1NEUA

Structure of myelin membrane adhesion molecule p0
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
115
Chain Sequence
IVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIHNLDYSDNGTFTCDVKNVGKTSQVTLYVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYELIN P0 PROTEIN
publication title Crystal structure of the extracellular domain from P0, the major structural protein of peripheral nerve myelin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 24
structure length 115
sequence length 119
ec nomenclature
pdb deposition date 1996-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1neuA00
1U3JA 2N4IA 5D2NC 2DQEH 1J0IA 3ISWA 4TUJB 1U95A 4FQ2L 3BT2L 4GAYA 4P3WA 4QRSB 5HPOA 2AJUL 4YDIL 2H45A 1FO0A 4JFYA 2VMFA 4JHAH 3C5SA 5E5RB 3FO1B 1UH2A 5ADPH 2P5WA 1F4HA 3CDGB 4P3CH 2XKNA 4BQ8A 3ARZA 2AJYL 1P4BL 5IGXH 5BS0A 4ZSOB 3L3IB 2ADFH 3FRUA 3WKNA 3B2VL 1T1YB 3F62A 3QFJD 1WIOA 3MRIA 3QIUB 2XWTB 1YEJH 1NBQA 5D6CA 2HFFA 2ICWI 1WT5A 2KPNA 3QNYA 3Q3GA 4G8FA 4KKBD 5GRVL 4N8VG 2CRIA 4NZRL 5JIIA 4RMRA 5D7KD 3UBXI 4G6ML 1R5IA 3IDMB 5B8CB 4HLZG 1K3IA 4JLRB 3OF6D 2BNRE 1F4XL 1SMAA 3DI2B 2AEIT 5C0EB 2ARJA 1CU4L 2OL3H 4PRPD 1KENL 5C8JA 1GZPB 5GSVB 4NZTH 4MQ7B 4NBXB 1UWXH 4HWUA 3TA3A 1E4WL 3W39B 4TSAL 4NQDD 3OHXA 4P3DA 4LKXB 1YJDC 5A1AA 1FNFA 2DL2A 3TZVD 4I0PB 5DDHA 1HNGA 1NLDL 5T33L 3CX2A 5ESQA 5I9QB 4UQ3B 2BNRB 2Y06L 1DR9A 2VITB 5ERWA 3U46B 5D1ZA 5DJAB 1RVFL 3GIVB 2JJSA 1L7TH 4G6KH 2H2PC 1BD2D 5C0NC 1NCTA 3RWGB 1G6RA 3T1FA 1MAKA 3FQNB 2KZWA 4U7SA 4WJ5B 3T2OA 4MQXD 3I50L 1KLGB 3RZWA 1G84A 4LOUD 1X5LA 2CUIA 4GKOA 3H9SD 3D9AH 2BXZA 1KC5H 4DN4H 3PIQA 3EGSA 1CE6A 4GKNA 5TDPB 2GITB 2EC9T 3MGOB 5TGBB 5K59E 4UQ2B 3MSPA 3BE1L 3DGGB 2ED9A 5IQ7H 4HT1H 3RGVA 3HC4H 2FDBP 4IOFD 1D5IH 3BQUB 1IGTB 4G7YL 1HQRA 4DAGH 3N1PC 4FZ8L 3GHBH 3NABL 4PJBB 3JXAA 1S7SA 2DQTH 3ZT6A 2PXYD 3JV5A 1GIGH 1DQLL 5T3ZL 2VZSA 2VZVA 5FUZL 5JIHA 4DW2H 4CADA 2YEZA 4NQVA 3VG0H 1EHLH 4K7FB 1IGJA 2G5BB 4YHIB 1RK0A 3QQ3B 3ARBA 1OQXA 5D4QA 3I02B 1DCLA 3HCVB 4YHMH 1CFTA 5DMYA 3QFJE 3VE0B 1UCBH 4JO2L 4YUEH 5ESVA 2CDFB 2PF6A 5C2BL 1UENA 1EFXB 2D31B 2HRLA 3ES6A 3MOBH 4NWUL 4HLZH 5T3XL 3W2DL 2PTUA 5D7KE 2UWEE 5F3BB 4GRLC 3BFOA 5C0BB 1GH7A 3GGWA 3MLVH 5EU6A 1FDLH 4X80H 4N0UB 4PRPE 5EU5B 3RTQA 4OF6A 3KYKL 5CJOL 1SYSA 3F7VB 2APXA 4CNIA 5F3HB 2J8UA 3FO0H 2E9BA 1ZHBB 1FCGA 1XF4B 4DVBB 4LU5H 5I18H 4NQDE 5J11C 1ZAGA 3KYAA 1QKZH 2PTVA 2YR3A 4HS6A 2AEQH 4UU9A 2Y1VA 1T1WB 4WTXA 4QOKD 1TTUA 4IOIB 3U4BL 3RUGE 1BD2E 1FGNH 4ORGA 2I60H 2OCFD 2R23A 3SDAC 3B5GA 2OTPA 2WBJD 3OG6B 2VLLA 5FYKH 3RU8L 4RWHA 3TH2T 5SWSD 2OR8A 3RVVC 3IFPA 1U8IA 3TIDA 3KLHC 3H9SE 1KXTB 1J0HA 1Z9SA 3BKJH 2X89D 1PSKH 2Z35B 4QNPF 1F8TH 4BZ1L 1ZT1A 3GMNA 1X6LA 2E7HA 4P57A 4ONHB 5F1KC 1IL1A 3TNMA 2YD6A 1SJEB 1NCWL 5CUSL 2UY7A 1NC2B 4H1LB 5KANI 1HHJA 1N59A 1Q9OB 1MAML 1P2CB 5HYSA 2OR7A 3QB7C 2D9QB 2NZ9D 1A1MA 2GHWB 2D0FA 3PNWB 1OAXH 5CZKA 1MI5D 3X14B 4PLKD 4Q9RL 1TPXC 4L9DA 5FA4A 3SBWA 4W68A 5CEZH 4KZDH 3JV0A 1KJMA 4MXWH 2H8PB 2BJML 2E27L 1XGYH 5GS2H 3ZHDA 3ZTNL 4Y16D 1G7JA 2YK1H 4PIRF 5KVDL 2A74A 5DJ6B 3BI9X 4LIQL 4RCAA 3VFTA 2EE3A 1R0AH 5I74B 2EE9A 5EO9B 4PJFF 1DANT 2D0HA 3ABZA 3C5ZB 5CILH 4NO0A 4YDKL 3SDCC 3TO4D 2I9TA 1N2RB 1L9MA 1RJYA 5IQ9B 1XIWC 5ICYB 4GG6F 5IVNA 1FFNA 3OPZH 1UCTA 1CFBA 4NC0B 3HTLX 3R1GH 1MSPA 2VISA 1K5NB 1XGPA 5IKCB 3U0TB 4IRZL 3GFUA 3K4DA 3AXLA 3C60C 5HHOD 3AS2A 4GKZA 1PKQA 1BECA 1SY6L 2V17H 3QWOA 4DGVH 3GSUB 1JHTA 1GAFL 4YE4H 5JZ7C 1R3JA 4O2FB 4HGMA 4IRJC 1TDQA 1NFDE 4WI6A 3CH8A 3SDDC 4U0RC 4QOKE 3ZKXC 1CS6A 1NGWB 5L0QC 4WVRA 1UADC 1AIFA 1UVQA 2LE9A 1A6UL 2H3NB 3VFMA 3DVGB 1MHCA 1MRCH 4PV8B 2G9HA 1RIUL 3IS1X 4JANB 3OJVC 3ZSTA 3MYJB 5SWSE 3UZEA 4IIQC 2BMKA 4U2ZA 1UZ8B 2ERJB 2VUOA 3P2TA 3PWJA 1Q72L 3N1QC 5EO0A 2R8SL 3VFGH 3B5TA 2J1KA 35C8H 3QUXA 4PJEE 1JPFA 5GZOC 3MRDB 4F9LA 3BVNB 2R56H 1MLCB 2XFXA 4UNTA 3B9DA 2YHGA 4KUZL 4E42A 3OGCA 1ZEAL 4NP4L 3IDYC 2V5YA 2Z92B 1U2CA 4ERSH 3MTRA 3F6IA 1FJ1A 4PJAA 4Q0XL 1JHKH 4F7TA 4M9PA 1MI5E 3BEVA 1DVFB 2HVJA 4LVOB 1SHMA 4OCSH 4LNRB 1JZ5A 3OV6A 1QBLH 5F9WB 1NGXA 3FB8B 1FLTX 3NPSB 1AE6H 3OSKA 4JO1H 5B39A 1WCBB 3A6BL 3GRWH 4NM4H 4OZIF 2NY3D 2KDGA 1CXHA 1KIPA 3QPQD 3RL1B 1RZ7L 4WFED 5DJCB 3GSNL 1VFBB 3TYGH 3QBTB 5L9DH 2O5ZH 3STZA 1MI5B 4L29B 4L4VD 3BZFA 4Y5YB 3DETD 3LAFA 3UTSB 3RQ3A 3VFVB 4HS3B 5FK9A 5HJ3A 5KW9H 4JR9H 5SWZA 5IFAL 4Y16B 4ELKB 5DHYB 1KG0B 1G9NH 1JTTA 2DLEA 4GS7B 4NKOA 4GG8A 2NLJB 5DSCB 5TE4H 4U1GC 4NSKA 2VIRA 3WCYA 3CAFA 2VL5A 1U8QA 2C3GA 1KV3A 2FEDC 2FJFA 4OQTH 2NTFA 1OSZB 2V2TA 4M7KL 3GI8L 5HHOE 4MNQD 4OGXH 4TUOB 5JW5A 2ZOKB 3HZYB 5JHDA 4QY8B 1T4KB 3SCMD 4TTDD 4L8DB 1IFHH 5GGSY 2OI9B 1Z3GL 2VLRA 2HMID 4TPRL 3GO1L 3ARED 4MYWB 3C5JB 2X4QB 2P24B 3ECBA 3PDOB 3PWNA 4RWYL 3OKNB 3MRPA 5I19H 5C9KA 1F11A 1CGWA 4KRLB 1WZMA 5C6TL 1OCWL 3TIEA 4I48A 4N0RA 1FNEB 5E6ID 3VFUA 4GXUN 3TA3C 3VFWA 4S1QL 5EOCL 4AH2B 3THML 3WS3A 2R29H 3RNQB 1N0XL 3NCYS 3GKWH 2VDKL 3QHTC 1MFCL 4M7LT 3VXQA 5EBMB 4HIIA 4YEEA 3VGAB 4YX2L 3PHOA 1QLFB 3F8UB 5D1ZC 4R4NC 5GSRB 3L5XH 3MCG1 1URLA 1UJ3A 1FIGH 3Q6FB 