1NF8A

Crystal structure of phzd protein active site mutant with substrate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
207
structure length
207
Chain Sequence
b'MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHAMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phenazine biosynthesis protein phzD
publication title Structure and mechanism of Pseudomonas aeruginosa PhzD, an isochorismatase from the phenazine biosynthetic pathway
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 72
structure length 207
sequence length 207
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 1nf8A00
3O90A 2A67A 3TXYA 2H0RA 1IM5A 3MCWA 4WH0A 2FQ1A 3V8EA 3KL2A 1NF8A 2B34A 4L08A 1YACA 3O94A 1XN4A 3IRVA 3R77A 1X9GA 3TB4A 3LQYA 3UAOA 3OT4A 4L07A 1ILWA 3O93A 3HB7A 4WGFA 1NBAA 3R2JA 3O92A 3S2SA 3HU5A 1J2RA 2WTAA 2WT9A 3OQPA 3PL1A 3TG2A 3EEFA 3O91A 1YZVA 1NF9A 4H17A
chains in the Genus database with same CATH superfamily
1K0FA 4TWJA 1P72A 3Q2KA 4CKBA 4DPLA 5CVEA 3EMDA 3RANA 2MSNA 4NC9A 1V5WA 1KJJA 2E9SA 3H8JA 4GGPA 1V7CA 2X6RA 1G2OA 1SNYA 2OP1A 3K73O 1SULA 4OSOA 4PZEA 2GBLC 3F2IA 4GPZA 1UBEA 6PFKA 4C1NA 1A2KC 1XKXA 5BUZA 3UWOA 4W8GA 3W8DA 1ZPDA 3SQDA 3KEMA 5GVSA 4NCKA 5JI2E 1OH6A 1R8QA 3ADBA 2V8BA 1UXKA 4JVSB 4HG2A 1BE1A 4MW9A 2ZSAA 4OXKA 2DH5A 3FFBA 1XPRA 2EQAA 1VI6A 2ERYA 1YD7A 2GQ0A 3C3BA 3C6QA 2OA0A 1NJ6A 3GG9A 2QTHA 4DZRA 5K99A 3VU0A 2ADMA 3B48A 2PQ0A 4F2DA 4EVRA 4N0DA 4MZDA 1JF8A 5DGTA 1YMVA 1JDBC 4RPCA 4R1PA 1S96A 1M0SA 3KEOA 4PSDA 4NDNE 4GIBA 4JKYA 1IZYA 2B8TA 1NSYA 5ALJA 5K03A 3UAVA 1WETA 4E32A 3LCCA 3DM9B 3HCNA 4F8EA 1SKMA 2IDMA 3H4VA 4KR3A 2GM3A 2XMSA 4HFNA 1CRWG 1Z73A 2Q5QA 1WUTA 2EOAA 1E3JA 2VO1A 3PUKA 3R40A 4TV8A 3FMOB 1RYNA 1BXKA 1LY1A 2N1BA 3SXUB 2VN8A 1LH0A 2A0UA 1Q19A 5G02A 2X5XA 3M83A 3C7AA 4O2AB 4F97A 1ZZGA 1A8PA 3LTNC 4RS4A 5CEEA 4ZZ0A 2ZRPA 3SFTA 1YBHA 1T8UA 1U0FA 1K6EA 1RRVA 2ZJBA 4DMMA 3NJ4A 4JEUA 3UYKA 1OPXA 5FWYA 2LIPA 3IIIA 3VNVA 5HJ7A 4PLWA 3HDHA 2ZS7A 1UC4B 3MZ0A 1JSLA 4OHZA 4JJ8A 5ALRA 3SYMA 3O38A 1RS0A 4A2QA 5K20A 1XXHA 3TB4A 2J4DA 1I80A 2JLVA 2FWMX 1JQ5A 1K9VF 4L8LA 1W75A 5CLGA 3ILVA 1GUZA 1QNLA 2OP0A 2GFHA 3I4LA 1QGAA 2NACA 3M6MD 1LTQA 4MRAA 5FXMA 3ZCPA 3G59A 4DLKA 1ODFA 1INLA 5ECDA 3TZKA 4ZDJA 3GDFA 1P45A 3HSKA 1CJTC 1J24A 1GAQA 5G0UA 7REQA 4X66B 5ESDA 1RXSA 4R9SA 2AEFA 2GB4A 1SOUA 3K9LA 2G5CA 3FW1A 3QE2A 4PVCA 3P9QA 4DQXA 1C2TA 3QU2A 1BMFA 2BM0A 3K6SA 3EZ9A 1O5TA 3CVVA 2CHUA 3EVBA 2WTNA 1M1YE 2PGXA 2ZTHA 3WGVA 4F9TA 1M2WA 1OXUA 3EASA 3BXGA 1FDRA 4BAUA 1FXSA 3E7XA 1V45E 2OCIA 1MAVA 2J7PA 1JAYA 4PPYA 5BW8A 2O5EA 5TVKA 1KXZA 4AJ2A 1EVIA 4RH3A 4U7TB 2Q1SA 2P6PA 3G5UA 3WKEA 3CZRA 2DMRA 5ENVA 4D80A 2BFAA 1GITA 3O8BA 3TRHA 4D0LB 4ER3A 3E7PA 2AOTA 2EP8A 5CCXA 2N3ZA 5HTKA 5LOVF 4GKAA 4Y2JA 5LIPA 3ULKA 3PQ6A 2HRDA 3DNFA 4G0XA 3EZYA 4NCXA 4UNRA 3U3MA 1L3CA 4E2FA 5I7EA 1OY1A 3ORQA 1IHPA 2H7CA 4Q03A 4Z8XA 2VF5X 1TQHA 3PE3A 2E89A 2PS9A 4V0ME 1ULBA 3HQ4O 4NAUA 2J46A 1SN7A 5G4KA 1YO6A 3JATA 1BEUB 3KJIA 3OUTA 4X93A 1VG8A 1B0PA 4X8OA 4H1UA 16PKA 4AZSA 1O6FA 1CUHA 1DAGA 1ZOIA 3SGLA 1ISHA 2HLNA 5DPMA 4L9SA 3ZDEA 4AJLA 3NX4A 3AHGA 3IT3A 2EIXA 4AROA 5HRCA 1Y8CA 3QYFA 1ZEMA 4Q1FA 4LHEA 1KS2A 5DGXA 3RUAA 4OL9A 1PV2A 4JU9A 4KACA 2QTAA 1JR2A 2OENG 1KR2A 4FZ5A 1U7OA 1C3OB 3KHTA 2I78A 1OXMA 2C82A 3NV7A 3H8WA 5D1HA 3SC4A 2CYBA 1T1RA 4K46A 1XMIA 2GAJA 2W90A 1OBHA 2DE0X 4NCHA 3P2OA 2DKNA 1L3BA 2PVCA 3IEVA 5FI1B 1AGYA 2VUTA 2G67A 2BM8A 2RGUA 3FRIA 4OKNA 3FJ1A 5ECYA 4XAQA 3OMXA 1FSFA 3BL8A 4RPJA 2E5FA 1Z8NA 2JZCA 4QLOA 2ZIXA 3ND6A 2C2KA 2IWHA 3UF0A 2VJPA 3BL6A 4BEJA 2QM8A 3KAJA 1HT0A 3WZMA 4DMHA 3JY6A 3IR6A 2ZJ5A 2G0TA 4HH3C 4TKLA 3FWYA 2AR0A 4LSMA 4RDXA 1E7RA 1KI1A 2YUIA 3BH7A 2Z3WA 4F38A 1X9HA 4E51A 5TX7A 1W5TA 1W25A 4UOQA 1OV4A 4XRRA 2QVZX 2IYPA 3NHAA 4E5VA 1X7WB 3Q7TA 4EZIA 2I91A 3LDAA 2DJIA 3I0ZA 5JS6A 3WJ2A 3EYAA 2A5GA 2WV7A 3OZUA 3PNVA 5E1MA 3W5DA 1MFZA 4D4LA 5LQJA 3GLFE 4TVKA 1H0HA 2IF2A 2HWXA 3DOJA 2VDKB 4LJSA 5C1IA 4DSZA 1PLJA 4KLRA 5IZCA 2ZIZA 3PQ2A 2ZDGA 5JAIA 3UHFA 3DQQA 4ALLA 4CLHA 5CT5A 4RIIA 2AOUB 2I7CA 2XKJE 4GD3Q 1O0BA 2XT9A 1FNCA 3BD6A 3Q8LA 4RZIA 4MJ7A 4EZBA 4OHFA 4WOCA 3CNQS 1NMXA 3C5HA 2ZJZA 3GCXA 3B78A 4WOPA 4Z0NA 1HWYA 1HQDA 1X1TA 2NZVG 1LRLA 2FI1A 1TK2A 4N39A 5FUYA 4GHWA 1A2QA 4B6SA 3KVNA 2IUTA 3DKRA 4GP7A 5AK5A 1PFUA 4D9FA 3PD7A 4QRDA 1W93A 4R6XA 1MT3A 1E8DA 1PGQA 3L0PA 4FMCB 2HCJB 3O3NB 4TYQA 1G5FA 1YR1A 4XCQA 3KEFA 2D1RA 2ZUWA 3NMUF 2QLFA 4IHQA 2X5KO 1OV6A 2HB6A 4TV8F 3JQAD 1R15A 1P81A 2RG1A 5MF6A 4PRZA 1BRMA 3WYFA 4EFDA 2NO1A 