1MHCA 1FLTX 3D0VA 4BFBD 2K3TA 4XH2A 1T5XA 4FQXD 5GS0C 5C08B 5L7XL 2YR3A 4JGJA 3F7VA 5CJ5A 2FZ3B 3PNWB 1S7XB 4WO4D 3VFOA 1FG2B 1OF2A 4CAGA 3QUZB 3SDAB 5SWZD 4CU8A 4QGYA 1V3KA 3CFKA 4R4BA 4XI5D 4ACPA 2EDDA 2Q8BH 1OAYH 5EZJA 3ZHKA 3VJ6B 2EXYC 5DJ0B 4IRJC 5B39G 5T5FL 4N5ED 1J05A 1J11A 4IIQB 2AJUL 1Y6KR 3OB0H 3SDDA 4EIGB 1G7IB 3MJ9A 4QRRE 4AT6B 5HHQB 1RJYA 4JY6A 4DUWA 4PJDA 5F1IB 2XPGB 1KIRA 5ENWA 3T1FA 3BP5A 4QCIA 5K93A 3QPXH 1CL7L 3MLSL 3RDTD 3ARGB 2X1XR 4PUBH 1KFAL 3MR9B 4NGHH 3D85A 1CR9H 3HFMH 3IFNH 1A9EA 3O3UN 4LSRL 1GC1L 5DUPL 1A1MA 1Z0MA 3G04B 5DD0H 5DGQA 3IAGC 3DUSA 4IMKC 4OLYL 2A6JB 5J1SC 4J2XA 4LLWA 3SGEI 5INDB 1QFWL 5E2WL 2UWEA 5GZND 1UB6B 4AMKL 4U1GB 4F7PB 4L4VE 4JKKA 5ERWB 3SDXE 5D7LB 4I0PB 4C4KO 5IOPA 3LRSA 2DRUA 3BJLA 1M7XA 3A6BH 5C0FA 4QHMB 2YD6A 3V5HA 3DSFL 1BJ1J 1JHLL 4KKCD 5M95B 3NTCH 4PJ7F 1U58A 2OBGA 4KPHH 1UH3A 2I24N 4JQIH 4WW2B 3QFDB 5ETUB 2BVQA 3AUVA 1TIUA 4UINH 4NUGL 3MRLA 4R6UA 2A77L 3V0VA 3EHBD 2DJSA 4QF1A 5J11C 2FECI 2L0DA 3TT1H 1AC0A 4JVPA 1MFNA 3S8WA 1HN1A 4Y88A 3CCHA 2R69H 2OR8A 2NZ9D 1PY9A 2IAMD 2EDTA 5B8CB 2X4SB 3SGJA 2E7CA 2EYRB 5ADPH 4Z7OF 1GOGA 4LSVH 2C3VA 4A6YB 5EORL 3MRFB 4DFIA 2GCYA 5I1AB 3ZE0E 4NCC1 4XNYH 1E6OL 2VDNL 1YNTA 1W0VB 4F7MA 3DRTB 2B8OT 2ZNXA 3HS0A 1MCRA 3M8OL 2VL5A 4EI5A 3I6KA 1MRCL 4ZFFA 1MCNA 1CIDA 2OZ4H 4M02A 2X4OA 3OAUL 3I3BA 1HSAA 4X6BB 1EFXD 3H9ZA 5FGCB 2XQYG 1FN4A 4P4KD 5FCUL 4XPBL 1HHGA 1LO4H 3SDDC 5E2TH 3ARVA 5HHOD 4HH8A 1GGCL 4YDJA 1YYML 1LEIB 4S11A 1KOAA 3KPTA 2JF1A 4MB5A 3L3OA 2XN9E 4JFOA 4PJXB 5JW4R 4BSJA 5ICYA 2LU3A 2LVEA 5KZCD 2HFEB 4RMUA 4RAVA 2ZPKL 2K9UA 4F7TB 2Z9TA 5DO2D 1H3VA 4UBDC 3W81A 1GPOH 1AXSB 1M6OA 3IGAA 3U4AA 4L4TE 4KWUA 4MYWB 1N5AB 4Y4FA 4YK4C 4DZ8B 3ES6B 5IVXF 1ZHKA 1G7MA 1MF2H 1MLCB 1MVUB 5FKPA 1S7RB 2X41A 2IGFL 4CN1A 1KF9B 3LV3B 3JUYA 4FNLL 3P73B 2AK4B 4XBPA 1HINL 4OZHE 5HI3D 3PQYD 5CJ8A 1JGEB 1GZPB 1PG7X 4XHJD 4KUZL 5T1DH 4PD4J 3VXRA 1INEH 2XZQL 2WQRA 4X7TB 1BJ1H 2AJVH 5C9JB 5IESH 3GSNL 3S4SG 1RZ8B 4DEPC 1XH3A 1XGRA 4QTIL 4UQ3B 4WI4A 4G6FD 4LQFH 3MRQA 5A2IH 1MQKH 4X80H 5MEOB 3UBXA 1HHKB 3LB6D 3BD3A 1P4IH 1EEQA 4R96A 4PRIA 2F74B 1JYXA 2E9BA 2HYMA 1J8KA 2ZUVA 2O26U 4XPAH 1OD9A 1W0YT 3FB7A 1DTUA 4HKZB 5DTFA 1GIGL 5I16A 2P48B 4U6VL 3QXDB 4Z0BH 1OAKH 2VLJB 2NY6C 3VXME 1UCBL 1I1AD 3JWOC 3TH2T 1RZFL 3RL1B 1KCRH 1OCWL 4U05A 2XKNB 1FE8H 1VFUA 3B9DA 1DP0A 2YD2A 2R23A 1XCQA 1IGYB 2X4PB 1GZQA 4YUEH 2KDGA 4YZFE 1I7TA 4S0SD 4JRWA 2YC1A 3VD7A 1LO3H 5GS2H 1T89C 5CSZB 2AV1B 3CFEA 2AJSH 4APQA 2X4NB 4FZ8H 4XVSL 1CFQA 2P5EE 3RWHB 1Q1JH 4P9HL 4NP4H 2NW3A 5HVHB 4PJ7A 4F3FA 5DURB 1A64A 3VDCA 4ELME 1RQ5A 2PR4H 4XNZC 4ZAKB 3HG1B 5GS1B 1AKJA 4MXVF 3S36L 4FQCH 4ZTOH 2EZ0D 3R0NA 2R56L 3KYKL 1EO5A 5IT2L 4HK3N 3T0WA 3BGFB 3BH8A 4HGWA 5D1QA 3WO4C 4Y4FC 4PYHA 5HGBB 1U3JA 1HILB 4MWFB 5HI5D 2ADGB 3QO1B 5ISZA 5F89B 3P4MA 3UTSD 1P84K 1X5YA 4G9FA 4GKZA 1BD2E 1ORSA 3MGAA 1DBJH 3QR2A 4KQ4L 4MXQD 4Y2DC 1X9QA 3PDOB 1KIQA 5DEFA 4DCQA 3S88L 3T8XB 4MVBC 2V17H 3RWDA 3FFCA 4LVNB 5BXFA 4M9PA 4O58L 3X12A 1WWBX 4XP4L 4XX1G 5HY9A 4JPKH 5E2VL 1S9WA 3ZT6A 4HC1A 2HTKC 1VPOH 1FPTH 5CJOH 3LMJL 3OWEA 5E1HB 2KQNA 3TA3C 3VRIB 4MJIE 3I9GL 4ZNEA 5LGKA 5SWSD 1L0YA 1DDHA 3MJGX 4YQXL 3QUMA 4ODUB 4MA3B 4M7ZB 1BQHA 3RGHA 1VEOA 3MO1A 1T7YA 2WWMD 3KNBA 1AIFB 1IEAB 1OQOA 1BQLL 4N8CH 4ONGH 5BS0D 4MQSB 4HIJB 1QVOB 4U3XA 3CNKA 3TYGH 3WUWA 5IVXA 4GBXC 4PG9A 1DBML 2P5WD 3CX5J 4UT6L 1RY7B 4NQCD 3LPGA 3O8XD 1U93A 1VB9A 3WIHL 2PYFA 5IBTL 1T22A 2DIAA 2R1YA 3FKUS 4PJBA 4NN5B 2D7QA 2EIBA 1U3HA 2A38A 4S2SB 4Y0GA 4APQC 3EYFB 4HK0B 5D1ZD 5IJVA 3V52H 4M7KL 3AXLB 3WKNA 3PIQA 5ICZA 4Y16A 1K6QH 5EIVA 3T3PE 3CSGA 2BVOA 4MA7H 2ZP0T 5LBSH 4XPTL 3CX2A 1KLGB 2HH0L 2CJUL 2X7LA 5IFHH 1T4KB 1AQKL 1SEBA 3LKRB 1FNEA 1JF5A 1MUJA 4LLUB 2P46B 1D5IL 5HGGS 1NFKA 4L1DA 3BD4A 1S7QB 3G6AB 2VMFA 4MJ2A 4XMPL 1V3MA 1FFNB 2FLRT 1XGUB 2IPTL 4XMKH 3WN5A 4UV7H 3OKLB 3C8DA 4OM1H 3LDBC 