1NEUA

Structure of myelin membrane adhesion molecule p0
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
115
Chain Sequence
IVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCDVKNVGKTSQVTLYVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the extracellular domain from P0, the major structural protein of peripheral nerve myelin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords MYELIN P0 PROTEIN
total genus 24
structure length 115
sequence length 119
ec nomenclature
pdb deposition date 1996-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1neuA00
2C4FT 4O4YH 2CXGA 3X17A 3WFDH 4YHML 3ZTJG 3H0TA 1NC2D 1S5HA 5IVXB 2O5ZH 2K7QA 4PJ8B 3F12B 4RMRA 4MNQE 2Z8RA 5C8JA 4N0UE 2AJZB 1BP3B 2WUCH 2IAMA 3W9DB 2NY6D 1P69B 1UFUA 3MRCA 3KJ6L 4XNMB 4S0SD 3L3JB 5AYUL 5D70H 3UYOD 5JHDA 1JTOA 1ORSA 5BXFA 3ECBB 3D39E 1DQDH 3QUMA 1QA9B 1NGXA 2AI0H 5SWZD 3RJQB 1AIFB 4P2QD 5SWSD 3X11A 4AG4H 3IB4A 3MYZA 4JFPA 2P43B 2QR0A 1VGEH 1N8ZA 2QV2A 3VXTB 3JV5A 4QHUA 5DD6A 5IVXE 2C3WA 1U8QA 2FB4L 1I8LC 1A1OB 4GS7C 2XWBB 5AUMA 2CMRL 3GK8L 4L4JA 1NCNA 5IHUL 3UX9B 1IGML 2VNCA 4P3DA 2XNAB 3KYOB 4BZ2H 2AEPL 4RGNE 1OP5H 1U8KB 2DQIH 4K3DL 4M03A 4MDJA 4NJ9L 2YUVA 4ZUTB 2CSPA 4Y1AA 3I2CH 1G9ML 5DDHA 4ELKB 1AD9B 2R23A 5B8CB 4S1DC 4O9HL 5D1XB 4X8JB 5J6HB 25C8H 2Q7YA 3OXSB 3GJEB 4RFEB 3C5SA 4NO0D 1FIGL 4W6XB 3VRJB 2PW1B 4QEGA 3D0VB 3S36H 1QRND 5F8RC 1QACA 3X13A 1DE4B 4QRPA 3V5DA 2A74B 5JO5B 4JN2B 2D7MA 1A1NA 4PUBL 1QSED 3AMKA 3QUZA 1X44A 4GRLB 1BX2A 4YHYC 1UT9A 4M7KH 4AIZB 2YEZA 3DX8B 4CRPA 1U3YA 3VGDA 1C1EL 2AW2A 2Z93B 5SWZA 3UTTD 2BNUB 1I75A 3FB8A 2DICA 4HV8B 3NIGE 4IDJL 3BKJL 5TFSH 4BUHA 1CICC 5EIQA 2HJKA 4PJ7E 5EUOA 1O0VA 2NY4C 3V5KB 5D6CB 3LKSA 2Q3AA 3D69A 1PZ5B 4ZS7H 4MD0A 4KKCC 4JKLA 1NMAL 3HUJF 1PEWA 5JDSA 3BHBB 4OBRA 2BSSA 3CLFH 1XR9A 1LK3H 2H41A 4QXGL 2VDLL 2A1WH 5EC1B 4EVNB 2Z35B 1LE9A 5DUBA 2AQ2A 1DANU 1KGCD 4YH6A 4DN3H 3HTLX 2MQ0A 2OP4H 5MERB 4ESKA 1BJMA 3QZWA 2MFNA 4UILL 5J89A 1UB6B 5C7XL 4WVRA 2Z35A 5A1AA 3QNXA 3RUGF 5I1KH 5KJRL 4WUUD 4OZGE 4MD0B 3D69B 2VKXA 1JGLH 5DMGC 3LKSB 1AD0A 3CC5B 4X7SL 3RTQC 3V5KA 3GUTB 5D7IA 3DRTA 2P5EE 5ISZE 5A16B 3MGOB 1Q94B 4WWKA 4MJ5B 4ONFH 3DMMA 2BNQE 3I02B 5TF1H 1FFQA 1O5DT 4P5MB 4PPTA 3CVHB 3FQNA 3MUZ1 3ZT7A 1TZGH 2VLKE 1TZGL 3U9UB 4C59B 1CFVL 4W6WB 5FAAA 4IOIA 3L3HB 5FOJA 4YE4L 4HPOL 3IJYA 3QIWA 4ETQA 4OB5H 1BX2B 2AQ1A 3CMOH 5HYJA 1NUDA 2P7TB 4L4VB 4ALAH 3SE4C 3ULUC 1VB9A 1EEUA 1HDMB 3B5TA 4JRYE 4HC1H 1DE4A 3RPIB 1S7XB 4YXLL 2B7DT 1JYVA 1FVEB 4M6ML 2BSRA 3PXJA 1JZ6A 4FXGA 4FQIL 3ZKMC 3H9YA 5D1XA 1BZQK 2UYLA 2PR4H 4P5TD 3MRMB 5CEZL 3ZE1F 3S88H 2Q86B 2OTWA 3OKKB 5LXGH 1U8IA 1MCLA 4H25B 3N9GL 4LSUL 4MDJB 1I1AD 1M7IB 4GXVL 4QXGH 3S37H 5CFHA 3IXAA 1LK3L 3EOBB 4OZFA 4GAJL 5E8PA 4JVUA 1SY6L 3WS6A 5HYJD 3VGAC 1KELH 1LILA 5EPMB 3D2UB 3VXRE 3WD5H 1PKQA 5HDBF 4JVPA 3HG1E 2VN4A 2AK1H 4PJXE 4WI6A 2DKSA 4G8EA 5DSCA 3SDAD 5BCAA 3T0EE 1E27A 2Y72A 1QA9A 4TNVF 1J87A 2G9HA 5L2KE 3RPKA 5JHDB 4GOSA 3QI9C 4PJAF 2WUBH 1LWRA 1BOGA 1U36A 5C86A 4NUGH 5LCVH 4LCIL 3HG1A 4RA3A 4XVUD 4UNUA 1S78D 4UT9H 3BJ91 2VOTA 4MVBC 3Q1SH 4RGMB 1YECL 2X4TA 4GKZA 1WFUA 2ZUVA 5EN2B 2FL5B 4KAQH 4J3SA 1NCDH 4J3OC 5HGHA 25C8L 1GXEA 1QHPA 1YMHA 4PJBA 1YEDA 3BUYA 3RKDD 3VU2A 5IFAL 5DHXB 5E7FA 2P5EB 3TBYA 3H3PL 1A7PH 1AE6L 3C5ZD 3PWPD 3T2NL 5MEND 4EZMA 4OLWH 1L0QA 2EKSB 1OARL 1A4KB 1G6RA 1I4FB 5DEZA 3MACL 3VI3F 1FIEA 5DRWA 3N85H 4Z7QF 1IGMH 3PWLB 5C0AB 2ARJA 3KPRD 3MYJA 3SQOL 1YJDH 4P2YA 2F15A 1S9XB 1HOCA 2PW2B 2AQ3A 2DBJA 1Q72H 4JRYA 2J2ZA 4OGYL 3QUKA 2R2BB 3PHQB 2YPVL 3MGTA 4K23H 3MCKB 3TN0A 1P2CB 2EZ0C 5EULV 4J3VA 3P4OB 3LKOB 3MV9B 5ANME 3O0RH 4G7YH 2D9QB 5JXEC 1BJ1H 1B3JA 1NMCC 1MCSA 5H2BB 4N9GB 5D1QB 3HRZB 1AC6A 3TPUA 2VLJD 4NQEB 5AWNH 4F7TA 5I73C 3HMWH 4BH8A 5IEHA 3QHZH 1SEBA 4X7EC 4WFGE 5E8EA 1CTNA 1B9ZA 4OGAD 2CH8A 4PJAB 1U6AL 3NCYS 1BD2B 1N4XH 3IFOB 3KYMA 3WS3B 2F53E 1CFTB 4G8IA 4XCEA 2PYEA 1BF8A 1H3PH 1WBXA 2DIJA 3HC0A 3UAJD 2A0LD 1XZ0B 4MB5A 3BWUC 5J1TC 2Y36L 4U1SB 4PLKC 1EGJH 1EGJA 2R29H 1S3KL 5C0JA 2DD8H 3GSWA 1OF2A 4Z7VE 5JR1L 2M8XA 4HLZG 3E2HB 1PKOA 2VYRE 1TITA 3HPJA 5JXED 5FA3A 1HQ4A 4LEOB 4NO5A 1WEJL 1EERB 2A2QT 4LLWB 4ZTOL 5J1SC 3VGEA 3O3DA 1A6TB 4HUKB 4LRIA 2J4WH 1WIOA 3SKOA 1KB9K 5ACZB 1T4KB 1CF8L 1RIVH 3O2DA 4RRPG 3T65A 5I1IH 1E4XH 4HEPG 2BHZA 1MRDH 2X4UB 5C2UB 2QADB 1U92B 2FO4B 2UZIL 4ZPTA 1YPZE 3RKDC 4OI9A 2W0PA 4X6CE 4U6HA 5AEAA 3LIZL 2YRLA 5MENB 4LAQL 3VXOB 1ACZA 5DZLA 3MRGA 4Z7VB 1J5OH 3BYYA 1JPSL 1LK2A 5GHWL 1YQVL 1DN2A 1A6AB 1VESA 2Y7QA 4J3TA 3VXMD 1GZPA 4M6AA 3QG6B 1FRGH 2LABA 5L7XL 3HE7B 5I8EA 4EN3A 2FR4B 4XVUC 2Y6SC 3R06B 1YUHB 3QISA 2YMXL 3L5IA 4K3GA 4I9WE 3VXSB 2OL3L 5C6TH 3ZHDA 1ODAA 2YD3A 1URLA 4IRSD 3GMOB 2P5WD 1R5WB 1UZ8A 3Q3GB 5ECJE 4OIAA 4XI5C 1KB5A 4WW1A 2VISA 2IC2A 5FYKH 4LPWA 1KACB 1U91A 3DRQB 4Y8AA 2EDJA 1YY9C 4D9LH 3LOWA 4NZDA 3W81A 1YNLH 5F6HI 4B53A 1EFQA 2VXTH 2V2TB 4H26A 4ONHA 2P42B 3TBSB 4YQXL 3LS4L 2ZUQC 4RAHA 3WNMA 5IT2H 4K7PL 1A22B 3MBEC 5FHAL 3HAEA 3PHOA 3I50H 2EDNA 3G6DL 3SDYL 3MNZB 4HS3B 4PJIF 4G6JL 3P9LA 