2AUTA 3O93A 4RCZA 1Z0AA 3BUSA 4WTOA 3QH4A 3JZMA 2SCUA 2H08A 5ENZA 1L1QA 4WKBA 3DO6A 3GJ7A 3AL2A 4QREA 4FN5A 4WXHA 1U2DC 1YI1A 2C4WA 1CQPA 5CX1A 3AEQA 4CEHB 4YJFB 1M74A 1MJGA 3FWPA 3IVRA 4K6FA 5A6SA 5J43A 3PA6A 1HG0A 2AYZA 1RLMA 1XEXA 2BC9A 2ODAA 3EAQA 2QLBA 4FGJA 4HN2A 3TM4A 1OHHA 1EM6A 1TYCA 1U65A 1ZS9A 2IU3A 3O8QB 4LRTB 3DLTA 1A96A 5E2AA 4DUPA 2AFIA 2JLSA 2AR7A 1I2AA 1RLIA 2G1KA 1C9JA 5D7NA 4I5EA 3W5JA 1VLQA 3EEYA 5J2UB 1G66A 1FXUA 2OD7A 1MORA 1RBYA 4HN4B 2GBFA 1XZPA 2BHTA 2VDPB 2ZJ1A 1LWOA 3JR7A 1MB3A 3MXOA 3ZS9A 1G18A 3KOZA 3NNSA 4DLRA 5IT4A 3X1YA 4MVCA 1KZ4A 1AZLA 4XCVA 4JB3A 3FKSD 3X1XA 1ZKMA 1KP9A 4LZAA 1WDMA 2PZKA 4ENWA 2OOSA 1D2HA 2EKPA 4N3GA 2DPXA 5FFMA 1TKCA 2EYUA 3K8OE 1A1VA 4JP2A 1HDZA 2FEAA 2DUMA 3NIDB 3FF4A 2H1VA 3IULA 2HRZA 1G2PA 4GWLA 1U7UA 1KIMA 5MGNA 1E1RD 3AETB 4J7XA 5JWHA 2V6GA 4ZCIA 2AMFA 1B6GA 3VV3A 3KSZO 1NP7A 5LP6B 1GTJ1 3BM5A 3PRYA 3BMXA 4Q34A 3TPFA 5CLLA 4DXAA 2WHYA 1TA9A 3MW8A 3QIVA 3VPFA 2P0AA 1GIAA 5ELLA 4MO9A 1BH6A 4GBMA 2FJPA 3SMVA 1U2RA 1Y8RB 1YI8A 1EMDA 1DXYA 1GPWB 2PV7A 3LNTA 4JJGA 4QOGA 2BTQB 3G3EA 4K9LA 2F3PA 5FR2A 2EEPA 1J1UA 3Q5DA 4P7BA 2HO5A 5CM2Z 5K9ZA 4DCPA 4GLBA 1CDZA 3GRAA 2VRCA 3HDGA 2HHAA 4RPHA 2CXUA 1HEIA 1TTPB 2NU7A 2WFLB 3ZI4A 1R64A 4Y6QA 2II6A 1BKYA 2P79A 2Q21A 1O94D 2ZT6A 2BD0A 1UPCA 2QD4A 4JX9A 4N9WA 4TV9B 4TVOA 3WGNA 4ZFNA 1T4CA 3PXCX 3H83A 2ZIWB 1F1BA 2B9VA 3KCQA 3V5NA 1KRXA 4UHEA 3VHXB 1LK5A 2FZWA 2OM2A 3S27A 3Q9LA 2P35A 5T64A 3SYRA 1CJSA 2I5PO 3DC2A 3GYBA 1QGED 4NH4A 2I34A 4YRFA 2DETA 1CUEA 3BULA 3FPLA 1FQOA 1NDHA 2DKOA 2DR0A 3C8UA 2XB8A 2I4LA 1E2KA 1D8TA 4P7KA 3ZGOA 4NXMB 2F3QA 1ZWKA 2YFHA 3EISA 4L3VA 3V7YA 2W4MA 2O2HA 4XWAA 3ROGA 1V8DA 3WE7A 3H2HA 5HK9A 3C98A 5CRIA 1LSUA 3M9WA 4ID9A 1C4OA 5A9TA 4E5SA 4XOIA 3O5AA 4GT1A 4EFMA 4KQIA 4DR7B 4PYOA 2Z98A 2EL7A 5B5SA 3DZCA 4WVLA 1C1XA 4WUVA 3A05A 1YZHA 2GYWA 2UYOA 1M8KA 4KQFA 4MIOA 3CEHA 2I6FA 2YRXA 4LNUA 4LYDA 3S68A 4F91B 1SU7A 4X1YA 2XGJA 2YVUA 4TXNA 3MK31 4U9UA 2Q5JA 4EB0A 3W5AA 1KC3A 4B09A 4DCVA 4P80A 5CHYA 3VR5A 2JI7A 3RHSA 4IIXA 3P9RA 2BFWA 4DB4A 1QU2A 2Y0DA 4TYWA 3H0CA 2Q5OA 3C7KA 3KTAA 1PWXA 4LDRA 1ENOA 3RW9A 2XOXA 3ONDA 5IJZA 3QVOA 4L9AA 1S2NA 4RY2A 3WOHA 1ZCJA 4UFPA 2CL5A 4RK7A 1DWUA 4ZYVA 1LX6A 4DCSA 3KE9A 4FHEA 5ESXA 3ZK9A 2HBYA 2P4EA 2PR7A 1FUYB 2BGJA 4IRXA 4FD3A 4L5IA 3NNDA 4BFUA 4RESA 4EA7A 4KFUA 1DCTA 2DAPA 2HAEA 2QMOA 1MN6A 4RMIA 1FPQA 3ASZA 5BUQA 3HXMA 3WYCA 4R1QA 2DERA 3RS7A 4CXMA 3OQNA 5G0VA 1MB0A 2JGRA 3PGXA 3JAMA 1JB1A 1UKZA 5JE8A 1UBTS 4LXHA 5H3LA 4C05A 3R7FA 2PK3A 3T3DA 1NQUA 1W8IA 2XKBA 1Y9DA 1RZ3A 1Z0ZA 4PFJA 3V8EA 1AV7A 1SWWA 1U9JA 2HHHB 2E85A 5HOEA 3FUXA 2OGSA 5CW2A 5DBHX 4QG3A 3CR7A 3DDOA 2ZTSA 3Q8WA 2JAOA 4K9OA 4UVIA 2JA2A 4XWWA 1G8HA 2VDVE 3L7LA 4LDJA 4MVJM 4YDHB 2HQ1A 2HEIA 1ONPA 2WNSA 3S5JA 1GEGA 3ZHOA 1A2OA 4ZPJA 1GCGA 2VQ6A 4O8CA 3ESRA 4LMPA 4QSHA 5EIFA 4IRMA 2JDIA 3TBKA 4CKEB 1E2EA 2XYVA 1TMYA 1P8JA 5JXHA 2JFGA 3HJGA 1I7NA 4ZJYA 2R8OA 3B6IA 1IPFA 1BE0A 4INJA 4F2WA 1YIAA 2OVBA 3CLKA 1XL0A 3EXAA 4NZZA 1XU7A 1VB3A 4U8HA 3VAZA 1NVKA 2G4LA 2GZ2A 2PMBA 4ZC8A 1NHGA 2CLHB 3MINB 1GP2A 3DEJA 3H1BA 4X9XA 2FZGA 4RHYA 3L1UA 2FZ5A 1LC0A 3KD2A 4B3DA 2Q5FA 3T54A 2I03A 1QK5A 2ODBA 1AX9A 1KPHA 2QYOA 1V39A 1XTRA 1B0ZA 3A4VA 3MCTA 3SVZA 4ZEVA 2ZM6B 3AR2A 4G5QA 3NTUA 4OV6B 1YQEA 4TZTA 1L5ZA 2ONJA 2IU6A 3V7NA 3AO0B 3DCIA 1R9MA 1B6SA 3TS1A 5BR8B 2V1UA 4ZEMA 3THXB 2XBUA 3DAFA 2JFZA 3NFRA 3HZZA 3PUYA 1RWVA 4QBIA 3NQ41 3LD9A 4DR5B 4FYWA 4MUIA 3WWPA 3RUFA 5CDUA 1BA3A 2B6NA 1Y6FA 1DPFA 4RVSA 1EUCB 1T9AA 1WHTA 3WNBA 3OC6A 4U2CA 4UNQA 5L45A 3DG9A 3W5CA 4KDEA 1WMAA 4C29A 3V1MA 3ZR4B 3A0RB 2GM9A 3A11A 3BXOA 4O5AA 2EG5A 2WIKA 3A4MA 3WK8A 3MRXA 1D0VA 1GCUA 2ECQA 1SEPA 2C3OA 1AIPA 3GH1A 3PSHA 4HEQA 1YR2A 1U1DA 4K6CA 4R5HA 2P2YA 4TPKA 5F5LA 5DHPA 4N54A 2AVNA 3B2EA 5T57A 2PT9A 2ZI4A 4GRAA 2G72A 1SM4A 4BYGA 4CKWA 3BDIA 3DOHA 3OUZA 4KXQA 3GRFA 3H5TA 3HBNA 1HLFA 1XZDA 4J2OA 3UKOA 1JG3A 4LXIA 1CZNA 4RFSA 5TJ9A 2X77A 3K5PA 5TNXA 3W8EA 3H16A 3SK0A 2VF4X 2JANA 3L0IB 4JA2A 4QDKA 3CEPB 4WOBA 5HFAA 5GINE 4ATNA 1U63A 4D9JA 4XLTA 4OOFA 3GAFA 3AUKA 1FJ2A 2ETVA 5AR1A 2F43A 4Z0PA 4YO8A 4BN4A 2V9PA 3HPRA 3ANSA 2JEYA 1XZFA 1PQYA 3IV7A 5K8UA 3U09A 2YW2A 5FORA 3T3OA 1ZK0A 1Q0UA 1IOZA 4OB8A 3EZFA 1YQQA 2P6NA 5IK2D 4BX9A 3VU3A 4A8JA 4DV3B 4FVTA 4OHRA 5SY6A 4Z4EA 4ETWA 3AM3A 3DDHA 1KVRA 2J4FA 1Y3HA 1II8B 3G0IA 3FFAA 3SF0A 1T2NA 1OZAA 4XIGS 3T0IA 1RWBA 2VHZA 3W0LB 2F6RA 3RJTA 3A3PA 1DFIA 4XA8A 1HYQA 3ELWA 3TQIA 4F3YA 3EBOA 1J9GA 1HDRA 2EFYA 2FPIA 1T35A 4PLZA 3PNBA 4QT0A 4D9GA 