1NF2A

X-ray crystal structure of tm0651 from thermotoga maritima
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
267
Chain Sequence
b'MYRVFVFDLDGTLLNDNLEISEKDRRNIEKLSRKCYVVFASGRMLVSTLNVEKKYFKRTFPTIAYNGAIVYLPEEGVILNEKIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELKEILSERFKDVVKVFKSFPTYLEIVPKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVAMENAIEKVKEASDIVTLTNNDSGVSYVLERISTDCLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phosphatase
publication title Crystal structure of a phosphatase with a unique substrate binding domain from Thermotoga maritima
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics/unknown function
total genus 89
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 1nf2A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1nf2A01
3E84A 4XPZA 4UMFA 3DDHA 4Y2SA 4BBJA 2C4NA 2JAUA 3K1ZA 2GFHA 4UAUA 1Z4JA 4ZEXA 1AQ6A 2I6XA 1NF2A 1TJ4A 4UASA 4UMVA 2DQSA 1Z4NA 2IOHA 5AW1A 4L6CA 4KN8A 5AVUA 3N5KA 1X42A 3E81A 4UMDA 2FI1A 4EX7A 2AH5A 3ZU6A 3ZUPA 5AW8A 3P96A 2R8YA 3UMCA 4BX0A 3PDWA 3N07A 4J2TA 5AW2A 4BX3A 3ET4A 2GHTA 3FZQA 2I33A 3U19A 1SWWA 1L6RA 4YGYA 1QQ6A 1RC8A 1RDFA 4Y2JA 3FPBA 4HAIA 3EF0A 4HGRA 5ALGA 4Y2PA 2GO7A 3DAOA 3AR7A 4PNHA 3L8FA 3I28A 1RLMA 1RRCA 2FDRA 2CFRA 2NO5A 3WKEA 2HEGA 1XVIA 3KBBA 3BWVA 4C4SA 2YJ4A 3QLEA 5AW7A 5AW3A 2YJ6A 3IB6A 5FP0A 4UU0A 1S8OA 2CN1A 2FUCA 2B8JA 3D6JA 1RMQA 3NUQA 5ALWA 2PQ0A 1Z4QA 2GMWA 3ZI4A 1KYTA 5AI9A 1K1EA 2B30A 4F71A 1T5TA 3L7YA 3B8EA 2P69A 3J7TA 4BNDA 2FUEA 5AKYA 1FEZA 3UMBA 3MN1A 3SKYA 2MSNA 4BKMA 2G07A 4GXTA 4EELA 2G09A 1QH9A 2X4DA 5ALIA 4EENA 3WK4A 1Z4MA 2B1RA 2P27A 1WPGA 3ESRA 2HI0A 5AK6A 5AKHA 3W5AA 1LVHA 4KX5A 2IOFA 1QQ7A 3SF0A 1VFPA 5AVTA 4NABA 4OCZA 4HYTA 4Y2YA 2PKEA 1XPJA 2HX1A 2AMYA 5A3QA 2HOQA 4O8CA 2YMMA 4KYTA 2Q5EA 5AHXA 4YCLA 3I6BA 4Y2VA 1CR6A 1ZRNA 2EATA 4JB3A 3IJ5A 3OCWA 1ZD3A 3MPOA 2HF7A 2WHEA 4HGNA 2FEAA 2OYCA 1TE2A 1U2SA 4ZEVA 4NWIA 3PCTA 3A1CA 1ZRMA 4KX3A 1YMQA 1ZD5A 2IYEA 4I9FA 3ET5A 4OHFA 4OD0A 3I1YA 1L8OA 3U7GA 1Z4IA 1Y8AA 2IA5A 3L8GA 5AK5A 1RLTA 1O03A 3OPXA 5AIAA 5IS2A 2OM6A 4RETA 2YJ3A 1U02A 3CNHA 4Y2RA 5ALOA 5AW5A 4MWOA 1RKQA 4YCNA 5ALTA 2I7DA 2I54A 3NRJA 3RFUA 5AVWA 3E58A 2P9JA 2I34A 3AR8A 4H1WA 2WF8A 3M9LA 1L7PA 3W5CA 4XQ0A 5AK4A 3MC1A 2ZG6A 1Z88A 4GIBA 3U7EB 5AW6A 3ZVNA 4UM5A 3FPSA 1IWOA 3S6JA 1L7OA 4FE3A 5AKGA 2OBBA 1YS9A 3AR2A 4RESA 4Y2XA 5ALPA 2NO4A 2Q4RA 4NFLA 2C88A 4FYPA 3FVVA 3SD7A 4YH1A 4Y2UA 5IT4A 2R8ZA 3I76A 2CFSA 3ZW7A 1VJRA 3QU4A 2B1QA 5AKZA 4DFDA 4UAVA 3KD3A 3QU2A 5ALZA 4BX2A 5ALYA 3FM9A 5ALDA 4YIKA 2ZBGA 4MUMA 3SHQA 4EZEA 3L0BA 3E8MA 5AI4A 4UM7A 5AKEA 1Z4LA 3OCVA 3R9KA 2YJ5A 3N28A 5AW0A 2BDEA 4AS2A 2MU1A 1NRWA 3SMVA 2HF2A 4IG4A 4BYGA 3L8HA 1Q91A 2ODAA 3AR9A 2YY6A 3U7FB 1TA0A 1MH9A 1Z4PX 2YFYA 2YMLA 1PW5A 3QUTA 5ALFA 2Q4TA 2BY4A 2FPWA 3OCUA 1QYIA 3WGUA 1Z4KA 2EAUA 2NYVA 2GHQA 4EEKA 5AI5A 3MMZA 2G0AA 3RF6A 3DV9A 3ONNA 4JDPA 3WKDA 2RARA 4Y2QA 3WK6A 3WGVA 4IFTA 3L0YA 4CE6A 5IT0A 2ZXEA 5AICA 5AVRA 2B82A 2JAOA 1YJ5A 5E0OA 2B8EA 2VKQA 1YV9A 3QU9A 2B0CA 2ZBFA 4J03A 3KOOA 4I9GA 1NNLA 2HSZA 1RKVA 2I55A 4NAVA 2WFAA 5ALUA 2G06A 1TJ5A 2WF7A 2AUTA 5AI0A 3N8GA 3L0CA 3PGLA 3ZVLA 3FGOA 1Z4OA 5AW9A 3F9RA 5AIBA 3GYGA 3NIWA 3AR3A 4KNWA 2C8LA 2FPUA 1TJ3A 2WF5A 5AI6A 5AVZA 1L8LA 3AR4A 4KNVA 1XP5A 3A3YA 5AKLA 3QX7A 5AVVA 1J8DA 3R4CA 3ZVMA 2WM8A 4BNDB 5AVYA 3L8EA 5AKIA 1ZD2P 5AVQA 5AESA 5AM0A 4ZEWA 1RQNA 2JGAA 1J97A 1S2OA 2HCFA 3L5KA 5AW4A 3IRUA 4DWOA 2W11A 2YMQA 3U13A 1SWVA 3AR5A 5AKJA 3WKAA 2YMPA 3NANA 5A3RA 3NASA 4F72A 3UMGA 4CF3A 1U7PA 2PR7A 2G08A 2OA0A 4CF4A 2P11A 3NAMA 5AKKA 1RKUA 1U7OA 3QNMA 3QGMA 3DNPA 4NV0A 3ZWDA 3WK9A 2RB5A 2QLTA 1JUDA 3R09A 3ESQA 3KZXA 3A1DA 5AM4A 3ZX5A 2HO4A 1WZCA 2AGVA 4Y3UA 1ZJJA 4CNQA 4YCMA 3EPRA 1RPZA 4FFDA 5ALLA 2W43A 3UM9A 4UMEA 5ALVA 3BA6A 3TLMA 4AS3A 3W5BA 3NALA 2HDOA 2JARA 4HGOA 3WKCA 2QYHA 3L1UA 3AR6A 5AVXA 3QU5A 3OTQA 3ZX4A 1F5SA 2ZBEA 3WKBA 3U26A 1N8NA 5A3SA 3QUCA 3QUBA 2W4MA 5AVSA 2EARA 4QQFA 5AI8A 4HGPA 2C8KA 2FPRA 2IOFK 3ED5A 1T9ZA 3KDPA 5ALHA 4AP9A 4EX6A 3PGVA 5ALXA 1SU4A 3QXGA 1RMYA 5AM3A 2YN4A 3EF1A 1O08A 5AM5A 1RLOA 3EWIA 2G80A 3B9BA 4L57A 2C9MA 3OCYA 4Y2TA 2BDUA 2R8XA 3ZWKA 4DW8A 4G63A 4UU1A 5ALEA 3CZ4A 4YIHA 3OCZA 3HLTA 4OFZA 2RBKA 5ALJA 4XE5A 5ALRA 1U2TA 4UATA 2D2VA 3WK5A 3WK7A 1EK1A 1L7NA 5AKXA 3KC2A 1YNSA 1VJ5A 4UARA 3SKXA 1RQLA 4UW9A 2CFTA 2R8EA 4E88A 4L6AA 5AM2A 1Z5GA 4QJBA 1ZS9A 2FPSA 3L1VA 1LTQA 4G9BA 4XOUA 2G1AA 1QQ5A 1T5SA 2WF9A 4CF5A 3W5DA 2ZBDA 4HGQA 2JAWA 2YBDA 3ZTWA 1Q92A 1WR8A 5ALNA 2ZOSA 4BEVA 5JJBA 2O9JA 5T41A 3VAYA 1N9KA 3SLRA 3M1YA 3QU7A 5ALMA 1WVIA 1CQZA 3HYCA 3QUQA 2WF6A 3N1UA 4B6JA 1L7MA 2FPXA 4C4RA 5ALKA 1ZD4A 5AM1A 4BEWA 2RAVA 3U7HB 1RMTA 5ALQA 3OCXA 1ZOLA 4C4TA 4DCCA 1EK2A 3QYPA 1Z5UA 3B9RA 2HHLA 5AK3A 3WK8A 3ZTYA 1YDFA 2O2XA 5ALSA 3A1EA
chains in the Genus database with same CATH superfamily