3ULVE 4KDWA 5BZDB 3BP5B 2AEIT 4J3UA 1MFCH 2W0FA 5GGSB 3GSNL 1M6OA 3K81A 4P2QA 4O02H 1A5FL 4F3FB 5I1AB 2VDPH 3MLTB 4FG6D 4P5TC 3OHXA 4NFBA 1HKLL 4IRSA 1H8NA 3FO0H 3TIDA 2HTLC 5KSBA 2R2EB 5D2NC 3BJLA 1YNTB 4GRMB 1OW0A 1GVIA 4MNQA 5CMAB 5E6IB 1ZLUH 5A2LH 1WWAX 3ZE0E 2E6PA 3TIDB 4OV5B 3ZL4H 4IRSB 3BGFB 5GS2D 3TO2A 4PJ7B 5JW4M 3OGOE 3WHE0 3QFJE 5E9DD 4F3FA 5I1AA 3TCLB 4WFFD 3AY4C 3JV4A 1CLYH 1FNEB 3WLWC 3MO1A 5DYOA 4XPGL 1WVZA 2R1YB 1D9KB 3SY0A 3BP5A 3EO9L 4AENB 2X4QB 3WE6B 1Z0MA 3PL6D 2VDRL 1K85A 5BS0E 1BBDL 2EECA 5DMIL 3MNZA 4ZQKA 5FECB 3L7FA 3RNQB 5TDNA 1ZS8B 1ZHLB 1K9TA 1NEZG 4F7EA 3B5HA 4FQ1H 3D9AH 1OAQH 1QR1A 4HWBA 4U0RB 5EO1B 2B1AH 4YHOL 4KUCF 2ZPKL 4V2CB 3QUXA 4PGEA 4PRIE 3VW3H 2V5SA 1NEZA 4Y8DC 1OAZH 2ZG1A 1K6QL 2YR3A 4ODUA 5F96H 1QBLL 1A7NL 3SCMB 5JMRA 3HAEH 1R5WA 2A73A 4LLDA 3V8CA 5FUOH 1RUML 3B9EA 1TNNA 5CGMA 4Z0BL 1BWMA 4PIRF 3BT2L 4M1DL 3BZEA 1CQKA 1RJLA 3S35H 5E6ID 3JVGA 5JOPE 4WNQB 1E4JA 1ES0A 5EIIB 3SHSA 3G6JB 5C0CA 4YUEH 2WAHA 2Y06H 5ALCL 4MCZB 5L0QB 4U0QB 1S9VB 4YGVA 4XXDA 1J0HA 4LSDA 1JNLH 3SPVB 4ZUWB 2FJFA 4PRIB 4R90H 4LSQH 5MENA 2ICWJ 4U6HB 2AK4B 9CGTA 4M6OH 5HYEA 1K4DB 4H1LA 5EO0B 4DN4H 3S6CA 2QHRL 3U0TB 4N1HB 2YPKB 2AERT 1FG2B 3BPNB 4MB4A 5DD3L 5GSVA 1A6PA 4O58H 2AJSL 3GNMH 4NPYA 5HI3C 4NRZB 1G84A 3QXAB 1JRHL 1QNZH 3GZKA 2DDQL 3GIZH 4FQLL 2B4CL 4L4TA 1MVFA 4HIEA 2V5MA 5LGJA 4XHJD 2UWEE 3SQBA 4JPWL 4JJ5A 1BWWA 1Q38A 4YBLC 4K7FB 5ESVA 4OF6A 3HPJB 2DQGH 5I8CB 5KVGH 2E8ZA 5C0AE 2KZ1B 2H6PB 1SBSL 1X5LA 1G7LB 3W0WD 2IADA 3KXFE 3LCYA 1I85A 1SJHB 1DQLH 3ALXA 2V7NA 2R69H 2HRLA 1W8OA 2FX7L 32C2A 3QAZC 3JTSA 4ZDHB 5FM5O 3I6LE 1LDPL 2PF6A 1NDMA 1DQQA 3DWTA 4RMWA 4XCEB 1ZGLP 3FONA 3WS3A 1ZLVK 2D0FA 2IPKB 2AVGA 3NH7H 3IJSA 4OLEA 5H8DA 3E3QE 1DANT 4QLRA 2ICES 4L9LC 3T0XA 2CJUL 2R39A 5CD3A 2JCCB 4UDUB 5D7SL 3Q6GH 4D9RD 2W9DL 5D1QA 1NCWL 4M7LT 4FRWA 2DYPD 1FGNH 3MV9A 3C2AL 4I4WB 3TYFB 5GZOD 1JGUL 1IT9L 3MCKA 3TN0B 2R2BA 3PHQA 4LLAA 4K3EH 5F70A 4BFEA 2I24N 5CILH 1J05B 5IG7A 3WSQH 1T83C 4MGXA 2K7PA 2R4SH 1S9XA 4AH2B 1ERNA 1T5XB 3ZDXF 4JHBA 1NL0H 2IFFL 4TSCL 5CSZA 4MB3A 4QHNB 2GJ6E 1MLBB 4YHKH 3DVIA 2FX8H 2H8PB 3AROA 4NSKA 4C4KT 1FNAA 5DFVC 1UKQA 4MZ2A 5JOFA 2VQUA 3TBYB 2W65B 4Q9QH 4JANB 2DIBA 4KK5C 1ZWIB 1CDJA 1VKXA 3A0OA 4PJBB 3VFTB 3NGBB 3WBDA 4OM1H 5D1ZC 1CS6A 2WM0A 5J6GB 1VPOH 5DD5H 3K2MC 1A21A 4X4XB 4GG6B 3IDYC 5J6GA 1LEIB 2A83A 3BKML 3VXQB 1C12A 2ZUXA 3DIFA 3HG1B 1YC7A 1ZGLA 3C6LD 3NAAH 5HVFB 1AP2B 1OQXA 4OJFL 1FSKB 1EA9C 3T2QA 2BSTB 1EAJA 3MV9E 3RZCB 3OSKA 3AREC 3LV3A 4HCRL 4KJPC 4GRWE 4OLUH 2X4OA 4J6RL 3IYLW 5MP6L 4Z7WF 2FECI 2G9HB 3I84A 3O45B 4RIRA 1FYHB 3AUVA 5TQ2H 1JV5A 1U8NB 1V7MH 4BQ9A 3L95A 4EJ1C 2H8PA 2XQYG 2IBBA 1T7XA 5DFWH 1MLBA 1A8JH 4OCWL 3D2UA 1OLZA 5HD8D 2F8VA 3NZHL 2D31B 5FO8A 4JY4B 4R7DB 1LO0H 5F88B 3TYFA 1DL7L 2MOVA 2K9UA 4UZGA 1EHLH 1MQKH 2J8UE 4F33A 3KS0J 1I3UA 3OKKA 3H7BA 1W0YT 4IM8A 3MFGB 2ZCKL 1LE5A 2YSSB 4XMKL 4UOW1 1CQYA 1LO4L 1YMMB 5BRZB 3B9KC 4YDKL 4QOKD 3QQ3A 4J3XA 3EUUA 3VXSD 2IJ0C 4UIKH 1RVFH 2DYPB 3TA3D 3SEPA 2RQ8A 1JGEB 4LPUA 4MLIA 4JZNB 2Q8BL 5C0IA 4M5YL 4PJEA 5EORL 3CH1A 4JO2H 3FTGB 3PGDB 3TIEA 4N90E 2QADC 3GI8H 3RIFK 2RCSL 2L7UA 3MRIB 1RMFH 4ETQB 4DK6A 4KKBC 1U95A 4AT6A 3CUPB 4CBPA 3U9UA 1EXUB 1U58A 1Z9LA 3QFDB 3FQNB 3V52L 3DXAD 4JJ5B 3ZSSA 1I9RL 3QWRD 1CDYA 2OZ4A 4GT7A 4WWKB 4HFUH 2C4XA 2R0ZL 3MNVA 3C2SA 1F3DJ 1C7SA 1TZIB 4N0CC 2E9WA 1LO2L 5C0CE 4NZJA 4L8SA 1FFRA 5FCSH 2HTKD 3QUYC 1CZ8H 2VLJE 4H5SA 4YXKH 1AO7D 1TDQA 4OZHE 3LN9A 4TNVK 3KPQB 1PDKA 3I75B 4HIJA 2YD5A 3BAEL 4KRLB 5EZOH 4OIIL 3CZFA 4CADA 1MREH 1G7PB 2YUZA 5DQ9B 3WIIL 5IM7A 1HILB 1YNKH 4NM4L 2YPKA 3VXUD 4AL8H 2JELH 5MERA 4JRYD 1A3QA 4U1HA 4QXUH 1I7ZB 4X7FC 1CN4A 4PRIA 4L29A 4JHWL 4HMCA 5L2KA 3U36B 2NY5H 2NNAA 4PREB 2I60H 4I9WD 4NWTL 4RAVB 3G6JA 1CLOL 2OLDA 5EIIA 5JIKA 1MCIA 2VWEE 3RVVD 4NOBA 4MAUL 3GHBH 5E08L 1QYGH 1SY6A 1YZZA 1P1ZB 2ZSWB 3B2VL 2C9AA 1EO7A 5AZ2H 5BMFL 2WMPA 5IMOB 4LLDB 2WQ8A 3T1FB 4TVPL 5ESQB 1F4AA 5IUSA 4CAGA 3SDCA 5ANMB 1HEZB 1QO3B 3MUGA 5D7KD 2E3VA 3LDBB 2IPTH 3LRHA 1KYOK 4GRLA 1YY8A 4L3AA 3FQWB 3U2SA 4GO6B 1A1NB 3NIGF 1XIWC 5A2JH 5JO5A 2A74A 4GMTL 3C8HA 4MD5B 3DECA 2NY2B 2GK0A 4HGKC 3MOAL 3TNMB 4GAYA 3OKEB 3X14B 3HPLA 5KG9B 5JTWA 3WNNA 4KJWD 5IB3A 1MFAH 4YX2H 4J8RA 4AENA 1NGWB 4NJAH 1BAFL 4X8JA 4G6FD 2APWA 1FNEA 1NBZA 1ZHKA 5GSRA 4LCCA 2BY0A 4TUJB 1JWSA 4HK3J 1AQKL 4M9PA 3MLPA 2BFVH 3MLXL 5B8CC 3QEGH 5DLML 3O6LH 1JL8A 1JIBA 4U6VH 1BQHB 3L5WB 4LARH 5T5FL 2AV7B 3IRPX 2Q87A 4GRMA 1KN4H 1V7ML 2EE9A 3ILQC 5HYFA 3NFSL 3C5JA 3EYFA 3IFNH 1CK0L 4U7MA 3V6ZB 5CZXC 3OHXB 4S2SA 3PWVB 3RVUD 4LAJH 5T1KB 3IDIA 1BBJA 4IRZH 3UROR 2DJ4A 2R2HA 3G6AA 4OJFH 1C5CL 2W0FB 2ICEA 1RIUL 3QUMB 3T2OA 3GBLA 3ECBA 1BFVH 1EIBA 3X3GH 4QRUA 4PRNB 4NBZB 2VC2L 2Y1VA 3D6GA 2HFGH 3D25A 3WUZA 1PGRB 4RDQG 1JN6B 1NGPH 1VEPA 3O3EA 1A6WL 2YA1A 3QDME 2GUOA 4NKMB 1HH9B 1IAII 3SE3A 4NO2A 2AABL 4UAOC 3LEVL 5IIEA 2HT2D 1FJ1B 4YHPA 1P7QA 4TVPE 3ZHKA 4TRPH 1NCTA 1UZ8B 3EZJB 1HHHB 1FFNA 2KUTA 4WW2B 4NQDA 2PN5A 3F7YA 3CSYB 3RUGE 5FEBA 4HXBH 3D0LA 4LDEB 3JV6A 