4GI2A 3KQPA 4V3CA 2Q29A 1SCKA 4L0DA 4HAVA 4OXYA 2A0XA 4X6YA 2DB3A 3HCFA 3T7CA 3ISTA 5U9CA 2AVDA 4F86A 2PAFA 3H84A 1P3JA 3RUPA 1W88A 3H7AA 3NHJA 5HFNA 2LIVA 4K87A 5EKUA 2OB1A 3I01M 5I4IA 3ZDCA 4PYMA 4LZOA 4KJZA 4Q48A 3DBIA 3WNDA 5FUMA 2MT9A 4P32A 1X7ZA 1YVEI 2YJ3A 2RJNA 1Q95A 3FIJA 3H0KA 3I53A 1E2QA 1DAKA 1RI5A 5JYDA 1YV9A 2DUJA 3D59A 3COVA 1GZ6A 3MJCA 4CMEA 1FP4A 1NG9A 1YIDA 5JAPA 1PJRA 1LSSA 1L9KA 1BWPA 3L7KA 4KVFA 4E88A 3FGNA 3STYA 3NAGA 4KFSA 3LLSA 1F17A 2NUTB 3GX1A 2D5BA 4R8LA 3BFJA 2C5AA 4WFIA 2L82A 3LUCA 2I1VB 5KYYB 1J1ZA 1M6YA 1SA0A 5IDVA 1JHZA 2KPOA 4F6LA 2H0AA 4YIKA 4ZTBA 4D4MA 1FQJA 1XJWA 1TIKA 2GMWA 3E9QA 4I3HA 4GBED 5K0ZA 3TX2A 1ORDA 1N9KA 2XR1A 4Q1AA 5I9BA 1ZCZA 3ROZA 4KTVE 4A3SA 5IJ0B 3AEKB 2EU8A 2FR8C 4FIDA 5KVAA 1KC1A 4KMMA 4BO5A 5FNVB 1N0WA 3IQWA 4K28A 3KKQA 1B8VA 4IUDS 2C1XA 3U16A 1G5QA 1DTSA 1T5HX 3CW8X 1XZGA 1C29B 4G37A 5TEVA 1ZD9A 3RJZA 1FFHA 2FEOA 3VPCA 3ZWQA 2OZLB 5DV9A 3KAQA 4YCLA 1QTIA 1M0TA 2ZXFA 4X63A 5G2OA 2HMTA 1B26A 4KQ1A 1CD5A 2R4UA 4KITB 1OE0A 1S2OA 2POQX 2QPTA 2AKAB 4K3VA 1X8KA 3D5QA 4ZCPA 2B99A 3C3YA 3HR7A 1NNSA 1WLSA 1I4LD 1Y33E 2PJZA 4FCTA 4BC0A 3ETCA 3DPIA 5BPHA 2NXEA 1UMDB 4ND5A 3TNFA 2XVAA 1H0SA 4NK5A 3GRVA 3WRVA 3RVJA 5EPOA 2D3TA 3EF0A 1HTBA 2CSUA 4LHYA 1KSJA 4S0ZA 3V9PA 5FAXA 1UXOA 3EVGA 2W9XA 1CLEA 1QF9A 1KI6B 1J07A 3LJKA 3PV0A 3WIEA 3GZ4A 5AI9A 4EQZA 1YL5A 2XT6A 1PVOA 4I9GA 1AC5A 2VHCA 1RWNA 1SIWA 2OSVA 2DHRA 1K5PA 2G71A 3LM8A 1UBNA 4K6GA 1KAEA 1MIHA 2C2MA 4PZZA 3L46A 1MABA 3LDHA 5D86A 2GCIA 2SKEA 4WMLA 2PXAA 2P2GA 1Y5LA 1JHAA 1XTJA 3NAZA 3IKLA 3I6ZA 1M54A 5BWNA 1EWTA 1U0GA 1J2TA 4HZUA 1JDUA 1R4MA 3H1FA 3JQBA 5ARBA 3EY4A 2VJNA 2W37A 5IFLA 4QQRA 2EF0A 5LIRA 3TUIC 4EO9A 1UDRA 1PKEA 3ZVNA 1A1SA 1SXJE 3PVSA 3HKEA 3LKBA 1GSIA 4V38A 1GPDG 4HAWA 1BAPA 4D5GA 3OT1A 4H3VA 3R9KA 4IRUB 1ZICA 3P26A 1DXQA 4AKSA 2UYGA 2VXBA 5C8ZA 3RJ5A 3WL3A 2YDXA 2HMYB 5BXYA 2D2IA 2ENWA 1RJWA 1RXIA 1Q57A 2LVBA 3H13A 4HWOA 4A2CA 5DDIP 1E4YA 1LLFA 2QTLA 1XX6A 5AW2A 1G8KA 2WTXA 3UQZA 4DMFA 1OI7A 2XYHA 1EXVA 1SBCA 3LC7O 3I2IA 4RUKA 5D6NA 3ZJ5A 1P8AA 2Q5CA 4JCCA 5CJ2A 3DWGA 4M55A 4J1QA 2O8DA 2DQKA 3LP5A 5CVVA 3M4NA 2GPYA 4IVNA 4PX9A 1Q1GA 1VTKA 2BGKA 3LIIA 4DCCA 2CNLA 3EIOA 2W2OA 2FLVA 4Q0MA 1G55A 4TROA 1QB8A 3ESYA 3H9JA 3PQ5A 4I1OA 4UCWA 1E96A 2GD1O 3OWHA 3L8DA 5DBEX 2CMGA 5DF1A 3OUUA 1BEZA 4YJGA 1DFGA 2OHFA 1Z28A 4BZWA 2W48A 3GDHA 3VVLA 4B48A 4B3HA 5JVDA 5J3JA 4COKA 2XCRB 2JGAA 2DH6A 1LJUA 4ZV7A 3SIRA 1YACA 4C04A 1JEEA 2CD7A 5DLEA 3WGQA 1Z6TA 1N8SA 3OCZA 4G97A 1M6NA 2HL6A 4K6OA 4KDRA 4B74A 2O23A 3RC9A 5C5EA 3ADOA 4H7DA 2COKA 2PZEA 4MAAA 2VDQB 1OBCA 2D0OB 4V24A 3RIEA 3V8BA 1S7GA 1MNAA 4NBRA 5J4KA 3A3KA 5KX5B 4W1PA 4X95A 2IEAA 2V6IA 4RJJA 4JX8A 4NYJQ 4G0UA 4Q3CA 2OM6A 2FW0A 4S1OA 3LWNA 3ZH9B 1R5OA 4P8RA 3I62A 1QHHB 4CDNA 1NE7A 3VPSA 4KI0A 1RLOA 1P5RA 4D9KA 3SCZA 1EI9A 4X3PA 1GKYA 5CAEB 5A0FA 3SM9A 3DO5A 3FZGA 4QTUB 3M4YA 2HSZA 3HBLA 4K9NA 4YXWD 5KTRA 3GP3A 4N8SA 3H1EA 5B6JA 1PX0A 2PJUA 4BKPA 1E79A 4NX2A 1HR0B 3OICA 1V41E 3B3AA 5CNIA 2AK3A 1TZMA 2DUNA 2YOGA 2RK6A 2WHPB 3LUKA 4YRRA 1I6LA 3WIDA 4U7GA 4BY9E 1DKMA 5JNVA 4QIHA 4KGXA 3QLUC 3SQOA 3HL0A 5TY0A 1N5OX 3F8WA 2E1PA 4LJAA 4Y2XA 3WTBA 5KS2A 3QEBZ 4CM4A 2L18A 3GRUA 1Q7BA 3PR1A 4URVR 1SVMA 1BXRB 3KQNA 1NFFA 3MWEA 5DM4A 3GVHA 5IAOA 1YFJA 2PUFA 4RK4A 5T4BA 4BO3A 3DBLA 4G8JA 4XVQA 2BFBB 3LY9A 4MQ4A 3STUA 1UBKS 1A9TA 3LO8A 4RD3A 4CIBA 3UJ9A 5JH7B 1C0KA 3AY6A 4U2EA 2EFCB 2OFOA 4IQ8A 1P19A 1GNSA 3F1LA 3OLWA 1H1LB 4CQJA 5CT6A 4EM6A 1M34E 2PLAA 2VRWA 3EWSA 1DARA 3HKBB 3NBKA 2QDXA 4TQGA 2F8TA 2BE9A 4FX5A 1V11B 4HEA1 3KQMA 4MWTA 1QFJA 2F62A 2GAFA 1W36B 1VSUA 4YRNA 1TEVA 1KAHA 1FFDA 2IBMA 1YJ5A 2GDZA 3I6IA 4IS3A 3RS8A 5KWIA 5DSZA 2E48A 1QH8A 4X3CA 3CXUA 1V1JA 1ML3A 3HYRA 2G06A 3F5MA 4FYVA 2ZE5A 3JQ8A 1UBSB 3B89A 3B20A 1QVVA 2NP6A 1QFMA 2ZRHA 5IN5A 3GGOA 4QQ8A 2VK4A 3O8OA 1V8FA 5E7QA 4D8YA 1ADGA 3A1VA 3AC0A 1T1JA 3SNKA 4U4AA 1IQUA 2JVKA 9LDBA 3FPCA 4AG3A 2IUUA 3PE4A 4I46A 3ZWVA 2FSGA 13PKA 4TWRA 5PNTA 1L7NA 3UXHA 1ZMXA 3UMRA 4FWIB 3UUFA 3NM6B 1GG9A 4PO3X 2YNMD 1UP6A 2O2JA 3JSAA 5ALUA 5BNFA 5KWVA 2HJWA 5FBZA 3ZKWA 4E15A 3ZE0B 3WGIA 4I9UA 3ZDAA 1PZHA 4QSMA 1NVXQ 1YS1X 1DE0A 2YXEA 3AR9A 4HEHA 4M6WA 5EIAA 5E9QA 3T0GA 4COOA 3KD3A 2BISA 4QARA 4DFDA 3HB5X 4MVJD 4JGGA 4ZOAA 5GONB 5A05A 3F7NA 3OECA 4FE7A 3BZUA 4AY6A 3RGGA 2CXSA 5DT2A 1LRKA 1QGZA 4JYAB 3GDOA 3TAXA 2VYQA 3VO2A 3DMGA 5LYJB 3QW2A 1LSOA 4R7GA 4B34A 4WZBB 421PA 2JNWA 3FDZB 3D7LA 3JXEA 1PQPA 2ZRLA 3NBUA 4FNGA 3T7EA 1NASA 221PA 2YMMA 1AS3A 3ELBA 3ZQ6A 4BX3A 1Z2PX 