5JJIA 4LTNA 4X1IA 4E15A 1KQNA 3LX8A 5A5VA 3HABA 5HPYB 2E1RA 3K1ZA 3TKLA 2DVMA 4CG0A 1FDIA 4MAFA 4YT2A 2OXCA 1KIAA 4YHHB 1FDVA 2FR1A 2ORYA 2Q4EA 3HRKA 2I6XA 1NSYA 2F3UA 3SBXA 2IP1A 3WAKA 4UMVA 2B20A 5AJWA 2DR3A 1AUPA 4BUCA 3OC0A 4OGFA 4RVDA 3ROKA 5JEDA 2DQSA 1US8A 3GGCA 2IOHA 2D1FA 2DLDA 5C37A 4QZVA 1CJUC 5I7SA 4CKWA 4YV7A 4OVKA 3VZSA 1USUA 3LF2A 2ZU6A 3LXRA 3IUEA 3ZU6A 3EPPA 5TRTA 4QASA 3L6DA 4DVGA 3KLBA 1A8PA 3GGDA 5EGSA 3EPKA 4Q4AA 2AK2A 2E4XA 4LF7B 1I0IA 4PSKA 4RW0A 2ATVA 2X7HA 8OHMA 1M8KA 2CYAA 1GTL1 2WFMA 2Y9MB 3PWTA 3Q7IA 3R5KA 4M0LA 1IBLB 2WIKA 1AD2A 2I2CA 3GGPA 4KXVA 1CX9B 1GTJ1 3IKVA 3V34A 4FOLA 1CR0A 2WAOA 1ANKA 5F5XA 1IVSA 2EFGA 2CXRA 3CVXA 4MKGA 3VFDA 5ADWA 1IJEA 1G20E 3K6KA 3HN2A 2OO7A 4TYNA 4LOLA 4ARBA 5LIRA 4NJOA 3KBBA 3IBCA 3RSFA 3RUFA 2JLCA 3EK2A 3SEAA 3W2GA 4EVIA 2P30A 3ELDA 1UK7A 3QP9A 4MUIA 5FTWA 5HJ5A 5HMMA 2YDYA 1Z3CA 3VRHA 2QTVA 1IEWA 4Z0PA 2ERXA 1JGTA 5TR9A 4KI0A 5EKXA 1I3MA 2YXEA 4LTMA 4LYDA 3HVIA 2I4OA 4G5SA 1H8EA 2Q5JA 4PXAA 1XYYA 2CF5A 4PG6A 1WHTB 2PQMA 2B30A 4CTKA 4JI8B 1YZUA 2P67A 1TTPB 2BF4A 3R5TA 2ZI9A 4WKNA 3TS1A 3WOHA 4C07A 1LNQA 4B4UA 3WL5A 2WWFA 2ZJ7A 2GGSA 3HBJA 3ZCPA 3P32A 3KAKA 1XDUA 2JLBA 3MN1A 4D3XA 2CVHA 1XEXB 4IIDA 4UU7A 3FNBA 3OKFA 4KO2S 3ADPA 4IDQA 4F2PA 4XQCA 4JQCA 1YZHA 1WPGA 2H4FA 2XRZA 1YVUA 2UVPA 4M8NE 4UNPA 5AK6A 4F9EA 4MPRA 4W5NA 1ZD9A 1XQ6A 3DMYA 4NENB 5FCDA 4R54A 1KMNA 4KPFC 1TX4B 3VO1A 2FPIB 2F9MA 2V6IA 3E70C 1M0SA 1MOQA 5BVGB 1VE9A 2EXXA 2XW6A 2ZZKA 4BLPA 4UTOA 5J23A 4KTTE 1BXRB 4JR2A 3FVQA 3ZV6A 4K9OA 2LIVA 2IYVA 2VSQA 2QM0A 2XB9A 3CUTA 3ZWAA 1L4MA 5BSKA 5JS1A 3A9CA 1SKBA 2XUOA 2MDTA 3R4VA 3OCWA 1DAPA 4PLFA 1CEXA 3WWOA 3EX7C 1HX7A 5DM4A 1DUIA 1VMEA 1ZGBA 1WUYA 1I1HA 3OA2A 4UNNA 4HGNA 4WERA 2JIOA 1G2OA 1SK8A 4NY1A 4DLTA 3Q9LA 1HV8A 3UKDA 4BC0A 3L0PA 1YMUA 4I1VA 2WIJA 3ZGOA 3W3AD 4LEIA 1BXZA 1DEXA 3T4XA 2HSEA 4HSEA 1Z8FA 1NBWB 4LDQA 1XAIA 2HJWA 1AB5A 3ZZMA 1KEWA 5FHRA 5HGJA 3ILYA 4G9EA 3VC3A 3A6GA 1W1UA 3K9BA 4LFCB 1GEEA 4OJMX 1B74A 4R81A 1DEKA 2BTQB 3A6ZA 2XJ4A 1R4MA 3JPYA 1LNSA 3LECA 5JC1A 4TKVB 2OM6A 2YJ3A 5I9SA 2WJIA 2JJ2D 2WVGA 4F1WA 2LWIA 4XD7D 3U40A 4B0PA 2HCJB 4OH7A 1XNJA 5LYJB 4PICA 4JVMA 3TNYA 1ZINA 2OENG 3MRTA 5G0UA 3RT1A 1I80A 2H0RA 2BUAA 4MVJI 1IN8A 4LV6A 3MG9A 4MTCA 5EERA 3QXSA 1ORRA 3KFLA 1PG5A 3OPQA 4U2CA 1FX1A 4TLEA 2CVFA 3WMRA 1DC6A 3M4NA 4YRCA 2Q3BA 4MEJA 5ETJA 1Z0JA 1ML3A 4KACA 3NBUA 5DYNA 5EJ2A 4P7KA 4I4IA 4HDAA 4R1MA 5DTIA 3U7EB 4ZYUA 1UMDB 2IPOA 3A05A 3IULA 3B78A 1L4NA 1O0CA 2OCKA 4ZYVA 4ZAYA 3UAVA 2F3SA 4IJUA 2XUHA 3HDGA 4OH1A 4X9XA 4CQMB 1JP7A 2CD7A 4Y2XA 1WBDA 1OCEA 2BP7B 2Y2UA 3L6RA 2ZYTX 4FMBB 4LXTA 4M7WA 4RLSA 4RY8A 4UHDA 4CTNA 2GM5A 4B6OA 1V37A 5C8DA 2QG9A 5CA0F 5IM4A 3HNPA 5FR2A 2WA2A 2Z4TA 5CFPA 4X94A 2Q4BA 1SO8A 1TU4A 2O2SA 1FU7A 2OY0A 3CR8A 3QU4A 4I2NA 5B2ZA 3E4CA 3B53X 4L5JA 5EWLB 4P92A 3UUEA 2O3RA 1VKZA 3INGA 4EO9A 2H1IA 5ISMA 5FLXA 4KCGA 5BNZA 3MOGA 1HYGA 1CUGA 5IJ9B 4C01A 1CY7A 4J0KA 3VSEA 1FLVA 3TRFA 5KX5A 3ADKA 2GPJA 2JIPA 1B7GO 4KLZA 3LM8A 1R5BA 4MUMA 3C43A 4II7A 3IP9A 3IBSA 1KO1A 3HFRA 3QBJA 1LW7A 2BFMA 3A14A 4FFBB 2Y77A 5F4ZA 3IPAA 4IX1A 2XBUA 3U81A 3TIVA 4BVAA 2QTRA 2E0IA 1X13A 3N28A 3G6WA 2HN9A 2YZ7A 2SKEA 3QPAA 4S12A 1KO7A 3O31A 3RSOA 4WCFC 4P98A 1Y3HA 3SBDA 4KH1A 3RWBA 4F4UA 3K30A 3OT1B 5C8YB 1GPKA 3ZH9B 1Z4PX 2IXGA 4W9RA 3UUGA 2ATEA 2E85A 2LRHA 2H4HA 4XWWA 3RPEA 7ADHA 4ZFNA 3BMNB 3VNBA 4TX1A 2W48A 1X9HA 3AOGA 4W63A 4HPXB 4PYJA 3MUEA 4Z49A 2ZCVA 1Y63A 3IILA 3JTEA 4MWDA 1FQWA 4JROA 2GEDA 4A8JC 2XVYA 1QV6A 3KSDO 3M5WA 4OGLA 2QJTA 3MOSA 5DHRA 3VUFA 5T5QA 1S7GA 3I1FA 2EWWA 1BN6A 1DZIA 2VJOA 3K72B 4LC9A 3FYCA 1Q21A 3ZOKA 1PS9A 2F7SA 3DAGA 1N6KA 5B3LA 1OX6A 4H1VA 2PLNA 2BE7A 5CM8B 2PAFA 2ZIXB 4YNBA 3Q2IA 2YICA 4Q21A 3BXGA 3T61A 4JOCA 1PQWA 1RLIA 4FFSA 4QL3A 3ZJYA 1KBOA 4TKUA 2JFGA 2TYSB 3E8XA 4CHGA 4D5GA 1KZGB 1AVTA 2HSZA 4B71A 5C9ZA 1A88A 2FMIA 3NVMB 2P40A 3LNTA 2PLAA 1KYYA 3NHWA 1O95D 2ZJFA 3OF2A 4RK0A 1YB2A 3WBKA 3WXBA 1DQPA 4IV8A 5FUQA 3BMQB 4OU5A 5DLEA 1LQUA 1PR5A 2JGNA 1JF8A 4NFSA 5K4GA 1LVUA 2JGJA 4KGVA 4FDUA 5IMSA 1G59A 1IEQA 5AI0A 1BE1A 1KOJA 2FX5A 2IDKA 4RMHA 2ZI6A 1JQEA 2CDCA 1JYFA 4ZTUB 4HG2A 3VR5A 1J2YA 3E9RA 2GPNA 1JIQA 4NR0A 1OILA 4BRSA 2HMWA 2DUUA 5AIBA 1HPLA 1FSSA 4LDZA 3JAKB 3F6CA 3LHSA 4ER0A 3CJRA 3MD9A 1M2NA 2YASA 3KE9A 2JFBA 1M74A 3QVLA 2G1JA 1F8FA 2W37A 1OLUA 3MCZA 4UHEA 1KKLA 5JNUA 3VPGA 5FAKA 4HTAA 3OUUA 4CMIB 2VHXA 3KUCA 4KNVA 2FSSA 3UXMA 1ZL2A 4ZTZB 3LVBA 2C2GA 3N3BC 1ACLA 5MFPA 1XQYA 4H3VA 2CD9A 4FEYA 3V7WA 4EF5A 4XJSA 1FS4A 3W5IA 3JTMA 4H7HA 2QM7A 4J0GA 3JWPA 4HPJB 4KHZA 3AUUA 5ITSA 5JAIA 4KXXA 3A8TA 3MCUA 5AM0A 4HH3C 5H3HA 4E51A 1NNSA 1T26A 4IXMA 4OLFA 4PPFA 4UUAA 4PX5A 3UHAA 5IUNC 1EB9A 5LR6A 3LSYA 1OB5A 1IFXA 4HDCA 5IUJC 1MX1A 1YVPA 3CRQA 2HA3A 2WIBA 1YZKA 4Q9KA 2FR0A 2XMQA 3T5BA 4MGYR 5CVJA 3TZQA 1PBNA 1JJ7A 2H3HA 3IDZA 4MJLA 1NLFA 5FR1A 1X7DA 5L7WA 5LMZA 3CEMA 3UH0A 3GLHB 4QXOA 4RM3A 4W4TA 3R1IA 1AKRA 2FSVC 4G8CA 1HKUA 3LO5A 5LB2A 4US1R 2PUTA 3KT3A 1E7YA 4WASA 1E3QA 2WWIA 3EZ7A 4MV0A 3AH8A 1FMTA 3QELB 4GG1A 4RKEA 4NCIA 3PXGA 1QFJA 1M1YA 3EVTA 4CLRA 3SC4A 1SOAA 2QRKA 1NQUA 1P7PA 2A7QA 3FCEA 5H7XA 4WBNA 3W8FA 1VHDA 1GTG1 1LPBB 4D80A 5B4TA 1UBJS 1SU6A 3U7QA 3RVKA 2Y0CA 7GPBA 4KIGA 1T9GR 3QQPA 1ZUNA 4HWPA 2WABA 3UJ6A 1ZJJA 