3R06A 2IFFH 5JUEH 3C87A 3AXLA 4R9HA 4AJ0A 3WJJC 5TGBA 5EZJB 2CIKA 4ODSL 3A6BL 2P5WB 5CILL 3GGWB 5HGAA 1FBIH 1LK2B 2F53B 4OUUB 3MRGB 2H2SD 5D72H 5HI5D 1FGNL 5C3TA 4PYHA 3HUJA 5E56A 3LQAH 4XVTH 2DL9A 5BJTB 3OAUL 1NFIA 4K3HA 1M4KA 1QBMH 3G5ZB 2FO4A 4JG0H 5FGBC 4WU5A 5EBMB 4XCFL 1HSAB 5ACMA 1HI6B 4Q74A 4L8DB 5FYLE 1NANI 4YFLI 3CDGA 2X70A 4JZJC 2IANB 5L2KD 1LD9B 2VDQH 3TGXA 5K9JH 5HDQL 4ODXB 1TQBC 4HG4K 5KVEL 3MZGB 4YDVA 4HUWB 4FN0A 4J2XA 4XCCH 3EJYD 2AJUL 2APBA 4XBEH 5T33L 1DZBA 1SBSH 4I3GA 4PRDB 1VFUA 3RGVB 4OBSA 1CGSH 1CGSL 1SYSB 1QFWL 4LQ1A 2P45B 4PJHF 1OM3L 4Y2DD 4XBEL 3BXNB 5T33H 4MX7B 1N5AB 1F6AB 3BW9A 3TJHD 4X5WB 1OAUH 4FMKA 1QSEE 4M4RA 4ZFZA 2GTWA 1DUZA 4JFHE 4BKLB 4OAWB 1T5WA 5GGVL 1BVZA 2ZJSH 1UEYA 1S7VA 2CRZA 3DURB 3GIZL 4FQLH 2PYFA 2X89D 1HXYA 1U8JB 1W8NA 3P11H 1J7VR 4BFGA 1OB1B 1FFPB 5BS0D 3O9WD 2YZ8A 2A9NL 5GRUL 3UJTL 5T1MA 3DMMC 4NRYB 3KPRA 4ZPVB 4RA0C 1PJ9A 4LHUG 4D0DA 5E8EB 2YOCA 4U2ZA 3NA4A 4RISL 3O8XD 4FG6C 4JG0L 4MAYD 4ODVL 1GGCH 1UWGH 4KDVA 4RCAA 1UJ3B 2NX5A 2VH5H 1WWCA 1RK1A 3OAUH 1Q9LA 4M62H 4QHKI 3BQUC 1FORH 3PIQA 2VZ3A 4B41A 4POUB 5ENWA 1RZKL 3P9MB 4ZYKB 3QUKB 4CMHB 1JNHB 4YUEL 2DQJH 4CJ1A 3MBED 4CGTA 5JIPA 2OMNA 4Z95H 3TT1H 3V0VB 1BZ7B 3UXFA 3NFPA 1TMCB 3O3BB 5DRWB 5CZVL 3LQZA 5FGCE 1X5IA 3CFDB 5D1XC 4LCYB 2XYCA 3BD5A 4Z7UE 4U1MA 3WKMH 1QBLH 2OJEB 3V6BR 4C56D 3RI5F 3TLRA 5TH2A 3S5LB 4D9QE 4FFZH 1J88A 1IC7H 2X4NB 2KL6A 4QF1B 1JRHI 4I2XE 12E8L 3CJJA 1EK3A 3IGAB 4ZOAA 2M2DA 4G6ML 1KNOA 4OT1L 1FE8L 3WS6C 4P2CG 4E0RB 1BGXH 3T0BA 4OZHF 4XAWL 5HGDB 3B3IA 5SV4A 2VABA 3W9EB 1I8IB 2WIMA 3MLUL 3GSQB 3TBWA 2Q1EA 3VG9C 1M7XA 2DMCA 3D48R 1G7IB 1DSFH 5CCKH 1IGJA 1AGDB 1C5CH 1F4HA 4L8BB 1J0YA 3ULVD 4DOHB 4IRZL 3MSPA 1A2YB 4P23B 2I9LA 3HHRB 1DR9A 2VB5A 4LFHG 5DMGD 1FPTL 2BNRD 5B38A 4OQTL 4PGDB 5E94A 4MD4B 1RUKH 4Y2DB 5DK2B 2ADJB 3HN3A 3OGCB 2WBKA 1RZGB 2D7QA 2R0KL 4KVNH 2EIZB 5FKAB 5EPMA 2EYSA 1M7DA 3VFVB 2CDFB 1B0GB 3L9RB 2XRAL 3A6OA 5DJ6A 2GJJA 1MHEA 1Q9OA 1T2QH 3L7EA 5T3ZD 4L4TD 3TP4A 2X4PB 1TQBB 4H25A 4LK4A 4G6JH 2EXYD 4PJDB 1OAYL 3KNBB 1INQB 4LSPH 4M02A 3QQ9C 1P7KB 5C0ND 3OF6A 5J56B 4PG2A 1F45A 1MRFL 3JSSA 4CU8A 1IGYB 3MRPB 1OWWA 1J86A 4FXGB 3RUGA 1LHZA 4G6KL 4HFWA 4F7PA 1CTOA 1KEML 4CVXA 1FLTX 2BRQA 1PQZB 3LD8C 4M5ZH 3ZKXC 4U4BA 3F7VA 3OX8B 1NH6A 4NKQB 3RRQA 1FYTE 4HKBB 1JPFB 4ELMF 4LPYA 3QDMA 1FZMB 5J0BA 4PG9A 4BH7B 5H35B 5L8JB 3PP3K 1RZ7L 2VIRB 2OL3H 4YDIL 4GAFB 3JWNC 4KJQD 5LWYL 3NA9L 3OR6B 1T66C 3L3KB 2MQCA 3AU1A 3EYQC 5BVPH 1MOEA 2BZDA 3FT4A 3NMEA 4N5ED 3ISWA 4G8FA 3DMMB 4P9HL 5F1IA 4K55A 4YIQA 5BQ7A 4JHWH 3L5XH 2DWEB 3DRTB 4I0PA 4OCXH 4ORGB 4LAQH 3VD5A 5DJ8A 4LLMA 4URTB 2IGFL 1IAIH 1HHKB 5MEQB 1TCRB 5DK3A 3O4OB 1A6ZA 1MREL 5B39B 4KDTA 4WFGD 3WEXA 3LPWA 3DI2B 1MCDA 1ACYH 2Z4QB 5IOPA 1NAMH 4MA3B 1RIVL 3IRZA 3IU3B 3GMRA 2CDEA 4KI1A 15C8L 2J4WL 3IKCB 3RZCD 4F9LC 3M8OL 4G7VL 3QNYA 3UTPE 5HGBB 1Y0LA 3C09C 2R0ZH 3LB6C 4LBEB 3NACH 4V2BA 1X5XA 1I9RH 2XICA 1QFUH 5JDSB 4W4NA 1Q0YL 1ORQB 4M1CD 1QFWI 2MPAH 3VFOB 1T80A 1IQDA 1YEJH 2BY3A 4LCWB 1EFXB 4L3EA 3ARBA 5I66A 3WNOA 1P84K 1KTLA 2KKQA 3S9DB 1JTTA 1RMFL 2NY6C 4N0UA 4D8PB 5B38G 1N64L 3C6LA 4QRSA 2Y36H 3IFLH 2R2CA 5HYQA 1DBBL 4JO2L 2Z93A 1DEDA 1VCAA 1XGYH 1OCWH 3CZJA 1AXIB 2NY0D 3OAZH 2YEZB 4KKAC 4AIZA 1ED3B 4KTDL 3WLWD 4ERSH 4PBWD 3CDFA 3QUZB 4FQXA 4X80H 3BPCB 4ZFGH 2G75A 1T22B 3BISA 5FKPB 3HI5L 4QKXB 3QHZL 1DBKH 4G9FE 4XMKH 1GOHA 1CWVA 4I5BA 4U1JB 5ID1B 2PW1A 5GIRA 4JO1L 1QFPA 2H2SC 1J10A 5HI5C 4PJIA 5IR1B 1LO0L 2EIEA 3C60D 2BCKB 2DQEH 3IDNB 4DTGL 1IL1B 5DRZB 5IMKA 1MNUH 2O5YL 3KXFA 4Z7NE 1F4XL 1NMCB 4A6YH 5JLZA 4PB0L 5C9JB 3SQOH 4Z78B 3RBSA 4XNUL 4OD3H 1IEAB 2CKBL 2H1PH 3CSPA 1KIPB 1MEXH 5KSBF 2GI7A 2DQUL 1N26A 4G9FD 5ERWA 1Q1JH 5I19L 1U8QB 4YC2C 2EH7H 4JGUA 3OXRB 5MP6H 1MCOL 3FQXB 4OLUL 3ARFD 3GFUA 4XZUB 5C09B 1ZA6B 5E8DL 1Q9KB 4JFPB 1QLFB 1YY9D 3GM8A 3MRLB 1AIFA 3HG1D 3NAAL 2XTLA 4NHCH 1IZKA 2V7HB 3I3BA 3MRBB 1VACB 4P5TA 5GS0C 4K94C 4JFDA 4IRSC 4MSWB 4X6EB 2QBWA 3X12A 3KYKL 5D2NA 1GOFA 4YHNB 2DBLL 4FP8H 3SDAA 5DGRA 2XY2A 4C56A 1QP1A 2KQNA 4OLVH 5INCA 4PJ8A 3ILPA 4ZXBB 1OSPH 4Q9QL 1QQDB 3P30L 4IS6A 2FYYA 4TQEH 2MHAB 3H0TB 4PJEE 4JY5L 1FNSL 4ZO8A 5EZLB 4BFBD 4LLVB 2AK1L 4YHKL 4G9FB 4KH2A 4WHTA 2I26N 3DROB 1IAKB 1KTDB 3OJMB 5HHVH 1KELL 1JGDB 3GMNB 1OGAD 2C3GA 1H3GA 1HINL 5JW4N 2R4SL 3WSQL 1FGVH 2C1OA 2IF7A 2HRPH 3FFCE 5INDB 5CAYB 3QUXC 4LF3B 1NLDL 3VGHA 1RZFL 3MLZH 1FZOA 3CK0L 2DF3A 5I1HH 4HS8L 3N06B 3REVB 4KFZC 4C56E 4N1EA 5A43C 3MXVL 4KTEL 4Z76B 4X99A 3V5HB 3V4UL 2XA8H 3TVMA 4HS6A 3S88L 3M1BA 4YZFE 1EJOL 1MPAL 3MJ8A 5KAQF 2CLRA 4H20L 5FUZL 2YD6A 4JKMA 3WIFB 3AS1A 5EA0L 3TBVA 5BVJA 3QXDA 1OGTB 1LGVA 3NH7L 5T3ZL 3QEQE 5E2UL 1QSFE 3C60A 3QBTB 2UVEA 3OPZL 2DOCA 3DGGA 5C08E 3ORJA 1NEUA 4YXLH 4AEHH 2XFXA 4Y2OA 4HKXB 2FX7H 4M93C 3SKJH 3S36X 2C7UB 1RAMA 4N0FA 1KJMB 1G6RH 4MJIA 4MDIA 3T4AA 4NNXB 4YPGA 5CBEA 2WWKO 4MLSA 1J1XH 4IEFB 2R4RL 1IC5H 5KVGL 5E2UH 4XGZB 3LKQA 2B5IC 5T3ZH 2DQGL 3I9GL 2YUWA 4OGAC 1WT5A 4PV9B 1VSCA 4H20H 1MFDL 3FHQA 3OKMB 1EJOH 3Q6FA 2JIXB 3SOBH 6FABL 4DKEL 