3S1AA 3L40A 2BBWA 3NT4A 2BDTA 2EKDA 4IX9A 5G0WA 3RSCA 3S70A 1H0RA 4ARZA 5H70A 1XZMA 3OKFA 3SWWA 1BWRA 2M98A 3UPTA 1Y8QA 1FW8A 3VNRA 2AJ8A 2YWCA 5LZ8A 2W6NA 1CRQA 1RNLA 5JDCC 2FFHA 3OZEA 5G41A 2ZYRA 1O94A 1QP4A 2DSTA 2HKIA 3DBHA 4K9SA 5JQGB 3A9SA 4OIMA 1YF3A 2RKWA 3EULA 3D02A 1DO8A 4HQOA 4U0JA 4QPZA 2H16A 2YZ2A 2P1DA 2AFHA 2AN1A 1OR8A 5AM4A 2FFBA 2G9RA 4L0MA 2PZJA 3E03A 2VJCA 3MGGA 2V74B 1E7QA 4CQLA 2WFZA 4EUNA 2VTBB 4PHGA 3K6JA 1NIJA 3T06B 1X7GA 1ZD8A 3HFJA 3IDSA 4WZAE 3KB1A 4YCNA 1XF1A 4BJ3A 2B61A 5JVDF 1ND6A 2ZRAA 4HNRA 3OWOA 3UWMA 3A25A 1SCJA 5JS2A 3U1VA 5T8KA 4WNIA 4RXTA 1Q1QA 3HCRA 4QQFA 5A3QA 2WABA 1N6RA 1YFZA 4HJXA 2EL9A 3IDZA 4EA9A 3U5ZB 2P9YA 3DMRA 3DZJA 3SEFA 1OFTA 3OZRA 2JCGA 3DW3X 2X19A 4UXJA 3RWMB 1ODSA 5HZMA 2IX3A 4P33A 1TA4A 3BOSA 3CX3A 3OFKA 4BE7B 1PSWA 2YHAA 4B46A 4D0NA 3EB9A 4Z1MA 5DHFA 1QM5A 2B8JA 2QJWA 2WOJA 3OZBA 4I4CA 3RSFA 2WT9A 3TQTA 4C01A 4IFIA 1ZSNA 1U9IC 2ID4A 3AIIA 4OHWA 1EFKA 3U40A 4LJLA 5HG0A 1E0JA 3BERA 3AVTA 2PTHA 4M76B 5TQ0A 3E61A 1PZEA 1L8XA 4KFRA 2RGYA 3KKKA 4MH0R 4PICA 1E89A 1JILA 1IY2A 1L7XA 2NPIA 2OFPA 3I2FA 3K0AA 5E6SA 3AZPA 2JLZA 2BHRA 3EFOA 3NVDA 3VPDA 3A4TA 1S8OA 2GRJA 1G3IA 3NAQA 3K94A 5ALMA 1PDOA 1UMCB 1Q16A 4TWBA 1GN8A 5HBRA 1R0SA 1C3LA 3MMSA 1Y6ZA 5FTMA 4WADA 2NWQA 3LL4A 5F2OA 4BAZA 4CIXA 3CLUD 2YIJA 4DQLA 4PZCA 1L4GA 2LCIA 2NTVA 1VYHA 3IAXA 3K0KA 3NT2A 3PIIA 3I6MA 5DH9A 3TAUA 4LF7B 3NDJA 1TF2A 5CCDA 5L3SB 5LR6A 5EWMB 4CCAA 4G4GA 4U5QA 1WS6A 3PJFA 5C5IA 4FI3C 5CURA 1NXOA 3PUXA 1DQPA 3DT9A 1QCCA 3DOOA 3ZZ1A 4PLGA 1BD4A 3G0HA 2IPXA 4BEWA 4B3FX 4AJJA 2HA7A 4JT4A 2NU6A 4IXDA 1JJVA 4QG7A 4DM4A 2MYTA 3U81A 1TQDA 1O95A 1SCQA 5BR1A 4LXXA 1DJNA 3K16A 1OXVA 3RYIA 4P6VF 2F17A 3AP2A 3N8NA 3RRJA 2YW9A 4DDUA 4M0LA 2CUZA 5EKTA 4BO4A 3GEEA 1XRSB 2FKNA 1ZK2A 4IFBA 1VGRA 2ODTX 4RVNA 3P2JA 3AVWA 3U4CA 2PT5A 3UATA 2GASA 5IDYA 3AM1A 1KE1A 5LDGA 3OCXA 4WW0A 1IM5A 3MJFA 3HB9A 2WJWA 1FYFA 3QE0A 5E9WA 5HPYB 1CY8A 4CTKA 2HV8A 4US1R 4CLRB 1Y6JA 2RH5A 4YAKA 1OH5A 2O48X 4KPUA 5I5EA 2HJRA 1OWPA 1VE6A 4BVLA 4RKQA 4B3GA 1V8ZA 1NBME 3JAKA 3L82B 2QDKA 4EHNA 4I66A 3TD6A 4GL4A 2NAFA 4N6OA 5CH3A 3HA2A 1DC3A 3WGOA 1GT91 2NU8B 1OD6A 4UQOA 1NWHA 2Q7DA 1DIBA 4GSKA 1I10A 4JJ6A 5DN6A 2UYYA 3IKTA 1XLWA 4NE9A 5BSRA 3AKZA 3B8EA 3D81A 1BFKA 2ZIGA 2QORA 4QJ4A 1TVKB 3N39C 2WAMA 4MS1A 4F8JA 4XOUA 2ZIUB 5KSPA 2NM0A 3STTA 3VYRB 4UHCA 4A6XA 1DKPA 1P1BA 2OVFA 5F1OA 3ICVA 3FPEA 4I4TA 4C3ZA 4LSGA 1PUIA 2ZYDA 3GT7A 1MAHA 4FMPA 4QAQA 2WLSA 4FGSA 4YP0A 5ALGA 4IQGA 2E1RA 3BVPA 4OHBA 1UBMS 4BJ5A 2QX8A 3K9BA 2JCSA 3F7MA 2PCLA 2BUAA 3OVMA 1EWYA 3C3CA 2D2VA 3FDXA 3U1TA 3TZBA 1UBHS 2YNMC 3AUUA 1T43A 3L1KA 4F12A 2JS7A 4W63A 3ASVA 3BJIC 1N1GA 2ISQA 1CUWA 2ZI6A 2A9FA 1WKBA 4HQKA 2ZCJA 2X8JB 2QQFA 4LXGA 1FRVA 4HWGA 4EPWA 1WVMA 4A15A 2KI5A 2R96A 1SKYB 5DN9A 4XGIA 4REOA 1I4WA 1DC7A 1TK3A 2C2YA 4Y0VA 4EHBA 4PNEA 4UNPA 2C2GA 4RY8A 1EA7A 3K9HA 4W9MC 1IMJA 4BFLA 2DFPA 5IK2A 1NI5A 4OLHA 1YTUA 4BCCA 1VIVA 4C4RA 5B1DA 4A0HA 4KQKA 1OVGA 3C5WP 4ZDKA 2HIHA 1SUIA 4TMWA 1DOHA 2CSXA 3BGSA 3EVNA 1CVIA 1SFRA 2Z6VA 4IJ5A 3R2JA 3BE8A 1TT5B 1Z4MA 5AFSA 3UAYA 5J1SB 2H1CA 4H18A 3CB2A 4L5BA 3R3XA 1F2DA 3HCCA 2AT1A 5AQEA 5CDGA 3NCTA 4S2EA 3R3ZA 4BWVA 2K7FA 2O8EB 1NJSA 1POWA 3OFJA 4IQFA 5EIOA 1B43A 4MUGA 1WZCA 3A14A 5E9AA 2QIPA 2BWJA 1JHQA 4IX1A 4AZ0B 3Q3VA 4EO7A 2O54A 3GOQA 1T1GA 2XNJA 1U4NA 1OKKD 1D0SA 4BFTA 4Q9DA 2R66A 3IV6A 3PDHA 1DX6A 1OUMA 2A4KA 3KOUA 4F7WA 1E0KA 5JOQA 1KFEB 2PZBA 5AUNB 5BUSA 1KYYA 3LLMA 4P34A 3ZC3A 4B31A 4BXOB 4M7WA 3SJAA 1QS0B 4ZYZA 1JHUA 4R2KA 4AP6A 4IFTA 4E7OA 1OLXB 3IBCA 2QNIA 4IWNA 1EP9A 2RD2A 4NCBA 5FTJA 4R6WA 4R2WA 3WC4A 4BKMA 1PKXA 4OJTA 3V1TC 5CFMA 2AMYA 3I3OA 1MHTA 2IY8A 2HC9A 4FK8A 1PU2A 1FS4A 5F3DA 1VE5A 4FYYA 3CMMA 3QI2A 2A1IA 4EB6A 1THGA 2WYOA 3R77A 2PQ2A 4AKEA 2XUGA 4AC9A 3EGXB 1KVQA 4ALJA 3FNQA 2J9FA 3EODA 3MWDB 2IVZA 4XUCA 5I51A 2ID8A 2MSDB 4D43A 3TI7A 1NGSA 2AMJA 2BRUA 2N75A 2W6OA 4DDVA 2QUZA 4B40A 5HGXA 2QS9A 1YQWA 3E35A 2CD9A 1DRWA 2PWZA 2VYVA 2UVDA 2WSSD 3EXG2 2BIFA 3KPJA 4BTEA 2C4KA 5LD2B 1AHNA 4K8RB 4TYMA 4AYXA 1T2VA 1UEJA 1QYCA 1Y3BE 1NUUA 2EWWA 4WT7A 3G6WA 4AJKA 2VDRB 2PBLA 3ODPA 1MR3F 4ZOEA 1VSBA 1HSOA 1DEAA 2QD5A 5BW6B 5DX8A 4ZVOA 4FPXA 5HJ2A 1FK8A 3EIHA 3KAPA 5AM1A 1X9GA 4KWEA 4DUGD 1LPBB 1E2NA 2J0VA 2Q62A 3NKFA 4QEZA 2I4TA 3R6LA 3CLUC 4FW9A 1XZJA 2NGRA 3DF9A 3KSUA 3WSVA 1VP9A 3NHYA 2O3SA 4R8KA 4WBXC 3C0KA 4G0ZA 3TTTA 4DLBA 4N18A 1NOKA 3I64A 1G291 4RIFA 3CZAA 3M9LA 2AI1A 2IE0A 1E5VA 1RC0A 3GLKA 2CHGA 2I99A 3AF4A 3WRWA 1CJUC 1FLVA 4XRGA 4MRMA 6NULA 