3DMMB 3KLAB 4P2RB 2EXWD 2B2XH 1NUDA 1KCSH 4J3VA 5E8PB 1MCSA 1KBGH 1SJXA 1C08A 3VXRD 4EQ3A 2W60B 1WFOA 2C3HA 3V4PH 3BZEA 4FQQB 1B4RA 4WFEE 3T3PF 3CK0L 3EOBA 1FH5L 3F7RA 5MENA 1JPST 5CEXA 4XMPL 1H0DB 1SEBB 1MJUH 2ADGB 4L4VE 3G6JF 3RGVC 1S7XB 4OM0L 4N0FA 4QF1B 3H3PL 5TDOA 3FO9A 2YD1A 2ZWLT 2ESVA 1RJLA 2EH7L 4LCUA 4OV6F 5FF6B 3VH8A 4IBLT 4JPIA 4PJXB 3K1KC 5AUMB 1O7SA 3FONB 3HFMH 3WFCH 2DBLL 3QNXA 2BY1A 5IFHL 3O4OC 4OZFA 1KCRL 2VKWA 3DV6A 5AYQA 2PYEB 3P4MA 1KIRA 5C1MB 1B2WH 3QUYB 1JPTL 2DL9A 2Y4SA 1AGFA 1NDMA 4HUUB 3BT2H 1YNLL 1KPVB 4MNQE 2BSSB 1P4LB 1KLUA 2AJUH 3MZGB 3D0VB 4MNHB 1NC4A 3CIQA 1PQZA 1OWRM 4Z7VF 1OW0C 4BUGA 3QIWB 1MQKL 2AJXH 4RQQA 4YFLF 3QHZL 2RBLA 2AXFB 3QZWB 2X1WL 2AJYH 1P4BH 5ANMB 2EXYC 2FR4B 1I1CA 1NEUA 3WKML 2EC8A 4Y8DC 5I1CL 3A6OA 3X12B 3RNKB 2QTEA 4P46D 3MNZB 3KPTA 5F44A 5L2KD 4LAQL 4WO4A 4P2OD 1CIDA 3EYVA 3AS3A 1CTOA 5I16B 4XCYB 1AQDB 4G6MH 4HZLA 3X11B 5IT2L 2H32B 1P7QD 2NY6B 4X4YB 1F4XH 4JY4A 4WTWA 4NNYB 3AREB 4YHOL 1OTTC 2ZOLB 1QSEA 4RMVA 1K4CB 2Z4QB 5F1OB 4B5EA 3T2NL 1E4WH 4KJQC 1VFAA 1FZKB 2XACC 3WJJA 32C2A 4E41D 4MDJB 2KQMA 1CDHA 5EU4B 3INUH 1U8JA 3QXUA 1FV1A 1OF2B 3CFEB 2OP4H 3UPCA 4UB0H 1JWUA 4XCCL 2DLTA 4JRXB 1M05B 3QDMD 5E8EB 1EIBA 1U8KB 1UT9A 1ONQA 1RVFH 4Z7WE 3VXRE 3LQAC 4HXBL 3VRIA 1IQDB 3ZTJG 1S78D 3U9UA 1XCQB 4OCMC 4I3GA 4MNGB 3QG7H 1J88A 1W0VB 3EDEA 5BRZD 3BZ4B 3NOIA 3RJQB 5TF1L 3TBSB 1OB1A 3JTSB 5J1AA 4X83A 5B4MD 4NO3B 4P23D 5GGVY 4Z7WB 3OGOE 3ULVF 3QWRD 5IW6A 2H9GB 3K1DA 4LCWD 1RMFL 2YC1B 1KJ2A 1ZLWK 5IFJA 5E8DL 1C5DA 2FD6L 5B21A 3ARDA 3EKCA 4Q6YA 4EKXA 1YNTB 1IGFL 4S1DD 2ED8A 2I07A 1LE5A 4R7DB 1J5OL 3SBWC 1GOGA 3DX8A 4G7YH 1TVHA 1JNJA 4FXGB 3FQRA 1YMMD 5E7FA 5EO1A 4TVPL 1NEZG 3U82B 3TVMB 1W8OA 1AP2B 1UWEL 4C55A 1L9NA 4XWOD 2BERA 4NQSB 4XVUD 3NA4A 5CIPH 4Z7OE 1KOAA 5FECB 3GUTA 3EHBD 4HJ0C 1DQQB 1VB9A 2PCPA 3V5KB 1PYWA 2EYRB 5FKPA 3VFNB 1KCVL 2FJGA 4XNXH 4PJIB 1IKNA 3F7YA 4K9EC 3QJFB 5E8NA 3VMPA 3WHE1 1S7RA 3FL7A 3HMXA 1FVCB 2CXGA 5DQDL 5DHVB 1IEHA 5C86A 5E94B 1WAAA 1E4XL 5C2BH 1CK0L 1V7NH 4QRTB 4ZUWA 4MCZB 4Z7UE 4NWUH 4KU1A 2VXTL 4HJJH 3HMWL 1PVHA 3QXAB 3W2DH 5ICZA 2LU3A 5CHNA 1J18A 2CXKA 5EZIH 1YEEH 2VRAA 1F3DH 2HN7A 1BBJA 1OD7A 1A47A 2YSSA 2P48B 5ESAB 43CAA 3KYKH 4YWGL 1ZTXL 3GSWA 1MH5A 4XXDB 1NKOA 4EN3B 4E41E 4NGHL 2IMNA 2FSEA 2HKFH 4H5SB 4OLYL 3CVIL 3CFKB 1IGCL 3BP7B 4HBCH 4P2QD 3Q0HA 4R97B 3QDME 2DQHL 3VXUA 4BSWA 3BIKA 3G6JE 3W11C 3QEQD 3F5WB 4MJ5A 2MWCA 1XR9B 3ULVD 2HH0L 4E41B 3D6GA 3DRTA 4LPXA 3RU8H 4KWUA 5BRZE 5FB8B 2XICA 4F9LC 4EEEA 1LE9A 5GRUL 3JV6B 2FHBA 1XH3A 4BFEA 5D7LD 3LPGA 3QA3B 1I7ZB 5DK0A 1FG2B 1RY7B 4L8BA 1EHXA 2CO7B 3B9KC 5D1XA 4HC1L 4LVHB 4P59H 4MA3B 5CUSH 3BPOC 2IH3A 3R0NA 3TPUB 2C3WA 5E4EC 1U3HB 1MAMH 3G9VA 4PYHA 2WIIA 2UUDK 1YMME 2YMXH 4QWWC 4MD0B 4P23B 4MX7B 4Q9RH 4M00A 1FG9C 1EEYA 4DN3L 5CKAA 1KELL 2BJMH 2X7LA 3BJ91 3CVHL 2E27H 1OGAB 2P5ED 4HDIB 1DE4A 4HXAL 5JORB 1CLZL 1NUNB 1R5WA 5ACZA 2Y36L 5KVDH 1OP5K 3E0GA 2VWEE 5DT1L 5DWUL 4MD4B 1J0JA 4WI5A 1OQOA 2C5DC 5F1SA 1NGYB 3QAZC 2ZUQC 4O2EB 4AEFA 2ICEB 4LSTH 1BFSA 5D93B 4OBRA 3TN0B 5LGHH 4NDMB 3BHBB 2HFTA 1HYSC 4YDKH 1I7TA 5JW4R 1U8LA 5FUOL 3HE6B 1FN4B 1ACYH 5ID1A 1OTSD 1JRHL 1CXFA 3T0DA 4W70A 5F9JA 5C0CA 4L3CA 1JL8A 4G9DA 3VGGA 2D7TH 4WI9A 5F6IC 5JPMA 4XNYL 4IRZH 4FQXA 1INEL 3RP1A 1RHHB 2VLKA 5EORL 4OI8A 4RFNB 1HWHB 2VR4A 3HB3C 3KJ4C 3V4UL 5JPNA 3VI4E 3V5HB 2FZ3B 1JN6B 4FQIH 3U36B 2GJ6A 4G3YL 4PS4L 4QHUA 5C0DB 4HGWB 3QEQE 3CUPB 5SX4H 3TO2B 3VXPB 3PL6A 3DVNB 3K4AA 4ELMF 3K2UL 4KKLC 1U8PA 4QXTB 1J1XL 1RIUH 2UZIL 1YY9C 5FO8A 1NUGA 3ROOA 1KEML 5D7LE 4XPHL 4YAQB 2R8SH 4PGBB 3MLPA 4OUOA 2VDRL 2JK5B 3WHXA 1YYML 3ULVH 4MAYD 3GBLA 2X4PA 3SKOA 5MEQB 5FUCC 1DUYA 1FNLA 1I8LA 4KUZH 4PJ9B 1ZEAH 4NP4H 3BYTA 3MJGX 1JTOA 4TSCL 1I7RA 1LDPH 2AJ3A 4Q0XH 5K9KA 1JI2A 5I1GL 1MCQA 3PWVA 4HWZA 2V5SA 3KPRA 4ONGH 2YD3A 2R1XA 5C0GA 1TIUA 4AQOA 5DQJB 4LLAA 2W65A 3MUZ1 5GISL 3A6BH 4PJDA 2P5EE 2ORBL 3BGMB 3VMNA 3WJLA 1DUZB 3GSNH 2GSIA 3WNMA 3MJ7A 3KNBA 3VA2C 4BKLB 4IRSD 2OXHA 2VDPH 2FX9L 4LSRH 1MCDA 5M95B 1LNUA 4XVSH 2IJ0C 3RX8A 3DBXB 1B6DA 1T22A 4RFOL 1YYLH 3W0WB 2ZNXA 2YD8A 4XAWL 1U93A 1DEEA 5C07A 5KG9A 1OPGL 5IFAH 1WC7A 4GAGL 3BPLC 4EOWH 4HK0A 4O2CB 3HLAB 4JQXA 5GJTH 5E00A 1JNHB 3MO1A 1L6XA 4XPBH 4ZFOA 1U58B 2H26B 3CXHK 2WWKT 3BPNC 3KDMA 5F7UA 2RR3A 3VCLB 1G7IB 2P8LA 1YNKL 4Y19E 2OTWB 1MQ8A 3LKQB 5EUOB 1VA9A 5IVZB 5E56A 3AU1B 1IAOB 3O8XA 4KUCF 3KPQB 4K3DH 2VLJB 5MHSD 3GSRA 2ICWJ 4Z7QE 3BRFA 1HI6B 5D2NE 4PJBF 3GO1H 3MRGB 2AK4D 2YN5A 5E6ZA 3GSQB 1TCRB 4Y19B 3HZVB 3L7FA 1HHKB 2BY0A 1OCWH 4ZDHB 5T1LB 3TT3L 3IDUA 1UYWH 3LVEA 1TVDA 5HPMA 3T65A 1CE1H 5EOCH 3THMH 1WICA 4U1LB 1N0XH 3SGEH 4MSWA 3P77A 4JN1L 2OBGA 4U3HA 4NBZB 2R0WL 4OJFL 3S9DB 4KJWC 1D6VL 2HG5A 2BFVL 4U6TA 4S0SD 5B22A 4P2CG 3BH9B 2X09A 1MWAB 4U1KA 2WANA 4XC3H 2ZSWA 4MS8D 5EIQA 1K8IA 1ZVHA 3UTPD 4OGAC 1AGEB 5K9OA 2VXUL 3UBXA 1XFPA 1WUNT 4HKBA 1OVZA 1D6EB 1F13A 1MIMH 5J56B 3E6FA 3CK0H 4OLUL 1S3KL 2APVA 4HQQH 5C0AA 3NCMA 2D7MA 3HC0B 4TRPL 1R3LA 1D7FA 4KTDL 3MLTA 4PJCA 3F6LA 3SDAD 1I9IL 2X4NA 5D71L 3TBTA 