2ESVB 2HJLB 4QGYA 2BC4A 2BVQB 3I6LD 4PJIE 5JORA 1P4BL 2Z91B 2E7LC 1C7TA 5IQ9B 1BIIB 3V4VH 5FO9B 4L3ED 5CBAB 3V0WL 5J57B 3VXME 2J8UB 5IFHL 5DJDA 5LG1A 4ZS6D 3AS0A 3TA3A 2MCG1 4HAFA 4NQEE 3T3PE 5KSVB 1U9KA 3U7AA 3QJHB 4X6BA 5BRZE 1X3DA 3C8KB 4OZ4B 4RWHA 2E7BA 3NCYP 8FABA 3IAGC 1L6ZA 1B6UA 2B4CC 4K94L 4OZFH 5I8KL 1GIGL 1BQSA 3JXAA 1ZLSL 1F8TL 1WWBX 3P30H 1OSPL 3CLFL 5CIPB 3SJVE 3BEWB 4Y4HB 5D2LA 4XBGB 4G43B 1U8OA 3SKNA 2DJSA 1S9KC 5JQHC 2H3NA 2DN7A 3TFKD 3QFJB 4JPIA 2OTUA 1R0AL 4JFXA 3HC3L 4FP8L 4M1DH 3BT2H 1A4JB 4ZAKC 1MSPA 2FZ3B 1JWUB 3CMGA 1EEZB 3B5GA 1IFHH 2YA0A 5AZEL 3ZYOA 4ELMA 5FUOL 1CIDA 3DETC 5I15L 2GITA 3FQUA 1AXSA 4PGCB 4WU7A 3QIBC 4NQSB 1XF3B 5GGTL 4YFLF 4DKAA 4GUPA 5I1JL 5DEGA 5DXWA 1CICB 1YQ2A 3H2WA 2PXYA 1C08A 3CLEH 2CO6B 4JRXE 1EO8L 2NLJB 1T83A 4X5XB 5JOPD 1PG7W 2FWOA 1F11B 3S97C 5I71C 2C1PB 4ACPA 3QH3B 2CKBH 3RIAF 4OD3L 4B0MM 2LTQB 4DCQB 1DVFB 3A67L 2F54A 5DUPH 4D3CL 2O5YH 1RJZA 1F3JA 3MUJA 4UTAL 3D3VB 4BSWB 4O2EA 1MWAA 1WBZA 4KZEH 2KQMA 1T0MA 1FO0B 3O4LB 3RWCB 4JHAL 4NQCB 5ILTL 2HLFD 3OKNA 4O2CA 4P59L 5DJYA 1R6VA 3EOYG 1RHHB 2JJSA 2WV3A 3ZL4L 4E41A 5C08A 5GXBB 2DQHH 1DUYB 5HHQA 4ZAKB 3W0WB 2W1NA 5D1ZA 3RWIB 4Z9KB 4KK6C 5F3HB 4U7KA 1G7MA 5IHUH 1ZAGA 5GS1A 5JHLL 3MCLH 3FO0L 3H42H 3HCVA 4JQIL 5CP3A 1ZVYA 3MRHB 3KWWA 2QQKH 5F1NA 1ZT1A 1A5FH 1NGYA 1UC6A 2YWYA 1KENL 4FFYL 3OAYK 5EOTB 1E4KA 5JPNB 1EMTH 4D0CA 1S7UA 4G42B 3QRGL 1AHWB 3AREA 4PBXA 3JZ7A 1KN2H 1MFCL 2NZ9D 5FUCC 2BVOB 3S34H 3O2DL 4QRRD 2AV1A 3PNWA 5GGUB 4M3KB 1NAMA 1ZEAL 1JHTB 3Q5YA 4K8RD 2WINA 1EBPA 3G6DH 3V9FA 3N1QC 1CDUA 4UIMB 3ET9F 4HWZB 3VFPB 4FTVE 1NBYB 3GMLB 4LASL 4Y2DC 5IEKB 4UNTA 4MXQC 4HG4J 3VDBA 1CI5A 1TXKA 1AGCA 1U8MA 2Z92A 5CEZD 1L9NA 5C08D 1UWEL 4AY0A 2HP4A 1Q0YH 2DB8A 3EHBD 4LCUB 4PRHE 5EO9B 3ULSB 4N8VA 3UZEA 3ZZ1A 1XCQB 3RWFA 4E42A 3DUUB 1P7HL 3PHSA 2ZOKB 3WLBA 4R4ND 4JO3L 4DKDC 3RTQD 4O4YL 4RMUA 3ZDZE 5I8OH 15C8H 2VMFA 4Z7QE 2I9TA 1N59B 5D7KE 2H26B 4D2NA 3O41A 2AXGA 3MR9B 3PGCA 1QBAA 4LOUD 3F5WB 1UZ6F 4YHIA 2PO6C 3SGJC 4ENED 1UA6H 4NO0B 1FAKT 4GW1A 1ZKAA 5I30H 5GGSY 4PTTB 5BS0A 4A2LA 3DSFL 1J1OH 1QEWB 3MJ9L 4QCIA 4M93B 1JPSH 4JY6A 3P0VL 2FSEA 1NJ9B 4NCC2 4C83B 4OCXL 2EC9U 4P2OD 2WBJA 1RZJH 3T08A 1GGYA 4IJ3C 1RU9H 4PRBB 4EUPB 1ZGLM 2XTJB 3PDOB 5DFTA 5DQJB 1E4XL 5BVPL 5I1IL 3NA9H 3VXUE 4CJ0A 3G5VB 3GSRA 1KCRL 3MRJA 1CF8H 3VMNA 5DVKA 2D2OA 3P0GB 1MVUB 1SYVA 3LSOA 3S98A 4ZTOH 3PQYE 4JQVA 3RTQB 3ARUA 5GGQH 5IW1A 4JFFA 4LU5H 5C0AD 3CPLB 4PJ5A 1GCFA 2OK0L 3SN6N 3UTQA 4ZNCD 4ZUSB 2FBJH 4I18A 3C5ZA 1BLNB 2FBOJ 3VXRA 1U3ZA 2NXYD 2DMKA 2VITB 4R2GC 3U9PH 3PJSA 4J3WA 4Q58C 1G1YA 3JBG7 2NMSA 5I1EL 2Q76B 2QHLA 2VUYA 5EU6B 1W0WB 3O2DH 3CX5J 1JF6A 1K5NA 4V1DB 2ADFL 5FYJE 4QRRB 2EO1A 4RBPH 3QRGH 4R7NB 4W6YB 2FCBA 5I1DB 1H3PL 3MROB 4DK3A 5F6IB 4DGIH 1HH6A 4HH9A 3QIUA 1T21A 2QQKL 1KXTB 3H9HA 4NBYB 3X3FH 2Y5TB 2NZIA 2DJUA 3SGDI 1HWGB 3MPCA 3MCLL 3DX6A 4JFQA 5EFIB 3BI9X 2X4SB 5AWNL 4JM4L 2N7AA 3MC0A 4HT1H 4RGNC 5I1CL 2EE2A 1CFQB 3SKMB 3PL6A 3GMQB 4ZTPL 5DD1H 5KSUA 1FPTH 3QNZA 3MJ9A 4HBCH 2ZSVA 5I76B 1AR1D 2YPVH 1F4YH 4OGYH 3O6FC 5I71B 2E27L 3ARFA 4G8GB 4P2OC 4PYGA 5E6ZA 4KZEL 1SMAA 4GJTB 3QQ4A 5F7DA 1RK0B 3A67H 4LL9A 3I6GA 1HHIA 5D5ME 4TNWF 3N85L 1HE7A 1TLKA 1FC1A 1BGXL 1FE8H 1ZA3B 1XR8B 3P4MA 1EO8H 5DT1H 1Z5LA 1YDPA 3U1SH 3U4EA 2ICWI 1K8DA 2WIIB 3ZDZF 4YBQC 4FFZL 2GY5A 4R4NC 2QSQA 4MNGB 5EU7C 1MCWM 1XGTA 5AZEH 2BP3A 2XZCL 4LHUA 4UT9L 5GGTA 3FCTB 5E1HB 1HCVA 3ETBF 1KLGA 4KKNA 3LDBC 3QQ4B 5F7DB 1J11A 3QULA 3R1GL 4WI8A 1OSZA 3FB6A 3HUJE 43CAA 5BO1H 2YC1B 5CS7A 1BZ9B 4UDTA 1RZKH 1DQJB 1T7ZA 5J4MA 1GIGH 3THML 3SO5A 3DUSA 1IQWL 4P9ML 4QTIH 3MMEA 5IB4B 5IW6B 2JJTA 2ZCLH 4Q2ZA 3VFGH 1CFNB 1A9BA 1I3VA 3SE8L 1BJ8A 5B4MC 3UBXB 1YEIH 1WGOA 2W59A 2X4SA 4RAUA 3NPZB 3QI9B 3WD5L 3DX6B 2HTLD 3N50A 4FNLL 3ZDXE 2W07A 2NY7H 4XPFH 4XCNA 3FFDB 2ERJC 2IBZY 5F7FA 4Z8FL 2O93L 3QIUB 3UJTH 1DN0A 4HUVB 1ZANH 4HWUA 5FM4A 2EC9T 5GJSH 2YXFA 2K3TA 2PTTB 1S9YB 4K3JL 5SWZE 4JAMA 1EHNA 4FQHB 1NC2B 4MCYB 3N1GC 5ICZA 1P4BH 3TPKA 3BWAB 3N9GH 4LSUH 4ODTL 1DEEB 2ZJSL 1OY3B 1LO3L 5EU6A 5ITFA 2IQAA 2ADIB 3V2AR 5DC0A 1GGIL 5IB5B 5LBSL 1XGUA 1UB5B 5FIEA 1HXMA 2GSGA 5JA9A 3UC0H 3VXRB 1AC0A 1G0DA 3QO0A 1QFWH 1W0VB 1WC7B 2O5XL 1U93B 1B88A 3TWCL 1OGAE 1J1XL 3CPLA 4PJHB 1IGIL 4JFFB 3QJFA 3MRRA 5E5RB 3WJJA 2DM4A 1ZTXL 1OP9A 1JHLL 2H9GA 5DTFB 4I48A 1SYVB 2HN7A 1MVUA 2VR9A 5BV7C 5KVEH 2EDXA 3MJ6A 4X8XA 1R3KA 4ODWA 4AEHL 3C9NA 3T0EC 1G9EA 4JFOA 3VH8B 3EYVA 3FFCB 3UJIL 3QDGB 4X9IA 5EA0H 3D18B 4LKXB 5FUZH 3FB7A 1IAOB 4MAYB 1JMZA 2Z9TA 4BM7A 1T1WB 3MXVH 4KTEH 5IBLD 3R0NA 5HY9A 4F80A 2LE9A 3GIVB 3CK0H 2VSDA 4P2RA 5K59F 1RZFH 3QPXL 3T0EB 5DMYA 3BGAA 4MXVE 5DWUL 3D39A 3Q5OA 4TSBL 2HRPL 4WEBH 4DGYH 2OS7A 1FGVL 5C0EA 5EU3B 5EU4B 1QOKA 3OR7B 5K33A 1QRNB 5EC2B 3OL2A 4TSAH 1RUQL 1RV6X 3W0WE 4QTHA 3VFMB 2PCPB 1YEGL 2MCPL 3BGMA 2NYYC 4JFFD 4U3CA 2YKLH 1PKQE 4UILH 5E70A 3O8XB 5A40E 2WBWB 3RA7L 1V05A 3ZE2F 4QHMB 3BVNB 1FNSH 2ZOKA 5DJCB 1QTYT 5FM5M 3DUUA 1WFTA 2A1WL 2VDLH 4HHAA 4NC0B 5J06A 4LLUA 4OLVL 3TYGL 2BX5A 4C58B 3T4YB 1A6WH 