4WZ6A 3ZE9A 4BPRA 2YZ2A 1G9SA 4LVNA 1TXGA 1EWKA 1NY6A 1LWOA 2FU5C 1V3VA 2IEAA 2ZJZA 1SUSA 2I0FA 3KCQA 3GRRA 2W6ZA 3KD2A 3PJGA 4UJ3A 3TK1A 1S4MA 4HGOA 4PO3X 5E2AA 1Z0AA 1E4EB 4KQXA 3Q2OA 3BK1A 3QU5A 3ZX4A 1FP4A 3WMFA 2QA5A 2OLKA 2PZLA 1IHDA 2E48A 3SU8A 2CLCX 2V96A 1LLUA 4TV8F 4ZN6A 4TL8A 1XLUA 1YBAA 4E5VA 5FX2A 3A4YA 1EVLA 4DSUA 1RT9A 3CKMA 3NATA 4N3BA 4ZJPA 4TS1A 3SBOA 5BY2A 1KDPA 3N8KA 3EXHB 2VZ9A 4QBTA 3R7LA 5HQ3B 1H2XA 3DQQA 1ND6A 4M9RA 4E2XA 1P9RA 1T0JB 4MR7A 1HNNA 1T9ZA 4RCVA 5BSMA 5IXSA 4URXR 3W9UA 4DMFA 5BNWA 1YD7A 1RXCA 1CRPA 221PA 1FYWA 4EDFA 4FT2A 1JAYA 2YN4A 3B1FA 3L4EA 4TS4A 1UPBA 3ES9A 1BZYA 1JPUA 2FHSA 3GYBA 3QVSA 4HT3B 5BN5A 1H3FA 3VHXB 5LMNB 2O1SA 1BMFD 1BWSA 3BRCA 3LFHA 1K92A 4K03A 4LV5B 2ODNA 1NQXA 3B9BA 1V1JA 5A9TA 4Y2HA 4Q18A 2PG3A 4WZBB 1B0UA 4A6EA 4MR8A 1PD1A 2JHFA 2R5WA 1VRCA 2QRQA 2ID9A 1VKHA 4Y6SA 1R4NA 4BVEA 5JFOA 2ESRA 2IW3A 3EZFA 3I2HA 1ZN7A 4Q7EA 1EMDA 4EHNA 4ENQA 2WB2A 1XRPA 4OFZA 1E69A 3M34A 1RWWA 3TTSA 1R0YA 2WSBA 4ZT4A 4ENUA 1GCOA 1XMSA 2VHJA 4GP9A 3EHDA 3SYTA 1WDMA 4UBIA 3RFTA 4JC0A 2EKPA 2WNHA 2I7VA 3L05A 4HNSA 2ZTSA 3PFGA 5CG1A 5K1ZA 2NUTB 1W4ZA 1HWYA 1D2MA 1H66A 2J0EA 3IAM1 1ZRSA 3LFUA 2J9YB 3MF4A 3QITA 3SSNA 4YRAA 2IT1A 2CL0X 1U5BB 4KDEA 2HPZA 2A2ZA 2I2FA 3S2GA 3VYVA 1HQKA 1QQ5A 3E9EA 3PQ2A 2P35A 1NG1A 3C74A 3U4HA 3IIEA 2GBPA 5EJEA 2I5PO 2WVHA 3TPZA 4HGQA 3MINB 5CXUA 3FCYA 4ZO8A 3W78A 3THSA 1R8XA 1T9DA 5K05A 4TUYB 2I4TA 3GLRA 4PX2A 5JJBA 4Q9NA 1OLXB 2VOEA 1PJTA 2ZPTX 2GAOA 2FRDC 3HSYA 1JDVA 1KETA 1MJHA 1X19A 2GTIA 4PGFA 1TM3E 2YNMC 1MABB 1I6MA 5DP2A 3IO3A 3S4YA 4C4RA 4IGIA 3FWHA 3FZEA 2Z9DA 2C82A 3FDZB 4WA7A 16PKA 1BVHA 5PGMA 1H9AA 2ZTLA 5GMOA 5LQUA 1EHCA 1TVKB 1QFMA 1KYIA 2GCNA 3FJOA 4IG9A 5A7FA 1KEUA 3CRZA 1GDDA 3DL2A 2DQYA 2A5DA 3MNFA 3IAS1 1R0XA 3CH4B 4RNCA 1N4DA 4N7RA 2XB8A 4AO7A 2NP6A 2P5SA 1CUVA 4GMKA 3NIGB 5LZ9A 1EU1A 1FNMA 1VJCA 4HBZA 3GFQA 1GFZA 1MVOA 4FINA 3RRZA 1R00A 4PCVA 1DXOA 2N1BA 2GR9A 4O4IA 4CUKA 2D5BA 4JBYA 3IAAA 3ZN2A 1KA9H 1C7FA 5FLEX 1CF4A 1VDZA 1N2IA 1V6SA 1L4YA 1CRWG 2BCJQ 1KI1A 4FZJA 4L9AA 4XPZA 4P7GA 2WT9A 3AFMA 3DDHA 3O4IA 3QE0A 5LL6P 1EGVB 4LGVA 1TLFA 3BSFA 3EIXA 1JWAB 1WUJS 2UYOA 1N5MA 2IX9A 2VBIA 1NVBA 3HCAA 1ZJ6A 4J1SA 4MINA 4MQUA 4NQZA 1Y5IA 4EVQA 4DDVA 2PFKA 2UU9B 2QZ4A 1IOWA 1KSJA 5BR4A 1HMPA 1QX4A 3TXAA 3TVDA 1K0UA 1T13A 2BZSA 2IZ1A 3IQFA 1W4LA 4IICA 2OFWA 4PHTA 1OX4A 4L6CA 1JW9B 1YT5A 3N5KA 5GONB 1ISJA 4UUOA 5G0WA 4ZHQF 1V25A 2PPVA 3F5QA 5D7NA 4YS6A 4DB4A 1PS8A 5A5FA 4ZXPA 1DAOA 1ZGGA 2CBZA 1MGOA 1WA5A 3P96A 4LJRA 3TTXA 4BX0A 2HLHA 3L0OA 4EPWA 2RAPA 4TRNA 3H9GA 4BL5A 5JT1A 3WWPA 5CXXA 1HRDA 5KCMA 2ANBA 3WG9A 4G0NA 1CV2A 3U3XA 4CMJA 5BMVA 3S1AB 4RK1A 1XKQA 4AZ0A 4E6PA 1I7QB 1L6RA 4Y9UA 4YGYA 5E38A 2ERYA 4IMRA 2VNSA 2BOVA 4M86A 4BLWA 1B8OA 1IJKA 1Q0UA 4JSTA 2NNWB 4A1OA 4DYHA 4PIMA 4A6DA 1L7BA 3PNBA 4D79A 2UXDB 5ILQA 3BL5A 5ERYA 3LZ6A 3KEOA 5DOVA 5CFNA 2GRAA 4FW9A 2NG1A 2QTTA 2B1JA 4FFMA 3AL2A 1NKSA 5HNKA 1JQJC 1OZFA 5ES3A 5FP0A 1K7SN 5HZMA 1EXMA 2CN1A 5ER9A 3O2NA 2BR4A 3LA8A 4ZQHA 4QHTA 2EJBA 2ZJ2A 5TQVA 4MUFA 1VBMA 5J9FA 3OETA 4KMSA 3RRYA 1T9BA 5AI9A 3GNQA 3WJAA 3FOAA 4JSRA 4ZO4A 1AKMA 2W2KA 3L7YA 2OXIA 2XT9A 2XCRB 3PGXA 4OJKA 4GGPA 1UP7A 4PQFA 3ZCXA 3D8SA 2CLIB 3E1GA 3QIVA 3AZQA 2RGXA 4RH1A 1EWQA 1SXQA 1AQIA 1UF9A 2WT4A 5H83A 2WV7A 2QF7A 3VPAA 2I6QA 4EARA 3OZSA 1T9HA 4P0PB 4HRVA 3QPBA 2NTEA 1KKMA 3C5CA 1AX9A 2C07A 1CE8A 4RHTA 4AF7A 3PPYA 1AA9A 4RDCA 1ENZA 4KX5A 3IHKA 5K6TA 3T5CA 1CZHA 2JGKA 4QT4A 4EW1A 3H65A 1QGUA 3SF0A 3VU8A 2HY7A 1VFPA 1GKLA 1ZIDA 3KQTA 5AVTA 3EUFA 2QUZA 4E4RA 3SEFA 1QCCA 1TCUA 2E4AA 1Z2OX 3EFOB 3MWGA 3UBMA 2H7XA 3OZDA 1UBTS 3ORQA 2JLVA 2H08A 3GRUA 5L7TA 5KBYA 1ULHA 2GYYA 3KQUA 3UFBA 4YDQA 3F6RA 4LXYA 4M6WA 4KYTA 4N9WA 2AN1A 5ANRB 4Y2VA 1HE3A 2A4KA 1V48A 3GBPA 1NVKA 3L0IB 3WY9A 2QXTA 1UBNA 5FL3A 5EGNA 4RO0A 1K7CA 1YR1A 2ISSD 2ZUDA 2HV9A 3AINA 5BUCA 5EJFA 3GP8A 4JBIA 5LWQA 1QM5A 4KG7A 4DBZA 3GLGA 5EE1A 2I8CA 2A5JA 4MV6A 3WNQA 4AG6A 4LHVA 4EYGA 4F92B 3EA4A 4L3VA 1S9HA 2FWAA 3GL9A 1NAIA 2AN9A 3CUSA 4X00A 4GM1A 3RAFC 3U7GA 2CV0A 3NEYA 4WN9A 2C4TA 1Z25A 3LQ1A 3ZR4B 1XNHA 1QE0A 2CLLB 1UL1X 4G4JA 4AJOA 2RGWA 2XGSA 1WDTA 3WQRA 3ICPA 2AMLA 5E3JA 3UMFA 3L7BA 3ULKA 4CCSA 4DIEA 3UAOA 5JAMA 1G9TA 4O2AA 4Y1FA 3TQOA 4MUXA 1WNTA 2IZ5A 3TM5A 4FNMA 3VH2A 1JEYA 4KYVA 1NR5A 1C3XA 3ZBTA 3KHTA 4FSXA 4BZQA 2R6FA 2RI6A 4YJ3A 4E11A 4QFCA 5H8WA 3UGTA 1JPVA 5B57C 3P9CA 1GY8A 1QANA 4GPEA 4XD2A 1P3Y1 5TQ0A 1ZJ4A 3GJ3A 5AW6A 1YBFA 2MMCA 1W85B 3H5WA 4QHSA 4RHEA 4WLUA 2BFFB 3S6JA 3IUBA 2C3YA 4FE3A 4EHDA 1ZM2A 4DUZB 2O1XA 3GDGA 5FOTA 2MIIA 2PXHA 2C0QA 2QEQA 4NYJR 3K3PA 3V6LA 4GI1A 2JA1A 1RJEA 2GB4A 4QECA 1YDMA 4CKBB 2XDQB 1GGHA 4GBMA 5ED4A 2C83A 4UEJA 1A7JA 2CVPA 3HH8A 3R75A 2QD5A 1UJNA 2GPYA 1C7EA 1U9IC 2JGEA 1E59A 1VB3A 2XMZA 2YQ5A 3BC1A 3OHSX 1SIBE 2C78A 3JQFA 1PDVA 4F3TA 2D5AA 4REQA 4TXNA 4YAFA 4OL9A 3ANYB 3PWZA 3ZWQA 3VC2A 4WA8A 4XW2A 2GDZA 1TD9A 1W46A 2YY7A 3RWOA 2AL7A 4QVIA 1W36B 2W6OA 1TEXA 1XNGA 4AJEA 3ZCQA 4M60A 1NXSA 4X84A 2R66A 4IEFB 4TXHA 3DQPA 3QVGB 1M5RA 2QTBA 1QKKA 3C16C 4YIKA 4F7WA 