3LKPA 4XVJL 2R1YA 3QUZC 1P1ZA 5LAXB 3PWUB 3ARVA 5IB3B 4U6HA 1CFSA 2XN9A 2CRYA 4PJ8B 2QHLA 4KRPC 4XNQA 1MY5A 1JPTH 4WWKC 4KUCD 4WI2A 1P4IL 3KWWA 2ZSVA 5ITFA 1RK1A 4KQ3L 3UZQA 1YNLH 1JK8A 5CEYA 5KSAB 3WIHH 4LQFL 3A67H 4L9LB 5HHPB 2DD8L 1F2QA 2YUWA 4S10A 3HI6L 1DBJL 2K7PA 3QHZH 5MHSE 4FZEH 3MGTA 1EZVX 4AMKH 3B83A 4Q6IC 2A6KB 1FBIL 2H1PL 2WLYA 4R96B 5I1CH 4HCRL 1L6ZA 1A7PL 1AGCB 3DX7A 1ZHNB 5DGQA 4LSPL 1A6ZB 4RGOH 5GPRA 5IG7A 1CLCA 5J3HC 5I8OL 1VGKA 1AC6A 2FWOB 3PGCB 3WDIA 4B50A 5IT2H 5CCKL 4ZUTB 3T0EC 3LSOA 3O0RL 3TBWA 1E0OB 4NC1C 4DZ8B 1ZLWH 4NJ9L 4YHOH 1N8ZB 3VDBA 1HZHH 2VN4A 1SQ2N 5E5MB 2DWEB 5AD0A 4V2BA 3T2NH 1N6VA 2DYPB 5E5UB 3VXMD 2C4FT 1S9VB 2IAMA 1XIWD 4F7PA 4JQVA 1T7WA 2QJDA 5JXEA 4K94C 1DDHB 2GFBA 3D69A 1DBBH 3K8KA 4I5BA 5EU7C 4HKJB 4FQLL 1SY6A 3MFFA 4XCCH 1MJJB 3FQTA 5I1AB 1RUML 4DUWA 5L6YH 3UTPE 1QRNB 4EXKA 2J5LC 3O3BA 1JZ6A 1LEIB 2R9HD 3C60D 1TZIB 4X5XB 2WUBH 2BHZA 4KMLB 1DFBL 1F45A 4GRLB 5DRNB 4U05A 5JZ7D 5GGUA 3OKLB 4QRQA 4JO4L 5CD3A 1J1OH 4CU7A 2VABA 2AJZB 3SDDD 4ZUVA 3Q1SL 3D85B 4X0KA 5F21B 5TF1H 5L2JA 4ODWB 3MV9B 4NRYB 5AAWA 5J11B 1PG7L 2UZXB 5FCUL 4MXQC 4X4XA 1RMFH 3CMOL 4IMLB 3HR5B 4Q9QL 5E8DH 5B38A 5JHLH 1ROWA 3UC0L 2I5YL 2NW2B 3V5DA 3JSSA 3NCCB 3GSVA 4RIRA 3CCHA 2ZUVA 4G9FB 5D5MA 4TVPH 1YUHA 3U1SH 4JHZA 4UNUA 2VERN 2LU4A 1ZOXA 1RUPL 3MGAA 4PV9B 3DROA 4ISVA 3HPJB 4JM2A 3LKRA 1FORL 1EAPA 4C59B 1KCVH 2EIZA 3VW3L 5I76A 4JPKL 3LS4L 5IB1B 3MV8D 1F00I 1PG7X 5ISZD 2MSPA 4UDTA 1EO7A 4FQJH 1KIUA 2X42A 1E4XH 3BD5A 1CK0H 1BREA 2HJKB 4HFUL 1J7VR 3S36H 1CYGA 2VXTH 2B0SL 3HMWH 3X3FL 1G9ML 3IJHA 4PJ5A 1U8MB 3SO5A 2XXCB 4JVUA 1U8NA 3PHQA 4FQXC 2EDLA 3E8UL 3LZFH 4GUPB 3C6SA 3C9NA 3LMJL 4XVTH 3R8BB 3U7AA 4X9IA 4OZGA 3SHSA 4KI5C 5EC1B 4UOW1 4YWGH 3FT2B 1ZTXH 3U4EA 4DZBA 3HS0A 3VXME 4OV5B 2UUDH 3ULUC 3AAZA 3NBNA 4P5TA 5HGDB 4PPTA 2RIKA 4Z18A 2NXZC 3DXAD 5HD8C 2NYYC 1IGML 2GSGB 4OLYH 2R0KL 1OP9A 3PL6C 5IMOA 5LXGH 1VFMA 3BIBX 3KG5A 4TUKL 3DURA 3ARFA 1C16B 5C6WH 2FEDD 5KAQG 5SX4I 1Q9LA 1IBGL 2F54A 3SDCB 3SE3A 4WIQA 4S1RH 1XMWA 4PG2A 1QNZH 1X4XA 2HLAA 4RGMB 1WIUA 5TPWH 2IG2L 2JCCA 2E7BA 3MYZA 4BH8B 1XGQA 1KJ3H 5GRUH 4IS6B 5I30H 1FNSL 2PETA 1UM6H 2C7UB 1I8LC 4C57C 5BVJA 4ODSH 5K9JL 3H9ZA 4NHCL 5HHQB 5MEOA 2MQ0A 4L3AA 3C60B 3NIDF 4RMUA 4X7DC 5GIRB 3GJEA 3BSZL 5FYJH 4L4TD 4RX4D 4CVXB 4HLJA 4IRJB 5SX5K 1CWVA 4X6DB 43C9B 1A6WL 1SJHA 1YEDA 4C83B 1T89A 3ZKXB 1F97A 3MLYL 4RBPK 3U0WL 5L0QB 1BJ1J 3VU2A 1AO7B 3N85L 4MAUL 1ZT4A 3WL9A 4JDVB 4DN3H 1NFIB 2EZ0C 4LEOB 2E7CA 2EH8L 2VXVH 2Z0BA 4BFGA 4L4JA 5CBEB 4JVWA 4R4ND 5D1ZD 1CLZH 3WXVL 5HYJD 1AJ7H 2Y36H 3CFCL 3TCLB 1I7UB 3LB6D 1F6FB 2G75B 3MV8E 2SEBA 2YKLH 5ISZE 3ARUA 3WIIL 4QKXB 2F19L 1IT9L 4G80B 3RWCA 3OB8A 3KXFD 3MV7D 1ZA6A 1T2JA 5LCVL 2VZ1A 2CLZA 4J8RB 4QRRD 1JJUA 1FVDA 1LHZA 3UPRA 4YHNB 4WV1A 5J9PB 4G8IA 4YNYB 2LV4A 3RGVD 5ISZB 3CFJA 4NZUL 4OCRH 4XNYH 1A7RH 1INEH 5FO9A 2DQJL 1CN4A 1D5MA 4PJXF 3RIFK 3DXAE 4ZYKB 2H41A 1GC1C 3V4UH 3X3GH 1D9KB 1FZOA 5HBBA 4X6CA 4HK3J 4NWTL 3V95A 5F7NC 5D96C 5DMKA 5T1KA 2P5WE 4G3YH 4PS4H 4JY6B 4YHZL 1LP9A 2LTQC 1YEIL 5C0RH 1LK2A 2R2EA 3F12A 4KROC 2DTML 3IGAA 4KQ4H 2UZIH 3DXAB 1U95B 4GAYB 1I1RA 4KJYA 3FTGA 4KC3B 1KEMH 1FO0B 4JFYB 4XPHH 4EZMA 3C5SB 5J1TC 1QR1A 1NGQL 2EXYD 2G2RA 2P5WB 2CLRA 3RY6A 3U79A 3SGEI 2NX5D 1RIHH 1DZBA 4NNPL 2XKNB 4F80A 4W6WB 4M1GH 4Y5VC 5BS0B 2Z8VC 2Q6WA 4MB3A 4YXHH 1HH9A 4L4TE 1YEFL 2WK2A 3FRUB 2OM5A 4U0QB 3MRIB 4EQ2A 4K8RL 1A7OL 4PJ7E 4M9OA 4BFBD 4TSCH 5D6CB 1WWWX 1R3IH 2D7PA 2HFFB 4QHMA 4G8FB 5TF0A 3QNYB 3Q3GB 5I1GH 2AJSL 4IOSD 1PEZA 2P8PA 4GAFB 1R5IB 2CR6A 3NVQA 2UVFA 1NMBH 3EO0A 3JVGA 4OAWA 2ARJB 2ORBH 5C8JB 5HYJE 1G7PA 4HS8L 3W5NA 1EA9C 3BOVA 1RZKC 4GRWB 3TA3B 4KHXH 2ZKHL 2VAJA 5F93C 3ZT7A 3W39A 3OHXB 4JZOA 4P3DB 1MF2L 5DDHB 2AW2A 3B43A 4ZAKC 1H8NA 2W38A 2XKUA 3MV7E 5ESQB 1CDIA 4QRRE 1IAKA 4XAWH 6FABL 4CN4A 1EJOL 5ERWB 5D1ZB 3TBYB 5D7IE 3TH4T 1G6RB 5EU3A 4OT1L 3T1FB 2APWA 5E08L 5GGRY 1KLGA 1D5BA 1X5HA 3AUVA 4HEME 5FYKU 1H15A 4HUXA 1P6AB 1YNKH 1MCCA 4M1CC 3PIQB 3EGSB 4R0LA 1CE6B 4GKNB 2V2WA 3SGDH 2FEEI 4MQTB 4XRCA 2D7OA 3REVA 1JGEA 4FXKA 2L4OA 3RGVB 2HJFA 3EFDL 1CBVL 3ARYA 3BIAX 1HQRB 5I1HL 1MRFL 5GHWL 4PBVC 2X4TA 2VDMH 3KYMA 5BQ7A 1S7SB 4X99B 3NIDE 3TEUA 2HJLA 1P5VA 3AB0B 4OI9A 2FO1A 3O4OB 3OWEA 2J8OA 3QXWA 1IEBA 4NN6B 1MUJA 4PJIF 4X7TA 4CADB 2YEZB 2NX5E 4NQVB 1QPXA 4M7ZC 2OZ4A 1IGJB 4WWID 5JXEC 1RK0B 3ARBB 4JN1H 4WUKL 3SQBA 2FX7H 4LHUG 3QIBC 5IVXE 4PP2A 2R0WH 1CFTB 4OJFH 1NCCL 4FA8A 1D6VH 2YD7A 4NCDA 5ESVB 3UROR 2BFVH 5TFSH 2Q3ZA 3ES6B 5KS9E 4U4BA 3GK8H 3J7HA 4M1DL 4N8VA 1UEYA 1DBML 1JI1A 3BP6A 5AG9A 5MERA 4OKVA 2ICCA 3MROA 2A9ML 4EI6A 1I8KA 2EYTA 3RBGA 3GGWB 5EU6B 5TDNA 3RA7L 2VXUH 1KPRA 3RTQB 3QFJA 1SYSB 1S7VA 3PXHA 4OLUH 4CNIB 1IC5H 4NPYA 2J8UB 4R2GD 4X9GA 1S3KH 2Z31A 2XOTA 1MWAL 1RZJL 1RUQH 4KHTH 3MFGB 4TRPH 5D6DC 2UWEA 1IARB 4HS6B 3EO1A 3W11D 3D5OF 5DEGA 4UU9B 3OF6A 1I9IH 4PJHA 3FT3A 5H37H 2BOCA 1F42A 4PRPA 4ORGB 2XV6B 4Z78A 2R23B 4ESKA 5E99L 4HC1A 4DOHE 5CP3A 4NQDA 1JPGA 2AGJL 4PGDA 4WW2C 1OT1A 2VLLB 3CH1A 3TZVA 1GGTA 1K4DA 1P4IH 2Q87A 