3PF2A 1G9MC 4PGZA 1Z3GH 3FZUD 2PETA 3QO1B 5HHXL 5TE4L 4OF8A 1HHGA 5F7EL 4GRWH 1KFAH 2GK2A 3O11A 1CXIA 5ALBL 4S1QH 1KPRA 5FO7B 4G8GE 2HT3C 1C1EH 2A0LC 2NY4B 3DVFA 3BDYH 4NGHH 5EOTA 2H32A 4P23D 2EH7L 2Q7NA 2GY7B 1S5IH 3HNSH 2G2RB 1U2HA 1C5DB 4PP1D 4WY7L 4NN7B 3S3SA 1A6VH 2FEEL 3QIWC 2XG4A 1DUYA 5HHQB 4A6YL 3DLQR 2JTDA 1RFDH 3ULVL 1YPZB 3EYSL 4U6VL 4F7MB 1MCQA 5DJ2B 2EICA 5GS0L 2SEBB 1GHFL 5FYLH 1ETZA 5BW7C 5GZNC 3PWNB 5T1LD 2DWDA 3QUMH 4X4YB 1G9MH 5E7BA 4O2EB 2SEBA 5HDLA 4F7MA 2AKRB 2OL3A 4ZFFA 3U46B 3QSKB 3DX7B 4M00A 3BX7C 4P46B 1NKRA 1YN6B 4Y5YC 3LEXB 3G9VA 4FXKB 3MOAH 5D96C 3WIHH 1YMMD 3WXVL 1RI8A 4XHQA 3SDDB 3UTZA 1N6UA 2FB4H 5KS9B 5J12B 4NWUL 1PX4A 3B6SA 3QDAA 4N8CH 3S96A 2QKIA 5HPMB 2RHEA 2A6KB 1F3DH 2YD4A 1INDL 1MI5D 4GUPB 3O6ML 3U0PB 5KZCD 1T6WA 1XMWA 4KU1A 4MQ7B 3IDMB 1SJXA 1JF1A 1I8MB 4CU6A 3IFLL 3O11B 2GITB 1N64H 3FQUB 1KJ2L 4MXQD 1GZQA 4ELMB 1FL6A 3MNWA 3WFEL 3WHXB 1S78C 3TJEL 4DZBA 5EUOE 4MAUH 3NPSC 3OKDB 4KRPC 4LQFH 1HSBB 6CGTA 1XF2B 3BPOB 4G9DB 4Y0GA 5ICYA 4NWTH 2PTVA 4LLUB 3DO7A 1ZSDA 2PXYD 5AAWA 3INUH 3NACL 4M8QB 1MHPL 4HHAB 3GO1L 5CUSH 1WTLA 3VXUB 1FSKC 1VADB 5K9KA 2A77H 2ARJQ 4OF3A 3M8OH 3MLYL 4QHMA 3LKRA 3HKFA 4LSVL 2BY2A 5E99H 2F5AH 4JREB 2HKFH 2X10A 1OOAA 4NN5B 3V6FA 1WAAA 4IRJB 4CNIA 4GG8A 4IOFD 5I17A 3IU4L 3FO1B 2VZVA 3VFMA 5I74B 1ACYL 4OLYH 3NIDE 1I1YB 5EZOL 3BAEH 4PJ9C 4EKXA 5SWSE 1ADQL 4X6DF 2E7CA 5KSAC 4WWKD 4LP4A 1OTTD 2VDOL 4N90D 4M7ZC 4OQ1A 4OZIB 2CLZA 3DXAB 2Z91A 2VZUA 4FS0A 1MLCA 2V17L 4EUPH 4LGPB 4I3SL 4HQQH 4GRLD 2WP3O 2GYSA 2DM7A 2VDMH 2F54E 3B9DA 2APVA 2XKNB 3FB7B 4PV9A 4MJ6A 3V52H 1IMHC 1BVKA 3ZDYE 4X83A 1C16A 3KPNB 4GW5A 1MY5A 2P46B 3OKLA 5D5MA 1W2KT 4YDIH 3RAJH 2GHWB 4F37K 2NY2D 4ODWB 4OLZL 4M8VA 2HG5A 1JUFA 3TT3H 1T1XB 5E2WH 2HN7B 5MEOB 4I0PC 3LKPA 4KROD 5KOMC 1G7QB 1DFBL 2NY0C 1K2DA 4KKAD 2Q8BH 1RZ8B 1A9EA 2VLME 3C60B 4ZAKD 3M07A 2MTPA 3KLAB 4M7ZB 1HCFX 3QO0B 2DL2A 3WIFA 4KDTC 5IP4A 4PJ9B 1S7QB 4PY7B 3DVGA 2PO6B 1J0JA 2ATKA 4M61B 1Z9MA 1OAYH 3EO1A 1TENA 2RFXB 4EDWH 4EI5B 2YPLA 4DJMA 2X89A 3UTTA 3QPQD 5ICZB 4UINH 4JREC 1DBAL 4GG6E 4EBQH 4F9LA 3EOAB 5F9OH 1FL5A 1KJ2A 1VFBA 2HVKB 4HUVA 1CGWA 1NGZA 2FJGB 1JGDA 2W0LA 2P49B 3KPPB 4QRPD 1FVDA 4PJGE 2E9IA 4ZS6C 4HJGA 5B3NA 3B9VA 1DBJL 4OFKA 3VFNA 2EXWD 4BSVA 3ARBC 1A9BB 3LN5B 1RUKL 3QXWA 4TTGA 3FQRA 3IDUA 3G6JE 4LRIC 2W92A 4J6RH 2EO9A 4PJCE 3OKYA 4UB0H 1JWMB 5CKGA 5FUCE 5EBLA 4X0KA 1F58H 4KI5F 4HWEH 5CJQL 4YR6B 3PP3H 4G5ZH 1X7QB 1TIUA 2EYTA 4FQXC 3RVXD 4GMSH 4JG1L 3IAQA 2FGZA 2VLKB 3TF7C 2DKMA 4HDIA 5DI8A 2HFFB 3BMVA 4XAWH 4HKJA 5IK3B 1F90H 1A02N 4APQB 2ITCA 4OM1L 2V7HA 2DLIA 4HX1B 2NW2A 1FO0H 3QCVH 4KJQC 2EDHA 5EIVA 5IBTL 3NIFF 3QWOA 4UT7L 1MJ8H 1E4WL 4XC3L 3RIFF 4NRXB 1VGKB 4NT6A 4YHZH 3CNKA 2X1QA 3QA3B 4HGMA 4NIKB 3LAFA 1UACH 3P4MB 5DC9B 4HIHB 2FDBP 5DVMA 2F9BT 2VLRA 4EN3C 5CWSB 4YNYB 5HYSG 2DAVA 2ZUWA 4FQQB 4NDMA 4TULH 5CZVH 1FFOA 4FQ2L 1IBGL 1HHIB 3W5NA 5L88H 5F9DC 5JLZB 1CL7I 3TT1L 1RK0A 3A6CH 3CGTA 4NN7C 1LEKB 4XMPL 2P8PB 3OB8A 1IT9H 1YYMH 4Y5XA 3QNZB 4UOW0 4LGRB 3OAZK 1CVRA 3GMQA 4P4KC 4U0RC 3SKMA 3UTPD 5D7SH 1TETH 2VH5L 3HZMB 4U1JA 4QHLB 1IEHA 1X5KA 1T0NA 1UWGL 3HI6L 3RDTD 3QXVA 1C8PA 1YEEL 3MBXL 4GBXA 4MXWL 5IROA 2BNQB 1NSNL 3NABL 2YD8A 2GFBA 3VWKD 3BPCA 5IESH 4R4BA 1AR2A 2EDBA 1CIUA 3MXWL 4U1NB 5E5MB 1IZJA 4LIQE 2ZOLA 1AO7B 4X6FB 2DQCH 1MWAL 2E7MA 2OTPA 2YK1H 4Y4HC 5FYKE 2E9JA 2EC8A 4MJ2A 3K80A 1BIHA 4WI5A 4UUJB 1OW0C 3RX8A 5DR5H 2B0SH 1EFXA 1OM3H 1EEYA 1XH3A 4LCWA 1TVBB 2A6DB 1KCVL 4N8VG 1LNUB 3IF1A 4A2MA 1KPVA 3HNTL 4X98B 4JZJB 5JA8B 4PJ5B 4KY1H 4XWOD 4JPWH 5CEZE 3RP1A 4R0LB 4E41E 4PLOB 5IW1B 3GKWL 3PGFH 3AY4A 5CEYA 3C08H 4Y4KA 3QNYB 4LVEA 3O4LE 3O3AB 2VDQL 3ARDC 1H5BA 3RWEB 3SO3B 1I1AA 2XQYK 4Y5VA 2HT3D 3SBWC 3GNML 4PR5A 4M48H 2Q3ZA 1T1ZB 4XCFH 2IG2L 1A6ZB 2R56H 1TCRA 3QYCA 3EYUH 2QHRH 3T77A 2J5LB 1LDSA 4TTDD 3WFHB 3C60C 3T04D 3VFUA 4EIGB 2YN3A 4CVUA 4F58L 3FZUC 4QY8B 5HVWA 5LQBH 5DJ8B 1U3HD 1IILE 4ORGA 1NJ9A 3CFJA 4GQ9H 5D72L 2DWEA 4PD4K 4R26H 5KSAB 2RB8A 1WCQA 2C3VB 4MYWB 1AGBA 4YIQB 2AXHA 3VDCA 5BQ7B 5LGKA 2Z0BA 5F1IB 1FLRH 3QDHA 5M94B 2C3VA 2CO7B 1AKJA 2AJYL 4NP4H 5I73B 2Z31D 5C0FB 4WDIA 1RJYB 1V8HA 2V2XB 2VIRA 1B4JL 5H35A 4BH7A 1RQ5A 1FZMA 1N59A 1WT5C 4ZUUA 1KJ3L 3H9SE 3GSUB 4B7LA 5D8JH 4NQXA 1MCJA 4HKBA 4JN1L 4E42B 4QRTB 5JMOC 1XCQA 1YYML 3O6KH 3OMZA 1EJ6A 3SGEH 2VLLA 1H5BB 4CVXB 8CGTA 3GMPA 3H9SA 3IAPA 4M43H 1MF2H 4F37F 3HMXH 4Y4KB 2COQA 5L88L 4UIMA 3VFPA 1QPPA 1P7KA 2WINB 1SJVA 3IJHA 4X98A 1INQA 3QZWG 1U3HB 4J4PA 3B8YA 4DUWA 2AV1B 3PNWB 4JZOB 4NN5C 5IJVA 1BFVL 2EE6A 2A6DA 2Q6WA 1UACL 4M7LL 3WJLA 4XPGH 1OP3H 3RZCC 4G42A 1S7UB 1MHEB 1Q9OB 2XXMB 3STLA 3VXPA 2O61B 1ZT1B 4POZD 5IBTH 2YWZA 3SDDC 5A3ID 4KHXH 1CK0H 3CFEB 1FHGA 4CN1A 2CDFA 3L9RA 3SJVB 4IMLB 3JV0A 3QDMD 4E9LA 4NZTH 3FT3A 3VWJB 4RGOH 4GMSL 4ZAKA 4UU9A 4KXZI 5HVGB 5GRVK 4LARL 5C08B 5T5NG 4FABH 2CKBA 3ARSA 5CJQH 1F58L 4TVPD 5GISL 2IH3B 4Z7WA 3O6LL 3D39D 3QCUL 3QEGL 3O4LA 1T0NB 1IAIM 2OQJB 1U8LB 2W0KA 1BAFH 4OUOA 4WW2F 1H0DB 4HULB 3JTTB 3DTXB 1QSFA 1T66D 2OR9H 4O5LH 3BRDA 