4WN9B 3K0EA 1NG1A 3R3UA 5AW7A 2V3VA 1GPLA 1V8OA 1QQ7A 3WLSA 3OCWA 3CUYA 2NLOA 1R27A 2YWFA 2Z0MA 2W6ZA 3ENZA 1NMYA 4LPKA 3QHPA 1EAMA 2CEKA 1K92A 1L5RA 1VE9A 5FWXB 4MDFA 4ZVKA 2C7PA 5D84A 4J1TC 1L5YA 4HATA 1OVMA 4LY6A 3TYXA 1PYGA 3DZIA 3LI2A 3WJAA 4AO6A 2H07A 2ODNA 5IKPA 4M1QA 4JNKA 1L8OA 4XJSA 2WU8A 3KQKA 5JS1A 4FUQA 4HAOA 2J48A 3C4QA 1UC5B 3D0RA 5JAMA 3PS9A 5B37A 3HJNA 5PGMA 5D3ZA 4JLNA 10MHA 4PG7A 2BEWB 3CLHA 1V6SA 3RIYA 4RV9A 1UMBB 2XEXA 3TLJA 4EF5A 5C52B 4JI2B 4KSYA 1GFZA 5EJMA 3GJ0A 1Q0ZA 3H2JA 2R1VA 3K6SB 2MU1A 4I4TF 3KLMX 1PZMA 3DE3X 2B34A 1K7FB 3LHIA 4H1TA 4TLLB 4R2HA 1W30A 4X7BA 1PWEA 4L5JA 4BO0A 1VL0A 4U9IS 3KTDA 4KZKA 5GV8A 3RFXA 2PUTA 1WHSB 2BN4A 4RF4A 4OJYA 3C2QA 3PLNA 3TPCA 1VL2A 2WIAA 4G0PA 3DFKA 4ME6A 1X1SA 2FCRA 2VKQA 4OQPA 2W00A 2IUEA 1JIJA 4ETIA 5KJ6A 3N70A 3Q6IA 2QXUA 4W4TA 5IABA 3V42A 2A9QA 4X20A 1HM5A 1PJ4A 2P9TA 1U9IA 2PLWA 1G8YA 5AIBA 1ZGBA 3HGQA 1W9HA 4H1VA 4IOMA 1QHEA 5HM8A 4LPSA 4RACA 2MR6A 3KP1A 1FZQA 2HPVA 2G5GX 2M1XA 3P9IA 4UMVA 4BPBA 2Y1DA 4YFVA 2JJYA 2UVQA 2EJWA 2RSLA 4UD2A 1MLDA 4YALA 4HZIA 1ZI6A 3FM9A 4HDCA 2VSOA 5ESWA 4A23A 4HGQA 1IK4A 1KK3A 2C8VA 1FYEA 1WW8A 2ZWAA 4YRZA 4ZODA 1DIRA 2YWBA 4NV0A 3H42B 5FKJA 2GVDC 2ICAA 1ST2A 3KLBA 2O52A 4J0DA 3A9VA 3OJLA 2B8EA 1U98A 2FP4B 2HDNB 1FU7A 3O3OB 4OH1A 1WZ2A 2R6JA 1OAOA 1JLSA 3QKRB 4B3BA 1NVGA 4QDJA 2I6UA 2GPAA 4IJQA 4M1KA 2DFDA 1O8BA 4Q4JA 3JV7A 2D54A 3HCPA 3EGCA 2BSXA 2IGBA 4L2IA 1AE1A 2HN9A 4Q15A 1Y3CE 1H2BA 1ONBA 2CLDX 3I3SR 1C3XA 1S89A 4CFYA 4EI2A 3GDWA 1P5ZB 2XXBA 4P7GA 2EQBA 1QK4A 1THZA 2QF7A 1MJHA 5IG2A 1YQGA 2PKWA 4JIGA 1WXFA 3ZN2A 1T9DA 3ZV5A 5EHNA 2XWQA 5DKFA 4X8HA 4PG8A 5GADl 4G5OA 4BB9A 2HSJA 2PEYA 5IBRA 3A9CA 5FBRB 3TWOA 5BYAA 3UN1A 5CXSA 4E70A 1NXQA 4MHTA 2CE2X 4MW1A 1ULUA 4ZV4A 4O4LB 4UZEA 2HMVA 3FWZA 4BKQA 5AM2A 2ZSFA 1Z0DA 2FF5A 4HAYA 1QKKA 1DWOA 3ZBTA 1CZOA 1UWKA 3X1DA 5CT8A 3ZWAA 4MIEA 2V96A 2MINA 3SIWA 4JT2A 3JVVA 3PFWO 5MFZA 1II9A 5EXTA 5GY7A 3E7FA 2HU2A 2LBPA 3ZWWA 3PJGA 3AKDA 4A6PA 1CQWA 1P29A 4YVFA 5KNBH 1MDFA 3I1YA 4AMGA 2IPMA 1T5DX 3TW4A 2EZ9A 5A9SB 2G5TA 2P5UA 4TT8A 3OTQA 3AG6A 5K09A 1UJ4A 2CWWA 5FPSA 1SUCA 4BNNA 5C5DA 4NR0A 5IYZB 1JWAB 5EXXA 2QRKA 1F60A 3P45A 1ATIA 1BJRE 4R83A 1I2BA 4MV5A 3BXFA 4TLCA 4F6RA 5IN4A 3H86A 3WRYC 3PXBA 1PHRA 2WQZA 1RM4A 4BZXA 1N36B 4FSDA 4H1WA 4M0DA 5KQRA 4WPGA 4MRPA 2UYQA 4YHHB 3FOZA 3OC0A 3M0EA 1Y1RA 1NAHA 1MAAA 2O20A 3ND8A 1E0SA 4P38A 3NB0A 5E4TA 5J23A 5T67A 3F6SA 1N7HA 4YAGA 3JPWA 1Z6ZA 4G8CA 4XUDA 1CS0B 3M5WA 3TOCA 3WP0A 4C6SA 4YJ2A 4JU8A 3UMJA 4C7MA 5B6PA 3RUDA 2CFOA 3MVEA 3OLVA 3ZZMA 4YO7A 4AJOA 2ZUBA 1PX2A 1Z16A 5EERA 1RI1A 3LBHA 1CJVC 5IFKA 1Q83A 4C0LA 3AV3A 1OASA 4WVFA 4QVKA 1EDBA 1SD2A 3I05A 2RGXA 2ZSUA 2F8MA 2O2EA 4MPDA 2JLXA 2B30A 2YWEA 1SVOA 1QORA 3WK4A 4MVJA 4BBJA 1ZM7A 3L7AA 3TD2A 1ESNA 1ZN7A 3G5AA 2A0KA 4EGSA 5JSUA 2CJFA 3QX3A 1VL8A 1YB4A 3ZNPA 3ONVA 2NZXA 4KXYA 4CF6A 4LF5B 2Q8NA 3G6KA 2JGFA 3MLBA 2VHQA 4UBMA 1PEKE 3LPLA 3VYUB 4EIWA 4P3YA 4TKUB 4B4OA 1GRCA 2I65A 3S40A 1ESDA 2BMWA 2EWVA 4KIJA 5HHTA 4YN3A 2P0YA 2C9ZA 3MQ4A 5C51B 3LRXA 3Q11A 3P9CA 2PMWB 1SC3A 1HDOA 2BJVA 3OIWA 3QBVA 4MVXA 3WQBA 3C97A 1OX4B 1J8QA 5EIHA 4BGEA 4BVBA 2J0SA 1I0IA 1ZDMA 1WXIA 3KJXA 4LE2A 1HH4A 3Q1KA 4GM4A 3QE9Y 3BXPA 5L3QB 3O84A 1KDVA 1D0IA 1RYFA 2WMNB 3OPNA 2WIDA 1A9OA 2DFKB 2XUZA 4XASA 4IIUA 4Z4HA 1M10A 1E60A 4PHHA 3BRSA 3KQVA 1XQYA 2QVXX 3ZQ4A 5GWXA 1CJCA 4ZEOA 5C80A 2WG0A 3FJYA 5IH3A 3BWMA 5M5BA 3QFSA 4EYQA 4Y9SA 3W79A 1FP7A 4RCYA 1IB0A 3PB3A 4FBMA 2G70A 1NFRA 4TVBA 4M22A 4H31A 2JI9A 3WL7A 1RBMA 1VB5A 2TMYA 3G9UA 2C0CA 3G88A 3GEHA 3HY6A 1ZD4A 4MTLA 3PC4A 4OHXA 3T1NA 3X1WA 1WDKA 1WUKS 1WXEA 3KZXA 5JJKA 1NVVQ 5HK8A 1G2QA 1YKSA 2PY6A 4FFMA 2QZSA 1RWWA 4RQTA 4V39A 3IPAA 1VSQA 3IB6A 3K9WA 2Y1WA 4NTZA 3TL2A 4B6JA 2BFEA 3AL0C 4IJUA 3VKWA 1M2GA 4OQNA 3ONNA 2EFEB 2EJUA 4PM4A 3AZQA 2L19A 3K0FB 3P97A 4I1SA 4RA6A 3UK0A 3M6FA 3R41A 1JIXA 2FN4A 3LT0A 4MINA 2PT7A 1M0WA 2BL4A 2Z2IA 3AF5A 1KY4A 1T0HB 4XVRA 4ABTA 5EL0A 1FTWA 1NJ2A 2AE2A 1KXJA 4RHFA 3SHTA 3U13A 1HFKA 1E3TA 2LNDA 3HJRA 1SC4A 4GBJA 3W6OA 2PUCA 1PTJA 3KLOA 3N2LA 2ATXA 2YMPA 2YHIB 3HDVA 2VR1A 4NBWA 4RZQA 4CEJB 4OSEA 5EE9A 4M46A 1GV1A 4XDZA 1KRHA 3MOGA 2ZCUA 2BZ1A 5BVGA 3DWEX 3ST7A 5CVTA 3HJAA 4C0WA 5L51A 3S2FA 3AUAA 2BY4A 4TGLA 1V3TA 5F77A 3OX2A 1IBCA 3SM3A 2GPNA 1JHDA 1JDBB 2JJ8A 4W8OA 1UBRS 2YVQA 1WPRA 2O4CA 4RABA 1HE4A 1I2ZA 2AFRA 4HYTA 4UDNA 1DT3A 4B2YA 4ZGGA 2Z56A 2D13A 2Y68A 1XCOA 3M1YA 1VCIA 4GGOA 3QBTA 2REXB 4WCFC 3KETA 4HXGA 3ETNA 2OSBA 3UCXA 3WQQA 1WB9A 4RTJA 2CLLB 3GJ3A 