1MFZA 2ZUSA 4ZOLA 4QGGA 2P4QA 4IKOA 2DX7A 1CHDA 4E4YA 4A16A 2HA4A 3AB7A 1SN7A 1EUCA 2XV1A 5EKDA 5K6AA 5AI4A 2Y1WA 3C3DA 1VFNA 1K08A 1EE1A 4JQYA 4BLUA 4Z9AA 1UEIA 3EYAA 5EMKA 4PTLA 2R2AA 1CXZA 3UPDA 2H0AA 5LZ7A 3VYUB 3IE0A 4F11A 3ZKWB 5EJ8A 3QPWA 3IQIX 1YVRA 5JI3E 4X54A 2XTZA 1M9NA 3MAAC 2W70A 4A10A 5HCIA 3LOPA 1DRVA 1XDGA 4NZZA 1RRMA 4K46A 3U7FB 1OXKB 2VCHA 1QRSA 1F06A 3DZKA 4AZWA 2HUNA 4JUCA 2X76A 5JD5A 4C7VA 1J5EB 3T41A 5I7OA 3WLFA 2N9UA 3KKKA 2BY4A 2P4UA 1ABEA 4AQYB 2PS0A 5E1BA 4BTLA 2KLBA 1FTQA 4DHWA 1OBFO 4P5PA 2NUAB 2WU1A 3DZFA 4EG3A 3MS7A 1UWLA 3PS9A 2QDXA 2RGAA 5B7QA 2V1UA 2PS9A 3HBLA 2V0CA 4OB6A 5TT1A 2J6IA 1NBMA 4EUEA 1MORA 3PGA1 4OHCA 1E1YA 5LA6A 5CLFA 1EP1B 3WJ7A 3ZDXB 2HJRA 3FSGA 4LJ7A 3SJZA 4WZAA 3URKA 1M6EX 2OCAA 2XOKD 5AXDA 5IJXA 4B47A 1IG0A 3HM2A 5CA1B 2ZXEA 1U2EA 1GUFA 4CKCA 3CLTD 5FWDA 1OA0A 3RYFA 2MTBA 1V11A 1OWPA 2ZJAA 3WLHA 1HL7A 4BZPA 4C6HA 4ZYLA 3AVWA 1F48A 2H85A 1JHPA 3ACBA 4PAGA 2CV1A 4C78A 3RYIA 2CMHA 4HLUA 3CLUC 1KMHB 3FIUA 4R7GA 2CMGA 1WOYA 2OHIA 3BHNA 2QMHA 2JIZA 1ACJA 1DEAA 1JEJA 1HE5A 1FTWA 5EUBA 1WDKA 3VR4D 2IYLD 4C0BA 2X40A 3EN0A 4B7AA 1MXFA 1GYPA 1XU4A 4EY5A 1QBGA 3ND5A 1QZXA 3I9FA 1WEHA 4RSMA 8LDHA 4DIUA 1SPXA 4EHAA 1QSGA 3JD0A 4Y1EA 4OX9Y 2J3LA 3KJNA 4WQMA 5FPSA 3BRWD 1Q15A 1JBQA 1S6YA 4MDYA 3VMFA 1U2GC 3FB1A 3FGOA 3OMWA 1B6SA 4MGKR 4UXHA 3TF5A 3H1FA 3TJZA 3CJTA 4YP0A 3MILA 1VKJA 4FNOA 1KQ3A 1GZVA 1SU7A 5CAEB 1L1EA 3QKRB 5TMDA 3ZWMA 2GUGA 2YWBA 2FW1A 4YRFA 3RTGA 3JS5A 5F2KA 4LI0A 1PJ3A 4IPTA 4L8LA 1W30A 4U3JB 2QTGA 1CBUA 3BJIC 3QLJA 4YWJA 5I7FA 4LF9B 3PUJA 1QIMA 1VP3A 1X7YB 3PNYA 1WSWA 2ZPUA 4LC1A 5AKLA 1GAWA 4ZQIA 3TRIA 4DA6A 3G9TA 3R40A 1RZ3A 4HNGA 4EITA 5HR5A 1FSFA 3E2PA 1LQ2A 2J7PD 2WOJA 4I4LA 1RC1A 1XLWA 1JHDA 3U4CA 4PFJA 1MNQA 1QCYA 3I5AA 4I9NA 1Y8ZA 2HJVA 1CVLA 2HNBA 3M8KA 4OHRA 2GBLA 3FPLA 5HKBA 3HKBA 2FYTA 1TGYA 2W2MA 3A58B 4S0ZA 4RHFA 1FX0B 3RANA 4UPVA 3WGKA 4D7AA 2AEEA 4B6GA 5GQSA 4V1CA 3JQ8A 4MQEB 2AUMA 4CM8A 5CDFA 3QKSB 5IF9A 1CB0A 3T1HB 1DLJA 1BD3A 2UUOA 3JR3A 3L93A 2E5LB 1RS0A 1OVGA 4A2QA 3PIDA 4BX8A 3AR5A 1BN7A 2PFGA 3WKAA 4BFYA 4JJZA 3NANA 3VO2A 3MTJA 4ARCA 4RA6B 2HT1A 2Y4NA 1YZTA 5JALA 1JR6A 5HM8A 1GPMA 1DV2A 1RXEA 2ZYRA 4U6SA 1GZHB 3U9SA 3QFSA 4EW3A 1JS1X 4YR9A 4H27A 2JBAB 2GXSA 3KQQA 4X20A 3JZFA 2XMGA 5AKKA 2R751 2F43A 3IXLA 1N32B 1QO9A 2J9FB 2HA2A 2Z6VA 4RNDB 2YY5A 2D3TA 5GM1A 2YJNA 3UH1A 3QLUA 2QLTA 1UZMA 1HDIA 2I99A 3R09A 1FUIA 3TXXA 3STYA 1VYTA 5CK4A 1T2EA 2W9XA 3NTRA 4RTKA 4HRAA 3VYWA 3FAKA 5IJ0B 1RWBA 1DOZA 1VE1A 2WFLB 5KYWA 2VHUA 1B8NA 3DE1X 3FNQA 3U4MA 5CFLA 3VR3A 2JARA 2C4MA 2FUG1 3EOBI 3SGLA 3C97A 1BE6A 1MTOA 4XVRA 1EH5A 3AR6A 3GF4A 3K6RA 3OTQA 4R98A 2WT8A 2Y1GA 2G70A 5KIAA 3CW8X 3T9AA 1B0ZA 1XA0A 5A3SA 3ZWNA 1PT5A 2H1RA 4QYIA 5DCUA 4PYNA 4EHHA 5C7OO 1RHKA 1J99A 2DH6A 4YT5A 3CVVA 4AN4A 3TRKA 2QXUA 2NU8A 4A5OA 4AFNA 2B9VA 3GUVA 3RKRA 2NV2B 4LSZA 3BDAA 3KJGA 4X62B 1Q16A 1AU9A 2VZLA 3Q8WA 3QZUA 2ZVPX 3FYDA 4I50B 1N6PA 1IHXA 1S3SA 4RH3A 2FPRA 2J09A 1GUYA 4HLCA 4B3JA 2VEDA 1V41E 3FSEA 3BGIA 2CWWA 3NRCA 1X70A 1Z35A 2ZWOA 5GVRA 3ZH2A 3TLEA 5HBRA 2O50A 2P7HA 2BBTA 2P91A 3OIVA 5C34B 4IUCS 3V7YA 9ATCA 4EYOA 5HZKA 5CTJA 3PVZA 5DN9A 4NCXA 5ARDA 3S2SA 3WL8A 3IODA 4BKOA 2V7GA 4JJ8A 1NQ5A 2X6QA 2YYAA 9LDBA 1J5XA 1RAHA 4MYRA 1YO6A 3K6SA 4Q47A 4TYPA 2IYAA 3MTIA 1EX7A 4ZQEA 5BNFA 4MB2A 4B3TB 2ACEA 1G8FA 1NN3A 1QIKA 2Q5IA 3IMCA 4HLDA 4XE5A 1ECCA 1YQUA 4MIEA 4DUPA 2XMSA 1XRRA 2BI7A 3MWDB 4YMLA 4ZAFA 2JAPA 3OEYA 2W6MA 4ZRDA 3QF4B 3D02A 1QG2A 1OXMA 2H16A 4F12A 3G23A 2PUWA 3GJTA 2CFTA 4NE7A 3D8HA 3MXOA 5G53C 5K8LA 3KJXA 1MQAA 1THMA 1V71A 1KO5A 4C88A 4COOA 1JAHA 1PV1A 2VWGA 3EEIA 3G0OA 4C43A 3NZEA 1LTQA 1XZKA 2OZEA 3QBDA 4GBED 3KHKA 4CDNA 2B1GA 4LDAA 4F4IA 4LXUA 1IPEA 5KNBA 3O1LA 4ZHSA 1GPH1 4CRWB 3DO5A 4IQGA 4L73A 1FLNA 3H9BA 3N75A 1IZ0A 3GLQA 3QEAZ 4D25A 4E5PA 3C8ZA 5HRAA 1MZVA 1ZCFA 2OB1A 5DLQC 2VRBA 4HNVA 1CF9A 5T41A 1T0HB 2BGKA 4NYIR 1SJ9A 3TQIA 5DM60 2B4YA 1BGVA 2B69A 2GA8A 4B4WA 4KR6A 4CN8A 1L7MA 4PQYA 3N59A 4CM4B 4Q6WA 1SKMA 3EFBA 4MS4A 4CIBA 1OH7A 4WKBA 1P9NA 4GQBA 4RK6A 2B34A 1AS0A 2V7XA 3TD9A 4PIVA 1JALA 5ALQA 2GJAA 4MRNA 3EA5A 1OYOA 5K3BA 4R0MA 3BF7A 2BFBA 4LZAA 3TZ6A 4D26A 1WS6A 5JLAA 4DV4B 1IM2A 2ZANA 4RFVA 7REQB 2C54A 2R6R1 4UHHA 2OCLA 2Z3WA 1FTYA 4J0IA 2ZZNA 3C4JA 2H65A 1QHFA 4MRSA 3R9XA 1W5TA 1HR0B 2O1EA 3L84A 4DANA 1UC4B 1EM8B 1RM4A 2Y3IA 2AG1A 1C9JA 4N0QA 2O2XA 2ZUBA 5BQFA 3PRHA 1Q0PA 2D0DA 2W4QA 1YONA 4NJEB 2ZITA 3L8DA 5CA0A 1ZK2A 3TG8A 1X8KA 1C3LA 2G71A 3B9PA 3WGNA 3ZIAD 2XQIA 3I6YA 4DZRA 3KJZA 1RTTA 1V1RA 1XD2A 1QG6A 1UAGA 3C7DB 4H6VA 2VYFA 1LW6E 2HRBA 2BSQA 4BNUA 1O6FA 1AQ6A 5KDDA 1C1HA 3P26A 1AQUA 2P0YA 2KW5A 3L18A 4HYEA 5KPDA 1LZKA 1OWLA 4KBGA 1UBFA 3RT7A 5B1HA 3V8VA 3JRXA 2ENWA 1HC7A 3MIZA 4FEAA 3I9LA 4XIYA 1OFGA 5F1YA 1PGPA 2PJRA 3IC5A 4H4EA 3HVHA 3O21A 3W6PA 1J39A 5I9IA 4BE4A 2I91A 1VYUA 4RZXA 2NU7A 3GLSA 2XRYA 3Q8KA 2UAGA 2Z3ZA 5AUOB 2FCAA 4G0QA 1NL3A 3D4NA 1E2QA 1VHTA 1U3UA 2QVYX 3KEGA 4KAAA 4J2TA 2OM2A 1GLVA 5JHHB 1NI4A 5SYAA 4RHCA 3FZQA 3LNCA 4XVUA 4B7ZA 4KXLA 5JS8A 1LK0A 3GEGA 