2CSPA 1CBVL 2BSRB 1DUZB 3M17A 5DI8A 3G5YB 5D1QC 1EMTH 2C5DC 4WO4A 1UEYA 2BDNH 3BHBB 4P2YA 3BGMB 4ZD3L 3BN3B 2H2SD 2CGRH 3LEVL 3D25B 4L8BA 4PRPD 3KDMA 5HYQA 5ALCL 3MV01 1FFOB 1CICD 4IHOA 5DK2B 4WFED 5I19H 4X7CC 4FP8H 3F7PC 3ARPA 2YWZA 3SJVB 3D9AL 1JGLL 1RURH 1UACH 3T2PA 2WWKT 1FZKA 3MUJA 2RGSA 1INQB 5GGSY 2DQIH 3MRRB 4F7CA 2ZUQC 1WVZA 4P23B 5LCVL 3RDTA 2QADC 4R7DA 4OCYH 4R4ND 5D7KD 1UYWH 3D3VD 5FUCC 5DD6A 5TDPB 5BV7H 2R4RH 1JYWA 4OZIE 5C0GB 5JXEC 3KLAB 1OT1A 4EVNB 4MHHG 1KT2A 4X99B 3V6OA 2EDJA 3MODH 3DMMB 3O6MH 3P2TA 5IMMB 5CJXC 1A5FH 3PV6B 4PTTA 5A1AA 1UXWA 3FOLA 4WCYH 5GS3A 1EO8L 2XA8L 3EYUH 1J1PH 4FA8A 5FB8A 5I73C 2DMKA 4IRSB 3TESA 3W9DA 1QRNE 5KVMC 3SKJL 4Y19D 2Y5TA 3SE3C 3X14A 4D0DA 5C70A 4WHYH 2MCG1 3FB5A 1LDPH 4GAJH 3CAFA 1X5HA 3VH8G 3QISA 1A6AA 4QRRB 4BA8A 1HQRA 3ZKXB 5I71C 3KVQA 4G8EA 3GRWA 2Q8BL 1OAYL 2OR9H 3TIDA 3FTGB 1FRGL 1U3HC 4P5KA 7CGTA 2NY1B 3WDHA 5T5NF 1FVDB 2YA0A 3U2SB 4UT7H 4O2EA 4RQQA 5AWNH 4Y16C 4R90L 4HPOH 4GT7A 1DE4B 1JF1B 3ARED 4X0KA 4AJ0A 1LDSA 5J6HB 4KQ3L 1ZS8B 4YHLH 3RP1A 4CUCA 3FT3A 2NY4B 3QPXL 3UMTA 4DW2H 4J7RA 5F1SA 4XRCA 3P9MB 3WS6C 4PUBL 3T09A 4NGHL 2V5SA 3FQUA 2NTSP 1CR9L 4NKDA 3WN5C 1DLFH 3HFML 4ZUVA 4L4VB 4ZYKA 3HAEH 1C7SA 5DD0L 5DJDA 3VFWA 4PB9H 3SDXB 4X5WB 5DRXA 2C4FT 4RAHA 2LVCA 2G9HA 3RY6A 3C2SA 2VLKA 1C16B 1KV3A 4QRPA 3QUXB 1IQDA 4ZPTA 3SO3B 5IBLC 2WINA 3E2HB 3HZKA 3Q1SH 3ZE1F 4FQ1H 4JEGB 1EFXA 3O6KL 3SPVA 4P4KA 3E8UH 1T5WA 4N5EC 5CGMA 3K4ZA 5HHOA 4J4PA 3AY4A 3MREA 2R4SH 1KJMA 3OL2A 4QRUA 3NTCL 3FONB 3GMOA 4KPHL 4JQIL 2AW2A 4OCWH 1DN0B 1XMWA 1A7OH 2E6PA 5HHVH 3OPZH 3B83A 3G5XB 3JWDH 4LAQH 4UINL 1AQDB 5JW3H 4EBQL 4EQ3A 2V9QA 4O02H 3KPNB 2YPKB 3BUYA 2NY2B 5E56A 1QSZA 3TT1L 4FFVC 1OW0A 3TFKC 3V6OC 3IF1A 4MD5A 4PJFF 4I18A 2R69L 1NUDA 4ORZC 5EZOH 1UB5B 3IRPX 4GG8A 5GZNC 1SJEB 4JHWH 2HA1A 1WAAA 3CIQA 4LSVL 3CVHB 1A6WH 5JMRA 5DMIH 4HWBA 4R3SA 4XNYL 2XY2A 2P44B 1ZMYA 3JTSB 4O9HH 4JFEE 3N06B 4I1NB 5HHNB 4XCFH 1TETH 12E8H 1LEKA 5DHXB 3R4DA 5H94A 2N7AA 4H25B 4YO0B 2WMPA 2OZ4L 3SCMD 4MDIA 1JWMA 3JV5A 5D9SA 1CGXA 4XB8A 1NC4D 3JV0A 3P9LA 5F9WC 3DUUA 1LO4L 4R2GB 3TZVD 2VDLH 3NIDE 3E3QC 4LBEA 2ED8A 3B9EA 3NA9H 1ZVYA 4R7NA 5F6IC 4NOBA 3WLBA 5IM7B 2NQCA 1XF4B 3VGDA 3I6LD 3D6GA 2RAMA 4FQHA 3L3KB 5EBMB 5AUMA 5FOJA 1AD0B 3S3PA 3QG6B 1B0RB 3RWCB 2VITA 1IGTB 1GPOL 4OZHB 2D9QB 4XGZA 3KXFD 3F65A 2C1PB 3RJDA 3RY6C 1RIVH 4ZUWB 1MF2L 1HKLH 3RUGF 1RULH 1WIUA 1M1SA 4LOUC 5F3HB 3X11A 3ALXA 1S8DA 3PL6D 4WFFD 1NBYA 3H7BB 4P4KC 4UQ2A 4NFBA 4LCCA 4LVOC 4QRTB 3K74B 3BDBA 2HJFA 5T1DL 4J4PC 3AY4C 5C3TA 5E8EB 3GBML 2X9WA 2AJVL 1P4LB 5IESL 4OT1H 1YEEH 3LCYA 1NCBH 5C2UB 2X5PA 2R1XA 4JQVA 4LPVA 4RIRA 2GJ6D 1JRHH 1JGDA 2FIKB 3GMNB 3QUYB 5T33H 2F54A 3DETD 4LQFL 1XR9B 5A2LH 3O6FD 3HZVB 1MQKL 4X80L 3O4OB 3X13B 3O3DB 4M4PA 5IV2B 4KI5D 3VXMB 1LNUB 1BVLB 3GJFK 1P4IL 4OLUH 3JV6A 1NCCH 1J0IA 1OW0C 3UAJC 3ZTJG 5IVOA 4OCRH 4I18C 4Z7WE 4BSWA 2V5RA 1D9KB 3FN9A 3GGWA 4ZFOB 1EZVY 5ICXB 3MV7E 4Z0BL 4KJWD 3FRPG 4TTDD 2Z92B 1OAKL 1AR1D 3GO1H 5DFVC 1R5VB 5SX5H 3NGBB 3G08A 4L4JA 2XICA 1KCRL 3V79C 1CDBA 1IFHH 5IW1A 4LSSL 3DVIA 3PWLB 1FE8L 3L3DB 3F12A 4JRXD 3GSOB 4TSCH 3MGTB 4V2CB 3TO4B 4R0LA 1AD9A 3RAJH 2P5EB 2NPLX 5C0DA 3MOBL 2D7MA 4GRLA 4YFLI 4JM2B 5EO0B 4RDQF 3STZA 3UROR 4N0YL 4ELMB 1AGCB 2AJSL 4FZ8L 5I76B 2DTMH 1XGPA 1A02N 5FHBH 1FVEB 3CH8A 2WQ8A 5KSAA 2YPLA 1Q1JL 3LB6C 3UXFA 4V1DE 1OGAD 2OM5A 3HI1A 3GSXA 5BJTB 1U95B 5DRNA 5HVGB 5SWSA 2P45B 5J56B 3LS5H 1JWUA 2PR4L 5JHDE 4L8SB 1HE7A 2AEPH 5CEYB 1BQSA 4K9EC 1QHOA 3C60A 4FQCL 4ZTOL 1D6VH 1MY7A 4AL8H 4LCUA 2BMKB 4JJHA 5H37H 3V6ZA 4HS3A 1QBLH 2FH8A 2PTTA 3IDNA 4PJFA 1N3NA 1BD2B 1I7UA 3C6LD 3GUTB 5BV7B 2FJHB 5MENE 4K7PX 3O8XA 4H8WC 1C5CL 2C1OB 4GAFB 4JHAH 2CXKA 3MFGB 3OGCA 3AU1B 5D1ZA 2APBA 3MRNA 4LCYA 1YMMA 1RK1B 3FQRB 5D5MA 2H3NA 1DBJL 1XIWB 4DGYH 5FO8A 1IKNA 3QAZB 5B38G 1MCFA 4R26H 3KWWB 4J8RA 1NAKH 2V17L 1HXMA 4JQVC 1EAJA 