1T03L 5ID0B 4L9LA 4TTDC 3I50L 5HGDA 4LCWE 4LSRH 3ZHLA 1HNGA 4XX1G 1W72H 3LS4H 3BO8A 1DLHA 5C2BH 2VQTA 3IGAA 1GPOH 4KJPD 1FYTA 4D9LL 2JKXA 1BMGA 1OPGH 1EZVY 2EDTA 5DF0A 1G7JA 4DOHE 5E1AA 2VZ1A 5FYKL 3HE7C 4PGCA 4WU7B 4IHOB 1EV2E 2J6EL 3RL1B 4LVHC 3CFDA 3O3BA 2OX5A 3FOLA 4XWOC 3QQ9D 4PRPA 3V0VA 2EXYC 3DGCR 4LEXH 2H3NB 4FQJL 1IKFL 5AYQA 3O2WL 5GS1C 5IK3A 2XTJE 2EEDA 1MFEH 3MLVH 3SDXF 5IFJA 1OHQA 4WI3A 1UKSA 4AM0B 1ZHBB 1I3RB 4HGWA 4KUZH 3BP7B 1P5UA 4HD9A 4AMKL 5IF0B 4QXUL 1FZJB 3CU1A 5JPMB 1N3NA 2BSED 3MA9H 2XPGA 4I8DA 4AL8L 4X9HA 1K3ZA 5IQ7L 1A7OH 4L1DA 5CZXD 2OBGA 4KV5F 4D0DB 2AJVH 2NY6B 4ZPVA 3VRLE 3GSXA 5ITBH 1SMOA 3FQRB 4OFDA 4LRNH 4OIIH 2CIIB 3EW3B 2ORBL 3LN4A 2ED9A 4FFWC 1FFPA 3HS0A 4WJ5B 3UPRB 4KZDL 3VCLB 2RR3A 4CN6A 5TQ0H 4XXCC 3MV01 4HQQL 1OTSD 3DURA 2BVQA 1LO2H 3GRWA 5ADOH 3K4DA 4LIQL 1DUZB 3EGSB 3QIWD 4Y4FB 1IGTA 1UXWA 1PLGH 5TJWK 3UTTB 4QGTA 1JYNA 1Y18B 2DI8A 3EO1B 4EI5A 5IQ7H 3GJFA 4QXTB 2PO6A 1KCSL 4ZO7A 4YPGB 2HKFL 3QDGE 3RVTC 4MJ4A 4MJIB 2RCSH 5F72S 5GPRA 2A77L 3KLAA 4WO4D 4ODXA 1DQML 4C4KO 2V9TA 1LD9A 3GO1H 2LU3A 3MFFA 5C0CD 3NIFE 2VN7A 1RJCA 2BOBA 4U1KB 1HI6A 4FQJH 1HQRB 3MJ7A 3B9AA 4OV6F 4XRCB 1HSAA 5BVJB 2Y9RT 3VGFA 1LP9B 4JB9L 4PJGA 3U79A 3ARVA 3HMWL 3M1BB 1MI5B 4X99B 3GSVB 3UTOA 3RJDA 4HZAA 1QFHA 5HSFA 1C16B 5BOZG 4OFYD 5CIPH 2IAND 3QG7L 4OGXL 1DL7H 3Q2CA 1TQCC 3EYOB 2BOCB 3EFFA 4HK3N 1XGRA 1FCCA 1R3LB 4Q0XL 1UXWB 1INDH 5HGAB 1BQLL 1GPOL 5TGBB 2NYYD 2X9XA 3AXLB 3K3QA 3DXAA 4ZO6A 3D0LB 4OCWH 4UOJA 4LSRL 2G5RA 1QVOA 3MZTA 1BM3H 2HT4D 1XEDA 4U1GB 1D9KC 4BFIB 3VXSE 3PQYB 5C07D 5EZLA 4WO4B 1OARH 2E6QA 4YHPB 1CFSA 3IXTB 4OF0A 2OI9C 2XWJA 4JRXB 5DHYB 4ZXBA 1TVDA 4OQTA 3F62A 1WISA 2VZTA 3RL2B 3QCUH 1QSEA 3EYSH 2QTEA 5IF0A 4AEIH 3BP7A 3QPQC 3GJFH 3D25B 4X5LA 1EDQA 1BEYH 5JZ7D 1A6VL 1ZSDB 3X12B 2CRIA 1X4ZA 3VXRD 4F9PA 3DO7B 4HWBH 4QOKA 1NFDA 4PB9H 2XOTA 1XF2A 2ENSA 2CDGB 1U8HB 4OZFG 3MRLA 1I8KA 4NUGL 3FOLB 1BBJB 1T7WA 1F00I 3IFPB 5C07A 4OCYL 3MJGX 3OXRA 3O6FA 4IHOA 4NM8H 4HXAL 3KR3H 2CQVA 2ED8A 3IDMA 3EYFB 5E1AB 2GEEA 3HNVH 4XB7A 1KFAL 2I27N 4XNYH 4FZEL 2ZUQB 1FYTB 1EVUA 5J3HD 2AV7A 5FB8B 1XF5A 1VENA 4W4OC 3RKPA 2GJZA 1KTRL 5L9DH 4TSCH 1S7RA 3HZVB 2QQLL 1UVQA 1J8HE 4YFEA 2V5YA 4JDTL 4FQCH 5E2VL 4K3EL 4LCCB 4OKVB 3DBXA 3S37L 2DLEA 4P46A 4GRLC 5DVNA 3BD3A 4FOMA 4JN1H 1NGWA 2BNRA 1ND0B 1H0DA 5DO2D 1XIWA 5GIRB 5LXGL 1MIEL 1DQTA 3JUYA 4I5BB 3TV3H 2YD2A 3BSZH 3GBNL 2YKLL 3NN8A 4P0DA 4PJ9D 2NY1D 4AK1A 1NFDE 1PAMA 2I07A 4QHKJ 1H8SA 1MHCB 5I18H 5ACLA 4UV7L 5IMMA 1KOAA 3FQWA 3MLWH 2VRAA 1N6VA 4K07A 1FNGA 5HHME 1DLFH 4Y1AD 5DWUH 4CVWA 5ANMA 1LDPH 1F4WL 5DJZB 1A3LL 4GQ9L 2IH1A 1NMBH 4IMLA 3SCMD 2K1MA 1CT8B 5ESQA 2HLFC 4GRWF 4F58H 1FN4B 5F1SA 4TPRH 2ZNWA 4N0UB 5IMOA 2O61A 1KTLB 3AS2A 2FHCA 4HPOH 2JJTC 4YE4H 3MRNA 2IG2H 1FYTD 1RUAL 3ARGC 4C54A 5F93C 3L6FA 5KVFH 5IJVB 1L7TL 4JR9L 4XB8A 4XPHH 5L6YH 1A3RL 3OKOB 4D0BB 4H1LG 2YD9A 2WANA 4ONFL 5I75C 1IKNA 1S9WA 1HIML 4XP5L 2D7PA 3BPLB 3VI3E 4FTVD 3DJ9A 2VE6B 1X4YA 4U1HB 1ZOXA 5ESAB 3AS3A 3GKWH 3PGFL 3IDGB 1B0WA 1PEZA 3L3GB 2VLLB 4XPBL 1IGIH 1QHOA 3HE6D 3TNNB 5DQ9A 4I0CC 2Y6SD 4CW1B 4CADB 2Z4QA 3WEXB 5B39A 5DD3H 2B0SL 4Y4FD 3KPQA 1R24B 1J8HB 3O8XA 1RJYA 2V2XA 4H5SB 3O6FD 3SE3C 4AQ1B 1WUNT 1LO3H 3CVHL 1GL4B 1AR1C 3DV4A 3L5JA 5KN5A 4L8SB 4I2XA 3NCBB 5DRNB 1MCPL 2DI7A 1U8PB 4JFFE 4LSQL 5D7LA 1TZIA 1MWAH 4YFDB 2DQCL 2DLHA 3O9WA 2XA3A 3QT2A 4G8FB 1VDGA 2Y06L 3FMGH 5D7JA 5D9SA 5ALCH 5JHDE 3WFBH 3T0EA 3QFDA 4Z8FH 4ZS7L 2HFEA 4AIXA 3STZA 4P2RB 2VDNL 4HF5L 4Q9RL 3FT4B 2ZCHL 5H37G 1YEEH 3MBXH 4QY8A 1X4XA 2R0WH 4UQ2B 4J1UA 5HJ3A 3WFHA 1UCTA 4KXZH 4Z0BH 1KPUB 3TH3T 1IAOA 1RUMH 1TETL 3QDMB 4GXUM 4LKXA 4IDJH 2ZCLL 4NFCA 5HDBE 3WL9B 1JBJA 4HUUB 1A7NH 2Q8AL 3PGDA 5FYKU 4Y5VB 3OX8A 3BP6B 1PG7L 4JFOB 3L3OB 4Z0XB 3DARA 3C9NB 4JPKL 1R3KB 1CXFA 3O3AA 2NY1B 2AXFA 3BZFA 2NX5E 1WZKA 1OAQL 3RUGB 1JHKL 3VWKB 2VXSL 4RZCB 1YMMA 5I75B 2X9WA 2XWTB 2XTJD 2YSSA 4TULL 3D5OF 4JZJA 1SM3L 1B0RA 2NTFB 3KJ4C 2QSCL 5C0RH 2VDRH 4F33B 1T0PB 3VRLF 4L4VD 1XH3B 4PV8A 3QWRA 3BEVB 1E4WH 4UT7H 5T1LB 3U1SL 4RNRB 3I2CL 1F13A 1B0GA 4K3DH 1KIRB 5E03A 2EYSB 2DQIL 3ZE2E 2CUHA 2UUDK 4I77L 3GM0A 1S9YA 4NBXB 1T20B 1JCKA 4WFEE 1JMXA 4MD4A 1OP5K 1TTFA 3FFDA 4PGDA 1WWWX 3GB7B 2BNQA 3BUTA 4GBXB 2DIAA 4KQ3H 2I9LB 5MEPA 5F97E 3OJVC 5D7IE 1VGEL 2E27H 2LQRA 1CFNA 4P4KB 4Y16B 5IW6A 2AI0L 1UG9A 5DD1L 1F3RB 3WDJA 1G1CA 2ITDA 1DQDL 2OR8A 4Y5XB 1G7IA 1C12B 4U3XA 3QUXD 3WUWA 2A83B 4OFIA 1IRAY 1GOGA 4JM4H 4X4XA 1OSZB 3FB6B 3OF6D 5FHAH 1LEKA 4IDLA 1KCUL 4J23A 3BQUA 4RBPK 3FCTA 2ESVE 4IMKA 4LHUB 4YK4C 5F7HA 1I7TA 4QF1A 4AEEA 4JM2B 1AGFA 1CD0A 5MI0B 3EBAA 4EBQL 2ADFH 4POYA 4NZUL 1KG0A 1AY1L 2X1OA 4QWWD 2JJUA 2DLFL 3QEQD 2VTFA 3ULUH 5BV7H 4JFYA 3MUHL 3U4EB 5D1QD 3NFPB 3BKYL 4YDLB 4XPTL 4QHNA 5EBWA 1INEL 4YXHH 1XR8A 2FBJL 5CSZB 2BXZA 1OL0A 2C3HA 1SJEA 2UUDH 4KKLD 3MQIA 5IG7B 3CIQA 4XWGL 4PJ7F 1AGFB 4NKDB 3UCRA 3MRDA 1AXTL 1X7QA 3QP3A 1K4CA 3LIZH 1XAUA 2HKHL 4ZSOE 3HRPA 5EBLB 4ZFOB 3KVQA 1TTGA 4ISVA 4HUMB 3LPFA 1G7HB 3TO4C 3O2VL 4R3SA 5TE6H 3E3QC 3KPRB 3WN5A 3PL6B 3O2VH 