4YHPA 3RIFF 4JM2C 3ESUF 4JE4B 2RHEA 4KQ3H 3IFPB 1U8IB 3TIDB 1DN2A 3BJLA 3B9KD 1WWBX 2WBKA 4LQFH 3G5VA 3UO1L 2A6DA 2DD8H 3C08H 1ZT1B 3RUGA 1YJDL 3GMNB 2BVTA 1BD2A 4LDLB 1IL1B 4DOHB 3TNMB 3CVHA 4HH9A 4YBLC 4EDXA 1INDL 4QWWD 4UOJA 4HUVA 1HHJB 1N59B 2H1PH 3KPOA 5HYSB 1E4XI 4FFYL 4D3CL 3CZJA 1A1MB 5HHXL 1A7PH 3H9SA 3TV3H 4HX1A 4HG4J 3H42L 5A40E 4I0CC 1ORSA 4OGYL 5FA4B 3C2SA 2EDYA 1KJMB 1SBSH 3O0RH 5AWNH 4EDWL 2C26A 4P5TC 3WXWH 1QYGL 4NJ9H 1G7JB 2A74B 3NFSH 4HIJA 3WLWC 5JXAL 1JWMA 5D9SA 3VFTB 1Z5LA 5IMMA 3KJ6L 5DUML 4QO1A 3RVUC 1I3GH 2PXYA 1CD1A 1IRAY 2WSKA 4U1IA 4NO0B 5CKGA 3WFBL 2I9TB 2X4RA 1RJYB 1PKQE 2H32H 3EAKA 4FQLH 1T2QL 2CR3A 2XQYK 4M6OH 2AQ1A 5JHDD 1FFNB 2FBJL 1M71A 5LQBH 1CDBA 1XZ0A 2XZQL 4JJ5A 3T4AA 4AEIH 2VISB 1XGPB 5DFWH 1B88A 1MJ8L 4JO4H 5KZCB 4Y1AD 5CLWA 5GRZA 3AXLB 3SDXF 4GKZB 1I9JH 1PKQB 1YY8A 3Q1SH 3MLXL 3U7WH 3QWOB 5ITBH 1JHTB 4DTGH 1R3JB 2V6HA 4XPFL 2D2OA 1U3ZA 5FCUH 4PB9H 1T89C 3CMOH 4RMQA 4Q9QH 1AIFB 1UVQB 4DUXA 3UC0H 3ARGD 3BGAA 4PJGE 5DA4A 1KACB 3UDWC 5CMAA 4GQPH 4MMXC 5KSVA 2O5XL 4POYA 3FOMA 3E3QE 3LOWA 2VQTA 3RVXC 3VFMB 5F7YC 3DVGA 2IBZY 1MHCB 2G9HB 3SE8H 4RAVA 4K7PX 2BMKB 4LPCA 4NCC1 1NFDA 3NGBC 3PWJB 1PLGL 5EO0B 2AVGA 3QT2A 5JNYA 4YHLL 4QOKA 3QUXB 1VENA 1JPFB 3L3GA 2MJWA 3MRDA 4WTZG 5DK3A 1FORH 1X5IA 4D8PA 1TZGL 2XFXB 4JPKH 1DEDA 2WBJA 4E42B 3WS6C 3U48A 3OGCB 4XBEH 1T1XA 5IHUH 1KB5A 1W0WA 1LO2L 5SWSA 1FJ1B 1HE7A 4PJAB 3HZKA 3PV6A 3NPZB 4WV1C 4F7TB 4CU8A 4UT9L 4HFUH 5GGRA 1R6VA 3BEVB 2NY0C 2HVJB 5LKNA 2N1KA 2B0SH 2JB5L 4PJEA 1NGXB 5E4EB 4ETQA 1G9MH 1OHQA 2R2BA 4HV8A 5EFIA 3MXWL 5B39B 5I75C 1H3GA 3CLEL 3E8UH 3U30C 3RX7A 1A1NA 1KIPB 4KPHL 3LMJH 3QDAA 5DHVH 1QP1A 5DJCA 3GMMA 5SX5H 3STZB 4PTTB 2F53D 4YK4C 3HRZA 2DLGA 1NCBH 1MI5A 2GTWA 3BZFB 3TJEL 1VFUA 2DQDL 1E6OL 4RBPH 1FAIH 3LRSB 5L8JB 5CP7A 3HPLA 2KKQA 5FK9B 5HJ3B 1IGMH 1OAUL 3GB7A 2R0KH 3H3KA 2ZUQB 2MPAL 5SWZB 5JHDE 4H0IA 5HDBE 4PGEA 3PXJA 4MA1B 4NKOB 3HE7C 4I3SH 4NSKB 3I6KA 3O4LD 2VIRB 4YGAB 2VL5B 1U8QB 2FJFB 2AABL 5EUOF 5A2FA 2NTFB 3G9AB 1LO3H 4UT6L 4Y1AE 2V2TB 5DUPL 2XZCL 1ORQA 3TO4A 5JW5B 4KDWA 5JHDB 2O5YH 1C5BL 3CFBA 4G8EA 3FOLA 4NHCH 5K9JH 4D0BA 2VLRB 3ZKND 5DS8A 3BSZH 1IQWL 4FTVA 3ECBB 3PWNB 3KJ4B 4WUUD 3GI9H 1VESA 2R2CA 1QFWM 3C09C 3MRPB 4HHAA 1F02I 3QDGD 1A6WH 2ZG2A 5HHOA 1LO5A 4JFED 1F11B 1MHPH 3TIEB 4I48B 1A4KA 3U0WH 4HWNA 2GK0B 5LG1A 4TSBL 4ZOCA 3N85H 1MCWM 1HH6A 4MAUH 3VFUB 2HFGH 1EO5A 3QSKB 1LMKA 3VFWB 2ZP0T 4ZPTB 2VYRE 2ADIA 4HK3N 3WS3B 2EH8H 5HI3D 4KJWD 1VKXA 2R69L 5IBUB 4X6EA 3CC5A 4R8WH 4X8JA 3WXVH 3C6LD 3VXQB 9CGTA 3CFCH 3G5XA 5AEAA 4FABL 4HIIB 3IJYA 3NN8A 3UXFA 3PHOB 3K3QA 1GSMA 3WIIH 1UJ3B 1X9QA 2F19H 1IT9H 1CFQA 3QNZA 1MCLA 4OGAD 1NBZA 1CXIA 3O2DH 4J3XA 5LCVH 4ZUUA 5GGQL 1JUFA 1C08B 1C5CL 1NCDL 5F7MC 1FLRL 1AXTL 2Q8BL 4PTUA 1OOAA 1BWWA 3BZEB 2X4UA 5I73C 3GHEL 4R0LC 3EOBB 3LEVL 5MENB 5CEXB 4NZUH 3IVKA 5DR5L 2F53E 4KY1L 1V3KA 2DQJH 4JO3L 3QUZD 3FFDA 1B0WA 1S7XA 4N0FB 3SGDI 3E1F1 3K81A 1CFNA 5TDOB 3FO9B 2ESVB 1RJLB 4LCUB 1MVFA 1GGBL 3NZHL 3VH8B 3SE9L 4JPIB 4KRPD 1S7WA 4X8XA 3KLSA 1ZHKA 3ZE1E 2NXYC 4WWKD 4YHZH 3QNXB 1GHFL 4OZFB 3DV6B 3O4LE 3P4MB 1KIRB 4H0GA 2EKJA 4L4VA 2DTMH 4OTXH 4Y4FC 3HNTL 2ID5A 1AGFB 1NDMB 3BPLB 2CO6B 1T2XA 1KLUB 3I3BA 1NC4B 1PQZB 5D1QA 1NGQH 2XYCA 3BRDA 2YOCA 4OD3H 5DD3L 3BPNB 1EO8L 4LRNH 3VWKC 1HWGB 2CDGA 4RQQB 2DI7A 5FM5O 4NNPH 1PAMA 5E7BA 3LIZL 3V6OA 2JB6A 5M94B 3BKYL 1HIML 5IHZA 2AXJA 1O5DT 2FX8L 5LWYL 1NDGA 3DI3B 4QLRA 1TXKA 1CVSC 4PFEA 4WUUE 5I6XC 1U42A 1IKFL 4K8RH 5J3HD 5J7CC 3FFCA 3DRQA 4MNQA 4JFEE 5F89A 3U4AA 3T0ED 1FO0L 4WO4B 3EYVB 4J4PC 2DOCA 3SCMA 3QQNA 4IM8A 1UB5A 1U8HA 2A0LC 4G8GD 4HZLB 4PP1C 3EJJX 4OFYD 2Z31C 1ETZA 1BFVH 4JY4B 2EDQA 2I25N 2EE6A 5BMFH 1QSEB 4L8SA 3O9WC 3IU4L 4MDIA 2ARWA 1VFAB 2BHUA 2DI8A 32C2B 4XI5C 1MF2H 4YIQB 5E6IA 4LGPB 1U8JB 4J7RA 4F15C 1FV1B 4HMCA 2B7DT 3HG1A 5CJ5A 3QH3A 3GNML 1JZ2A 1HOCA 1JWUB 3LKSA 1X5ZA 3O45A 3D2UA 4LASH 3B9EA 3TGXA 5IJKA 1ONQB 2NTSP 1Q0XL 3DGCR 5C0JA 4KAQL 4FFWC 4J1UA 3VRIB 5E08H 3QISA 4PUBL 4QTIH 3U9UB 1IM3A 5HHVL 3WV0A 4EUPG 4NYLA 4Z8FL 4ZXBD 2WWMC 5I1KH 2Q1EA 1G9EA 5IF0B 1CL7L 1C7TA 2EDBA 3AY4C 2JJVA 3TBSA 1A6TA 1OB1B 4MQXC 3LN9A 4MWFA 5J1AB 4G7VL 5EIIA 4BELD 4LOUC 2V7HA 4Z7WA 3VXRA 5IW6B 4WU5A 2ZUSA 1KJ2B 1RULL 1G6RL 3H7BA 3RVTC 5IFJB 2Q86A 3EO9H 1C5DB 1DSFL 3ARDB 3EFDH 8FABA 1FNAA 5EZOL 5LVEA 2I07B 1LE5B 4WFFD 2EO1A 4FS0A 4AL8L 3FQRB 2HT4C 1MRFH 5EO1B 3T3ME 3NCEB 4P99A 5L88L 3PE9A 1TLKA 3QR2A 3FMGH 1WAAE 4KV5F 4ONOA 1IZKA 2K9UA 4I3RH 2EDFA 4P4KD 5CAYB 4XWGL 3GUTB 5FECA 3RZCD 2DLIA 5CIPA 5I1JH 2PCPB 2PXYC 3IJSA 1PYWB 2Q8AL 5FKPB 2FJGB 3F7YB 4WUKH 5E8NB 4JG1L 4JHWL 1S7RB 2H2SC 4Y2DC 1NCCH 4YDLC 1CDGA 4W81A 1LEKB 4BK4A 2YUVA 4ZUWB 1S5HA 4G6FD 3T0EE 4M1DH 1BVZA 1SEQH 1DBMH 1X5XA 1C1EL 4N5EC 3MLUL 4NC1E 3MRLA 4U7KA 5CHNB 2XT1B 4G8GE 4YPGA 4NCC2 5HDLA 3BEWA 4NOFA 2OTUA 1HNFA 5KVEL 4GKSA 2A9MH 3RA7H 1BFOA 2HN7B 5ADOL 1BBJB 1OAZL 3ULUD 2YSSB 1M7DA 4PY8I 4HWEL 1YQVL 43CAB 3PV7A 4XP4L 4LSVH 5BO1L 2NXZD 5HD8D 5GS1A 2NYYD 3GSWB 4P46A 2AEPL 4LSSL 2BRRL 4Z7UA 4Y5XA 5L2KA 