3ENWA 5DX0A 5FXMA 3GEDA 3FLAA 5FV7A 3GX1A 4F6RA 5E3HA 2XUIA 5IJZA 3PB3A 4LXIA 4LUCA 2PA3A 3X1KA 3T5GA 4QHYA 4TL9A 1JL3A 4PC6A 1RACA 5GTDA 4LYFA 1PR4A 3F96A 2VNIA 4DKXA 2GZDA 2IEDA 3WLMA 1ENPA 1RVV1 3DBLB 3LF1A 3PHIA 5REQB 5EPUA 3PPIA 3GNLA 3VR6H 3VX3A 2JGIA 3SFZA 1I4DD 2PMWB 3AZPA 3FROA 3IT3A 3GLIB 3QW4B 3KQMA 5LUAA 3Q1LA 2A33A 2XITA 1ESNA 2XJ9A 3K4PA 3TQSA 5DJ5A 4EL0A 4M1TA 4B79A 5BV8A 1Z7BA 3FF1A 4LE1A 4R9VA 4HEA1 5JC8A 5K0LA 5CUQA 1KFKB 1FDSA 4YV2A 2VK4A 3TZCA 2YVLA 5TPZD 2PU7A 2PKRA 1ZR2A 1P5RA 1U3VA 4MVJH 4B3IA 4JOBA 1R6DA 2P1RA 1I7NA 2EJCA 3VBEA 2P69A 3RYTC 4US0R 3SE7A 2VDQB 3C1OA 3JVDA 4KQ2A 4CPDA 1PJ2A 2BEUA 4DA4A 2FOXA 5GZ1A 2G07A 4U6NA 4BXOB 1QF9A 4HMOA 1KH1A 3BJRA 4Q16A 5HIMA 2N46A 3RV3A 2C7RA 2QR3A 3UGJA 4MV5A 1US8B 1T4MA 2P27A 2QD2A 3PI6A 1I1NA 1YUNA 2ZIWB 1SC9A 5F7XA 1NMSA 3ESRA 4NG4A 4TV9F 3U4QA 4YP1A 1M2WA 2B4KA 5G02A 4CKWB 4DMLA 1VL6A 2IHKA 3KWFA 2BBSA 4LF6B 2Z83A 3HXMA 3H7IA 1ODLA 3ZHVA 2VHVA 4F7DA 4MW2A 1J2JA 1PV2A 2OP1A 3O90A 6ABPA 3ZDCA 1REQB 2HBYA 4LQLA 4Q7MB 4J49A 3JVIA 2C94A 4ZA2A 4YMGA 1VGRA 3KQKA 4P7FA 1W73A 4CM6A 3I2YX 2YUTA 1RPAA 4A3SA 3DHEA 1FDWA 2IYUA 2OR3A 1II8A 2Q5EA 1WB6A 4R8KA 3R7AA 3D3JA 1BXGA 3BL6A 1ZD3A 1LNZA 1SUEA 5HKOA 2VP5A 1C9MA 3WBJA 1XK6A 2C03A 3D2LA 4EHLA 3HLYA 5SY6A 2VWPA 2A3RA 4EKNB 2P0EA 1EGMB 1ZRMA 4KX3A 3EZXA 4OAQA 4CMEC 3PKIA 2Y93A 3LDUA 4QYSA 4HVLA 5FQNA 1B41A 4XB1A 2YWDA 1QP0A 1L5NA 4GNKA 4Y9RA 5AIAA 5BV0A 3MRXA 3QEOA 1STOA 2PWYA 2QTVB 3BB4A 1QHGA 3CNNA 1OBHA 2Q1SA 4N5NA 3L1HA 4NV1A 4QVKA 1UP4A 3OU6A 2H5LA 2H06A 1PN3A 4WECA 3U48A 3I5YA 1CUWA 2H54A 2Z8ZA 5LCXA 2PZ8A 2ZUCA 3JQPA 4NZMA 3RFUA 5L53A 1YFKA 4L4ZA 1FFSA 1S8NA 4AKEA 1N0HA 2K7ZA 3WADA 4B4DA 2IYTA 3DMTA 1A95A 2XYGA 3SP1A 2XMCA 1V2HE 2ZG6A 3RS5A 4Z4FA 1QHSA 2IY8A 3NHUA 3RVMA 3DKVA 3ZXUB 3IPRA 2V6GA 4XFKA 1OFIA 4MQ6A 4TQAA 4YMTA 1L5MA 1EFRD 2ATCA 2UVPB 2XLBA 3OLVA 4KQ9A 3UHPA 2JHPA 3ZYZA 2FG7C 5EPEA 3EASA 2D62A 3DWGA 3EG9B 2AFHB 3V80A 4AF8A 2ZAOA 3BE5A 2Z6UA 5CX4A 3AJ9A 1E0SA 2CFSA 4FONA 4KUGA 1DKLA 4ARUA 5IZ4A 1R0ZA 1I5EA 1ZYUA 3LCMA 3JQGA 1SKAA 3FTQA 3OX4A 4XWAA 4R9SA 5D3MA 2P2YA 4JUFA 5AXAA 1FTGA 5DB4A 4E3ZA 5HK9A 2LR0A 4NP6A 4F6CA 4BWFB 5EIXA 2HBRA 3R2JA 4B4OA 5TLSA 2JFWA 1M2VB 4IZIA 3C3EA 1DC3A 3HA7A 3K53A 1J9GA 4LF8B 1G20A 2ZBGA 4JJFA 4PHGA 1TL7C 1BYIA 4URZR 1JKFA 1MNAA 1KR2A 4LKOA 4TV8A 1CSEE 4J90A 3STUA 5LM3A 3ER8A 2X8AA 1DIRA 3P9KA 2YJ5A 3R9KA 3IOCA 1T3SA 5EHGA 1L5YA 4O02B 5T6MA 1KRHA 2CC2A 1R4MB 2EFEB 4IO1A 2LCIA 1P7WA 4G2TA 2IFTA 2IV2X 2V0NA 3A9UA 1F60A 2COKA 4X64B 3AF6A 2I2XB 3EEBA 3EC2A 2QPAA 3I9JA 3SMVA 1IWBB 4FZRA 1W4AA 4MUAA 3FGNA 3NM6B 4I4NA 3B7PA 3WHKA 3R74A 1J56A 1S89A 1LPOA 2ACWA 2A9FA 3A6DA 3NIDB 1NE7A 4TQUS 2XUDA 1EVYA 4OJTA 3GJSA 2HEIA 3NS7A 4YCAA 5TGZA 4JOSA 2WYWA 4CIAA 2PUAA 1WMEA 1WVMA 1W4RA 3H2YA 4J16C 5KQRA 3TZKA 1OV6A 1U31A 1V4NA 1ZQ1A 4MUHA 3THOA 4ZAGA 1R8YA 4OKSA 3G0CA 2NYVA 4CLXA 4BQFA 2O8VA 2FR8A 4HFMA 4QWWA 3X44A 1T2DA 3GWZA 3OF3A 4JN6B 1Y33E 4YRNA 3BSSA 1MF7A 3L7IA 1OU4A 3GUYA 1OAOA 1YAHA 2FJPA 5TDHA 3TCXB 1XWWA 2JCYA 1CR4A 4XCVA 3NYWA 5TF0A 4WKPA 3AI7A 1K3FA 5IT0A 4QEDA 1XALA 1NQVA 2YR0A 2HYIC 3PNPA 2D1SA 2GBGA 2HK7A 1I4TD 2Q3HA 1YNOA 3MT9A 4MI3A 1CNEA 1UMCA 4MVJD 5CLGA 3S2YA 1G38A 3G2JA 1SNYA 4F4FA 2PZFA 3HJAA 1LU9A 2WIAA 3HA3A 5JDIC 2JJYA 4N82A 2BJVA 1AUQA 1Y3IA 3FKQA 4WLOA 3GGJA 1LEHA 3C3MA 2G77B 1GVHA 2BFNA 2GN1A 4B9AA 1WZIA 3QSYA 4U5QA 4BLOA 5ALUA 3CT6A 3LGSA 3NAGA 5B4UA 2FOLA 1ZSNA 3G2MA 1FPQA 1DP4A 4EB3A 4WBSA 2AUTA 2JJ1D 2Q2VA 5DCLA 2O8BA 3CCBA 4MQ5A 4L4YA 3UCXA 5E8RA 5DEIA 3I8SA 4N5LA 5ITZA 4EJSC 3THXA 2AX4A 4JMLA 2P9FA 4UFOA 3RUIA 3VZCA 2B35A 4AMGA 1C9YA 4YP5A 1I4WA 4J4TA 2XLCA 4HGYA 2GZMA 3OX3A 3SHTA 3ZZ0A 2B83A 2EKLA 2HA5A 3KKPA 3QLVC 2IXBA 1R6TA 4IF6A 1KDOA 1A8SA 1P4JA 2Z5VA 4NL4H 1OHHA 2OZLA 3RVOA 2VHCA 4C5AA 5IG2A 4AKHA 3B5IA 1QDUA 2BT4A 2X4IA 2A9RA 2I2BA 1P6UA 1PT6A 3DD1A 4MKXA 1G6OA 1T5DX 2N3ZA 2A58A 2GAJA 4HQ6A 3A3YA 1RBQA 2QNBA 4ENSA 4MW0A 4WJKB 4RABA 3MWFA 5TE9A 2QMOA 2CYBA 3SZMA 4D42A 4RYDA 1VLZA 4FC6A 2G5PA 2VC2B 4M7RA 1DRWA 1T36A 2WU4A 3PKZA 3V55A 4K9RA 3ZWWA 4CM5A 4OGKA 3ZD9A 3SXPA 1R0LA 1ODTC 2HJHA 4HAZA 3CPJB 5BRJA 4S05A 2IUTA 2XNJA 3C6KA 3V3TA 2GCOB 3OMXA 3L2OB 1KBZA 4BN4A 3NEAA 4DQVA 2PUBA 2EW2A 2F9LA 5K2MA 1SC4A 1UBEA 2HR1A 1NTOA 5EXPA 3H6GA 1QNLA 3HPQA 2UYHA 4TKZA 3FDFA 5E4TA 4UD6A 3ZXYA 1EQUA 3WYDA 1UM8A 4ZHQA 3UMGA 1ZW6A 1U7PA 2B92A 3TFQA 2ZDQA 1JN0A 2A92A 1WM1A 3OQ1A 1THGA 5CEEA 3BH6A 4EG8A 4R71A 3COPA 4MW1A 1WB4A 3OPYA 1UEXC 4B73A 1GPNA 4JQSA 1Y6GA 3QGMA 5AOBA 2GD1O 2VRNA 3Q8XB 4QARA 1P4SA 1JIIA 3C6BA 1KEKA 1ONBA 3RC3A 3T38A 1ECBA 2PO5A 4AJ9A 1A4IA 2JIBA 2FFQA 3EGVA 4GC5A 2F6RA 2BLLA 2Y1KA 2XAAA 5CU7A 2WJAA 3U37A 4D0GA 2NZYA 3BXOA 4MV3A 3LLMA 3RRFA 1M1NA 3KR9A 1LLCA 3U5ZB 2TRSB 1ZBQA 2J0VA 2WZCA 4B2PA 4IVRA 4RIGA 4G97A 5HS4A 5AH0A 3WNDA 5HHTA 1Q5PA 4H6PA 4MJXA 4S2UA 4YAJA 1QRUA 1GU7A 2R87A 5DHTA 1N7HA 3NALA 5E6SA 4C87A 4MJ7A 4WHMA 1C41A 3ZBPA 1XQ1A 4BNTA 1OGJA 2OO5A 2I2DA 2EERA 3B6IA 4FGZA 2CE7A 5IKPA 1SVIA 4ZU6X 1Y7HA 1Z6QA 3AUSA 4YO8A 4EO7A 1JIKA 3D0OA 1GYRA 1ZAYA 2JD1A 1TYEB 2WU8A 