3QDJD 2EDYA 4KRPB 4WWKA 2HP4A 1CFTB 3MV8D 1XR8B 4LEOB 5IEHA 3ESUF 1KBGH 3BN9C 4D0CA 1VPOL 2ZCKH 4XX1E 1FPTL 5CJOL 5F96H 1OP5K 5DA0B 3STLB 4YDIL 5BZDB 2PETA 2QSVA 5JPMB 4L3EB 4X5XA 4DZBA 4F8TA 3VI3F 2HG5B 3C6SA 4GG6B 5CP3H 4HBQA 2EE6A 4UAOC 4PRPA 3HCVA 5HI5C 3RVWC 3GI9H 4LCWD 4PR5A 2OMNA 5E4IA 4ZUUA 2DQGH 3SHSA 3TBSA 4N8CL 1OD7A 4ONGL 5DMJB 3CDFA 4L3CB 3L5IA 4MXQC 4ORGB 3TYGL 2PO6A 2FJGA 2MFNA 4GKSA 3RUGA 4TRPH 4XTRD 4OZGE 1BHGA 4HX1A 4HS6B 1P4BH 3ZT7A 4GRLC 3HAEB 1RSFA 1MVFA 2OQJB 5C08D 4W4OA 2GSGA 5I74B 2ZG3A 1JNNH 1CT8B 2XTJB 5MEPB 4F7EA 4HQQL 3CVIH 5KSAC 3V52L 3QUZD 3SDAD 1A1NB 2AQ2A 1BIHA 1QD0A 4MA7L 5LBSL 4GAGH 2VB5A 4FXKB 5J89A 3QULA 3F7YA 4OV5B 4PLKC 3DOSA 4POYA 3C60C 5DYOA 3PG2A 4GW4A 3HMXH 5C0ND 2ID5A 4HZLB 4RA3A 2RFXA 4XMKL 4Y19A 2Q76B 1U9KA 4XP9L 4S1RH 4UV7L 1EGJA 3KPOA 3ARGD 4E5XB 2FIRT 4U33A 3RNQA 1KJ2H 1EMTL 1U3YA 3TGXA 2BDNL 3O8XC 4GXVH 2OLDA 2WM0A 1J5OL 5IB3B 3VFNA 2D7TH 2CGRL 4W68A 4BQCA 3OHXA 4NN6B 1J9CT 2HVKA 5I19L 2EDFA 1AXTH 4FP8L 2VR9A 1NEZG 1IKNC 3LEYH 3T0XA 1SYVA 1M7DB 5D7LD 4I0PD 1RURL 5FDWB 1UACL 4YHPA 3H2WA 2WUCH 2Y72A 3P77B 2DQIL 5JQHC 3ARFB 4OCYL 4WWKC 5MEQA 2X89D 2D0GA 5E08H 3AM8C 4MD4B 35C8H 1R5IB 3EJYC 2CDFB 1QRNB 4DK6A 1ZANH 1KYOK 3MODL 4D9QE 1HYSD 2C26A 1A5FL 1TDQA 4QY8A 1WFNA 3W11C 1FAIH 3IDIB 3QEGH 4WCYL 2VH5H 3EYUL 4PGEA 1J1PL 3FB6B 1FH5H 2EDWA 4G8IB 4K8RC 2VQTA 4Y5VA 2C7UB 2BNQA 3QIUB 2V2XB 2EO9A 2SEBB 3R0MA 3VCLB 4XXDB 3RKDD 5CIPB 1RHHA 3S3JA 1NDMA 1N0LA 2R39A 1M71A 3FB8B 3SDCA 2PO6C 2R0LH 2X4RB 1HHJA 3G5VB 4GKNA 1LDPL 3QQNA 4GAJL 4KV5F 3DWTA 3AS1A 1ONQB 3O41B 5B39B 2XACC 1G7JA 4NHCH 5JOPE 3OKOA 4W4OC 1CLYH 4LSDA 2NX5E 1I8IA 3TNNA 4S1DC 3RWGB 2E5EA 5D70H 4IMLB 2E7LC 5AWNL 4HPOL 3B43A 3FQWB 5KBNC 5IMLB 3D0LB 1T1WA 1I9JH 3MZGB 4YHLL 1ZLUH 4MXWL 1L0XA 5L9DL 4DW2L 3HE7A 4P3WA 1ZSDB 5FDYA 4NNPL 3MYJB 5C6TH 1A9BA 4LRIA 4PPTA 3QCVH 3T2QA 5KVDH 3DX9B 1LD9B 1DEEB 4PB9L 2A2QT 5I9QC 1PSKH 3O45A 2P8MA 3C5JB 2ITDA 3L5XH 1FAKT 3N1MC 3SCMA 1RD6A 5F1NB 3Q1SL 5GHWH 5J6GB 4FQ1L 1WQVT 3LY6A 4WDIB 4JB9H 1RJCA 1AHWA 1HNFA 2CPCA 4MQ7A 2AJYH 2EEAA 3AS0A 3O4LE 5E7FA 1W72H 3S98A 4NQEB 2BY2A 5IHUH 3QUKA 4H0IA 3RX5A 2EICA 3MX0A 2AK4D 1XCTB 4HWUA 4G6AD 4RBPH 4OCWL 3LKNA 3WKMH 3KJ4B 3U0WH 5HHVL 3OPZL 3JWDL 3BZEA 1YZZA 5JW3L 3NCMA 5EULV 5IK3A 1G9NH 1N8ZB 4O02L 3O2DA 3ULUH 4TNWK 3CXDH 1KB5B 2X4TA 3CLEH 2AAVA 3BW9B 2XNAA 4JRYE 3KXFA 3VXTA 3RVUC 1SMOA 5GISH 4JFEB 5EZOL 3CFDB 1NCWH 1NJ9A 4JHWL 2R2BB 3ME0A 3PL6A 3QA3A 3QNZB 1I1CA 4Y5VC 4GO6B 1A6WL 1Q9LA 5E8DL 5DMIL 2LAAA 2V2TA 4PBVC 5EU3A 4PJCF 4D9RE 5FYKE 2YWYA 1I7RA 4O9HL 2VLJD 1HH6B 2IQAA 2ZJSH 5ANME 5F9AC 3GMMB 3SDCC 4KI1A 2DQEH 3QIWB 1TETL 3HHRB 1KNOA 12E8L 3C5ZA 1OB1A 3ARDC 3BESR 1CDIA 4YAQB 2AV7A 1ZE3C 3NIGE 1PQZB 2DBJA 1VDGA 2R29H 2NTFB 1F97A 4Q2ZA 1E4XL 3ARBB 2X05A 4G43B 3G6JB 4C55A 5EO9A 3PXJA 1VESA 2YEZB 2VDLL 3CFBA 5GZOD 4MNGA 4ONHA 4PRBB 4QRQA 5D96B 3STBA 3BZFA 4N8VG 3QXWA 4Y4KA 4N68A 4KK9D 3QB7C 1WBYB 1K2DA 2BRRL 3HE7C 5B3JF 3PE9A 4PJAF 4OZFB 5H2BB 2EDRA 5DURD 4YBHA 3MRCB 3U46A 4ZAKD 4I0KA 3HG1D 4M8QB 4NJAH 2YRLA 3CLFH 3FQXB 5GGSB 3MUGB 2MKWA 4X6EA 3TBWB 1BFTA 3VXSA 5GRZA 1RIVL 1QSEE 3L5HA 1YDPB 5IB5A 1HKLL 3QO0B 3SCMC 1RULL 3AMKA 4R8WH 2V2WA 4WWID 2DMBA 4OQTH 4HLZG 4O5LH 3QXAA 2B4CC 2JJTC 1H15A 3S5LG 4C56E 3BPCB 1G7LB 5JDSA 3LQAC 4JN2A 3UTTE 1VKXB 3C5SB 1AHWC 1VFBA 3LHPL 3B6SA 4HS8H 4RWHA 1YY9D 3REWB 2CDGA 4NQXA 2G2RB 4B5EA 2J8OA 1IC7H 3ARQA 1AGBB 4OT1L 1YEEL 3QCTH 4XCNB 2W0FB 1NCBL 5JNYB 1ZHBB 3CC5B 2ZCLL 3T2NH 1JRHL 5T33L 1HOCB 4GAYB 2W9EH 3QQ4A 4Z7WB 1NDGB 5A16A 3Q6FA 3ZDZF 5EWIL 4NQSA 1M4KA 3ULVD 3JWNC 3IJYB 4OLUL 5HJ3B 2GY7B 1NCCL 2Y6SD 2HLAB 4N1HB 4DFHA 1FYTB 4X6DB 4OCRL 4Z7NE 5EPMA 5CLTA 1XF2A 2VZOA 3PWJB 4CMHB 3GO1L 4Q7DA 4YBQC 5K9JH 1PY4A 5DJAB 4WHTA 3PL6C 4GRMA 1IFHL 4OI8A 1QA9A 3BJ91 3EOTH 2IBBA 4TSCL 2H32B 5E0QA 1FQ9C 3C5ZC 4LASH 1Y0LB 3F58H 2ICWI 1F2QA 4BQ9A 5HSFA 3QDJA 