1RZJH 4P2OA 5FA3A 2FSEB 4HUWA 4X5WA 3VFOA 3MACH 5ALBL 3RWHA 4EVNA 2O61A 1P7QA 2X70A 5MI0C 3VXUB 4BSWB 1CLOL 4MXVF 3BIKB 4EI5D 3VG9C 2MQCA 4WW1B 5KVFL 5E99H 4MJ5B 3FHQA 3QI9C 5F7EL 3VD9A 3DRTB 4WGWB 4E41A 4RRPG 1H3UA 1AQKH 4PG9A 3HKFA 1LE9B 4YXKL 1XH3B 4WCYL 3QDMA 1N64H 4FOMA 4XXCA 1CXLA 3H6JA 3UO1H 5DK0B 4ZS7L 1YJDH 4L8BB 3G6JA 2OSLA 5D1XB 4X6DF 2BVPA 2AI0H 1INDH 4HPYH 4PD4K 2DMKA 2IH3B 2YN3A 3OJMB 5IUSA 3IRZA 1T0MA 3TPUA 3LN4A 4WFFE 1LILA 2B5IC 5BRZA 1AHWC 2WIIB 5D7SL 4LLVA 4D3CH 3ALWA 2A9NH 1WBYA 2F8OA 2GEEA 1NEZA 2EZ0D 3C2AH 5DD6A 5E6YA 2CIKA 4JG0H 3BW9A 3HC3L 3H42H 4OGYH 2NZ9C 3QWRA 1EEYB 4LCWA 1R5VA 2C3VB 2X7LB 5J6GA 1ADQL 4EDWH 1QSFD 1DE4B 4S1SL 5LBSL 2RJMA 1WJ3A 5ACZB 4Z7VA 2CUHA 1YMMA 5C0CE 1OGTA 5EUKA 3WO4C 5A2KH 4D0CA 3FQXA 5IEHB 4NFCA 2ZZUT 3FRPA 2BP3A 4NDMA 5CD5C 1Q38A 1WF5A 2CH8A 1I7TB 1G9NC 1U8LB 1FSKB 2Z93A 5ID1B 4OCNC 1G0YR 1T2QH 3DYOA 2Y07L 1TQBC 4N0YL 2FBJH 5EWIL 5KSBE 4XMKH 4K7PH 3OJDB 1J1PH 5F9JB 3BAEL 3ULUE 5C0CB 3SE4C 4DVRL 4L3CB 4G9DB 3BMVA 2IFFL 4ZNEA 5JPMB 1MJ8H 4FQXB 4U7MA 4GW4A 4GSDL 1JE6A 2VLKB 3EYSL 3MLXH 2VH5H 5JPNB 2OMNA 1A21A 4RSVA 5GS0D 4D9QD 2GJ6B 4KROD 2PR4H 1CDJA 4LK4A 4QHUB 1P84K 3PL6B 5HDQH 2XQBH 1U8PB 3UTQA 1UXSA 3HAEG 3SEPA 5DZNA 4O51A 4QXUL 3CD4A 5FO8B 5AAMA 3ROOB 1WVZA 4JPVL 4P2QA 1YDPA 2ATPA 4YHLH 3ETBF 4Z95L 1HYRC 3QYCA 4CN6A 5I1LA 3TWCL 1OAQH 1ED3A 1IGYA 3WHXB 2HFEA 3OX8A 1AY1H 4OZHE 2X05A 2X4PB 3SKOB 3UAJD 3QEQA 1DUYB 4PJDE 1TZGH 4NQED 4LNVA 5CLTA 4KV5E 4OSUL 1MPAL 5DVMA 4B0MM 5FHBL 1LO2H 1RI8A 3HN3A 1I7RB 2AJ3B 5K9KB 1A7NL 3CLFL 5D7LA 4UT9H 3PWVB 4HWZB 3KPRB 4QHKI 4CU6A 4XCFH 2R1XB 5C0GB 2JB5H 2W65B 2APFA 4GRWF 2J7LA 3MXWH 3WFZA 4PJDB 4NHUA 3H9YA 1QSFE 3CLEH 3VD7A 2EECA 3S4SG 4KPHH 4HWBH 5I1DA 4LCCC 4UIKL 2GSIB 4H25A 3MJ7B 3KNBB 4ZAKD 1IJ9A 2NY3C 1IM9A 2A38A 5F7KC 3ZDXE 1NFKA 1LNUB 3QPQC 1YEHH 2EO9A 1E6OH 1T22B 1TQCC 4H8WL 7FABL 1OAUH 4OCLC 3N9GL 1MREH 1U93B 5C09D 3U0PA 1DEEB 4MMZC 1FL3B 5C07B 2P5EA 4JRYD 5KG9B 3BKML 1WC7B 4HK0B 3NZ8A 4RA3A 5D1QC 5E00B 3MO1B 5EOCJ 4ZFOB 4M1CD 2FECI 3V0WH 1G1CA 3KDMB 3FN9A 2AABH 1TTFA 3I6LD 4I2XE 4OCXL 4UT6H 3V6OC 2P8LB 5I15L 2XZCH 1X3DA 3ARXA 4ODXA 4XB7A 4OIIH 3S37H 4U33A 4JFPA 5FM8A 4JEGB 4J6RL 1UGNA 1HN1A 1QG3A 2C9AA 3O8XB 4TTGA 3GSRB 2OQJA 4D9QE 3JWDH 4N5UA 4TTDC 4TQEH 1T80A 2FLBT 1JBJA 3FT4A 3ARWA 1IGIH 2C1OA 3L7FB 4CMHC 3OL2A 3V4VL 4OF7A 4ZUSA 4C56D 1WWCA 4L8SC 1DTUA 5TQ2L 1BX2A 3RKDD 5E0QA 5J12C 3SPVA 3CSBA 1CR9L 4KVCL 2FGZA 3T65B 3QIBD 3NIFF 5IW1A 5D2NA 4U1LA 4MSWB 3ZDZF 1QLEL 4N9GA 1DQTA 3EZ8A 3P77B 5E6IC 3UEZA 1A0QH 2HT2C 5JDSA 3MNVA 4NQEE 5JR1H 1Q0YH 4WHDA 2ZNWA 1CQKA 3CX5J 4OB5L 2HG5B 2Y25A 2O26U 5FO7A 1QHOA 2CKBA 3SY0A 4U1KB 1IMHC 4WI4A 5D8JL 3OAZK 1UEMA 4Z9KB 4PRAA 2ZSWB 2R0ZL 1K8IB 2HVKA 1SBBA 2IAND 5DHXB 4PJCE 3QO0A 4MAYA 1NCDH 1C5CH 3I75A 1FLRH 3UBXB 3B8YA 2J8UF 2Q8BH 3TNNA 2EXWC 4HKBB 3GM0A 4HKZA 3HI5L 4W6XB 1LK3L 5HGGS 4ORZC 4NRZA 4JFZL 3GHEH 3E6FB 4ENEC 3LEVH 4KKAC 4JB9H 1PKOA 5C0AB 1B4JL 5DR5H 2BCKA 1H3TA 4KY1H 2NQCA 3WYRA 5IHLB 4JO3H 4KGLA 5DA0B 5T1MA 3MLTB 4PJCB 1J0ZA 5C09E 2X4NB 4GAJH 2CIIA 4XPAL 2V2XA 3LKPB 2A77L 4JRYE 2R1YB 1P1ZB 3PWUA 1BLNA 4U6HB 2YWZA 5BZWA 1CFSB 2XN9B 4IRSA 4XB8A 4K2UL 4XNQB 1MRDH 1WTGT 3NACL 3KWWB 2ZSVB 5ITFB 1RK1B 3I6LE 3DWTA 3VXNA 1EX0A 4M7JH 1NQBA 5CEYB 1JK8B 15C8L 1KJVA 5F7WC 5DD3H 4N1HB 1EO8H 1ZE3C 2NY4C 5IESL 3MGTB 3LIZH 5EOQL 4ZPVA 3BKYH 1KFAL 1HIMH 1DQDL 2FH6A 1QO3A 3VI3E 1QPPA 1IKFH 5FHAH 3E6HB 2QQLH 2VR9A 3DX7B 2DQIH 4L3ED 4FMFA 4M48L 3QHFL 5DUBA 5IG7B 3VGBA 4C56E 4ELMA 5JA9A 1VGKB 5E9DD 3FAXA 3SJVD 2A6IA 4ZO7A 4MJ6A 4P46C 3WLWD 2IGFL 4JQIL 3LSOB 3TBWB 3GDBA 4P2OC 3RVUD 3NAAL 2R0LH 2XTJB 1MFEH 1AR1D 4LVNB 2AK4A 5AD0B 3O2WL 1YA5A 5LGJA 3IU4H 3O3EA 3HZMA 5CS7A 4RZCA 2IAMB 4F7PB 5IB4A 4M7ZB 2BC4A 3U83A 4HF5H 2GFBB 2DQUL 5KOMC 5EH1A 4I5BB 3QIBB 2CMRL 3WNLA 3MFFB 3FQTB 1TJHH 2IANE 1Q0XH 4JFQA 2J6EH 3TJHC 4MB4A 2QKIA 4GRWH 4PRNA 2X2YA 4PUBH 2XTLA 4PRBA 1BBDL 3SGJA 1WZ1L 1A9BA 5HHVH 1RFDH 5GGUB 1T5XA 4QRQB 5CD3B 4DGIL 1AGDA 2IEPA 1QBML 3PHSA 2VABB 4ZUVB 4X0KB 5L2JB 1EXUA 4G7VH 3BD4A 1T7VA 5IW3A 2GI7A 3BUTA 1MFDH 5EULV 1GGCH 2NY5C 4X4XB 1MFAH 1DBKL 3O6MH 1RULH 3RVXD 1G6RH 3SGKA 5A3ID 4J3OC 1NH6A 5HHNA 5B38B 4YHYC 4YXLL 3VRJA 3V6FA 3V5DB 3SQOH 3L5WA 1OAKL 3GSVB 4RIRB 3CCHB 2DIJA 3QEHA 5D5MB 1YUHB 4JAMA 3QPXL 1OD9A 4GXVL 3LDBC 2A83A 4HIXL 2FCBA 4K07A 3SDAA 1EFQA 3BH8A 1OL0A 3L3KA 1KJ2L 4XWGH 3DROB 5J0BA 4ISVB 1AKJD 4JM2B 2Q8AH 3OKKA 3LKRB 4ZNCD 1EAPB 1M1SA 4DKEH 2FGWL 4PJAF 2EIZB 5I76B 4XWOC 3RBSA 4JHWH 1DLFL 4OZGE 1N0LA 1QTYT 2EKSA 3D3VD 4UDTB 1IAMA 1I9RL 4LLDA 4APQC 4DCQA 4YBLB 4L3EE 5GRJH 1A7BA 2WQRA 3MLUH 5E9DE 3S3JA 3SJVE 3F58L 2QBWA 3B4NA 3IJHB 4PJ5B 4YZFE 1W72A 1U8NB 3PHQB 2RAMA 4DKFH 1RHFA 2BVEA 1OAZH 3C6SB 2WP3O 3C9NB 3G5YA 4NJAH 1XGUA 4OZGB 5A2JH 3HMXL 1YQVH 1F58H 3BKCL 5BO1H 1PZUB 4PREA 2QADC 3U4EB 4DZBB 3HS0B 2AEPH 5DYOA 4XP5L 3FCTA 3AAZB 3EOYG 1WWAX 4P5TB 3B8SA 3FKUS 2R4RH 5E9DB 1OAYL 1FC1A 4R6UA 2DQGL 2NY7H 3OKYA 4JFXA 2HT3C 3HE7D 5DVKA 4QRPD 5DD0L 3DURB 5I2IA 3RAJH 3U7YL 3ARFB 5FGBA 4DQOL 3G6DL 