1KZ1A 2FGKA 3G8YA 4XWKA 1XZQA 4ZYWA 3LIIA 3O84A 2BEVA 1A4XA 4MNTA 4AJ4A 1SRRA 4G1CA 4PONA 2Z08A 4IIYA 2E2WA 1VTKA 4LZNA 1CC1S 4JFRA 4RKWA 1RPTA 4V0RA 3UJDA 1VPWA 5B58C 4GP6A 3CLSC 3KB2A 1TCBA 1V95A 1WABA 3CONA 4IOLA 4JLNA 2G4LA 1IRXA 1EBUA 3O8DA 4NCHA 4OY3A 1KDZA 3HXQA 2G0TA 5I8PA 3WDMA 3BXHA 1HT0A 5EEGA 4EJMA 2G5GX 5FFMA 4A7PA 1NVMB 5BOSA 2CXTA 5JDCC 1WU8A 4KQEA 4GSLA 1B6GA 2PH7A 4TSKA 2DY0A 2P8JA 2IDMA 2ZR0A 3LZDA 1Z6ZA 3A2MA 1TPZA 2GI4A 1GN9A 2H8KA 1TU0A 4O1MA 4U2KA 2AVDA 1HT3A 1JR3E 3B13B 4KGZA 1FRFS 1L4FA 5COQA 3EG5A 3PNVA 2YV4A 1IIRA 4I5FA 1M1YB 2VDMB 4G09A 4X8HA 3D7RA 4LA4A 4CLRB 4OBXA 3NM5A 3AVOA 3UA3A 4CMGA 2LDBA 1W75A 3C98A 4WBNB 2IBTA 4DQKA 3N0WA 3U7QB 3B85A 2DR2A 1QTIA 1VJ5A 2OV6A 1ZUNB 4Y7CA 1YRQA 1BIFA 1E98A 1DRKA 1OIVA 3N5CA 1GZ4A 3PHBE 3VSBA 2WEKA 1ULZA 1DCMA 1ZX1A 2ONKA 4RUKA 2QAGB 5CW2A 4RSHA 1WKCA 2XDAA 3NBMA 5IMBA 4CZ2A 4JQZA 2IYNA 3VVLA 2OV8A 1AHIA 2XUKA 5ENDA 3KXDA 3VNSA 5FV4A 1Z12A 2WOOA 3CRW1 5F33A 2O6HA 5JYCA 2J31A 4B6EA 4URFA 2JH9A 2AKAB 3IBTA 1FP4B 1J42A 3TFWA 1RM0A 2RGDA 3EGDB 3ZTWA 3HYRA 2I66A 2WJYA 2JC3A 3FH0A 1VL2A 3DTVA 3L7AA 2R6CA 1J8VA 1L4GA 2R6ZA 2O0LA 2QU8A 3I5MA 5AWFC 3BBLA 2MCFA 3ZY6A 1QMPA 3SG0A 2FH5B 1A4RA 3QJGA 3ZZNA 1SKYE 2CKMA 3IUNA 3R9IA 1WVIA 2DT5A 3KU1A 3PQFA 3P2JA 4Q12A 2DSNA 2ISQA 1E32A 1KS2A 3EQZA 1MRZA 2G9ZA 3OD1A 4PG4A 2HGZA 3WHPA 3O5AA 3Q5EA 1Z0SA 1KP2A 1I3LA 1NIJA 1Q1AA 2AN5A 2CUTA 4M4SA 2QVGA 4LYEA 4RZQA 3I2IA 4EJ0A 4RBNA 3T9FA 2DYKA 3RUAA 1PZGA 4B9EA 1SCIA 4Z4CA 4ALLA 1T1GA 2OHGA 5E2IA 2XKBA 2WD8A 5BN5B 5DYTA 3EW9A 1E0JA 2GYVA 3PEEA 3UK1A 3OLQA 1DXHA 1AMNA 1SELA 1UZAA 4MPJA 1NLYA 1NHWA 5K0TA 5CLIA 1LD3A 3AV3A 4KXNA 3WAGA 4FFVA 4I1PA 4MR8B 5B1IA 2QRGA 2AQKA 2RHDA 1RE0A 1Y9AA 2Y0PA 2XVAA 3H83A 5KTMA 1QYWA 3A1EA 3AERB 4KVZA 4P35A 3UW1A 1AHPA 2C59A 1ZI8A 2H4YA 3AV0B 3FW1A 4I6EA 3CH5A 1WMAA 3U0BA 2Q5CA 1JQBA 4FMCB 1JEQA 4F1KA 3K70D 2UUBB 4RSRA 1N33B 1E9BA 4D9BA 1ZKDA 2EYQA 5A6VA 4XSHA 1XXLA 1MJ5A 4UHBA 3P0IA 2IEGA 1H8ED 1Z17A 5EWJA 1L8XA 3EIFA 3NIBA 3TPCA 4RX1A 1IVYA 4C14A 2FZWA 2J9RA 4G1MB 3EFHA 3PL1A 4H16A 5DTJA 5FTMA 5JJCA 3IKTA 3KDSE 1E1RD 3GEPA 5CLJA 4O5OA 1H3EA 4RQBA 3DMGA 4RPLA 2I4RA 1P17A 4OQFA 2X15A 1DKUA 5A7GA 3UMCA 1OQAA 1I2CA 1PWZA 3QX9A 2APJA 3TR5A 4ZYTA 4GXQA 3QWFA 2QI9C 1HRKA 2V7QA 2GHTA 5BUQA 1V8ZA 4PRKA 2IYZA 3RFVA 3U4GA 1WO8A 1N5DA 5I7WA 2D1TA 2FW0A 4US2R 4N0PA 3UAZA 3ZY3A 4D92A 1T2CA 3CHYA 4XAQA 1YACA 4NXNB 4AJJA 4IDGA 1W9MA 4Y2PA 3TUJC 1VXOA 1NKTA 4LBZA 4Q66C 1QS0A 4RANA 1NIPA 3KLMX 4DV1B 4WCFA 1TVEA 4JB0A 3VR5H 2FY8A 1H8HD 2Z95A 3UPTA 1RLMA 3KVVA 4J0HA 1YR7A 4RTNA 4GOMD 3SC2A 1N9ZA 1X9GA 3E7XA 4BB9A 2CSUA 2VDOB 1FNDA 4ERNA 2C98A 5F3WB 1ZNQO 2AMVA 4WGFA 2BGUA 4M22A 1J2EA 4MV1A 1Q1EA 1E3LA 3V7UA 4OLAA 2V5VA 4BGUA 4RD6A 4LIPD 1NRIA 3LHIA 5SY4A 2FUCA 2JW5A 2NYAA 2YV1A 2FK8A 1LLFA 3VR2D 4J8PA 1JZTA 5A05A 1KJ8A 1HH4A 4O4IB 3ME5A 5C1PA 1R0WA 2OQVA 1CZNA 1SQSA 2PXXA 5DGIA 2E18A 1VBKA 3QWBA 2JAXA 4Y0VA 5DTRA 2ZRMA 4A8JA 1YJ8A 1U65A 2VYNA 5EJ6A 3U1VA 4NMMA 2J7KA 1WV0A 1R50A 2E9SA 1RIIA 3I6IA 4IJVA 3AHJA 3J7TA 3PA6A 4HCJA 4HWSA 1FDRA 3ROZA 1GRRA 3AUKA 3UWMA 2F8LA 3AM3A 1DX6A 3ID6C 1E58A 1JDBB 1TK9A 2FN4A 3Q3IA 3L9XA 4C0XA 5CDYA 3QJYA 13PKA 2CK3A 3S2UA 3H2IA 5LYJF 3CF2A 4C4YA 1OT3A 3A9WA 3OZWA 4Y9SA 3ZTTA 4L50A 1OX4B 1U0SY 4JJGA 1KEVA 1SUIA 4CR7A 1KH2A 4ZYZA 3W5AA 3QRWA 3HYNA 2FP4A 1BE8A 3RRJA 5FORA 4YFVA 1IY9A 1WXDA 3EY9A 2A9QA 2O06A 3N8IA 1IBCA 3QUAA 4UBKA 3H6KA 4P0QB 3ZWXA 1QJ4A 2PKEA 4KWCA 3F9CA 5K0CA 1JG7A 3N86A 1J2TA 3RUHA 1IXSB 1MG0A 2WPNA 1BA2A 4RCZA 4AZ0B 4GZ3A 1A3CA 2FQQA 1CR6A 1E1LA 4QXRA 2EZ8A 3REFA 5JZSA 4G5GA 1MBZA 4RACA 5KYYA 2Y1EA 5DDIP 3VAAA 3GAAA 3NGMA 5F35A 3T12A 1LS6A 4EWLA 3GHHA 4JLAA 1ZJ5A 3SIWA 4UHCA 4XRGA 8ADHA 1N2ZA 4OLBA 2JDIA 4PS1A 2FEOA 5TF4A 1FSZA 4XWGA 1U63A 1M83A 4NDAA 1JMVA 1QO7A 1ZD5A 2IYEA 4EJFA 2DFKB 3VZBA 2AB0A 3SIXA 1NXQA 2DBQA 5T57A 1SUCA 1D5WA 2BUBA 1ESMA 3FG9A 1ELOA 1KZ7B 1U4OA 4BGEA 3OJXA 3M1IA 4D9HA 4YASA 2HPHA 2J3JA 1V5EA 3P2KA 1SD5A 1FQKA 1C0PA 1CTQA 4OXQA 2O8CA 5ALTA 4E5SA 3I9MA 1ZK3A 3QI2A 4PZAA 2RBGA 1QO0D 1NBIA 3OOJA 4EBFA 2W2KB 3IQGX 4KIUA 3T15A 1P9OA 4PVDA 1LGYA 1X39A 3S2IA 4GBJA 1E6CA 3I34X 3KKOA 4HLNA 4LK2A 4CLEA 1Q0RA 1OBVA 2SCUA 4Z86A 4KREA 3REGA 1QUEA 4XQEA 5HZHA 4UEKA 1E89A 1YK0A 1D4ZA 4Y6OA 3AEYA 4LBYA 1A7AA 1N3LA 2X6RA 3MBOA 1G0NA 1SHLA 4D8XA 3BTOA 4KOAA 4XFDA 3RKUA 3WNCA 5C8YF 5KHLB 2FSVA 3AF3A 1CE8B 4X8LA 3NP9A 2CNBA 4AJ1A 4MVWA 3B51X 2C7BA 5EXEA 2B2NA 3VX4A 1G9XA 3QMMA 4W7SA 3LT1A 3TW8A 1Q3KA 2OLJA 4H3HB 3ZCUA 1GV1A 2PY6A 5B1YA 4JVNA 1RAEA 2BL4A 4D82A 4C7JA 5EJ4A 3GARA 2WYHA 5K8VA 1KE1A 3OPYI 5AUNB 1UBUS 1AN9A 3MW8A 2HT6A 1MX5A 2VNJA 4QUAA 4UAVA 4GX2A 4KOEC 4GP7A 4YAOA 4M6WB 5IT9A 4GXRA 1QKIA 1AO3A 1YUBA 1PGQA 1GCGA 4N0EA 4QYMA 1IHUA 1SEPA 3FPCA 5ALZA 5GJCA 3W2IA 4HUTA 1P1RA 1PYGA 3RIEA 4XIIA 4JBWA 1PWXA 2PBZA 3H13A 3K16A 4X71A 5HKKA 3ADDA 1VECA 5J4YA 2JLYA 3IV6A 2JB9A 5ULLA 2JIQA 4GYYA 4KXMA 1ZSVA 2CF6A 1KI9A 3WSTA 4OXRA 4OHKA 1L5LA 4CU5A 3GLGB 1G55A 4CCAA 3MJSA 5A4DA 3W79A 4JB8A 1IZYA 1AGYA 3S27A 1N5RA 1HEIA 4FHZA 1HYHA 1MU0A 1WF6A 