1CL7I 3GSWA 1IKFH 2F8OA 1VEPA 4LSPH 3VI4F 5FYKH 2DTML 5FHBL 1UZ6E 3DX8B 4P4RB 5JO5B 5MHSD 3OBAA 4DN4L 5A3IC 1J12A 2B20A 5EO1A 4U3CA 5TDNA 1F90H 1TENA 5E1AA 2F8XC 2DLIA 3LS5L 1AE6L 2AEPL 4Y4KC 1GCFA 5IJKA 4U1KA 4NKQB 5E8NA 5MENB 1RUAH 2FX7H 5AAMA 1WEJH 4AL8L 5F3BA 4PLOB 1ZK9A 3R8QA 4XZUB 4J3TA 1GYAA 4NQDA 4JR9H 2WP3O 5D6DA 3H3BC 1SBSL 2EKSB 3U82B 5J7CC 4HKJA 5IQ7H 1I1FA 3VFGH 4NNXA 4TTGA 1FGVH 4ODSL 3MRGB 4DAGH 4JHAL 4OF0A 2FZ3A 5F8RC 3PNWA 1NC2B 4PJCA 1WWAX 3VWKB 1S7XA 2J7LA 1FV1B 5E6IB 4NBYB 1J8HE 1GC1C 2E27H 3CSBA 4DGYL 2QHRH 2X70A 3VJ6A 4AM0A 2VXUH 4R26L 4N0UE 5DJ0A 4A2LA 2JJSA 4WU5B 1EHLH 1T21A 1NAKL 2D4DA 2FWOB 5C09B 1G7IA 2OL3B 3S34H 5DFWH 4AT6A 4KJPC 5HHQA 3SJVD 1JWSB 1WV7T 3QQ3B 2XPGA 1KBGL 1WZ1H 5JIHA 1AGEB 3VDBA 1YPZE 1YC7A 4LLAA 3AB0B 4U0RC 2ZCKL 4P23D 4WJ5A 2CQVA 4CW1B 5F96L 5IHLB 4TULH 5DR5H 3MR9A 5DEZA 3ILPA 2CO6B 3L95B 5CD3B 5KAQG 4PJAA 3G04A 2A1WH 5EG6C 2WBJB 4JFPB 2FD6H 2BNRB 3IYLW 4OZGB 3DMMD 2X4UB 4WUUE 1CD1B 5INDA 1UVQB 5SWZE 5DRZB 4JZOB 4JY5H 2DQGL 4IOFC 1TPXB 5DJCB 2IBZX 4FFZL 4IRSD 3V5DB 4MQXD 4XNUH 5TQ0L 1CFSB 3UC0H 3UJJH 4JFDD 3WFEL 1P4BL 4QHMA 4NWTH 3N1GC 1BZ9B 4L8CB 3IFPB 1P7QD 1YEDB 4OFIA 2X89A 1T1XB 5FA4B 1BWWA 1JNNL 5JXAH 1UWEH 3ZYIA 4WW2A 4QRRD 5FO9B 3QFDA 3CVIL 4XPFH 5ETUA 1DVFA 5D93C 2WK2A 4PV8B 4GAGL 1G7HA 4TUOB 1S7VB 5GGTH 2NY1D 3VWJB 5BVJB 1CQYA 4K2UH 3EFFB 4IS6B 1T0PB 3IAQA 4LPYA 4YHYC 4GSDH 3D18A 3ZKSD 4MSWB 5IJKC 3WLWD 4WY7H 3HMXL 4U7SA 4KK5D 4HUWB 5GJSH 5HGHB 1W72B 3FO2B 5JIKA 1DN2A 2Q86B 1H3PH 4K55A 3IU4L 5B8CA 4DKAA 3T65A 1P84J 4KTEH 2NY4D 5D6DC 2ZUTA 2VISB 1Y18A 2VDPH 4HHAB 5IHZB 1KJ2L 3MRFA 3J7HA 1ZVHA 4X8XA 2OYPA 3GNMH 4L4VD 4GXVL 1U8HB 2VDKH 4KVNL 3HRZA 5EU4A 1B3JA 1JUFA 5IFJB 1W0VA 3QG7H 4NBZB 4PJ8C 4MNHA 2D7TL 1MCOH 2JK5B 2Z91A 3QUMH 2VXTL 3QUXD 3K4DA 1UENA 1YEKH 3PHSA 1G0XA 4HFUH 4P48A 5D7IB 3VFTB 2ZKHL 5FO7A 1AXTL 4O51B 4NN7B 4HJGB 3ULVF 5BO1H 2VXQH 3LEYL 4X6BA 2H45A 1IGFH 1IGJB 4ODWB 3C2AH 2WUCL 3KLHD 2OI9B 3QEUB 4QYOA 3NA4A 4ODHL 2CRZA 4FABL 3T0AA 4GW1A 5E08L 2P1YA 1N7MH 1PX3A 2B1AH 2ZCHH 2XY1A 3RWEB 3ZMRA 5KSBF 1ZANL 2DLHA 2HFEA 5C8JB 3N9GH 4LARH 3BPOC 4B50A 5JW4N 1FAIL 3QPQD 5F88B 3QEGL 2GITA 2VH5L 2Y25A 1XF5A 5I6XB 1FH5L 3OKNB 5CD5D 5I2IB 4DZ8A 2VSCA 5KJRH 4H1LA 3D69A 1QBMH 1A7BA 2V7NB 1MLCA 1MVUA 3HB3C 4Q6IA 1S7RA 3U30B 2R0LL 3QEHB 3LV3A 4C57C 3P73A 5FAAA 1NCTA 1F3DJ 1T83A 4X9BA 1D5ZA 3QRGH 3MA7A 4NHCL 4OFKA 4I5BB 1CLYL 5C9JA 2FX8H 2VWEE 4S1SH 4XVUC 1RZ8A 1CXIA 5D70L 1IAIM 3WNNA 1DQQB 2AP2A 1DVFC 3SE9L 3GDBA 3T3MF 3WNMA 4EUPG 4XCEB 4LKCB 4M62H 3EGSB 1J0KA 1QO3B 1UH2A 1ZLVK 1T03L 1ZHNB 1I9JL 1HHKA 2XZZA 4IRZH 5I66B 3MV9B 4R2GD 2XWBB 1J18A 3SE8H 3WIHA 4M6MH 2PW2B 4TVPL 4YLQT 1KPRB 1CGTA 5C6TL 5KSUB 1Y6NR 1UM6H 3QCVL 5KVDL 4LKXB 2VKWA 4PJGB 2X9XA 3IKCA 5ILTH 2R2HB 2VLJA 4P9HC 1FO0H 1PKQE 1QBAA 1PSKL 3TVMB 3RL1A 1IAMA 3PQYE 5C07D 1H8OA 3O4LB 2XKNA 3L5XL 4QLRA 1TZHA 1TVHB 3UX9B 5GHWL 1K9TA 4N90E 3NIFF 4PGDA 4ISVB 1IGYA 2X4PA 4XB7A 4JB9L 5ACZA 3ROOA 4JHBA 4P0DA 2AJYL 3QFJB 2JCCF 2WAHA 4KH2A 5CSZA 5E00A 5IHUL 3S96A 3IS0X 2AV1A 5IFAL 1NANH 2OS7A 4YPGB 5GGUA 2X4NA 4ONFH 3TBVB 1KB9K 4JN1H 5ECJE 1XGQB 4U31A 4DTGH 3RWHA 3WKML 3U0WL 1KTRL 5B3NA 4Q9RH 3OAZK 3GRWH 1CXEA 1G9NL 1R3HA 5HHMB 2BSSB 3ULUL 2D7NA 2GI7A 4ZAKA 3CXDL 3RZCB 3HG1A 5GS1A 4B53A 1LO5B 4OCXH 3CLEL 3QUYD 2XG5A 2YD5A 3MJ9L 5DK3A 5EU6E 5E8OB 5GISL 4M6OH 5AD0B 4PG2C 1NCWL 1GRWA 1F4WH 1IAOB 3BRDA 1MH5B 2GJZB 3WIIH 1G6VK 1JNJA 1D9KD 3NH7H 2VABB 2CXGA 3S9DB 4Q6IC 5CBAA 1TITA 2ZJSL 1HILA 2ILLA 4E41A 2ADGA 1FL3B 2DQEL 3QO1A 3SOBH 1T83C 4RGNB 3DI3B 1F3DH 3QNXB 5KS9E 2R29L 3L7FA 5F7UA 3PP4H 2H41A 5DVNA 1ZT7B 4RCAA 2AEWA 2PYEE 1CE1H 4U6YB 5C0IA 2D2OA 3GSQB 2BSTB 1Z2KA 4EN3B 3QH3B 4LHJB 4K07A 3ZZ1A 1F6FB 3MRJA 3T0EC 3CFJB 4YHIA 5D8JH 4QHLB 2I26N 2R1WB 3SDXF 3ALPA 3A6OA 1RZGB 4NJAL 1U6AH 4C56B 3UTSE 1S78C 3UTTB 4ODUA 1FVCA 4UIKH 4OSUH 1B6DA 3MBXH 5IKCB 