1Q9LB 3PGFL 4GFTB 5GQBA 2F54B 4HH8A 2HLAB 3VXMA 3DECA 1XIWA 8CGTA 2FATL 2JCCB 5IK3A 2YPKA 5SV4A 5KVGL 1XGQB 1FE8L 4YXKH 1A22B 3B2UC 3HNSH 5E95B 3ULVC 4U3CA 3CSGA 1J0YA 1DQML 2WUCL 3EYFA 4L1HA 4QHNA 4DUVA 3T8XB 3IKCA 4ZS7H 1D5XA 2J2ZA 5BVJB 5MEOB 5D2LE 5TQ0H 3QEUB 4XNUL 1LQSR 4DKAA 5MEPA 2DIBA 3T2QA 3GJEB 3PP4L 4JCLA 5EBWA 5SWQA 3ZDYF 1EZVY 5D7SH 1SJHB 1YEDB 3NIGF 4ONFH 3SDDA 1K9TA 4U3XA 4JFHD 3HC3H 2FNBA 4XPTL 1R3HA 1ZT4B 3WL9B 3NH7L 3R8QA 3S34L 5C92A 5F7FA 3PWPD 2CLVA 4RGNC 3UX9B 4LF3A 4S1SH 5LBSH 1GVIA 4IIQA 3NCYP 2WP3T 2A6JA 1YC8A 4FP8H 2X44D 3RWCB 1HXYA 1ZLVK 1SVZA 3RWFA 1BFTA 1ZA6B 1QVOA 4LRIC 2CLZB 2E9WA 1BPVA 4BSJA 1FVDB 5CZXC 2Y07H 4N0YH 2K3TA 3UPRB 5EWIH 4G6JL 4WV1B 4G8IB 5J9PA 3V52H 3BAEH 1DN0A 2NY0B 2F58H 4DVRH 3DUSA 2QSQA 1HKLL 3MV8A 1RPQA 3NFNA 1TNNA 3RWIA 2IFFH 3IDXL 3CFJB 3MLRH 4K23L 3WSQL 3S5LG 2Y72A 5I75B 5FXCH 3PABA 3U30B 1D5MB 2B4CH 3EYSH 1WGOA 5ALCH 1LO4L 3CXHJ 1FZOB 4X6CB 1WBZA 5DMKB 1BM3L 4QRPE 1FYTD 1FZJA 4YK4B 5T1KB 4NKIL 4Y4FD 3L6FA 1LP9B 3ARSA 4WENB 1EH9A 4I77L 3BXNA 1LK2B 2APBA 1HHHA 5DJYA 3F12B 4XNMA 3IGAB 4F57L 4KDTC 1FL5A 3VWKD 3LRHA 4QXUH 3DXAA 4KJYB 3FTGB 1BMGA 1CICC 1U36A 2CPCA 4JPVH 2IPTL 3ZE0E 1A3RL 1QR1B 2ADJA 2G2RB 4LP4A 3ULUL 1S7TA 2CLRB 2BNQA 2DBJA 3GSXA 3TWCH 4DK6A 4MZ3A 5EBGA 3G04A 2Q6WB 4OSUH 1HH9B 1MPAH 3QCTL 1GXEA 4J4PD 2A0LD 4MAYC 5FHBH 1T03L 4PP1D 5JO5A 1A7NH 2Z31D 4N0CC 4QHMB 4S2SA 4JFHE 3QXVA 4M43L 1E4KA 1T20A 2P8PB 1U2HA 2B20A 2PO6D 3O9WD 3PWPE 3EDFA 3EO0B 3MRHA 4OAWB 1S9WA 2FH8A 5IBUG 5FOBA 3MCKA 4L4TA 1G7PB 4RX4A 4XI5D 4UIKH 2OL3B 4PJ7A 3JWOH 5A43C 5AYUL 3SOBL 2J4WL 3ZHLA 1I4FA 4JZOB 5HHMD 3M1BA 1UB6A 5FFLA 5I71C 1UACH 1CGTA 4FFWD 2GYSA 3D48R 4H8WH 3KLDA 4IRSC 5FYKD 2XKSA 3RDTD 3W9EA 3N9GH 3S88L 1IAKB 2VDQL 4F33A 3O3DA 1XR8A 3BKMH 5HYJA 3VRLE 3TBYA 3UTTD 3MBEC 3VD4A 5EU3B 2WWMD 1TJGH 1I1AC 1NBVL 4POUB 3R06A 3P30L 2YA1A 3X17A 2IQAB 1D5BB 4AT6A 3AM8C 4HIHA 1H15B 4HUXB 4KVNL 4OCXH 1QQDA 3KXFA 1RUKL 3MV7A 2XA3A 4RMSA 5GRVK 3OMZA 5BW7A 5I15H 4QRRA 3WHE0 1GPOL 3RVTD 3KS0H 1WLHA 3OAZH 4MA7H 4R0LB 1UM5L 2V2WB 3CFDA 4XRCB 2AK1H 4J6RH 5D7IA 1FYTE 3L3DA 4FXLA 2ZJSH 4YR6A 2HT4D 3REVB 1JGEB 4FXKB 3JTTA 5CEZD 4WHYH 3LKOA 1ITCA 1YPZF 2HJFB 2DM3A 4ZFOL 2AQ3A 1XGTA 1XGRA 1JYWA 5GS2D 3NTCH 2X4TB 3KYMB 5BQ7B 1YZZA 4PY7A 2NXYB 3OB0K 2HJLB 4X99A 2VC2H 1CQYA 3EW3B 5TQ2H 1JFQL 4A2MA 3WD5L 4WEBL 1T0NA 1IEBB 2BSRA 1CR9H 1MUJB 4X7TB 2KZ1B 1G0DA 2H2SD 4Y2DD 3MOAH 3Q5OA 4I4WA 2W0LA 3SDYL 3UCRA 3IFNL 5CSZA 4PP2B 3ZMRA 2QQKL 4P9HH 1F6AA 4N5ED 4OB5H 2R1WA 3I3EA 1OW0A 1KEGL 3DSNA 12E8L 4LCIL 2QHRH 1KTLA 4N8VB 3FN0H 2V9QA 4Z7NF 1MCRA 3BP6B 5MERB 3SGJC 4OKVB 1VSCA 3ULSA 2NX5A 4GBXD 5I6XB 2R0ZH 2X6MA 3MROB 4M7LL 4EI6B 3HUJE 1I8KB 2EYTB 5CGTA 4BQCA 5TDNB 5DRZA 5JQ6H 4PJHE 5DD5L 1AGBA 5AG8A 1KPRB 5IVXA 1WIPA 1LK3H 3QFJB 4MS8C 3V2AR 2YPLD 4JFZH 4OCYH 3U9PL 1S7VB 4NPYB 3PDGA 2YD5A 5FM5M 4MGXA 2YWYA 5KS9A 2Z31B 1B4JH 5MP6H 1PFCA 3SGKC 4AIXA 5HHME 3MUHL 1OM3L 3REWA 3UP1A 1BF2A 2UWEB 2DQFA 4GJTB 5FYKE 3B6SA 3EO1B 1T5WA 4M5YL 5DEGB 3QI9D 4PJHB 3FT3B 2HRPL 2A77H 2BOCB 4H20H 4PRPB 4LARL 2BDNH 4Z78B 3UTTE 2F5BL 1KPUA 1JPSL 5F96L 2IF7A 1WCQA 1EUUA 4K2UH 3OKMA 3OKOA 1JPGB 1JGDA 4NQDB 2LU7A 3P9WB 4Y88A 4PGDB 3CH1B 4IEFB 3TZVB 3NACH 3TT1L 1K4DB 5AZEL 4YHPB 2EDOA 1E4JA 1J11A 1X4ZA 4TN9A 4XHQA 1RZKL 2W9EL 3FHAA 4PRID 15C8H 3G5VB 3MC0A 1EGJL 2A6DB 2M1KA 4ALAH 3RUGB 1BD2B 4O02H 3CVHB 4OZFH 4HH9B 1A5FL 4EDXB 1ADQA 1DQDH 1KUMA 3WMSA 5CEZE 3DARA 4HUVB 3KPOB 1A14L 1N26A 4N90D 4JY5L 4UTAH 3O81A 3H9SB 4HX1B 4IDLA 4PY8J 2I26N 1DL7L 3QHFH 1ORSB 4GMSH 4O9HL 4JQIH 2W92A 3RFZC 2C4XA 1X44A 3NAAH 3EYUL 5DJ0A 1UFUA 4PRHD 5BOZG 4JPWL 4HIJB 4LHUA 3P0YL 5CD5D 1JWMB 2E7LA 1EMTL 5D9SB 1Z5LB 4KXZH 4U6VL 3WEXA 5IMMB 1KYOK 2FIRT 4OZ4A 4QT5A 5DC4B 1RZFL 5FGBC 3DIFA 2PXYB 2VL4A 2IQ9L 1CD1B 2DJ4A 4U1IB 2DQUH 2JJTA 2X4RB 4KTEL 2CMRH 4WI7A 4F3FA 3O6LL 4Y2DB 4ODHH 4CMMA 4U1HA 3MRQA 1M71B 5B3JF 5FGRA 1XZ0B 3OQ3B 4JJ5B 3O2VH 1XF3A 5GJSL 3T4AB 1BBDH 2YPLE 4B41A 4LLMA 4FTVD 2BVOA 4F7EA 2FJHB 4HGKC 4KI5F 3DHJA 4JREC 4DGIH 2R9HC 1YY8B 4UILL 2F8XC 2X40A 3LCYA 2VO5A 3EFFA 1DBKH 1NBYA 4CJ0A 1XF5A 2DJUA 4LPYA 3VWJD 4LGSB 4YXLH 4N68A 3IAGC 5CMAB 5KSVB 3FOMB 3PQYD 1OAKH 4JDTH 4RAVB 4TULL 5I1IH 3IRPX 3QPXH 1BQHG 3S96A 5F8QC 1H5BA 1NFDB 3QI9B 4PRIE 2ZCKH 5JNYB 1FP5A 4QOKB 4P4RA 3L3GB 1RU9H 3GMOA 1S9YA 4PJGA 1A3LL 1JIBA 3RL2A 4WHTA 4D8PB 4ODBD 2FGWH 2WBJB 4NC2B 1DLFH 1T1XB 1KB5B 1V7MH 1W0WB 4N90E 5SWSB 5FM4A 3HZKB 1I9RH 3PV6B 5EDXA 3O3UN 3T0XA 3B9KA 5GGRB 2EYSA 1Y18A 5F88A 4PJEB 4Y89A 2IALA 4ETQB 2R2BB 4HV8B 5EFIB 1QFHA 5EIVA 1I3UA 1BZQK 1A1NB 4HD9A 1X5FA 5GZND 4PRHE 4LDOB 5C71A 3HMXH 3PUCA 3NA9H 4O58L 3EOTL 3CXDL 3GMMB 1X7QA 3P11L 4E5XA 4XP5H 3HRZB 2GTWB 4PTTA 1EUTA 5CZVL 1ERNA 5CP7B 2CRZA 3LRSA 3HPLB 2ILLA 2DQGH 3BDYL 3GB7B 3LD8B 4XP6H 2VTFA 5DJXA 2AJVL 4OLZH 4BA8A 5D1QD 3WFHA 1SMOA 2EIEA 4PGEB 3WE6A 1PZ5A 1JGUL 4NUGL 3PGFH 4CDHA 4HW6A 3T77A 3I6KB 1K6QL 3K8MA 1FAKT 2FATH 4FTVE 4AENA 4X6BA 1JGVL 3FFCD 1FE8H 2EDRA 4D9LL 4F58L 3OZ9H 2JKXA 1ORQB 3TO4B 1ZLVH 5C08D 3H7LA 3OXRA 1UH4A 