5JO0A 2DTEA 2F1RA 4X8LA 4R1MA 5G4LA 5FPYA 3V3TA 1Z7GA 2PFSA 4UUBA 3VC3A 4BRUA 3U7QB 4AY4A 3DLCA 1E9EA 4TTPA 1AQJA 2AZDA 3MRSA 2EKZA 3ROQA 1E2LA 1JU3A 2H85A 1EA5A 2R1TA 4WAUA 1V8BA 2P91A 4UBLA 4YI3A 4HQRA 5FV7A 5CG1A 1MCZA 4Q82A 1SAYA 4CVNA 5DP2A 1RYBA 3QBEA 3FDJA 3RTCA 4MI6A 2GEVA 1OXSC 4FKBA 3ZV3A 3CVWA 3LQ2A 2VPTA 4PYRA 3CISA 3LS2A 3EDCA 1CU1A 1EJ6A 3IEKA 4N0MA 4UDYX 2C03A 4CE6A 2WUFA 1KMNA 1XR3A 2CHFA 3I01A 3IS3A 3ZHCA 4EJFA 3PE6A 1SOAA 2DPYA 2NSLA 3RHZA 4I8XA 4G2TA 3AFIA 4GYYA 5CXXA 5F2KA 1MX1A 2IY9A 3AL3A 4G5SA 1RM0A 3G7NA 1N6LA 4J1TA 4DDTA 2D1FA 4G0OA 1ZYUA 1NIPA 2JJ1A 4M8NE 1MIOB 1JJIA 1CY0A 1XA3A 1NQOA 4U7HA 4KE7A 3UHPA 3H5LA 3LUBA 1M6VA 1UANA 2VC2B 2AJBA 3HU2A 4FDTA 4UTVA 5ECWA 3K0SA 3T7SA 4CYMA 1IULA 2ZYVX 3I5UA 3ADKA 2GZRA 4JYBA 4NJMB 3UOGA 4ZYXA 1PT7A 1CT9A 2JK1A 3BHJA 4YJ2F 4ZU3A 1ORVA 4Z2AA 5EZSA 4MWBA 5REQB 3IILA 4G5FA 5EAIA 3BD7A 1Y7LA 3E18A 3GG2A 3BB3A 4EARA 1XQ9A 5JNRA 4M8KA 5C1BA 5KSYA 4WECA 4D3XA 3GV0A 4LCEA 2F90A 5IKMA 2WD7B 5EIXA 2SBTA 4OMDA 4FJ1A 3A1DA 4NULA 1DBVO 1OZFA 1PWZA 1YOVB 4EDFA 2GZ1A 4MR7B 1RW4A 4DA6A 3M1IA 3KUKA 3PPVA 3QUSA 1ZD2P 3R3YA 2P6OA 2V7BA 2FWRA 1E2PA 2QVYX 3IURA 3JQEA 3MHPA 4NOMA 1VHQA 3PYMA 4AY2A 2Q1YA 3RUIA 1E0DA 4MVJF 4P3OA 4UREA 1EPUA 3DNMA 2J3IA 2BHLA 1IWPB 1XCLA 3CNEA 4F71A 1J56A 3MTBA 1ZOPA 3IOMA 5M2QA 2H5JA 3SSMA 1PDVA 1K4MA 4KE9A 2QG9A 2V7TA 4LHSA 1OSNA 3LP6A 2Q7XA 1PDWA 2JL1A 5CA0B 4B4WA 4MQLA 3TLGA 2LDBA 3TKYA 3REQB 1RJFA 2ZUSA 3QF4B 4ZO7A 3DSRA 4D4HA 2HA0A 4ZTUB 1IQRA 3MBKA 3ENWA 4UEKA 4AN4A 1G17A 2WICA 1D04A 1XMJA 5IUKC 1TM3E 1Z0FA 2FN3A 4J6EA 4Z7QB 2C5SA 3DW1X 2IS1A 3VH4A 5E8JA 2HK8A 4L3WA 1F3OA 5F1KA 2JLBA 5EQJB 4MB0A 4B6EA 2RKOA 4M1WA 1CQIA 1X0XA 3FMPB 4CKCB 2Z5LA 1AHHA 4U7DA 4J0FA 4A0FA 3THSA 1W96A 2HJ9A 4GZLA 1W4ZA 4RZUA 4TS9A 3PQCA 2XD4A 3CKMA 3T1VA 4CQNA 1ISSA 4FFLA 1EESA 3HM9A 3BS4A 1NVBA 2YJGA 4I5GA 4RMNA 3GARA 4MVWA 4O4JA 1J7KA 2BFFB 3DH0A 4A03A 5JIBA 3MGAA 2WINI 1YZNA 3SC6A 4RJKA 2NUAB 2WYUA 1W5SA 3EVAA 3H97A 2DHDA 3H9EO 4GX1A 4RPIA 1PZXA 5KNCA 5ER9A 2DHQA 3FPSA 3HR8A 3BG5A 3P9XA 5FO1A 5C18A 2ALJA 2WZDA 1X86B 1KF0A 1AGRA 1NQXA 2YHUA 3PNPA 1ZWLA 2DLNA 4PQRA 4UVHA 1Z0IA 5FUQA 2BHNA 4NXNB 1KYTA 2RGCA 3QV2A 3T61A 1UJBA 3GPBA 3MFYA 4NICA 1I7PA 2QVCA 2R97A 1GQYA 4IXTA 5F51A 1R4ZA 3N8DA 3FMFA 5M7EA 2HSGA 4OKSA 3R9XA 1OGJA 2QLJA 1U5BB 1V43A 4MTCA 2XADA 5LMZA 1T10A 1Z8DA 3U7HB 1K0UA 4U1RA 1FE8A 1GYQA 2I4NA 3HVJA 3NTRA 3FPGA 3B1XA 3LU1A 2PL9A 2OBYA 3OJFA 5BSTA 2G1AA 3S99A 1YHYA 5FBVB 4GOOD 2Q6LA 4ZCMA 1OTHA 2HI0A 3RFCA 3VXKA 3ZOKA 4R1OA 3OOSA 2J8ZA 1IZZA 3JWGA 2HHCA 3V7WA 2E0IA 2BP7A 1KZ6A 4MQ5A 3N0VA 4YACA 3OAAA 3FUUA 4ECEA 4LYGA 4PVDA 1XTKA 1XI2A 2D2FA 1IVNA 1RCUA 2DX7A 3D8SA 3U26A 2FW1A 3H6GA 4C2TA 2R79A 2GCNA 1P1JA 3PT5A 2B78A 3B38A 1TKBA 1KFKB 3MBIA 3MBOA 4HLDA 3HXOA 2AFVA 3CKLA 3IT2A 3JQ7A 3MSXA 4M1ZA 4R1SA 2FVYA 3ZLBA 2QQGA 1ZR2A 4HB0A 4Q18A 3GXOA 1GD1O 3R3SA 2RHCA 2WSSA 1HEYA 2K2QB 2NVWA 3IHWA 4W5JA 3VJKA 3IHTA 3TOZA 3UH0A 2NVUB 4CTMA 4OXXA 4F92B 1FYXA 1B2RA 3F96A 4V0LA 2QZ9A 1TM7E 5BW4A 5EJEA 3PHIA 1AKVA 1F3LA 5EMKA 4DV7B 4M99A 3G2QA 1MTOA 4Q4HA 1YRBA 2JEZA 4HI0E 4MLZA 4JUFA 3DR3A 4B6PA 1JWBB 1O03A 3R09A 4N7RA 1L4EA 1XNHA 1C4KA 4HHEA 5FD8A 5JAOA 5JAZA 4FYHA 1NN3A 3SJBA 4A26A 4C88A 3RJ9A 1FFXA 3UWDA 4BE4A 1C30B 1N2GA 2ZYUX 3CIFA 3WZLA 3S1SA 1N8NA 1WCIA 4QM6A 3KQOA 3D6HA 4WUTA 1H65A 1UBCA 4WZBE 2Q49A 1WUJS 5KDLA 1N6IA 3IE1A 1WSWA 2V4MA 4G67A 3TIIA 3N86A 1CJKC 4CV3A 3EW9A 1IUKA 1NVAA 3LUJA 1OAKA 1A7JA 3QEJA 3PD1A 4BCDA 2WAXA 1KP3A 4PRLA 1VLVA 1L5HA 4CTJA 5JPCA 3VPXA 1AO0A 4LBWA 4DILA 1A5SB 4NPAA 4C5AA 2H2IA 4GRIA 4P93A 2V3WA 3WB1A 5A2GA 2YWDA 3KS9A 3LF1A 4QYIA 5KJCA 1J0CA 3QMMA 2EX0A 2DM6A 1CE8B 2OC9A 4OEHA 1X1RA 5ADWA 3NG1A 4M0PA 4UNSA 1JZQA 1EG2A 4DIMA 3BMQA 2VWGA 1FLDA 4Z86A 4BMZA 3U3OA 2I9KA 4DG5A 2B7CA 1IHUA 3DBRB 4DIFA 1CQJB 1RSZA 4EGFA 3NUQA 3T0FA 1MJ5A 2X0IA 2IUYA 2YJNA 1NW7A 3ONWA 5HRUA 1DKNA 1Z4NA 3JPYA 4UJ3A 1RQGA 2I22A 1E7WA 4H15A 3OCCA 4FQ7A 2VH2A 1NF9A 1XKLA 4MGIR 4ESEA 1TM1E 3KJFA 3N2YA 2WF5A 1KIAA 1TO1E 2F3SA 3Q2IA 2QR3A 5EUCA 4TXJA 2RE8A 1F7UA 1VMAA 4C22A 2X4GA 2YJ4A 2BGMA 4G84A 3LHKA 3PQEA 1RTKA 4ZT5A 3E2MA 1RAHA 4P7FA 4W1RA 5E8RA 3AHCA 1ONOA 1JQLB 3DEHA 4TWAA 3SJ7A 4BMYA 2JG3A 1AKMA 1EFVA 1RXCA 1VL1A 1Q6ZA 1JI0A 2IS4A 2R2GA 1KAQA 3DOUA 1R4MB 4PTLA 3MOSA 5LVAA 4B75A 5CD9A 5H8WA 2IXFA 2H7VA 1K5DA 1GNRA 2I76A 4UZFA 3G8YA 1X15A 3TW8A 4EL0A 1MA3A 2GWHA 2V97A 3CVYA 3U3ZA 3QFCA 4MLCA 1X13A 3ANNA 1E18A 1ECCA 4W8HA 3UMMA 5L7WA 1N7GA 2I54A 1T25A 1VIMA 1RMQA 1VP3A 5C9ZA 2QR2A 5IUJC 