5D1XB 3IXAB 1QQDB 3VXOA 3L3GB 1VADB 4F37K 4FN0A 4R8WL 1FZOB 3FT2A 4HIJA 1D6EB 4TSAH 5HDQH 4OQTL 1BD2D 4AIZA 2IALB 1VEMA 4O5LL 3RBSA 1LQSR 5IMKA 2FGZA 5LKNA 1C12A 2XQBH 2EH7H 1F8TL 3EW3B 3PWNA 4LFHG 4HS8L 5F7NC 4HWBH 1RUQL 2AXHA 4J3UA 1T04B 1VENA 4MMXC 3DROB 3EYFA 4HK0A 2NY0D 2HN7B 3QCTL 4W4NA 2P7TB 3AXLA 4L29A 3T2NL 2W9EL 1KLGA 4F33B 5IVZB 4ZSOE 1T4KA 3LKRA 1NLBH 1VA9A 3UBXG 4WENB 4LLUA 3ZE0F 4K3GA 4RX4A 4KRPD 5I18H 3G6AA 1NCDH 2HT4D 5GJTH 5HGDA 1ZVSB 1J88A 1FFNA 1XGUA 4Q9CA 2V9RA 5BS0E 3WJJA 2AJXH 3P4NA 4OAWB 5L8LB 1BF8A 2AXFB 3VD4A 5TDOB 5HGAB 3O3AA 2BSRA 3MBEA 1DUZA 5K9JL 1JZ2A 2P5WE 4YDLB 2IEPA 3G5YA 4NQCE 2HVJB 1NGZB 1G0YR 1ND0B 2F8VA 4L3ED 3WL9B 4BH8B 3BGMA 1MJ8H 2FBJH 3UTZB 3BAEH 3MNVB 4Z18A 1FFOA 4KMTH 4LASL 4HT1H 4HUUB 1WFOA 3GK8H 3MRMB 3SJVA 4I9WD 3IJHA 4QXTB 5HYJA 4LSPL 2GK0A 2UYLB 3VFSB 5FYKL 4ELKB 1BMGA 2JCCA 4E0RB 4OLEA 4CL7A 1RIUH 3ULVC 3MRRA 3Q5YA 4PRHE 1B2WH 4Z8FH 3GBNH 2Y6SC 5TDPA 2X1QA 1ADQH 4MB4A 2XTJD 4EXPX 1F90L 4WNQB 2FATH 1R6VA 3KLAA 4JKMA 4X99A 3KPRB 2OZ4A 4KUCD 5FOBB 2GUOB 2GY5A 4LLYB 2BZDA 3DMMA 1A22B 1RUAL 2FX7L 1WEJL 3B3IB 4WTWA 3PV6A 3ZL4H 4OZHF 4JR9L 4KAQL 4D0BB 4JZJB 3DVGB 1F3JB 5IQ7L 5ESVA 5L2KB 3VFGL 4IRSA 4EI6B 4M7ZC 4WFEE 1KIPA 1J8HB 1A7QH 1ZA6B 2VDMH 2IPKB 4DAGL 1TQBB 4N0UB 3VRLF 2FX9H 3A0OA 3GMPB 5FUZH 2QSCL 1WWWX 5B38B 4QRSA 2EDBA 4QRRA 3D3VE 3WE6B 5DK0B 4UNVA 2E27L 5F97E 3D2UD 4PD4K 1CWVA 1IGMH 5EU7E 1YPZB 1NMBL 5L2JB 1EHLL 1T7XA 2FYYB 1L7TH 4TNVK 5MERA 1CU4H 3DGGB 5FF6B 4JM4H 2FB4H 3S34L 5E24E 1CG9A 2NR6D 3BT2H 3RIFF 3NBNA 4M1CC 4ZFGL 2YD3A 1JF1A 1V05A 4FQXB 1WZ1L 4OD1L 4HIIB 1H8NA 5LXGL 1A4KB 1J7VR 2OJEB 4JCLA 4WUUB 3ARFD 3P9MA 5DR5L 4AENB 1NAMB 4TYUA 1V8HA 5DVLA 5B22A 4JFXA 3WJJC 2DLEA 4L4VA 3Q48A 1PG7H 4YZFF 2A1WL 5E99H 5IROA 3V6BR 1QRND 3SDXA 2FD6L 3MBEC 1SY6A 1E4WH 4U2YA 2BVPB 4NC1E 3IVKA 3IDJB 1C16A 1LEGB 4PFEA 2HT3C 3O11A 1WBXB 2ADIB 5T1KA 3K3QA 5CJQH 3MRPB 3TJHD 3NZHH 4JM2F 4XNUL 3UC0L 2Y06H 3QIUD 3UJJL 4CADB 4W6WB 4POUB 4ELMF 4KTDL 1I4FB 4NWTL 3MJ7A 4LK4A 3G5ZB 2O5ZH 4P2RB 5EZIH 3RWIB 2FR4A 2DQCH 2XWTB 4AH2B 3ZLQC 1IGIH 2NLJA 1UWEL 3FONA 4OIIH 4XPFL 1HWGB 4Z5RA 5A40E 3KPSE 2OSLB 1AQDA 2APWA 3BEVB 1REIA 3KPNA 2YPKA 5GGTL 4GOSA 4K2UL 4XVJH 2EDEA 4GSDL 5CS7A 2J8UB 2UVFA 4WY7L 3H9HB 3JVGA 5GJSL 4PJIF 3WJLC 3DMMC 3MLPA 4J3XA 1H3PL 5C0RH 1FNGB 3CH1B 4YIQB 1CDHA 3RZWA 1SJEA 4KTEL 4PP1D 5JMOC 3IFOB 3S36X 3CVHA 3BP6B 5AZEL 1MLBB 3RBGA 1RU9H 3GNML 1JBJA 1FSKB 2VDKL 5IIEA 3JTSA 5C92A 5SV4A 1DUYB 5HHNA 3VXPA 3QG7L 2WBKA 1NEZB 1KTKE 1MCOL 3QUML 4ZMAT 3OX8B 1EEZA 1A6ZA 2CMRH 4H25A 4YO0A 1YEKL 2NXZD 3BKYH 3BH9B 4J3WA 3HUJB 1YUHB 1J0JA 2EE3A 4MA1B 5BO1L 1ZWIB 2VXQL 2XN9A 3RTQA 1D5BB 1IGFL 2UUDK 1R3KB 3GJFH 2H26A 2HMIC 3C2AL 3CUPB 1BLNB 1ULVA 1YMHB 1OAZH 1T2JA 4HH9B 5JW4Q 4Y4HB 3TBYB 4NQED 3LPWA 3TO2B 1U8OA 3PGFH 2KZ1B 4RFEA 2OTWB 4HJ0D 1N7ML 1H5BA 2B1AL 4EQ2A 2NY4C 1B0GB 4L4TA 1DFBH 4OGAD 5EBMA 4ZXBB 1AD0A 3N9GL 4LARL 3QG6A 1B0RA 4MMZC 1T1ZB 1Q9KB 2DQHH 1YYLH 4GUPA 3RWCA 4C59B 5IP4A 4RRPA 5E2UH 5IROC 3EYSL 4OZHA 2HJKB 2C1PA 5KJRL 2VAJA 3GMLB 4JFED 3VMPA 1QBML 2V7HB 3QDAA 3PWVB 5JA9A 1EGJH 3LKSB 1CGUA 3U0PA 3U0TA 4LP5A 1VACB 5F3HA 4ZUTB 4X7DC 2DWEA 5DDHB 3RJQB 5DD3H 2D4FA 4QRTA 2W9DH 3FO1B 2ERJC 3L7EA 1MI5E 3QRGL 2F53D 1TLKA 4JPIA 4Y1AB 3H42H 4UUJB 3TT3H 4OFPA 1GH7A 4NC2B 1P4LA 4K23H 2FX8L 1A6TB 3C87A 1NFDE 3I6LE 4S1SL 3TN0B 4UT9L 1Z9SA 2UZIH 5TH2B 3GMNA 2FIKA 3QUYA 3TNMB 2HJLB 1XR9A 4RWYL 1GOHA 1X3DA 1YJDH 5FM8A 5GSVB 4PJ9B 2IH3B 4M62L 5GIRB 3ARBD 1P7KB 2DMCA 2VOTA 3X13A 2A83A 3O3DA 5IV2A 2NY2C 3NPSB 1RUKH 3VXMA 4KHTH 1PKQB 2YK1H 4IRZL 1LNUA 1BVLA 3SE8L 1CXFA 3WNKA 5CD5C 3JVGC 2HLFD 5CSGA 1UM6L 2N7BA 4WEUD 1G84A 4ZFOA 2ATKB 4AEFA 3FAXA 2G5RA 2Z92A 3NPZB 5ILTL 5KANG 1HQ4A 4WFFE 1FO0L 2AJZA 1ZKAA 2EKJA 3VFVB 5HHPA 4BH7B 3L3DA 4EKXA 1SHMA 3GSOA 4L5FH 3TO4A 3FFDB 1U92B 5FV2A 2P5EA 2W91A 2J5LB 2VO5A 1XF3B 3MFFA 3BI9X 4GXUN 