3DUUA 4ZO6A 4JHBA 1DQMH 3CFBB 4G8EB 1IAIM 1Z6JT 4GXUM 2MKWA 3FOLB 3LPWA 1GCFA 1NLBL 4FQ1L 2ZCLL 4D0BB 1YN6A 5DS8B 4QHKJ 2ERJC 3HI1A 1E4KC 3PP4H 4FTVB 1L0QA 1R3KB 4QNPE 4Y1AA 3PQYE 4HHAB 4QCIA 1CVRA 5HHOB 1MEXL 1LO5B 3T0WA 3IXTA 3P40A 1A4KB 2GK0A 3G5ZA 1HH6B 4Y4KD 5DJDA 3GBMH 5EC2A 4L5FH 4MZ2A 5DJZA 2HT2D 3CU7A 3MODL 2ADIB 3HG1D 4ZPTA 4XBGA 3QUMA 3D2UD 1VKXB 4X6EB 3CJJA 4HFWA 4WTZA 3CC5B 3ARGA 4X8JB 3G08A 1E6JL 1MHHA 2YZ8A 1XCTA 4LVOC 3G5XB 5E2TL 3TF7C 3IJYB 3NN8B 3IYLW 2BNUB 1IEAA 3BD3A 4X7SL 1CFQB 3QNZB 4Y2OA 5C3TA 1NBZB 2L0DA 3LB6C 4U49A 3VFPA 4XMLL 4ZUUB 1V05A 3RHWK 1JUFB 4ENED 4H26A 5F7DA 4KKAD 4PTUB 4Y5YC 3QXDA 4PJFE 5IBTL 3VFSA 5BW7C 1FCCA 2VZUA 3WFDH 2X4UB 1FL6A 1RV6X 4AG4H 1QBBA 1ZWIA 1HKLH 1RD6A 3EJYC 3IDXH 4GG6E 3WSQH 4K23H 3IVKB 5I8EA 3L5IA 4NN5C 1J8HD 4OBSA 5B3JE 3RVWD 4NO2A 3AFLA 4GS7C 3FFDB 5CWSA 5TE6L 1LO4H 1CFNB 2W0PA 5KTEL 3WNNA 3LH2H 2OK0L 1CCZA 2NY3B 1BM3H 1FGVL 1S7WB 4N8CL 1ZHKB 2FO4A 4NKIH 4G42A 5DVLA 3BN9C 3M17A 4LSUH 4DEPC 4BSVA 3MRNB 2MCPL 1HQ4A 1AFVL 3GBNL 3V6OE 1Q9KA 4HMEA 4O5LL 3V0AC 2F53A 2WNGA 4L4VB 2YUZA 1ACZA 5DTFA 4UV7L 1RURL 1WEJL 2OI9C 2NY4D 2ZUYA 4M8QA 3FFCE 1ZS8A 2QEJA 4FQ2H 1A2YA 3C8KA 1RIVL 4K71B 4YDIH 1A3RH 5D1QB 3LKNA 4XTRC 4K7PY 2CDGB 3SDXA 4JKKA 5FYLL 2VXQL 4M62L 4ZS6D 3C8DA 2JB6B 1Y0LA 5ENWA 3O4LA 5IHZB 1FVEA 1I1YA 1NDGB 4AEHL 3B2VH 4WEMB 3FFCB 3OAYK 1T03H 3DRQB 3NFPA 2DQEL 4MNQB 4Z5RA 5F89B 4R4FL 3N1MC 3SCMB 3I6GA 4KK6C 4M43H 1UB5B 1U8HB 2QL1A 4NZRH 4JHAL 4J3SA 5ADPL 3HG1E 1ETZB 3IF1A 3BPCB 1QA9A 3K46A 5CBAA 1CU4H 3OG4B 4L8SB 1KENH 1T7XA 2P4AB 4WUUA 3MA9L 5J12B 2FYYA 3H2WA 4RNRA 1V3JA 2ADFL 4F7MA 3QDJD 5CGYC 4MDIB 3QDGA 4JFEA 4JZJA 5AYUH 2J4WH 4TSAH 1YEJL 4EBQL 2EDEA 3MREA 5F70A 4OZIE 3VD5A 4YIQA 3OB0H 5E6IB 1NLDH 5T33H 2V9TA 3TJHD 3HG1B 4MCYA 1DLHA 3QH3B 3S88H 3MV01 1HOCB 3LKSB 2VDQH 3D2UB 2Y06H 3O45B 4WDIA 1QFWL 1FQ9C 2BSTA 5C0JB 3C6LA 4J1UB 2WW8A 2G5RA 2OL3L 1NBVH 2Y7QA 4NZTL 1MCOL 3DYPA 4BQ9A 1IM3B 3KPPA 5DURD 3RX5A 4NYLB 3VA6A 3I50H 4HPOL 3ZYIA 3V8CA 1I3RA 1J8HE 1RUKH 5EOTA 5IF0A 5LJYH 1A6TB 4MWFB 5EIIB 2GCYA 1UM5H 2V7HB 3VXRB 3QUYC 2P46B 1FPTL 4WU5B 4QGTA 2OMBA 3D25A 3H7BB 4G6KL 4NQCD 3BE1H 2Q86B 2XPGA 2X9WA 4KH2A 5D5MF 3D39D 8FABB 3FZUC 2BZDA 2L7UA 3TP4A 4QXGL 4FZ8H 3NABH 3QUZA 3MRCA 3X13A 1KT2A 1JFQH 4JM2F 1XF1A 1DQLH 1BJMA 1QEWA 4WEBH 3OKEA 5E2VL 5T3ZH 4DN4L 2E7LC 5FUZH 5DRXA 3DNKA 4WWKA 1MCHA 5CIPB 4CGTA 2P8MA 3IJSB 2ITDA 4KJPC 4LAJH 5IQ7L 4HT1L 4KXZI 3IFNH 2JJTC 4APQD 3QFDA 2OJZL 1AD0A 2QQKH 4HKXB 1FZMA 2NY4B 1LEKA 1KEGH 4JO2H 12E8H 2M26A 1S5HB 4LCIH 5BXFA 5L2KE 4Q6IA 5T3XH 3MRLB 4YPGB 3BEWB 2OTUB 4GKSB 2OZ4L 4DW2L 3AMKA 3MRJA 1BFOB 2QADD 5ECJE 1EHLL 1M7DB 1CDYA 3V8OA 4U1MA 1P6FA 4FRWA 3AROA 3U9PH 5CJOH 5GS1B 4N9OB 3QDJE 2A73A 4P46B 5GGSA 2E6JA 2HT3D 3WIFA 4DFHA 4Z7UB 4Y5XB 5L2KB 5ICXA 3V6ZA 3T0EA 1JWSA 4P2OB 4NZJA 5FA3B 3GSOA 1ZKAA 4G8GA 4HUWB 4N1EA 4U1NA 4X5WB 3VFOB 5HI5C 3RHWF 3KYOA 4R2GC 3RWHB 4OFYA 3T3PE 1UQSA 4EVNB 1MCIA 2O61B 1EEUA 1NAMA 1P7QB 2X70B 4YH6A 4NIKB 1Z2KA 3MLVL 3U4BH 2JCCF 2F5BH 4WW1A 1H5BC 1JPSH 5F96H 1ITBB 3B2UD 4EUPA 1F3RB 4PG9B 4LU5L 5AZEH 1VEOA 1ULVA 1NMCB 2W9EH 1CG9A 2C1PA 1X5AA 4YFDB 3E3QC 3QDMB 2OS7A 4UIMA 2AEQL 4FG6D 4IHOA 4BZ1H 1NUFA 5IB5A 2IPKA 3G6JB 2OSLB 1G6VK 4LCWE 4NQCE 2DF3A 1BIHA 2HTKC 2BVPB 2I60L 3TVMC 1NCWH 1U92A 4XP9L 3D39E 1T0MB 3LN4B 3GKZA 2DI9A 5BRZB 5HVHB 4ZXBA 4Z7VE 4LLVB 4JY5H 1WBYB 5FYKL 1G9MC 1NEZB 5KBNC 3ALXA 5DD6B 1B6UA 1IM9D 2CIKB 3BW9B 3GEWB 4GW1A 4M93B 5CFHA 3DX6A 3S35L 2QQNL 4RGND 4P2YA 3BKJL 2EDHA 2X4OA 5J13C 4LCWB 1R5VB 2JIXD 1F8TL 4O9HH 5J6GB 3QCVL 2C3VA 1YN7A 5HDOA 4D0DA 4OLWL 4P0DA 3EYUH 3RWEA 1KNOA 3ZTNH 4Z7VB 4CAGA 1YMMB 1EMTH 4LIQH 1OGTB 4U6VH 5EUKB 1F4WL 4D0CB 3FQXB 3MRMA 5IEHA 2E7MA 5CZXD 4ZNEE 1QFUL 1QR4A 2YUXA 1OAXL 4U31A 4OF5A 4P4KA 1FYHB 3V79C 5TE7L 1J8KA 5HY9A 2Z93B 3STBA 4J12A 3KPSD 3RZCA 4KZDL 4JFOA 4MXWL 3OJDA 3WUWG 1OTUC 3S35X 1VFOA 1M7IA 4R97C 3WO3B 4X6CF 4GW4B 4PLJD 5CILL 1SY6H 1IC1A 2XWJA 1GAFH 3LV3A 1JGLL 1LP9F 2XZZA 5KSBA 4P2QE 3HHRB 3PF2A 4LFHG 3OPZL 1A6UH 1CICD 3ULVE 3R1GL 1WV7T 4RRPA 4ZOAA 1UXSB 3UTQB 4O51B 3ARGC 3EYQC 5IWLC 3OKDA 2V17L 1YDPB 4P2QB 2ATPB 4P5KA 3R0MA 4YE4L 1Q72H 3U2SA 1HILA 5I1LB 1U3HC 2R2HA 4EI5A 3IAQA 1ED3B 1IGYB 4P9ML 2CGRL 4M3KB 2HFEB 3OX8B 5DRWA 1KULA 1A3LH 3QEQB 2KUTA 4HAFA 3B9VA 4N0CD 3IETA 1OY3B 1U8OA 1C12A 3VXTA 1B0RA 2CUMA 1MRCL 1QFPA 2HLFC 1VGEL 5D7LB 4MJID 3JWNC 5ID0A 2ZPKL 1K3ZA 3LPFA 1MVUA 4XAKD 4RGNE 3KPNA 4OZHA 2HTLC 4NHUB 5D93C 2EEDA 2F15A 5J57B 5I1DB 1RZ7H 1KB5L 3EOTH 4H25B 4H88L 4JN2B 5DVNA 2XG5A 2M8XA 3ZL4L 3I9GL 4HWBA 3KPMA 1IM9B 1NCAL 2PKDA 1UC6A 4QTHA 1J0KA 1JHKL 4RGNB 3MJ9A 3MBED 1GZQA 3K74B 3U0PB 3MMEA 4NUJA 1WFUA 1ZGLA 1KIQA 2D3VA 1I1AD 3KPSE 2P5EB 1QSFA 1FL3A 2X1XR 1AE6L 4R90L 3V0VA 3IU3A 1JGUH 1U91A 3NZ8B 1Q94A 4K3HA 5E2WL 4CVZA 1NGZA 2VDLL 1Z9OA 4IJ3B 1K6QH 1NKRA 3TYGL 5L9DL 1JGVH 4GMTL 5EA0L 4F58H 4D9LH 4M7KH 3GI8H 4ODXB 5BJTA 4F8QA 5KW9L 1F2XK 4JFPB 1CD0A 4JR9L 3B9AA 1PBYA 2OQJB 4FQ1H 2ZCLH 1F90L 3QO1A 1CZ8L 1Z3GH 4FQHA 4P49A 4TPRH 5TE4L 4JCMA 2Z91A 4RWYH 