2B5WA 4OU5A 4QBHA 5ADVA 5IJWA 1GPBA 2W6JD 1LLUA 1X87A 1YRHA 2J31A 3QKIA 4PWYA 4O4JF 3P5SA 1JYFA 2P4HX 4BQSA 1CY6A 4WCFA 2I3BA 4G0YA 4RELA 4DDMA 4CLXA 4I6EA 3NBYC 8OHMA 4OHYA 4PBTA 2O8CB 5L95A 1A5BB 2HBQA 3TLKA 4ENPA 2BVNA 1VBMA 3NPAA 4JJFA 2XTNA 3OPYA 4TLEA 3GJYA 3L06A 4U00A 5BRJA 3U6BA 2A14A 4YEDA 1E3LA 2QRHA 3F3KA 3VUEA 3A70A 2F00A 1BN7A 1PO7A 1UPFA 3W8RA 4AICA 4IM7A 4L51A 1Y8ZA 1D2RA 2N47A 4YAWA 3IAEA 1E3QA 5LB2A 4KQGA 2F7SA 4YASA 4PPNA 3FAKA 2Q9UA 2GN2A 1ZNZA 2XWSA 4GC9A 5EHQA 3VA7A 2NO0A 3OX3A 4P3PA 1U8TA 2NTEA 2R5WA 3NEPX 4WNYA 1UWVA 1MENA 2VA9A 3LUDA 4P1ZA 3VYTB 1FJHA 2AC4A 1H5QA 3DMHA 4MDYA 4AECA 1UDCA 3ANXA 3OT4A 4FEEA 4DBLE 1I5RA 4RVOA 3GT4A 2A0FA 3P9SA 1YZQA 4J90A 2RCNA 4JLBA 4X97A 4S1VA 2EZ8A 4ZU6X 2QV7A 3UHOA 3OZAA 1C7RA 3QA9A 4NAVA 4DLLA 2XGOA 4GS5A 3SAJA 3CZPA 1DZ3A 2ZJYA 1ZRSA 1XZ8A 2B94A 4PEVA 4WJLA 3B6ZA 3I9OA 3LP8A 1RKUA 4GQBA 3A2MA 3GEDA 5IAEA 3TTXA 4DNPA 3PDIB 5CMLA 5BWCA 1U5AA 2ATVA 3UXEA 3K05A 1T3TA 2VTEA 4YT5A 4J1NA 4QTTB 3N5KA 2DFLA 3NASA 3E9CA 1TUEA 1ZK1A 1IOLA 4ZDWA 3EMKA 4P3XA 1I6WA 5LC1A 4MUBA 1DCKA 5ITZA 2WTUA 4CT5A 2XRMA 2OUIA 1IZ0A 1JDPA 1WF6A 3C5VA 4PAOA 5CFPA 1L8QA 4JZYA 5FQOA 5HZKA 1WQ4A 3LECA 1OFHA 4G0QA 3H19A 1SEVA 1GRVA 4OQFA 1ENZA 1HDCA 2WM2A 1QANA 2Q6OA 4E5PA 2E5WA 1LDNA 1VGVA 4HLUC 2IEYA 4QBKA 1KBOA 5LKRA 4UHJA 4YTEA 1E6EA 3FKQA 4ZGWA 2Y0CA 5C4IA 2E6UX 5DIFA 3CF2A 1JH8A 1BWQA 2Z9DA 1QFZA 1X7XA 2HIMA 2QTRA 5K3EA 2W2PA 4Q24A 4TZ6A 2H31A 3IAHA 3N2KB 1A27A 3H2SA 4QYXA 3COZA 2QAJA 4D57A 3BMOB 3JQAB 3EXHB 2DPHA 2JFWA 1KMMA 1E4EB 4KREA 1G21A 1OLUB 4BRWA 1V47A 4L7VA 3DYIA 3SZRA 3ZCTA 3HU1A 1MVOA 1Q0RA 1W4RA 3IXMA 4L8GA 2CCGA 4Z9XA 4DIBA 4H35A 3DLAA 2D2XA 1OC4A 2XHEA 3H3JA 5DLYA 1ZD5A 5B7QA 1UZMA 1QB7A 1EZ4A 1VRWA 4HDNB 4BNZA 1DBWA 1SKYE 2NZUG 4WJKB 2CJYA 4BX2A 5KHOC 2PLNA 3KM0A 2NP7A 1F5NA 2RG7A 2XGGA 3RV3A 2WAOA 1I1NA 5BWMA 3Q8MA 4JLPA 3HI4A 3IRVA 1RAFA 4JXKA 5EZYB 3N6XA 4YHBA 3O2QB 1PJ3A 1S2GA 1VLLA 2HCRA 1UFVA 3PHBE 3Q3HA 4HFRA 4ND2A 2PYIA 4OFXA 3MGCA 1QH1B 4QHSA 4WBSA 3ER6A 4EUFA 4YRTA 1OIVA 5E6UB 3TNJA 1FA9A 1SCUB 1Q0PA 4IJWA 2I71A 1T4BA 2KQUA 3NVAA 3O03A 3P2MA 1LVHA 2Z9CA 1BDBA 3F5SA 1IHXA 3FHOA 4LYAA 5T4EA 3ZNNA 4XD2A 5DGIA 4BO6A 2ORWA 1W5EA 1Q44A 1Q21A 1HQKA 4JOSA 3VDRA 3WDLA 3HABA 1UFKA 5ICCA 1ZH2A 2B3TA 1ZRNA 2CDAA 2XYQA 3OQIB 1QQTA 2WM8A 3DPSA 3T38A 3EY9A 3T95A 3DAHA 3WLAA 1RZVA 4G1MB 4WNCA 3T7JA 1GKLA 5CB6A 3N8GA 3FYSA 3DOIA 4ZI2A 3P9PA 2VPYA 3Q3JB 3HKDA 2VAVA 1IN8A 1QHIA 3R7BA 2VH1A 4M9RA 1W44A 1P1IA 3STXA 1ZR4A 3DXYA 3FX2A 2TSYB 4MSUA 2OBBA 2VT2A 3JD4A 5AW8A 1YS2X 1NZFA 1PQWA 1EU1A 5TQJA 3KSAC 1R6UA 3C3XA 1ULTA 2IXEA 2IU0A 4O1MA 3V34A 2JA1A 4PLVA 4BC1A 7ADHA 2IH4A 4G56A 1Z4PX 1B8NA 2I6GA 3QLTA 5ES4B 4X6XA 2PFKA 2E37A 1DQZA 3NDPA 2ZGVA 2VJYA 5IEJA 3P94A 3R23A 3SYNA 3EOBI 2WMDA 1KOJA 1TTTA 3OCYA 5EC8A 2GF9A 1VC2A 4U0KA 2ZRJA 1SBIA 1E1CA 1MG5A 4OFBA 3WA6A 5AOVA 3ZOZA 1W5FA 1F8FA 1EUDA 2WJVA 3LF2A 2JIMA 3I2GA 5IF9A 3RARA 3GNSA 2A2ZA 5DXJA 3QRWA 5AICA 5B3JC 4EHAA 3LO5A 4ZRDA 1ODLA 1JFFA 5D2CA 2J3LA 2GCGA 2H1SA 4ZVTA 3X0DA 3HXPA 2Q3FA 3GK3A 2I1QA 4D92A 4KGZA 1GAEO 4XTRA 2JBAB 3G2MA 3M34A 3SNHA 3MRTA 2XUKA 1NKVA 3V9AA 3A3YA 1CQZA 2HMSA 3F6CA 4OL0A 3TSOA 5IXYA 4I1PA 5AK3A 1E61A 1NLMA 1NW5A 2W8BB 1MO2A 2HJGA 1COWD 2PX0A 2PMEA 1NTRA 1YCDA 5AESA 2PGOA 3ADDA 2E4WA 2H1HA 1ZCBA 4NATA 3O9MA 5DXFA 4HADA 3MCAA 4JL6A 5TPWA 1EFHA 1XEAA 2Q3JA 1H2XA 2CBXA 2QI9C 2EKBA 4IIDA 4WL0A 3IH5A 4EAAA 3UTDA 4ARCA 2BFDA 2H2DA 2R87A 4B82A 2BUCA 4DRYA 4JNCA 2IVFA 5AXDA 2OWEA 1ZU5A 3AVQA 1FP1D 4S0XA 5CK5A 1U1FA 4BQRA 4Z7OB 4OQDA 5CM8B 3KVYA 2OQ2A 1MRNA 2A5FA 4JB2A 3TEMA 3W2HA 5CDFA 1TFRA 2E55A 2FPPB 4HQ0A 1M2JA 3D3WB 1FX0A 1CUBA 2FG6C 2R84A 5A4AA 1NV9A 2PL3A 3T7IA 1YMUA 3G5LA 2F1OA 1XF9A 4J07A 4OK3A 1P77A 1E3MA 1M2EA 1YOBA 2VDWB 4YCMA 3JD2A 3O94A 1OA0A 3GCWA 3RYCA 3QSGA 1XXHE 1HC7A 4NCAA 4WESB 5IKEA 4F96A 1FSPA 4DGSA 3QNWA 2IHBA 2H5LA 4I9NA 4OAPA 5EJAA 1OBOA 1ZUHA 4ITRC 1XCPA 1KO7A 1N2EA 5C8YB 5K0SA 1Z62A 2PTGA 1LF5A 2WJJA 4MKRA 5DLPA 1F2TA 4HTFB 2OV6A 4MLDA 2OWDA 1CZLA 1YZGA 5B58C 4KX5A 4XVCA 1IBSA 1X8JA 3PEUA 4GP6A 2QLLA 1RKQA 3CX4A 2F1JA 4LGMA 4PLHA 5D3KA 4BIMA 2WPDD 2XVXA 4BBPA 3UBTA 1EFPA 2YH2A 5I01A 1AURA 1JTFA 1J5EB 2RHDA 3NWEA 4X92A 4YJDA 2E87A 4MQEA 4N5HX 4MCJA 4WBNA 2GKGA 3X3HA 3SIPA 4B4UA 1NZJA 2GR9A 3L4BC 3T5CA 4O4HA 3ZU5A 1VCOA 2WB2A 3BSYA 4XSGA 1UOQA 3B12A 4RA9B 2HWKA 2H4FA 1N5RA 5KYWA 4DDHA 3CEMA 2PGAA 3HYCA 1CUFA 3PGKA 1JMYA 2I3ZA 2Y0BA 2IS2A 3QYPA 1O77A 4CI0B 2PMKA 2ZBGA 3BAFA 1T3ZA 4X45A 4HNSA 1VHLA 4BKRA 4OVKA 4GYKA 1ABBA 