5EB9A 2GJ6E 1KTDB 4DKEH 4OZIF 4P59H 1CTOA 5EIIA 4JM2A 5EO0A 4J6RH 5C6WH 4MZ3A 2ZSWB 4LPUA 2OR7A 4FHBD 3QYCA 4ELMA 4KI5E 3VA2C 3EO0A 4O2FA 3RTQC 1X44A 1QACA 1KYOJ 4PJHE 4JN1L 4Y8DC 1OP5H 4DTGL 3FO0H 3LN5B 3R8BB 5GGRA 4Q9RL 1XZ0B 5EU6B 3GRWL 3B5HA 3QEQB 1U95A 3P4OA 3L5JA 3RVVC 2ORBH 4BKLA 3QJFB 4K7PY 2G75B 4UIMB 1WUNT 3LEXA 4M93B 5T3XD 3B9KA 4L8SA 5D2NB 1H5BC 5E4EC 5LVEA 1PGRB 5J13B 1WC7B 5DC4B 4P46A 4LP4A 3LOWA 2BMKA 4PJEE 4HG4K 4HF5H 4JRXE 1LILA 4DK3A 3HN3A 4M6OL 5CEXB 4Q97A 1FNSH 2CUHA 3MJ8B 4M7LL 2YRZA 1T2XA 3QJHA 3QZWG 1F4WL 1BD2A 1HH9B 4N9GA 1FYTD 3GSVA 4MJ5A 1CD9B 5KS9B 4U1NB 4ZOAA 4TPRH 3QI9A 2XXMB 4QOKB 5EBLB 4QXGL 2C1OA 3SE4A 4FXGB 4X6CE 4U0QB 1MJ7H 2HT2D 2LE9A 4N1EA 5HI4D 4WI5A 2ICWJ 1O7SA 3SOBL 4KDWA 2ESVE 1F4AA 1RK1A 2PYEB 1JPFA 1OGAE 5T1MB 1MWAB 1OSZA 3EOYG 1XIWA 2ARJB 3LKPB 4BZ1H 5CINH 1U2HA 3PP4L 3KWWA 4PGBB 1U8PB 3LQAH 4RA0C 4N8VB 4JREC 4MJIA 3QUYC 5ACMA 3NFSL 1CE1L 1GGBH 1CFTA 1X6LA 2LTQB 1OOAA 1XR8A 4OLWH 4F57H 2AQ3A 4P2OA 3B8YA 3O4OC 3GHEH 4LVHB 3BMWA 3EOAB 3O0RH 1QNZH 2V5YA 2XRAH 2Z4QB 5D8JL 1DQMH 3RWJB 3STLA 2CKBH 2LV4A 1MFEH 3QCUH 4RFNC 5JPMA 4KHXH 2AJ3B 4MCYB 3O2DH 4UMGA 2CKNA 4LIQE 1T20A 2D9CA 1U6AL 2NY3B 5BOPA 1ZGLP 1QR4A 5HXMA 1EZVX 4NM8H 4UIKL 3NGBC 4OSUL 3MBXL 3EZJB 3MLVH 5EUKA 3LN9A 4LU5H 1C08A 2ADJB 4J23A 3S5LB 1P2CB 2C3WA 4QHNB 5DRWA 4L3CA 5HDQL 4ORGA 4TSAL 3TO4C 1EPFA 1XFPA 1DQJB 3CMOH 3OV6A 4XAWH 2CIKB 4DOHE 4OI7A 2NXYC 2XQBL 4NDMA 3HPLB 4HS6A 1LMKA 2EH7L 2BY0A 4YHZH 3MV8E 5FA3B 3HAEA 4JM2C 1ZT4B 4HWBL 2OQJA 1CT8A 1NC2D 4MAYD 1R5WA 3VWKD 5MEPA 1OGTA 5JOFB 4KKAD 5E6ID 4HUKB 4DKFH 5H35A 1Z9OA 5JORA 3IETA 2AGJH 2VQ1B 3VGAB 4FXKA 4H88L 4NSKB 4QTHB 2Y4SA 1OM3H 3ZT5A 4R4FH 1S5HB 1SJXA 1NLBL 1BPVA 3B9KC 3VXQA 3LQZB 5C09D 4NQCB 1X4XA 5I18L 1NCDL 4LCWE 2PUQT 3GKWL 4XWGH 5GJTL 1TVDA 5F7FA 3IB4A 4P46C 5IHBA 3REVB 3VGEA 1KJVA 4Q6YA 5HYEA 1YQ2A 3UO1H 1LO0H 2EEBA 2AJXL 4PV9B 1G9EA 4E42B 2JJVA 2UY7A 4HV8A 1B6UA 3V8CA 4UTBH 1G7PB 5DWUH 2CR3A 2UV3A 5BV7C 4WU7B 4OFDA 1F4XH 5C08E 1MJ8L 1R3LB 2FBJL 2FSEB 3QI9C 2WBJD 5IB3A 3BAEL 3NIDF 2BNRD 3LIZH 1EV2E 1NUFA 4HKBA 4KMTL 4PRHB 4D2NA 4HT1L 1P7HL 5CBEB 3AAZA 1MCHA 1CN4A 5HVWA 3RX8A 1LO2L 1XIWC 4OZIA 5I17B 5IF0B 3OZ9H 2E9JA 5L8KB 1M7DA 3WCYA 3P77A 1RIUL 1B88A 1I8LA 1B2WL 4Z8FL 3GBNL 4LL9A 2YOCA 1LK2A 3AMLA 2YSSB 4HUXA 1ADQL 4MD4A 2Q8AH 4P2OC 3LKQA 2CDFA 3TF7C 3K8KA 1QRNA 5BRZE 1FORH 4XXCA 5HDBE 1A6UL 1RZKH 1ZXQA 1OLLA 5GGVH 3DX6B 3UEZA 4Y89A 1AGFB 2RIKA 3VWJD 3IDIA 3K2MC 4DN3H 3FB6A 5F6HJ 4G8IA 3S37H 2VDQL 3QHFH 3IDMB 4OUOA 2C7UA 1VSCA 2V2XA 3H9YA 1A7QL 4NHUA 5LWYH 3MCKA 2VDML 4L9LB 4XXDA 4GW5A 1NGWB 1OTSD 3FB8A 1WCBA 1UQSB 4PS4H 5D7LE 5FUZL 1X5ZA 3G5VA 3OF6D 1SM3H 3O41A 5B39A 1KXTB 4U6XA 4HAGA 3U6RB 1GOFA 4KVCH 1SEQH 4ZOBA 4Z7VB 1IGML 4P57A 3EDJA 3RWGA 3L3HB 1L7TL 3L3IB 1CU4L 1UJ3B 3CXHK 4JM4L 3QDHA 2FB4L 3MRKB 3FQWA 1J0ZA 5IMLA 3BT2L 4D8PB 1BFSA 4PLJD 2FHFA 3D0LA 4PLNC 1LE9B 1EUUA 5I1LA 3CMGA 4D9QD 4QNPE 5FK9A 2DWDB 3MYJA 1ERNA 1UZ8A 4RNRA 3RVXD 2DYPB 1NBZB 2AEQH 1LD9A 3KPPB 1DEEA 2GW5A 3U1SL 1U41A 2J8HA 3WHXB 1E4WL 1WSST 3UPAA 3EYOB 3JWDC 4RAUA 5FYJE 2QV2A 2EC9U 4G8GB 3SKMB 1A1OB 3UDWC 1U8KB 4CDHA 5TF0A 5FGSA 5CJQL 3NZHL 1FNHA 4U1MA 4WDIA 2Y06L 3QIBA 4ZPVB 1OPGH 2IANB 3KPSB 5JOPD 3BX7C 4IRJB 1DANT 4FQPA 5E9DB 4PRNB 2O5ZL 5C2BH 5EZIL 4TVSa 5IGXH 3GB7A 1IGIL 1FL5B 4OIIL 1MEXH 1FLRL 5DSCA 4UZGA 3FRUA 4TOYH 1BIIB 1K4CB 2DF3A 1CZ8H 4PJXE 2HRPH 4XVJL 1FJ1B 2PCPB 3BW9A 2IJ0C 4YWGH 1OTUC 4XXCC 1BM3H 3GJEB 5C0RL 4ZQKA 1QSFE 4JFEA 4Z0XA 1I3RB 3CFDA 3MV9D 1PZUB 2R2BA 1BOYA 3WXWH 3TJHC 3EYQD 4YXKH 4AQ1B 4N0CC 2NY7H 4KJQC 1F2XK 1RU9L 2IADB 3QNYB 2F9BT 1UWXK 1JRHI 1HH6A 2AK4E 3TVMD 3QIWA 3O4LD 1A6VH 2CMRL 3LPFA 4YAQA 3BKYL 4HW6A 1KN4H 1U8IA 5DMKB 4G43A 3TV3H 1A3LH 4X4ME 5J11B 4GMSH 4P3DB 1OAZL 2OP4H 3EAKA 3QFJD 4JFHE 4K7FA 4PRBA 1I1YB 2H9GB 2EYSB 1CDYA 2MKLC 4KFZC 3NCBB 4MS8C 3INUH 2W0LA 1WBYA 1DFBL 4XAKD 