3LS5L 4I2XA 3FT4B 4LQ1A 3HAEA 3ZKNC 1MEXH 2C1OB 3BP5A 5K59F 4KKNA 5C6TH 1N4XL 4ZUSB 1BX2B 1A4JA 3SPVB 3KYNA 3MODH 4PJ9C 2Z8SA 4JZJC 4S1QH 1OARL 5IW1B 2RGSA 1IFHL 5D2NB 4N9GB 4ODVL 4A2LA 1H3VA 2VDKH 5JDSB 1MFCH 3MNVB 3ZZ1A 4C58B 5HI3C 1ZSDA 4YX2H 5I19L 5FO7B 3C6LC 1T6WA 3R4DA 1MOEA 2CKBB 4MJIE 3SY0B 1Z0NA 4Y5VA 3EDKA 4XAKE 2YA2A 4NRXA 4NM8L 4I0PD 4XMLH 4PRAB 1HDMB 1REIA 4MLSA 2HVKB 4KMQA 5IP4A 3QO0B 2ICWA 4MAYB 1YMHA 1V5JA 3O11A 5IROA 1F6LL 2BNRD 2QLVB 2R29L 3I75B 5EG6C 3U6RA 2R15A 4NQEA 2BY2A 3TNNB 4F9PA 2WMPA 3S4SA 2GTZA 4HKZB 4NRZB 2NPLX 1ZVSA 3BWUC 2UWEF 3S3SA 1FH5H 1UKTA 3ILQC 2XA8L 2BCKB 3OAYH 4XMPH 3VMOA 4Q97A 1MLBA 2VAAA 3L5XL 4U6YA 3L95A 4F7CA 2E3VA 5T1MB 4OM0H 4JKWA 3H3PH 4TVPD 4HBQA 1JZ4A 3T4YA 3CPLA 2DICA 2CIIB 2EH7H 2FIKA 2V2XB 4XGZA 1EGJA 1FGVH 3JV4A 1KBGL 3SKMA 1BLNB 5GGTA 3O3AA 2DBLH 5BZWB 2VQUA 2WIMA 5E03A 4ZAKA 4IRSB 5IFHH 1KCRH 5EPMA 4O5LH 3RWJA 1IVLA 5TH2B 1JV5A 4NBYB 3BQUD 1V3LA 5E2JA 3VXNB 2N56A 3RUGF 3MBEB 4I8DA 1XF2A 5C09A 1I1AB 2V5RA 4POZD 3L7EA 1BZ9A 1KJVB 4BK5A 4JRYA 3RY4A 4ELME 3DOSA 4IMKC 1MQKH 5FYLH 2VXQH 4M62H 1SYVA 3MRFA 1ZHLA 2VR5A 4ZPVB 1VACA 3HFML 3QRGL 3Q2CA 1QO3B 4AEHH 3WKMH 2AK4E 2VN7A 4ZSOE 2PW1A 3E6HA 3SKNA 3O41A 4UDUA 4R4FH 2HAZA 4LAQH 5DUBB 4KRMB 4ELMB 1EFXD 2A6IB 3ZYZA 4MJ6B 1Y6KR 2AJXL 3P4NA 5C0BD 3T04D 2JELL 3L9RA 1RZJC 2AK4B 3MA9H 3BP4A 4QYOA 5LGJB 1AH1A 3O3EB 3HZMB 4RZCB 5A2IH 4EBQH 3L3HA 5IB4B 3EZJB 2BC4B 4C56A 4ZQKA 4BYHA 4FFVD 3BWAA 3QIBA 4EXPX 4UI2A 1QFWH 3TFKC 2PTTA 4JFQB 2QKIB 4JM4L 4HXBH 4PRNB 2IPUK 1RQ5A 4NKDA 2J6EA 3B3IA 2GUOA 3OR6A 4PRBB 1MCOH 4YO0A 1A9BB 4XHJC 4A6YA 4QHLA 3SN6N 1T5XB 5DI8A 4HPOH 5FYJD 1AGDB 4EIGB 3GJFA 2DMCA 1IC7L 4CKVX 3INUL 1EXUB 1Z0MA 3TBVB 4ODTL 2IANA 2OP4L 4PJ8C 4TVPE 4UB0L 4ZXBC 1GGYA 4KTYA 4MLIA 2XG4A 1GGUA 3LN5A 4FN0A 1FPTH 4KK5C 1EBAA 2GJJA 5HHNB 5D6DA 2DKMA 2FD6H 3VRJB 3V6FB 5KSAC 4Y7MA 3EOAA 1IGFH 3L5WB 4L9LC 1J5OH 5F1NA 1BHGA 4QXGH 1NFDF 3QG7L 3QEHB 1NC2D 1X6NA 2WLZA 4QRUA 4JAMB 3Q6GL 4M3JA 4OIBA 4YDVA 4PD4J 3TC9A 4WI8A 5FDYA 2A83B 4X4ZA 4NNXA 5F7HA 4PJBE 1UWEH 5E2VH 3SDAB 3BH8B 3L3KB 2FLRT 1KLFA 4WW2A 5I8KL 4ZTOL 2ZG1A 3OKKB 3ZT5A 4GLRH 4YFLI 2B1AL 3MQIA 1J9CT 1LD9A 2IBZX 4HJGA 4P4KC 4L8CA 2OJZH 4M03A 3RZCC 4H1LG 4BFIA 1HXMA 2EKSB 5DQDH 4OFVA 3PGDA 4PJEF 4LLDB 1MCPL 2Z8RA 4OD1L 4DCQB 4NQUA 4JGUA 2XWBA 3C5ZD 5IVOA 4UINL 2OZ4H 1W72B 1BZ7A 5FKAA 7CGTA 3G5YB 5C0BE 1XGUB 1T7ZA 4Z0XA 4XNXL 1FFOA 3IT8D 3LQZA 1EK3A 1TPXB 2BY3A 4PREB 4M4RA 4N0UE 1O7VA 4PGJA 5DYOB 3F7PC 3FCTB 2WM0A 2ZUWA 4OI7A 4L3EA 2GAZA 4R3SA 1V7NL 3V7AG 4NGHH 5IOPA 5E9DA 3MOQA 3SJVA 1G7MA 4JFXB 4HJJL 4BH7A 4O4YL 3CVIH 1IGCH 2DQHH 3T09A 5I2IB 5EZIL 1YEEL 2BNQD 1G7QA 3IDGA 4LPWA 2LQRA 3KR3L 1L0XA 1PY4A 4D94A 3VXMB 4HUNB 4EI5C 1XIWB 3MLSL 5GRWA 2HH0H 5IK3B 1BGXL 2YPKB 2ZCHL 5FYJE 1H8OA 2DKSA 3L5HA 2D9CA 3VXSA 1P84J 1U0QA 2HKFL 4YGVA 3EYFB 4QHNB 5DMJB 4HBCL 1T04A 3IKCB 3T8XA 5GS3A 1D5XB 2WAHA 1G7HA 1KXVC 4JREB 3FAWA 5FDWA 4PGZA 4JJHA 2MNUA 1CFVL 1PG7W 1MCBA 3QEUA 4HC1H 5MEPB 5CP3H 5HI4D 4XP9H 2OJEA 5EBWB 2F5AL 5SWQB 1JTPA 4UUJA 4AIZA 3SDDB 4U0RB 2WZPD 2XZAL 5HYQA 3S35H 2QQNH 1J05A 1R3HB 2OX5A 3UDWA 1DVFD 5D2LA 2CLVB 3QCVH 1KELH 3CVHH 2VLMD 4LF3B 4HXAH 4OLWH 4IIQB 4P59L 4H1LH 1ZGLM 3BISA 5DWUH 5DT1H 4M61A 2A6JB 2NY5L 1MY7A 1F4WH 1SVCP 1QFUH 2YMXL 1HXYB 5FCSH 3MNWA 4C54A 3RWFB 3V7AE 1QVOB 1AXSA 5IMKA 5TE7H 1BVLA 5FUOH 3WS6A 3UTSD 3IDYB 1MCNA 1AKJA 2G60L 3EJYD 1JRHH 3FB6A 1N3NA 4LCYA 4RFEA 4Z6AT 1DN0B 3Q48A 3QDHA 3DUSB 3MV8B 4H0HB 3RWIB 3NFNB 3D3VA 1GGIL 2NNAA 1O0VA 4LSTL 3PABB 5LGHL 4CUCA 2BVQA 5EORH 3BN9D 3JWDC 4KKCD 2D7QA 1JGLH 4PYGA 1WBZB 3RJDA 4RGMC 1ACYL 1FZJB 3ARQA 4WU7A 2BNQE 3G6AA 4ZMAT 4PLOB 3L6FB 2DQCL 4WFGD 1VCAA 3BXNB 1HHHB 5DJYB 1FFPA 2D7TL 5GS0C 1NPUA 4XNMB 3K2UH 1LGVA 2ED7A 4AEEA 4AYFA 5IB2A 4YHKL 1FL5B 4XTRD 1J1XH 4R26L 1ZGLP 3HE7A 4CVWA 4U1GB 2ADJB 3IKKA 4QRPA 2PYFA 1I8IA 1S7TB 2BNQB 3GSXB 3KVQA 4P9MH 2CGRH 1ZT7A 2VDRH 3TYFA 4DJMA 1YYMH 4FQIL 3BO8A 3HRPA 3G04B 2E9JA 3AVEA 3BGFC 4KK6D 4LMQI 5IROC 1MAJA 3UAJC 5JO5B 2BX5A 4W4OC 1T3FA 1VGEH 4F9PC 4S2SB 4Z77A 2ZPKH 4KZEL 3T0VA 1KTDA 4OFIA 1T20B 5EZLA 1FC2D 3DMMD 3P4OA 4P2RD 5DLML 3MRHB 5CGYD 5GISH 2VLME 1S9WB 3DO3A 3ULVL 5FGSA 3KS0J 3MCKB 4L4TB 5FOBB 4BQ6A 5IMLA 3VXOA 1Z9MA 1KB5H 4H88H 1I8MA 4PJ7B 1C8PA 1WTLA 5C70A 2OL3A 3LEYL 3ZL4H 3I9GH 1W8NA 1NCAH 1I4FB 2FX9H 3CSYA 2D7NA 3M1BB 1LDPL 1UB6B 5DD1L 5CSBA 3DV4A 3DSFL 1R24A 4ONGL 3W9EB 3KXFE 4RFOH 3PWPA 4F33B 3O3DB 3IDIA 3UTSE 4YBHA 1XR8B 4QXWA 4R90H 4RAUA 1OPGH 5HYJB 5JMRA 4GAGH 5H37G 3DTXA 2E6PA 5E2WH 3R06B 1CI5A 2VDLH 2AEWA 1D9KC 4PB0L 4F2MA 1Q9WA 3ZKQD 2IQAA 4AT6B 3P9MA 1E28A 4HIHB 2PYED 2VDPL 3S5LA 1KCLA 4LSRL 4GMTH 2P47B 3QUYD 4Z7WF 2OLDA 1QQDB 3KXFB 3MV7B 4XVSL 5EA0H 3UYRL 4QRRB 1M4KA 4M5ZL 4R4BA 1YYLL 3CFDB 3FZUD 1TVBA 3MRRA 5D7IB 4NN5B 3L3DB 1ZA3A 4YR6B 1F90H 3JTTB 1CZ8H 4OLEA 3QIWD 3LKOB 4EOWL 4WFGE 2ICES 2GIYA 5GJTL 1XGTB 4XPBL 1XGRB 1U41A 3LS5H 2IPUG 4LHUD 4PY7B 4DEPB 1N4XH 3TT3H 3ILPA 1T0NB 2BSRB 5I8CA 4KJPD 1FYTA 5I17A 3VGHA 1OARH 4LPVA 4HSQA 5JOPD 4Y4FA 4I4WB 4K3DL 1P7HL