4OB8A 1J23A 2ZWIA 3I30X 4I19A 2C9ZA 2Q8NA 3A32A 4WN9B 4QU5A 4KI7A 3HDHA 4TL7A 5J2UB 5BPFA 4DV5B 2PKWA 2ICAA 1W0JA 3AP3A 5FOUA 2O4CA 3NHRA 2XSZA 3R3WA 3FOZA 3ROFA 1VCOA 2FPPA 4KLAA 3ZE0B 2WKWA 4BE9A 2CXXA 1WD7A 3HR4A 1YU6A 3KR1A 4O2AB 3RYCA 5C1BA 1JEYB 1SB8A 1UT8A 2VS1A 3PL5A 4JKIA 4EM6A 3VR5D 1E1DA 4GMXA 3A9SA 2ZK7A 1C80A 3HUTA 3QX8A 1E5LA 1T2VA 5JEEA 4FFOA 2EP5A 2REQB 3M6LA 4YJ2F 1WP9A 4U2BA 2DPYA 1Q7GA 4HQLA 4PFKA 4YI5A 5TQ0B 5PNTA 1ZWKA 4QLAA 1RZUA 2XCOA 4CEJA 2H1HA 4BNZA 1H3NA 3OU7A 1CUIA 1ZNYA 3HKCA 3VH3A 3ZNQA 4DIFA 2ZDHA 3MGCA 5DN6A 1GPJA 2A78A 1SD1A 2IYRA 3FNHA 1INLA 3FRJA 3KXLA 4O3FA 3HACA 4ONEA 1AY0A 1Z8NA 2OHHA 3NM4A 4HWGA 2AEFA 4XYGA 3R7NA 3PSHA 1A9RA 5AVRA 1V16A 4KE8A 4UC0A 5F1KA 2ZYSA 1OLSA 4WNAB 1O58A 1P5FA 4OMCA 2VTKA 4D0NA 2VHQA 1J0XO 2I3GA 1K6EA 3GT4A 4NS4A 4QXQA 3WZLA 1JU9A 1ZD8A 4HOYA 1AGPA 1EDEA 1KL7A 3B1XA 1E64A 1WU7A 1L5QA 4MROA 2C8VA 3CXUA 3EEQA 2EV9A 3PXEA 4ER6A 3IMEA 5L6MB 1RP7A 3CUWA 3NONA 1C0EA 4G4SO 3M1AA 3ER6A 1E6MA 1SHJA 2FEXA 2H1OA 3BERA 4MLDA 4DLPA 3AL0C 4GWGA 4L2IA 4BGDA 1K0FA 1EUCB 4PYRA 1FSGA 3VR0A 2GPAA 3GMDA 4C7OB 2VUSA 2BFEA 3ODPA 5IKEA 1P7CA 2VHTA 1KJQA 4YCCA 1Z4OA 4W6QA 2Y1DA 4X6LA 2C95A 4PR3A 1YB1A 3OC6A 3TVYA 1ZM4A 3U9LA 3O83A 5LDDC 1IRIA 3RM3A 1TFRA 3UCEA 3QVOA 2GEUA 1GPWB 3OESA 1MRNA 1WP4A 5JR3A 2FRDA 5FLKA 1T35A 3U39A 4E13A 2YNMA 4A1FA 4WDRA 4B81A 2BH9A 4AM8A 1LRLA 1DIAA 4IDFA 2N47A 2IZ6A 1XN1A 3G8DA 6Q21A 3GA7A 5KQGA 3IUSA 4BKQA 2ID7A 3GT7A 3FZNA 1XRLA 3RFXA 4B6RA 1SCJA 4E4TA 3ZVMA 3ZS8A 2GPSA 4LFBB 1NSFA 1GKUB 3N2LA 3H86A 2DETA 3L8EA 3ENNA 3UG6A 1KOGA 2G25A 4Q00A 4PFSA 2DFDA 2W2XA 3LJKA 5LA6B 3QHAA 4I1IA 4KBYA 4ZO6A 4V0SA 1ENOA 1RQNA 2WMYA 4WZAB 1P1FA 1XJWA 1ZG3A 2ZAMA 4QXMA 4L0QA 4UVHA 2F59A 4PG8A 4FWBA 1OH8A 1H9CA 3BB1A 4BKUA 4B3GA 1GYQA 1V11B 4QWMA 4BMOB 3K9CA 4CEHA 4KEAA 3TIGA 4HX5A 1SWVA 2HKIA 3RYIB 4P53A 2ZSUA 4M54A 1SC3A 4ANFA 3D0KA 4LZOA 2QPLA 4L02A 1E9AA 2VA9A 1RHQA 3PRJA 3QQ5A 4LHEA 5HOQA 4BO5A 2P65A 1E6LA 2WC1A 2RCYA 2ZSHA 3BSWA 3D54D 4M89A 4HQKA 5EE3A 1IK4A 4CF4A 2P11A 5JSZA 4MI9A 1NP3A 1RKUA 1MIOA 3VDXA 5JSHA 1I13A 1N6NA 2CNNA 5KSPA 4WD3A 1DO2A 1RTKA 3AY6A 3E03A 3ZWPA 4RTSA 4PBTA 2W6JD 2O0HA 1R9JA 4QQKA 3PG5A 3ADCA 1XL0A 1GLGA 1DKQA 5BN4B 2ECPA 1PFWA 1P1IA 3L7CA 4GGMX 5C0OE 3GJ8A 2PD6A 1RPZA 3K32A 1FNSA 5ALLA 3DKRA 4M38A 1H6BA 3BA6A 1NQTA 2IJGX 3MWKA 5FUBA 5HDBB 1P80A 3UANA 4E5KA 1XKLA 2R9VA 2Q9UA 1EG7A 4P3YA 4RENA 3HQ4O 3OJCA 4UUNA 1EDBA 4NG5A 3KT0A 2WV9A 2XHEA 3KYDA 3KWJA 4JP5A 4XPIA 3T1NA 4AMZA 5IFLA 5KWIA 3PNOA 4JCCA 3HY4A 3RQIA 4EMTA 3HB5X 1ADGA 2ZIZA 3LUAA 4MV7A 4JGGA 1G5HA 4NHEA 4BNGA 5EC8A 1SCDA 2GRUA 4NBKA 3NTUA 4ARAA 2RIPA 4B8ZA 1ADYA 2VP6A 3L4BC 4FFNA 5EJ5A 1H2WA 3AFNA 4FDMA 3KT6A 3BIJA 4QQFA 3CLRD 4YUVA 4G07A 1EFCA 2VSYA 4CW7A 6REQA 1JG1A 4Y98A 3HKBB 2R2GA 3OQJA 1COZA 1G21E 5J4KA 4V1CB 4CG3A 1TF2A 4GDMA 2AYXA 2ZUFA 1E2MA 3G9UA 3IXMA 1MO6A 1L7AA 2M6SA 1FYXA 2RGGA 3QYAA 4R16A 3DV0A 1JDPA 2QTMA 1IJFA 2VXBA 4QBGB 4TUYF 3U1TA 4CM8B 4JLSA 5A9SA 4DDUA 1APBA 1XNRB 1UDXA 5FFFA 5DWQA 1B93A 1I2BA 1AK1A 4EHJA 3M1LA 3TDMA 2CXQA 4DLYA 5CBPA 1WKBA 1MT3A 4NEHB 4MUEA 4TV9A 1QYCA 1P6XA 4BMXA 3RJTA 4DYDA 4Y2TA 4EY7A 1V6AA 2YS7A 4GLOA 2Z1NA 1W0KD 5ECDA 3TNJA 2Q62A 4LF4B 1IK6A 1Z0UA 1ULAA 1AKTA 2VJBA 4X20B 3BJEA 5JTUA 3FB4A 1YR3A 2F43B 2QVBA 3OE7A 5HK8A 4BO0A 2ODWA 2D2VA 2WUGA 3T7SA 4W1RA 3P1JA 1L7NA 1PYOA 4KYIB 4ERXA 3GFOA 3JAWB 3ZQ4A 1EE9A 4D3YA 4DUGD 1SURA 1U4SA 4IAOA 2NXWA 4AKIA 3C7KA 1Q0ZA 1VHWA 2WWRA 3F4KA 2V9PA 4RVHA 2CLMB 1RYZA 2IELA 3N2YA 3E48A 3BIFA 2DC1A 4QOHA 3HJNA 3Q3HA 3TJRA 4RK7A 3T54A 3QXCA 3BAZA 4QUDA 5DFAA 4AMYA 5C52B 4DQLA 3DDUA 4CF5A 4CTMA 4IHJF 4DARA 4B3SB 4BFSA 2C4WA 2IYXA 3EVZA 4FDTA 4I1RA 1W94A 1ST2A 2PRIA 2ZREA 5BSRA 1Y4AE 4PTYA 1SXGA 2YVAA 3GAFA 1BKDR 4WOPA 4CJXA 3CZCA 1BDJA 1Z8DA 1GA6A 2QR5A 2NU8B 2PIAA 1XJ0A 3L5OA 4AMUA 1G8SA 5KYVA 1G4HA 2HLNA 5B6JA 2JI8A 3M3DA 1L3BA 3G2NA 2J59A 3ETHA 3JYLA 1Q84A 1P6QA 1KQFA 3GH1A 4HWTA 3UJ8A 4A82A 4DUYB 4G9GA 1NZDA 1TI7A 1P61B 1IHPA 3K94A 3OCXA 3WIOA 4D41A 4BQQA 5I4IA 1F4VA 3DAPA 1U81A 5M5BA 2JH3A 4TWRA 3HFJA 1Z15A 3UB4A 1JQKA 4J3NA 2QQEA 3SYKA 4KUEA 2Q9CA 4DC0A 3KUDA 1E2IA 4BEJA 4KV9A 4YQYA 5L4LA 3NNDA 1E8DA 1MB0A 1TVCA 2VRCD 1T6NA 2WTBA 3H4MA 4IQFA 4R1NA 3RVJA 3R0JA 1L5KA 4O4JB 2WTMA 5JNSA 4CM1A 3V8MA 1PJ4A 5ALSA 3K6SB 3DA8A 2AK3A 3V46A 1CUZA 1A9PA 1ZK1A 1QC5A 1SKQA 3RUEA 2FMXA 2PN1A 2PL5A 3HNOA 5HKAA 3CVOA 3W9YA 2C4NA 3TLZA 2GFHA 2JFXA 4DT1A 1O54A 4C2TA 1UWKA 4MIYA 4UBNA 3W8DA 4EG5A 4IDEA 4X1OA 3ICEA 1VQ1A 4HDQB 3WRYC 1U9IA 3HR7A 2H2GA 4L0DA 4EUSA 4ID3A 3TW6A 4DSNA 5BWOA 5JU6A 1KAEA 1BWRA 2IW1A 4OP1A 5AJYA 2LGJA 1UM9A 1NF8A 2ASEA 1XO1A 2AH5A 2WJZB 5IVIA 4N03A 4EQZA 5LNK1 3BB3A 3WQBA 3LT4A 2IH5A 4QRHA 1BJTA 1G18A 3C7CB 2GCEA 3C8HA 1FL9A 5KKAA 4CV3A 5DWVA 3N74A 5H0IA 5FNVB 4AZ3A 3IBGA 1YZQA 3D7SA 3OEWA 4XUCA 1P4RA 1D2AA 4YRIA 1WRBA 1U3GA 3U19A 3INTA 1YKGA 4O29A 4BQOA 2I80A 2Z2YA 3PR3A 4PYQA 2Q49A 4KKXB 2JEYA 2QI9F 2Z8YA 3MOIA 4OTZA 4OBBA 3TL6A 3NUGA 1CKEA 4X95A 1QPBA 2HHJA 1TIPA 3AM1A 3I9KA 1CY4A 4HZGA 3PFFA 4MS4B 3ENKA 1P0FA 2DHQA 1FNBA 4JC5A 