3D39D 5H2BA 3ARSA 4JQXA 1EEYA 3MRCA 5HHMD 4OZGF 3RZCD 4NKMA 2DQHL 4M8QA 1NEUA 3D0VB 3I2CH 3FQXA 2W1NA 3MUGA 3NN8B 3TZVB 2EIZA 1MI5B 4D9RD 2CDEB 4UDUB 2CK0L 1EGJL 1YN6B 3VFOB 1OF2B 1FC2D 3CFKB 4R4BB 4RMQA 3DO7B 3BPCA 1G7LA 3QIBC 5DD3L 4A6YH 2W9DL 3S4SA 3C5SA 1VKXA 5FYJH 1T66D 2LQRA 1J05B 4OD3H 5CP3A 2EXWC 3REWA 2Y9RT 3MACH 1I85C 2Z93A 4KKBD 3H42L 4EUPB 3TBTA 2VN4A 3LH2H 4K23L 4JY6B 1YEIH 1X5KA 2W0FA 4PJDB 2Y23A 3QDMD 1KIRB 1ZHBA 3CC5A 2QR0A 4RGND 3SY0B 2UZIL 5ENWB 3CGTA 4QCIB 4Z7WA 1NDGA 1YNKH 1E4KA 3MV7A 4O4YH 4HJJH 1RUKL 3D85B 4KHTL 2YK1L 2E7MA 2LU4A 3MCLH 3E3QE 3UPRA 5JIIA 1A9EB 1JN6A 1A1MB 2HLAA 3DUSB 2BX5A 2FHBA 3MLRH 4EN3D 5BCAA 2WANA 4LLWB 4MJ4A 2FEDC 4YEEA 1BBDH 4JKLA 5DZOA 3ULUF 4M6NL 3WHE0 2UWEB 2GJ6B 3B2UD 3EBAA 2VR4A 5DJAA 5I75C 1KCSH 3O6FB 1WTGT 2FL5A 1CYGA 5B4MD 1AP2A 1PD6A 5IOPB 2GSIA 1RUPH 2H32A 3LRSB 4L5FL 3MNZA 2PXYC 3HMXA 4C56D 4PJHB 3UTTD 3V5HB 3QIWC 1IM3A 4LLDA 4V1DA 5D1XD 3V7AG 4DKEL 2VKXA 1U58B 2WZPD 1KJ3H 4DEPB 4J6RL 4XNQA 1RAMA 1T0MB 4JG0H 2P8LB 1L4IA 5JHDA 1UM5H 1KJ2A 1H8SA 4N0FB 3C8HA 1WJ3A 2P49B 1K8DA 3MLWH 2DIBA 3FO0L 3V8OA 2BCKB 3UJIL 4PJEB 3BISA 2ORBL 4WHDA 4X9GA 1WISA 3WFDH 1RI8A 4EDWH 1QFOA 1W8NA 2QL1A 1EVUA 3RGVC 5DZNA 5MENA 3RVTC 2OTUB 3DX7A 2NY6B 4JQXC 4ZO7A 4G6JL 5DD5L 3QP3A 2FRGP 4HF5L 1BJ8A 4JFFD 3LRGA 4ODTH 3D87B 3ZHDA 3RI5K 4F15B 1A6PA 3TEUA 2ESVB 1YNTB 2IG2L 3WNPA 2ED7A 1VFAB 5C7XH 4F7MB 3ARYA 3MRGA 1HK6A 4Q58C 1INDH 3HS0B 4PRDA 4TPRL 2VL5B 1AFVH 3I6KB 1OTTD 2COQA 2F19L 4F9PA 1MJ7L 1NC2A 1MCPH 2X4OB 1IRAY 2IPUG 1FV1A 3JSSA 4YR6A 2JIXA 3MOQA 1RUMH 1HHGB 4TUKH 1ETZB 3IJSB 4E9LA 4CN6A 4WU5A 1U8MB 5IR1B 4CU7A 3LQAL 2OL3A 3CK0L 32C2B 1GGBL 4OLZH 3L3OB 2VZVA 4HXBH 3QQ3A 4JFOB 1MCDA 2WW8A 1E4KC 1N26A 4F57L 3FZUC 5ICYB 4R97C 1IAKA 3GHEL 3IDYC 4RAVB 2Z35A 2IBZY 3O0RL 3DV4A 2D3VA 3T77A 1QNZL 1TJIH 3ZYZA 4IBLT 1DQML 1W0WB 2L7JA 4TQEH 3RWFB 5CWSA 2CKBL 1Z0NA 1MFEL 5CD3A 3QCUL 2FCBA 2DKUA 2X2YA 4KHXL 3O2DL 3WO4B 2AI0H 4Y4FB 1D7FA 1G7MB 3KPRD 4JFPA 1T3FB 4DOHB 5GRVK 4OZGA 3K2UL 4NM8L 5HI4C 3MLVL 4LU5L 3GM8A 4JZOA 3OKKB 1KB9J 1BX2A 1JTTA 5DJCA 5L2KD 3V5DA 1CFSA 3CMOL 4XAWL 5D72H 3NOIA 4Y2DB 3V6FB 1J8HD 4DWHA 1BZ7A 4YHZL 1V7MH 4UTAH 4YHOH 1HZHH 3IDUA 3NCEB 1BZ9A 4L8CA 1F00I 3IFPA 1A7PH 1YEDA 3MUY1 4XHQA 1S9XA 3MRQB 5EOTB 4XC3H 5FO9A 4LMQE 1X5GA 2YKLH 3UBXB 4GRWE 4DKFL 1SBBA 4PV8A 3OKDB 2AGJL 4TUOA 1JZ3A 2K7QA 4R96B 3QXVA 1A8JH 1LHZA 1OM3L 1SVZA 3TA3B 3VWJA 4R4FL 5BVJA 3PWPD 5HD8C 4IS6A 3ULVH 1WIPA 5DTFB 2EE2A 3V0WH 5I16B 4HUWA 5HVFB 4XWGL 1W72A 5CLWA 4OM0L 3BFOA 1RZJH 3EJZC 1LO0L 4DVBA 3N1QC 3EYVB 1V5JA 1CTNA 3NIGF 3UP1A 5MP6L 4WUUD 3B2VH 5KN5A 5IHZA 4JFDE 3VA6A 4UTBL 5DWUL 4GBXB 1XCQB 1QLRB 3ZTNH 1F4XL 5LGJA 1U8HA 3WIFB 1KEMH 3SBWA 1V3JA 1VFOA 1HXYB 5IFJA 1I7TB 3IS1X 2YC1B 3LIZL 2FGWH 5ALBH 4F9PC 4YHKH 3VFTA 4PIRF 4PTUA 4O51A 5JTWA 4ZG1A 1ZLVH 1JVKA 5TFSH 4TN9A 3F7RA 1Z3GH 2RR3A 3OZ9L 2Z8WC 3VXUD 4PJ7B 2APFA 4KRMB 3MLZH 4F3FB 4ODWA 5BRZB 4P2RD 1G1YA 3BD5A 1AKJB 3H3PL 3VG9C 2ZG1A 2Q8AL 3VFPB 2D7PA 4I8DA 15C8H 4JY4A 1FORL 1FFRA 3Q6GH 1XGTB 2VAAA 1ZHLA 1OSPH 1RZKL 5C8JA 5GGVL 3TYFA 4HGWB 4HKXA 1MFBH 4DN3L 3EIFA 4XMLH 1ZT1A 4I4WA 3S37L 1JGUL 3QHFL 2A0LD 3ILQD 1QPPA 2VRAA 4UI2A 3RA7L 5I2IA 1S7TB 2DQJL 2Q3ZA 4I3RH 3VH8A 1OAQH 3ARUA 2V7NA 3V4VH 5LWYL 2NX5A 4WI7A 5CZVH 4WI2A 4PS4L 1X4ZA 1F5WA 1SM3L 3BGAA 3WV0A 3OAZH 1U91B 1F4HA 1KIQB 4DCQB 4KVCL 1SEQL 3FFCB 2VLRE 4U1SB 2CLRB 3SGDI 2IF7A 2ZG2A 3I3DA 1DQQA 1OWWA 5E8PB 3T4YA 4KK8C 4LKCA 1J1XH 4OQTA 2D0HA 1QO3A 2FO4A 2HKHH 5CUSH 2ZUWA 4Z77A 4OI9A 4L1HA 1MJJB 4S10A 4B0MM 2B5IC 4Y4HD 4F58H 4MHHI 4IJ3C 4AEEA 5DJZA 1IC5H 5KSUA 5I73B 5IEKB 3V7MA 1F3RB 2BOBB 3LN4A 2AEQL 3F6LA 4LKXA 1E6JH 3GEWB 4ZXBD 3DNKA 2PW1A 3WUWB 3O4LA 1G9NC 3ZKND 1CGYA 3ULUC 1UZ6F 2XIDA 1NFIB 3SBWC 1X5LA 1LVEA 3SKNB 1U93B 5E5UB 1IEBB 5I71B 1C8PA 3VD3A 4ISVA 1JZ8A 1TTGA 2R1YB 4Y5YA 3NACH 5KOVC 2VLLA 1OPGL 1U3HB 3AS3A 1H0DA 