1YYLL 4HJJL 1CFQA 4U1LA 5CJ5A 1I3GL 1OT2A 4XNQA 5EFIA 1RZJL 5B4MD 4I3SH 1U3HC 3B8SA 4KK8D 3KPPA 32C2B 1S7VB 3GB7A 4Y7MA 1NGZB 3P0VH 4HH9B 5AD0A 1WEJH 5B3JE 4MX7A 1FL3B 3ZKMD 2IADB 4HUXA 4F7CA 5E2TH 5I30L 1RIHH 1UM5H 2ZP0T 1PZUB 1KIRA 2P44B 5DGQA 4KJYB 1UM6H 4OD2B 4K7FA 5ESVB 4XPTH 4ZOCA 2M26A 3BEVA 4PJ9A 1BLNA 1EGJL 4HIEB 4HUWA 4JVWA 3MLYH 3VXMA 3E6FA 1AGEA 3KYNB 4UT6H 1U0QA 2P8MB 1RY7B 2F5BL 5KVDL 3QXTA 2Y07H 1B0RB 1A9EB 2NTFA 3BN3B 5TPWL 1QD0A 4PG2C 4TN9A 1KJVB 4WWID 4XP9L 3LKPB 3AAZB 1KIUA 4PRID 4LQFL 2XZAH 4PLJC 2J88L 4Q9CA 4NO3B 4NYLA 2XN9D 2FECL 4ZO9A 1VFAB 3HE6A 2Y23A 2ATPB 2H2PD 3DXAE 3U6RA 5I6XC 4Z0XA 4RMQA 3H9ZA 1ZEAH 1NFIB 1KJ2H 4OFPA 4F2MA 3S34L 4HUUA 2FJFB 1Y6MR 1KN2L 3MV8D 4XAKD 1BVKB 3BDXA 3GRWH 1JPTH 3CDCA 1KPUA 4FFYH 1CLCA 3UBXG 2CIKB 4N8CL 3MRFB 4PTUB 5FCUH 1JZ4A 4KQ3L 1UH3A 4WNQA 4C83A 1I9IH 3JWOC 4JQXC 3H42L 3STZB 2CLZB 1YJDL 3WXVH 1PYWB 4GRWB 3CSYA 3U30C 1NC4B 1KLUA 1RZIB 2NY3D 3H7LA 4QCIB 5CJBA 5D7JB 5D9SB 4RGND 3SGDH 1I1YA 4GW1B 4NO0A 1GGTA 2ICWA 4DW2H 5D7LB 3SCMA 1G9NC 1FJ1A 1UWXK 1A7PL 3DV4B 3M17B 3F5WA 2FEDD 3RWDB 5ILTH 4JHAH 2CPCA 2GUOB 4NKMA 5LAXA 5FYLL 3FHAA 2VQ1A 1F2QA 2CK0H 4P48A 5E4IA 4OD1L 4KHTH 5F7LB 3KLDA 4KAQL 1U2CA 4CW1A 3RWFB 1AJ7L 4M8QA 3VXUA 1CICD 1YECH 5FECA 1JNJA 5ESAA 1HWHB 1K8IB 2VE6A 1QSZA 2JCCF 3EYQD 1T04B 2YRZA 1S5IL 3SY0B 2DRUA 4Z7VF 2VLJA 1IM9D 3G6AB 5DYOB 3WHXA 3BDYL 4NGHL 3MNWB 4LVHB 4I1NB 4PJ8D 1MFBL 4JFZH 4RFNB 5FYJL 3V6ZA 3L6FB 2Q8AH 4OV5A 2BVOA 4NQCE 4U3HA 5I15H 4NQTA 1WQVT 3UAJC 3ZO0A 1TZHA 4D0CB 4P4RA 4M4PA 3ESUF 2QKIB 5F1NB 5HPMA 2LVEA 3HC3H 4PFEA 4R8WL 1CT8A 1MFNA 3D2UD 2IH1B 5MENE 1ONQA 4WGWB 4Q6IA 4GAJH 4Y5YB 1UXSA 3RWIA 2E9BA 5GSRB 1YN6A 1F8TH 1M6OB 1BQUA 3DNKA 1ZLSH 2HMID 5IMMB 5CKAA 4PJBF 4GXVH 4E41B 4K94H 4L3CB 2I07B 4ZFFB 4HMDA 4GLRI 4B5EA 3ROOA 4U6TA 3HR6A 3OKEA 3X14A 3RA7H 2YBRA 4DGVL 4RFOH 2WNGA 4NZRL 3ROOB 1RJZB 4MD5A 1UH2A 1XIWB 1IM9B 1ND0A 2QEJA 5DC4B 2GT9A 2PO6D 2EKJA 3AM8A 4NOFA 3MODH 4FXLA 4DCQA 4OZGF 4WEBL 3DBXB 1UXSB 2A38A 1MCHA 3DRQA 3DYPA 4G6AD 4OKDA 4UV4H 2VISB 1D7FA 1P4IL 1S7RB 2UY7A 3IDXL 4KMTL 1RZKC 3LRSB 1MCFA 4KI5E 4ONGL 3GMOA 5GGVY 4Y5XC 4XP5H 4EI6B 1BOYA 4QO1A 5DEGB 1MFDH 1TZHB 2VR5A 1CFVH 5L6YL 3I9GH 3QG6A 5C07B 5IROC 3HMXA 5IHZA 1HHGB 1N2RB 1A4JA 1CVSC 1CDHA 1IGCL 5F6IC 4TPRL 1U8HA 3IS1X 4P3CL 3PE9A 5HBBA 3RIAK 1T04A 3IDXH 1P4IH 3QFJA 1I7ZA 1WFOA 1JGLL 3WDIA 3VFSB 1NMBL 1JHLH 1A3LH 1HNFA 4G43A 5GS3A 3UTTE 2JB5L 5D2LB 4Y4HA 3OPZH 1DLFL 4FFVC 2VJXA 3F7RA 1KCKA 3MLWL 3QHFH 3TWCH 5E4EC 3KPSB 5DJCA 1X6LA 1H3XA 3U48A 3SDAC 3QDGD 2VQ1B 3T65B 3JWDC 2LV4A 3I3DA 1MPAH 3H3BC 4JRXA 4WHDA 3PABA 3IXTA 3DSNA 4YBLB 1RZJC 2MKLC 4KK8C 2W9EL 1NPUA 3K7UA 5CEXA 4YBHA 5DJDB 5EU3A 5EU4A 5KSAD 3BH8B 5E2VH 5GJSL 1QVOB 1NMAH 1H5BC 3ZT6A 2XZQL 1HINH 5JORB 2MQ3A 5J7CC 1CE1H 1I1AC 2W9LA 5L9DL 4IRJD 1J9CT 4WI9A 1T1WA 3WO4B 2X1XR 4AIOA 1H3UA 1U95B 2LU4A 4AT6B 4MAYC 1Q8MA 3Q6FB 3LMJL 1R3LA 3BKJH 1MCEA 4FZEH 4XNYL 5C0JB 5E8NB 2MSPA 4NNYB 5IJKA 5FF6B 1IQWH 4P9MH 3THMH 4M6NL 4NM8L 3FTGA 3TIEB 1H3TA 4JFZL 4MQTB 4TQEL 5FYJH 3CH1B 1NLBL 3GSOB 1B4RA 4POZC 5BO1L 4M7KL 2J8HA 2R9HD 4WIQA 4JZNA 3ARDB 3U6RB 4MA8L 3T4AB 4G8IB 2J8UF 4XP6L 1PSKL 1VFAA 3HE6B 4PUBH 2C7UA 4LPCA 3ULUD 3QQ3B 2X4RB 3RDTB 4I48B 5L0QC 2DBLH 5BRZA 1EUTA 3MRKB 4HWBL 4NQEA 1LE5B 1CG9B 4HZLA 2AAVA 5C09D 2HWZL 1U93A 4N9GA 1AGEB 3KYNA 3BZDA 2OR7A 1JNNL 4YHLH 4NHCL 3TBVB 4OD1H 3LKOA 1F6FB 3MGTB 5F88A 4HH8A 5L8KB 3EDEA 4R7DA 3BP4B 4X6CA 1HK6A 4ODHL 1PX3A 2ADIA 4Z76A 5FO8B 1MCOH 2PW2A 3T0DA 3REVA 2D31A 4KJYA 3WNLA 4OZHB 1OLLA 3ARQA 3JUZA 3NBNA 2AEPH 4F7CB 4MCYA 4XTRC 5C0AA 4EQ2A 1IGTB 2N56A 5T5NF 3L95B 3OB0H 5AD0B 2C1OB 3QCTL 5AG9A 2XKSA 2Z31C 4R4FH 1QRKA 2DQDL 1MNUL 4J4PC 3FKUS 1NQBA 3DROA 2X4OB 2E7LA 1BQLH 3IETB 2DQEL 4WJ5A 3UPRA 2VL4A 4XC1H 3MX0A 1JPTL 3RZCA 4MHHI 4U1LB 5IB4A 3BPLC 3WN5B 4JO1H 3T0WA 3DIFB 4R3SB 3MUY1 2FL5A 2MHAA 4IS6B 4K8RH 3FN3A 2YC1A 3ILPB 5HHOE 4KK9D 4XMLL 1FZJA 3B83A 1O7VA 1H8OA 5DURD 3S4SG 4JFHD 1I3RA 1K4CB 4HGWB 4PLKD 3SDAB 3FAXA 1S8DA 5JNYB 4NN6B 4YHNA 5E4EB 1VKXB 1TJHL 2OYPA 4LMQI 4KTDH 4WRLA 2MWCA 2O5ZL 3SDXB 2Y07L 2L4OA 1SJEB 1I9JL 4TOYL 3PV7A 5IKCB 4UT6L 4RX4A 3VE0B 1T89C 5EBWB 4PRPB 1QUNA 5DSCB 2VR4A 4Q97A 5ISZD 1Q9KA 3ELAT 4JFYB 1CGTA 5C09A 1MIMH 1ZK9A 1MJ7H 1UM6L 5ERWB 1T5XA 3HR5A 1ITCA 1YA5A 1UM5L 4BK5A 1QFUL 4M1GH 1PLGL 1IEAA 3IXAB 5GGQL 4YZFF 1EH9A 3MV11 4D94A 4Z78A 4JE4B 3BQUB 5ADOL 1M7IA 1OD9A 5HHNA 2R1WB 2AJXH 3ZMRA 2FATL 3U7YH 1UJ3C 4N1CA 3LH2L 4UDUA 2Q86A 3ARFB 4G8GA 5CD3B 4KZDH 2EEAA 4Z7UA 3RVUC 1R3HA 2DTML 3WUWB 4HJJH 5KVMC 4X9FA 4LRNL 2FD6L 2D9CA 3H9SD 1MCKA 3UJJH 2IPKA 4U6XB 4Y16A 3UMTA 2BSRB 4RGNB 3BKCL 1DTUA 1D5BA 1D5XA 4JFDD 2F58L 4JFQB 5MEPB 2IGFH 3F58H 4WTWA 4AMKH 3D87B 3CFBB 3ARTA 3MREA 4WFED 1HDMA 1KGCE 2F74B 2FJHB 4FZ8H 3ULVF 3L5XL 1AXTH 1SJHA 1ULVA 4AQOA 3K74B 4JKKA 4CDHA 1K5NB 4LVNC 4V1DA 1IKFH 3VI4E 5FM8A 5I8CA 5TF0A 1INEH 4EOWH 3CVHA 4RNRA 3GJFK 5LGHL 3VXPB 1B90A 3KPRE 3MGOA 5D7IB 5SWSB 4C55A 4JO3H 3CC5A 3VFOA 1AY1H 2AGJL 4XXCA 1ORQA 3UTQB 5F7UA 3G08A 1WAAF 2NY0B 