4QQ8A 2G88A 3W77A 4HVCA 1GPDG 5A1TA 3B3AA 4KLNA 2JI7A 2P68A 2QRLA 2OQIA 2VZEA 4DWWA 3TLYA 3UAXA 4B7CA 3DPSA 4BB5A 3Q40A 3ZGXA 2WLTA 3EE6A 4J6FA 3EF3A 5F21A 4OBEA 1IUKA 3ILVA 3D43A 1Z0KA 3BE8A 3LBHA 5E3IA 4A0HA 1F20A 1X15A 3IB6A 3ZBQA 1RRFA 4NULA 4CL0A 4XRRA 2PYDA 1HI9A 2H9IA 1O97D 1TO2E 4Y6LA 4ZYXA 1UKVY 1R6AA 2FSUA 5C1DA 1T8RA 2BGIA 1JECA 2JFNA 3O8LA 4IFEA 4XR4A 2E4VA 5JW6A 1JHAA 2PQ0A 2GMWA 2X0IA 1DAKA 5AUPB 2HMSA 3C6YA 3CRRA 3E27A 5CVVA 4YRJA 3ZD6A 2I6GA 3CJQA 1Z06A 3AOEC 1AB6A 5CA0B 1EBBA 3O47A 5A71A 2WSSA 5BQ5A 1V1RB 1XD2B 1D2HA 2YRXA 5AKYA 5J58A 1P77A 4E94A 3F0TA 3SKYA 3URMA 2P0AA 2E7ZA 4BP8A 4YMUA 4GX0A 5GZ6A 1VMKA 4PZ0A 3WDKA 4YYZA 4XDGA 3PHGA 1ZN9A 1OV4A 3QE2A 1VYVA 4AWXA 4EPYA 4ENWA 4KO4S 1Z63A 1KEEA 2OZPA 1DTEA 2A57A 2NU7B 2PX0A 3GPBA 3AYXB 3FGPA 2WHPB 3DE3X 3IYLW 4YC7A 4LZZA 3DCYA 3IOBA 1I3OA 1N2JA 2OV3A 4IUDS 4E07A 4ED9A 1NI4B 1GQOA 3R6WA 1BOFA 2H17A 2ZXFA 3ZD8A 5KUTA 1J1UA 1WUHS 4I55F 5K3EA 1HDCA 2AZMA 2RDMA 3AHDA 4PV7A 5MN6A 2EATA 1U2GA 3R5XA 1NUTA 2A1TR 2IP2A 4C6TA 5C8XA 3H9QA 1EQAA 4JD5A 3HDQA 4HSGA 2GCGA 3WLKX 3K1AA 7MHTA 4J7UA 4HNUA 3UT6A 2GAIA 1TYDE 2QKYA 1KVSA 3NYRA 4ZEVA 4NV3A 4XB2A 4YFYA 4D0LB 1PV4A 1C81A 2I03A 2QT1A 4Y6GB 5F4BA 3TE6A 1LF0A 3RO7A 1IHOA 2ZQ5A 3KKQA 5L6LB 2QUHA 1Q7EA 3I1YA 4JYZA 2OAQ1 1A8QA 4RMNA 2Y6VA 4S2EA 5JYBA 3N0XA 1XYGA 3FOWA 4FPXA 5GZ3A 5JFTA 1P4AA 3ZNOA 2OQRA 4YN3A 2Z3VA 2HPAA 3QV2A 1II0A 3CNHA 3TSZA 2V98A 2B0JA 2AOUB 3AJ8A 3O9MA 4L5AA 3R3YA 4UE3S 1J0BA 3MJVA 4Y2RA 3JVEA 3K0AA 3SOZA 3ABRB 3H5IA 1A69A 4X7PA 1JMYA 2QMYA 3DWEX 3IP7A 2A30A 2I54A 3PD1A 4MAAA 4O2LA 4R2MA 4DLBA 2QRVA 5BUSA 5JATA 2GASA 4YCDA 3P2MA 3AVVA 2QQGA 4RK4A 2O3SA 3EMVA 5JNTA 3E0QA 3R6TA 2F67A 1A2OA 1O95C 3PPXA 2QE6A 3U3OA 2PTGA 4A92A 1DG1G 2UZ1A 1KWGA 2BUCA 1TMKA 4FSDA 5DW0A 1Y6QA 1PK9A 3ESDA 3C3PA 4U9HS 3GZNA 4UHFA 5LBIA 4INPA 1PR3A 3QM1A 3TEJA 4WH0A 4YACA 1KJYA 1UXKA 2Q4RA 2IPXA 2NO4A 3DBIA 1X94A 2F48A 4FKMA 3LPAA 1HXHA 3FSJX 2R8ZA 1VL0A 4M8KA 1JTFA 3VPSA 3PQ8A 4MO2A 2BMEA 4FDLA 4G23A 4XXHA 4LMPA 3J80A 1NBMD 5AJZA 1J9EA 1FFEA 1II8B 3A0UA 1HYQA 1W52X 1FTSA 1U8YA 1KYWA 3C1AA 3NGLA 3QI7A 5FOQA 5LKRA 4DV3B 1N78A 1KYZA 1QYRA 2QV0A 5CA1F 3EVFA 4OPMA 2MYNA 1HNWB 3CO5A 2BEWA 1NVVQ 1KVUA 2JL1A 4G01B 1XPOA 5IVDA 3B6MA 1JAZA 1FU8A 3C3JA 4MARA 1MQSA 1P0PA 3L79A 4H7EA 1USIA 4B3FX 3WFJA 3GJ0A 4CTJA 2RHRA 5A4FS 4JT2A 4M1OA 3M5DA 4TMXA 4PLPA 2OKGA 2R6HA 3U6KA 2JIZD 2G63A 2R4UA 4V39A 1PU2A 2FFHA 2PBLA 1JT2A 2EFYA 3G02A 5KNBH 1GQFA 4J4BA 3EXG1 1L4KA 1XV5A 5IH7A 4I8IA 4QRDA 4L9WA 1WW3A 1VSBA 3NCHA 1E66A 2ZM5A 5IDYA 4YJKA 2AI2A 2OSVA 3WFIA 4I1YA 4L7VA 4C06A 4YV1A 4ETNA 1M2HA 1VZ3A 1RP1A 1VPLA 4DCPA 1U0HC 1C7ZA 2D2FA 1MH9A 3L46A 4RTMA 2YMLA 1PW5A 2BZ1A 3DG9A 3Q5GA 4NARA 3PX7A 3K9QO 2HDHA 4RIIA 5KTSA 3VUEA 4X93A 2DTDA 4GPIB 5EQDA 1A2KC 3CX6A 1PQ4A 4KK4A 4MVYA 3TOSA 3AF4A 2BR5A 4LCEA 4PWYA 3M70A 1Z56C 1H2AS 4H77A 4LJ5A 1GZUA 4RF3A 3GGSA 4ISBA 3MJEA 4HL6A 2DKFA 4QPJC 5LQRA 1EXWA 4L4UA 1QOQB 3KQYA 1BW9A 3LDFA 3NO4A 3Q6IA 4FKBA 4P58A 5H68A 3VTKA 4EECA 5IVHA 3SPXA 1DL5A 4FW8A 3T0IA 4PCLA 1JT9A 3AWIA 2ZE5A 2IKSA 3VSCA 2QENA 1TZKA 5KYXA 3BVPA 3EOZA 3JQGB 4LRUA 4KUHA 3BGOS 4N7BA 2PVCA 2KM1A 2G04A 4GE3A 4H7IA 5DSTA 3UJHA 1DX9A 3RIYA 3RWMB 1A5BB 5JD4A 2B98A 4NVRA 4JGIA 3L4JA 4QGFA 3K15A 1LPPA 4I1OA 3UN1A 1IZ8A 1NNLA 3HXLA 5KEIA 4IIXA 2V6BA 3X2SA 1RKVA 3AI2A 4HFJA 1UBSB 2VCYA 3WWCA 3LY5A 3PXDA 3FVTA 1VMIA 4WY2A 1N6RA 2VR1A 1G7RA 1A50B 1G20B 3QW2A 4N18A 4N76A 5H9VA 1LI7A 4YRPA 5THXA 1K88A 5E1OA 3ZQ6A 5HZGA 4TV8B 4Z2YA 3DFMA 1NLZA 1YQXA 1XFDA 3G0DA 1CY2A 4JXXA 2E5WA 1IZ9A 4Y9TA 2AFHE 1G1AA 1OXTA 1Q17A 3UAGA 2IODA 2QT0A 2VAPA 3PVSA 3PXAA 3PU6A 4PO8A 1M5TA 4Y1RA 1MAUA 1TZCA 2RAUA 3R7FA 2NUPA 4IL5A 4TMFA 1WOMA 3T1QA 4QBKA 4JYCA 1TJ3A 5D6OA 1MVNA 4HP8A 1D6NA 4QU9A 4ARSA 2OXFA 3IDFA 3OLXA 3QOFA 1CD5A 4CMAA 1A2QA 1W88B 1DUSA 3G2IA 3E05A 2BW0A 1KXJA 1A8IA 1HFKA 4G26A 4TVBA 3L1JA 4QG7A 3RSSA 3SIPA 3U4DA 5SZHB 1B6TA 3VR3D 4PSDA 5KNLA 5EHZA 3U44A 1H0RA 2D5IA 4PGGA 2ZJYA 4QEKA 4B5KA 2XKKA 4YAWA 2QZSA 5JXGA 1MZPA 1IXRC 3ITKA 4CG2A 4Z0HO 1F9AA 4D9MA 3PNMA 3V1KA 3GDHA 4J7AA 4TLMB 1AHHA 3WC4A 4F1JA 3RSCA 3DLIA 4IXWA 1VSVA 2PT9A 2VBCA 4DM3A 4F3YA 4DWOA 1FK8A 3P5BA 3U13A 4RWEA 1BG6A 2DHDA 3DEFA 2DKNA 4LWOA 1WUKS 3IRVA 4MYTA 3IB3A 4DDHA 1PL8A 2CXOA 2J3IA 1IN4A 5CT4A 5HUHA 4LXXA 3RRBA 3F6YA 5SZJA 5BR7A 1SRQA 1VJ0A 2BHLA 3G1UA 2VDJA 2AA3A 4NZOA 4BEVA 3A28A 3DE6X 2QUBA 3AP1A 3HY6A 2QRMA 5L3SA 1ULBA 5ICSA 2O8BB 1ZRHA 4IJQA 3QVXA 3THXB 1PWHA 4YECA 2HUPA 4FT4A 1PL7A 2PWZA 3DEHA 3NMUF 2Z9BA 1EFAA 4PR0A 3ONWA 1CWUA 4CI9A 5L45A 3HPRA 4K7JA 3D6TB 4JJKA 3CG0A 4YQZA 2IEIA 1M34E 3ZE6A 3KJQA 3TLMA 5ALVA 3IJEB 5BVGA 3B3JA 1U0GA 2P4HX 1O0BA 2HDOA 2OZLB 3L8CA 4O4HB 1QH0A 4YAKA 4AYTA 2D13A 1SY7A 1E9EA 1NURA 2H1VA 3LBFA 2QYHA 1GPYA 2QAGC 3QIAA 1ZMTA 4BAGA 3NYQA 3E9DA 1GARA 1RYYA 5H4GA 1ZESA 2PMCA 2WAAA 4P32A 3UUWA 1TEZA 4YRKA 1RI5A 1PSWA 1QHYA 5IAGA 1WSDA 4QRIA 4RTRA 3FPFA 1NYRA 3TMAA 1JHOA 2XB6A 2Z8YM 1AXGA 1H6DA 1T36B 2IVZA 2QZPA 3P9NA 4NKRA 2KX7A 4XIJA 3V97A 1Y7TA 3NH9A 1Y5NA 5HSGA 2X5NA 1I7LA 2ORED 2GJ9A <