3EDDA 1JPGA 5C2BL 3PIQB 5DS8A 4YPGA 3HNTH 4Y16B 4B7IA 2ICCA 3AROA 5IGXL 4M8VA 3DBXB 1MEXL 3WBDA 5DQ9B 3OXSB 2P8PB 4JRYA 3PXHA 4TOYL 4ZS6C 1XT5A 4Y1AD 1QSFB 1KGCE 4OZFG 1KULA 2BSSA 3TN0D 1CZ8L 1LO5A 2HRPL 3DPBA 4ZO6A 2BERA 2OX5A 4CVUA 4YWGL 5C07E 1BM3L 3VD9A 4PJ9D 3RPIA 4RISH 3G6DH 2EDNA 5D4QA 1P1ZA 3M17B 3SO5A 5DI8B 5ANMA 5AD0A 3OKEB 3P9WB 4PJBF 1E0OB 5IB1A 1X7QA 1IAOA 3HA0A 3WXWL 4XPGH 1MH5A 4N0RA 2NY7L 1UT9A 3KDMB 5HYQB 4N90D 4U49A 3V5KB 4IHOB 4U3HA 1JYNA 4WRLA 4KRNA 4GS7C 5EBWA 1SY6H 3D1MC 3HE6A 1JPSH 3V9FA 1A6VL 4IOIA 3HLAA 3QNXA 3HNVH 1QLFA 1UFUA 5AEAA 2XZAH 1KN4L 1H9VA 1A2YB 1BVKB 2YZ8A 3TV3L 1A3LL 4GMSL 5C0AE 2Z31A 5KOMC 3SGJC 2BHZA 2BSTA 4EN3A 3QH3A 4ZFZB 1BF2A 1KCKA 4XVTH 2PTVA 3NCFB 3INUL 5D7JB 1JNHA 4O2CA 1UXWB 3BDYH 3CFJA 3FOLB 4QHLA 1QSEA 3LD8C 5EU6D 3ZKMC 1UKSA 5FB8B 3QEQD 4RGMC 4MJ6A 2R1WA 1FFPA 1FHGA 1YQVH 5E70A 4NNYA 3W9DB 4YHMH 3PHQB 1JGVL 3I2CL 2WP3T 2GK2A 3X14B 4C56A 4EI5C 1MCLA 1TZIA 2A9ML 1G1CA 3FB5B 3UTTA 2DQUL 3D48R 5D1XA 1EJOH 3IXAA 1VHPA 4G5ZH 1I8MA 2VC2H 3L3GA 1A14H 3DLQR 4G42B 1A6AB 1D6EA 1BZQK 3BOVA 1G6RB 4EJ1C 1UEMA 5GPRA 4Y5YC 3QQ9D 3CVHH 4A6YL 5IWLA 4P5KB 5F9WB 2DM4A 4QOKD 4OD3L 5DT1H 5CMAA 4O2EB 3FAWA 2IMNA 1HCFX 3C08L 3DROA 3LH2L 1YEIL 2P7TA 1A7RH 1NGPL 2PYED 3FN0H 3FN3A 4HIHA 5CZKA 1X6NA 5K9QG 4X0KB 5F6IB 5J1TC 3P11L 2FBOJ 4F33A 1EXUB 1YNKL 2DM2A 3RQ3A 2OJZH 1BEYH 4O4YL 4ZTPH 1GXEA 2B7DT 4HJJL 2BOCB 3MCLL 2FNBA 3FRPA 4I3SH 4ZUVB 2A74B 4EIZC 1T6VN 3TIEB 3MLRL 4M3JA 1H3TA 2A9NH 1K5NB 3SKUD 3QWOA 2G9HB 3N85H 4OAWA 2VLKB 1BBDL 4QRPB 5HGAA 2KH2B 4JDVA 1TQCC 2WINB 3PDDA 3DECA 3HZKB 1I9IH 3HZYB 5AAWA 1ND0A 4OFYA 5GGTA 4PREB 3ETBF 4X9FA 1ORQA 4LVOB 2NY3D 4XCCH 3MNVA 3VI3E 4BSVB 3BRGC 6FABH 4XP5H 1FNAA 1VGEH 1B4RA 2F58L 3MREB 3HE6C 1KJMB 4S0TD 3ROLA 1KJ3L 5DLMH 3FQTB 5K59F 3GMOB 1HHHB 3MRMA 3V7AE 4JG0L 4KMLB 2W07A 4QXTA 3ET9F 4JO2H 4Q9QH 2X6MA 1UM5L 1DLHA 3MSPA 4G80B 1GAFH 3MLWL 3BUYB 3JV4B 4K71C 4X5LA 3LRHA 3MYZA 2Z31C 1AY1H 5IW6B 1E28B 1IILE 4NPYB 1EHNA 5EC2A 3IF1B 1YEHH 4QHKJ 3WFDL 4JDTH 4ENEC 4P5TD 4JO4H 4EDWL 4KROC 1VGKA 1RJLA 4LLYA 3SQBA 1MNUH 3QZWB 4L3EE 3MLUH 3HMWH 1NL0H 1B0WA 4GG6E 2B39A 4P9MH 4D0BA 4K3EL 4ODTL 4JZJA 3DVGA 4PRAA 5J3HD 1FZMA 2HTLD 3KLDA 5I1DB 4R3SB 1J8HA 5C7XL 5D1XC 3UTOA 1I75A 2UZXB 3KS0J 3LSOA 3GIVB 1LEKB 3X17A 1INDL 1K4DA 4I9WE 2O61A 5C0EB 3KPQB 4N0UA 5C1MB 1AFVL 3EO9H 1I3GH 5C0BD 5BOZG 1MCPL 1JWMB 5IB4A 1JHTB 5I8KH 5J8OA 2E9IA 5D9SB 3W5NA 4XWOD 5IWLC 5DK0A 1Q8MA 1RUML 5FYKU 4TUKL 4NO0A 2XTJE 1WBZA 1YPZA 1KCVH 1CVSC 4HMEA 5L2JA 4ETQB 2FYYA 4PRHD 4FG6C 2D7OA 5FF6A 4R7NB 1WAAF 5I8OH 1ACZA 4OLZL 2CD0A 3L9RB 3R06B 1AO7D 3KYNA 4FQXA 2BSED 4FQHB 2MTPA 1WZLA 4HIIA 4PP2B 5AUMB 1ACYH 1A4KA 3GSUB 1MHEB 1MFAH 1XEDA 4WUUA 1TJIL 2E8ZA 4MX7A 4AENA 5SWZA 1U8LA 1NGQH 2VITB 4JPVH 4NJ9H 4KZEH 2V5TA 4XGZB 2FHCA 4G6KL 4BELD 1UCTA 2AI0L 4JE4B 3EDEA 1AGDB 3ECBA 5CGYD 3UTQB 3BIKA 3IDJA 3ZKQD 3QWRD 3C9NA 1RJZB 3MRPA 2UUDH 1T80A 4QWWD 2HJFB 5DC0A 5D72L 4GRWB 5D6CA 4PB0H 2VXSL 1F58H 1I4FA 1V7ML 4YHOL 4UTAL 1HZHL 3VW3H 3G5ZA 2R1XB 2ITCA 3EKCA 4LDLB 3TPUB 4KTYA 1FO0A 1JGDB 4F2MB 2QQLH 43CAB 4XC3L 5JUEL 3P3YA 2XZCH 4HG4J 5F7EL 2OSLA 3BEVA 2A6DB 2R9HD 2YD8A 2AXJA 3JV6B 1IT9H 4YHNB 4P3CH 2VZUA 4HXAH 4YFLF 1IQWH 5DEGB 1S3KH 2VQUA 2DM7A 5CKGA 4JFDB 3ULVL 3V0WL 3H9HA 4AIXA 1HYRC 4HFWB 1RZJL 3MLXH 5SWQB 1P7QB 3CH1A 4UAOB 1BECA 3G08B 3MGOB 3MRBA 3MUHL 3B2VL 3O9WD 1F42A 4X8JB 4M1GH 2DM3A 1AD9B 2DYPD 1WWCA 3ZTNL 4FQQB 3CSPA 5TGBA 1KEML 4G8FA 4KC3B 3H9SD 5IQ9A 1DUYA 5C0DB 4GRLB 1NEZA 5GS0D 2FGWL 4YHKL 4G8GD 2MPAH 2IAMA 1XGPB 3BH9A 3VGHA 2DL2A 5KSAB 5F9JB 5TFSL 1Z3GL 3HI1B 1D5BA 3GSXB 1R3KA 3MLZL 3NFPB 2IAND 1YN7B 1HHIA 3KPSD 5DRNB 3CUPA 2EXYD 1BLNA 2NNAB 4IRJD 4BYHA 4Z6AT 5FM5M 1YMHA 3IFNL 5E9DD 4FQXC 1Z5LA 5HPMB 2C3HA 4WO4C 1U42A 5CAYB 3Q6GL 3RL2B 5KG9B 3U4EA 4ZXBA 3IDNB 1OSPL 4U6HB 3U79A 4XI5C 1N3NB 1QR1B 4X6FB 1MCBA 2I25N 4XMLL 5ELIA