2CKNA 1OPGL 1AQDA 4M5ZL 5D1XD 2D7TL 3P0YH 5E24E 2GSIA 1UWEH 4DFIA 2WW8A 3VWKA 1Y0LB 3AB0B 5C2BL 5D71L 4RSVA 5FGSA 5GSVB 3H9SB 2CDEB 2CUIA 5DHVB 3W39A 4EI5C 2NW3A 2EDLA 1T03H 3S8WA 4QRTA 3VFRA 2OXHA 4ZUWA 4BSJA 3BQUD 2DLTA 4EUPA 4XXDB 1XGQA 1XR9B 1I1CA 2BJMH 4WDIB 5HJ3B 5F7NC 4UQ2A 1ES0B 1PZ5A 2VAAB 1GH7A 4FQPA 3VMPA 2R8SH 4UBDC 3VH8G 5JHDD 4FABL 4I0PB 3SGJA 3BH9A 1F97A 2BMKA 2R0KH 1WZ1L 4YGAB 1ZV5A 4BYHA 5JQ6L 2KZWA 2BMKB 4P99A 3U4BH 4HV8A 3BH9B 1V3KA 4XP4H 2VLRD 4OSUH 3TO4D 2BNUA 4YEFA 3AU1B 4YHIB 2VAAA 4KHXL 4P59H 5KN5B 3HAEG 2WBJC 3F65A 3TJHC 1XGQB 3IDJA 3V6OA 1T1ZA 1O7SA 4H1LH 1NGQH 3ZDYF 2D3VA 4JM2F 1NCBH 4F7EB 2QSCH 5C0RL 3MLSH 1SM3H 1D5IH 5E8OA 2N4IA 3W39B 5DHVA 1N0LA 4RWYH 3WFCL 2LAAA 4KRPB 2D03H 4OLXH 1D9KA 1MF2L 3CLEL 5EOQL 12E8H 4YEEA 2X1WL 2E7HA 4JQVC 3JV4B 4BELD 4R0LA 2D0HA 4ELKA 3OKOA 3KNBA 1CU4L 4UAOB 4Y1AB 1IJ9A 1RULL 4KROC 4HIIA 1JGVL 1AHWC 4XVSL 2VDKH 5SWSA 1EEYB 4I18C 4B7IA 1REIA 5CMAA 2XNAA 3RGHA 3ARPA 3MRNB 1IFHL 5GJTL 1B4JH 4OF5A 3TO4B 1FN4A 3KWWB 5AUMB 2R0WL 2R2EA 4F9PC 1DP0A 3O3UN 3MRHA 5GRJH 1NBVL 2E5EA 5D6DC 1EHAA 1G7MB 5JW4R 5DD0H 5D1ZB 4P2QB 1FLRL 2DMBA 5E5MA 4PJFE 35C8L 2KDGA 3QIUC 2F74A 1MHCA 2FJHA 5I8KH 3P9LB 4M62L 1D9KD 4JM2D 4O2CB 3CVHH 4K2UL 5DJYB 3NN8B 2IPUG 3DUHA 1R3IH 1FO0A 1A2YA 3TH2T 5IWLA 1GGCL 4F8TA 1AI1H 3HAEB 3PHOB 4RISH 5SX4H 3TVMD 2IBZX 4IOSD 3WXWH 1F3JB 4L8BA 3W9DA 4KQ4L 3KLSA 4P9HC 3OQ3B 4YDLC 4ONHB 1DVFA 4W4OA 2P8PA 2ZG3A 4IOFC 3V0WH 3F12A 3W2DH 3QH3A 2VABB 3W9EA 3BRGC 1U91B 4XPBH 1F11A 5IVXA 1S5HB 1P6FA 2R1WA 1EX0A 3HZVA 1OTUD 2GJZB 1MRCL 4P46C 1XF5B 3MGAA 3UTSD 5FB8A 1C08B 6FABH 3SOBL 1GAFL 1X9QA 1OAUL 4O00A 3HNTH 3VXSA 3EKCA 5TH2B 3S5LA 1L7TH 3HR5B 4X6CF 5E00B 5I8EB 3CXHJ 3O6FB 1IC5L 5FA4A 4LCYA 3LQZB 2F53D 3M45A 4S1DD 3QWOB 1I8KB 3U4AA 2KH2B 5D1ZD 1G6RL 3KS0H 2NW2B 2QL1A 3VE0A 2CDGA 5EOCL 3F7PC 4APQA 3GDBA 3SDXA 4HKJB 1U8OB 3G5XA 2HFFA 2IALA 2X1PA 5B22A 1U92A 3TZVC 1ZVHA 5KZCB 3MXWH 5ENWB 2HH0H 4YK4B 2EDYA 1S8DB 4UV7H 5JNYA 1FDLH 3ULUF 1H3VA 1NSNH 2H45A 3CSBA 3NABH 4MXWH 5HHOB 1JFQL 1QSEB 4X0KB 4WHCA 3ARGA 4NKOA 2HAZA 2XA8L 1D6VL 3C8KA 4OZ4A 4MA7H 3VA2C 5DHYA 1UADC 5EUKB 4LNVA 2FX9L 1CFSB 3KDMB 3HA0A 4OCRL 4NRYA 4GKSB 3C09B 3LN5A 3PQYA 4BSVB 4P49A 1OB1A 2OJZH 4NO5B 5GZOC 4OF7A 2PTUA 4FQCL 3KLHC 4JDTH 1HXYB 5IQ9A 2FIKA 5FA3B 1FVDB 3QFJD 1SQ2N 5DJAB 5E9DE 1OAXL 1KJ2B 2HVKA 2DM2A 2GTWB 3EOAA 3LEYH 4FQ2H 4V1DE 3BXNA 4KI5D 2BOCA 3EFFB 5FHBH 4Z7OF 3HNVL 5DEFA 3WNKA 3PP4L 2ZUUA 4JY5H 4OZHA 4LHUD 5DRXB 1NAKH 4OCYH 2BVPA 3J8F7 3DVGB 3SDXE 1MJ8L 3CXHK 4X6CB 4XC3H 4NNXA 3GI9H 4PJGB 1LP9A 3QQNA 1NGPL 2RBLA 2N1KA 1ADQA 4XRCA 1QFWM 4HKXA 1SEBB 4Z7UF 4U1KA 2VC2H 4BH8B 5IEHB 1E4XI 2R0LL 1J1PH 5GRWA 3DGGB 1CL7L 3JWOL 4JO4L 1BEYL 4L8DA 1WICA 3X3GL 3HRZA 4XNXL 5MEOA 2J5LC 1D6EB 1RIUH 5GGRY 1SEQL 2ESVD 4GBXD 2HG5B 1UZ6E 2WLYA 2BHYA 4WU5B 1J0KA 1CYGA 1DCLA 5E8DH 4ZMAT 3G5ZA 4HS6B 4JRYB 3GJFB 4QXTA 2IMMA 2J6EA 3RU8H 1VFMA 5BJTA 4ZSOB 5I19H 4GW5B 1Y18A 5HYJE 2X5PA 5DRXA 3WUWG 5FF6A 3KPSD 3NFSH 4NNYA 3LKNB 1KULA 5E8NA 1DBJH 2A6IA 3PWLA 4PRPD 5LKNA 4Y4FA 5INDA 3GGWA 1GGBH 3FB5A 5HI3D 1I4FA 5IVZB 5EZJA 4PB0H 4PJ5D 3WO4C 2EKSA 5JW3L 5DJAA 1HYRC 3JV6B 3DMMD 2P5EA 3VCLA 5D4QA 2MMXA 3HS0B 3BUYB 4NQDB 2BERA 3ZTJH 5HGHB 2NTSP 5GRXG 3KDMA 4UMGA 2P4AB 1CBVH 3MOBH 4EDWL 2FYYB 2X4TB 1CLZL 4NKOB 1KSRA 5JPMA 1JN6A 4MS8D 5HHOA 1V7NL 5E6IC 1ZHBA 3SDDD 5A3IC 4ZFGL 3KPSA 4X80L 1YEKH 5HXMA 1BOGB 2IALB 1XGYL 2P48B 1CXHA 3F7QA 3NCFB 3QIBD 4JFDB 3EJYC 3VFSA 3BPOC 1L7IH 1HSBA 4KUCD 1S7SB 3HZKB 1VHPA 4DZBB 4OZIE 4JFED 4MS8C 5BMFH 4P2RD 3FN0H 4K9EL 4BZ1H 2JE8A 3QXUA 5IVNA 1QYGL 5FA4B 3TFKC 5E00A 1WSST 1MJUL 2MNUA 3C6SA 5TE7H 3U0WH 4MQ7A 1G7JB 3QDJD 1KIPA 1WTGT 4APQD 2UZXB 2LFGA 5E8PB 1GSMA 2A6KA 2VDML 4OTXH 3VD9A 5HI4C 4EI6A 3V7AG 3LRSA 1DLHB 3BO8B 4EDXB 5KW9L 2OTWB 5TQ0L 3WDHA 5HYSB 2WBJD 2BCKA 4FXKA 4LMQE 1NBZB 3MRMA 1NCAL 1ZHKB 3BE1H 4NM4H 1QSFB 5CP3H 4PJIB 5IR1A 3UP1A 2A9MH 4JPVH 4Q9BA 3V4PH 4OLYL 3UTSB 5SX4I 2AJVL 4CUCA 5IB3B 2OQJA 1FVEA 1NCAH 4GAYB 5EZIH 1UKTA 5BW7A 5LJYH 4YXKL 1CZ8L 3BN9D 1ETZB 3MA9L 1S7XA 5DA4A 2C5DC 3T3MF 5D2LE 1JYXA 2VZOA 4L3CA 1UEMA 2Y25A 2XKUA 3LZFL 4OM0H 2LTQC 3IJYB 3QIWB 4P9HH 4Q6IB 4Y5YA 1MFEL 1WK0A 1ONQB 5EWIL 5TE7L 3U0WL 3I85A 4LEXL 2G2RA 3CFEA 3T3ME 3TO4A 3TJEH 1XT5A 1FQ9C 1RZ7H 4PS4H 3WN5C 3D85A 4P4RB 1Q94A 4HPYL 3ARBB 1Z6JT 3V6OE 3QIBB 4HIIB 1NCCH 4PJDF 1BQHG 4RMSA 1U3HA 4RFNC 3QAZB 3IJHB 4XX1E 3UZQA 1KEMH 3QNXB 4WO4C 1YEKL 1JF5A 1AFVH 4XVJL 3WO3B 4YDKH 1K8IA 3GMPB 3T09A 4OCSL 3RY5A 3RBGA 3ARXA 3KLHD 4MA3A 4P5KA 5E8OB 2ZCKH 2F19L 1HILA 4N68A 1CBVL 3U7WL 1EHLL 2X09A 4NQXB 5EC1A 4EVNA 3IDJB 4QNPE 1TQCB 5MEQA 2G60L 4YPJA 3KJ4B 5IW3A 4E41D 1GHFH 5GS0H 5C0FA 3BYTA 3WIHL 4QTHB 1DDHA 5D6CA 3G9AB 3R8BB 3BDBA 1AKJB 1ZLWH 2HJKB 4NZTL 1KXVC 1A47A 3D39B 3HE6C 1MAJA 1KLUB 1RZIA 5KSAA 1PYWA 3EAKA 2EDOA 3BIKB 4KVCL 3WFZA 1J8HD 3RU8L 1Q0XL 3OR6A 5DQDH 2B1HH 3MRFA 1N0XH 1KB5L 4JKPL 3T77B 5KAQG 5KS9E 3QDGA 4M7LH 1DSFL 3FFCA 5F9AC 3VFRB 1E6OH 2Z8WC 3X13B 2NW3B 3F7VB 1KIQA 3RY6A 3RWEA 1J1PL 3F6LA 4UTBL 3QB7C