1BFUA 5DNWA 1U94A 2UV8A 1QV7A 2VZ0A 1M7BA 5BORA 3PEYA 2HQOA 3VO9A 1GZ5A 1P1CA 1QE3A 3GY0A 1NFQA 3GGDA 4G65A 4NMXB 1D3AA 1Q92A 3TLXA 4CMKA 2BSAA 5JUWA 3GRCA 1OI4A 3L0BA 3PUVA 2QR5A 4G0MA 1YS6A 5B1SA 4UZSA 3PBKA 3V6LA 3NVKI 5A7FA 1FRZA 5JQWA 2G77B 3IAAA 4PO1A 3AERB 4Q3OA 5BMOA 2QD2A 4RHXA 3FCOA 4IVPA 1GTSA 1PJZA 3FYUA 2SKCA 4I1UA 2HLHA 3V48A 5ELXA 1Q1BA 1XD2B 4Q9JA 4BCBA 3V4RA 3AM5A 1KE2A 1MQSA 4DIOA 1Z2DA 4A0QA 5AM5A 3D6JA 4PR0A 4NU6A 3A1SA 1Y9EA 4CR6A 4X8MA 2RH9B 4ERNA 2C04A 5FUBA 1U2EA 3CZ4A 1JEQA 3BN3A 4KX3A 5ICEA 5M3BA 3TGWA 4OLBA 3EGDA 3IQEA 2H17A 1H3EA 1DV2A 4H4EA 1W6RA 1M76A 3FGZA 3RLFA 3NVMB 1B6RA 3AI1A 2GVNA 1ENYA 1JBKA 1Z34A 4WERA 4DSUA 2C3PA 4BQPA 2WWIA 3CH4B 2J07A 1KQ3A 2Q8QA 3P9KA 5E0OA 4ZJPA 2FPOA 4HAXA 4R81A 5BQFA 2PHZA 4O2RA 1H2WA 3NWBA 4MR9B 3R0XA 3AVYA 4P4SB 3SYTA 4MW6A 2CW5A 1U6IA 3AJRA 1PV1A 3IIKA 1FIUA 4BNGA 2PIDA 4G07A 4LWPA 4XGKA 2XF2A 5E4JA 3SFZA 4G01B 3W8NA 2CLKB 4F60A 4M0CA 2BFPA 3DMDA 1GAWA 2B6HA 4K8OA 4FR0A 4Y6PA 4FD2A 3RNOA 4DVJA 1GDDA 2IXTA 1I4DD 3PFKA 1Y42X 3UAWA 4CCYB 3FZNA 1R9GA 1XQWA 4M1SA 3VPHA 2UVPA 1I30A 4KQEA 5IANA 1JKXA 3IESA 2GK6A 1UQTA 4GI3A 4TTIA 5I4KA 1ZGAA 3GRPA 5JLJA 3KKOA 4PAQA 2IL1A 2Q7OE 2R751 4FXOA 4NKRA 2CV2A 4FFBA 3HXTA 1X38A 3T99A 1QWSA 2E4XA 3A6EA 3EBPA 3QUTA 1TEZA 1HORA 3LVFO 3QHQA 3V8RA 5JEEA 3I9NA 3QVUA 4MPPA 5DLQC 4GLOA 4BFXA 1F8GA 3I72A 4YPVA 4ZDIA 2ZQZA 1WKVA 1J0XO 3G1TA 3BMCA 4RMGA 4UAUA 3K4QA 1QG2A 3NM4A 2Y6VA 1CJMA 1EM8B 1RWQA 1Y1LA 3JVUA 4G0VA 3AUXA 4MP6A 1FVOA 4N5IX 3SQLA 1U0HC 2FQ1A 1HDYA 1YR8A 2LR0A 3UC5A 1GQOA 1IHDA 1RYYA 1US8A 2SKDA 3WISA 1OB5A 3SEQA 5JW6A 2WDZA 1D5WA 4RZHA 3O8RA 1KSGA 1IB6A 1QGUA 1DDGA 1DHTA 1H6BA 2B1JA 1DEXA 1T29A 1U1EA 2CDNA 3GLGB 1OYVA 5JD5A 4G1CA 4UVGA 1JFTA 3P0JA 4ARSA 2Z43A 4QJ5A 2BBOA 1C0LA 4GE3A 1W76A 4NCIA 5H16A 4CT0A 2A5YB 1LK0A 2UXDB 2GESA 3O47A 4P3KA 4ND6A 2OY0A 3OI7A 4LV8B 1ISGA 2NTYC 3FYDA 1S6YA 4YAIA 3B7PA 4B7ZA 3O31A 4C5CA 4W5QA 3Q9UA 5BV2P 3BIFA 1EDDA 4EEKA 3G23A 1I7SB 5KWJA 3G0OA 1SXPA 4KYIB 1G60A 1Q14A 3U17A 5CBPB 2PX6A 4JQZA 2ZUDA 4R51A 3GHHA 3GZTB 4QU0A 3IAS6 4TYYA 1XRJA 3OG9A 1PSDA 2AFIE 5K3CA 5LBIA 1CK4A 5DNCA 3TUJC 4EHLA 5C2JB 4M9UA 5T41A 2VHUA 4KGDA 4OD0A 3Q85A 3BZBA 4A82A 4QD3A 5LA6B 2IELA 1A95A 1DI0A 3GLSA 2VSFA 4HPXB 3B2NA 4TMTA 3TFWA 1UQRA 3DOEA 1ODJA 1PSZA 1YDGA 4UE6A 4FMDF 2OKGA 4EPXA 1NY6A 1R00A 3E70C 4MCAA 3TEJA 3V8MA 5I7OA 2GO1A 5TGTA 5K6RA 1EWVA 2FY8A 3PWZA 4DEXA 4WBNF 4G4JA 4E94A 2BHSA 2R8YA 4KMSA 4KR2A 5GJCA 2IT1A 4ETNA 1K7YA 2FDXA 1F14A 2WJZB 4O4HF 1AMUA 3U4QB 1M2VB 1FY2A 1Y7PA 4HRXA 2ZW9A 4LOLA 1JPVA 4BNUA 4IILA 3NHKA 2YKGA 3TFOA 3M2PA 3PRKE 4QXRA 5EXEA 2IBTA 1ZUWA 1GNVA 5D3MB 1C5KA 1V96A 1ZGHA 4RTMA 3L05A 5F3WB 4FC6A 1A5ZA 1F51E 2RGEA 2J6CA 4F2GA 3Q0EA 1EFDN 3VDXA 1TEXA 2AG0A 1DQSA 1IJEA 2AJCA 1LX7A 2JEOA 2Y9PB 1TRKA 2JLCA 1M2OA 1IRIA 2XDWA 5KYNA 2XMPA 5AJXA 1WOYA 1M1NA 1XMVA 2H6EA 1ZKDA 2P78A 4R8VA 2WWVD 4MRMB 5AVRA 5LLDA 4DV5B 2NT3A 5DASA 4PONA 1MX3A 1I94B 1RQ2A 3VR6A 2V7GA 3L43A 3W77A 1P4GA 3DUFB 3SYLA 1EVLA 4RDHA 1G20A 4FGZA 3ITNA 4KN6A 2ZXUA 5I9NA 2HFKA 1IZ7A 3GFTA 4LF4B 1XTIA 4JJ4A 3VM6A 1CUAA 1J49A 4C4TA 1NF2A 3KE8A 4FIZA 4Y1FA 4R3WA 4Z0HO 4KEAA 1JQ3A 1GRRA 3PD0A 1TAGA 5EJ6A 1O96B 3C45A 5FOWA 2K2WA 2H5EA 2HCTA 3B53X 4MMXB 2X0NA 2JFBA 4MICA 5JPDA 3LZDA 1ZGCA 4M1YA 1XVTA 2O7RA 2Q4DA 2GJSA 3GD5A 1KY2A 3E48A 3NANA 1XE3A 4JKIA 2ID7A 4W9NA 3PRJA 2DP4E 4QBFA 5BNTA 5C1PA 4RX1A 1JLLA 1BHJA 1KQOA 2WIJA 2ZWMA 2O06A 3OQMA 1EUQA 4UEOA 1M8JA 2WKPA 1Q20A 3MS4A 5IARA 3MT9A 3ESQA 5CEJA 1DQYA 1W6UA 1KL7A 3M3PA 1AKWA 3QXSA 4MS3B 2HSDA 2CLMB 4R0NA 3A0UA 1UDAA 3I5XA 4YYZA 3SC2A 1ZVVA 4KQXA 4HDSA 3Q5EA 4R1TA 4DSAA 2QP4A 3OFND 5IS2A 4TTSA 4WJZA 2R7NA 3JYHA 3PPWA 2MMGA 5DLDA 4B73A 2HPAA 1YC2A 3UAOA 2AEEA 1RRKA 5HP4A 1KQNA 2QP3A 3I9JA 3N3BC 1O9HA 1T2EA 5DSXA 2AC7A 1EK0A 1HZZC 2GZAA 3E1SA 1W59A 3PCTA 4ZXPA 1T34A 4CM8A 2H1LA 1YZVA 3C85A 2WF6A 2EDCA 3ZWMA 4LJ7A 3ACCA 3S28A 3VVMA 3HXQA 2Z2YA 5DGCA 4A8HA 1U0OC 1TTHA 4UM8B 3AUJB 3EXEB 5P21A 1JR6A 4OATA 3P19A 4XQGA 5FOVA 3I61A 4DLWA 4TKMA 1G8JA 2ZYGA 3KYDB 3LVRE 4K03A 3FKJA 3QVSA 1YJAA 3C24A 4N3BA 1NLUA 4GM1A 3DE7X 4BIIA 3DVRX 5JYBA 2P4SA 2WKSA 3ERCA 2BEJA 3KPWA 1RD4A 1OJLA 3P0IA 4OQMA 3TBFA 2RHOA 3EYWA 4LYJA 2JH3A 1D2EA 3JTMA 4JN6B 5LUBA 4OHCA 1VJ1A 3D0OA 1J8DA 3X1JA 1AGNA 4G5HA 1JFVA 4MHSA 2X4IA 5ALOA 5HQ3B 1O3YA 1I3KA 3I4FA 3K0CC 2L2QA 4WOKA 4X44A 1E6LA 1TFUA 3QE4A 4KIGA 2FPGB 2R68A 1X92A 2C9DA 3TD9A 1G5HA 1BE8A 1LC3A 5AVYA 2W2KA 2BF4A 1K08A 2O3JA 1MU0A 3F71A 3O3CA 4MWOA 4UTXA 1ZXLA 3I6YA 1E3WB 1JN0A 2EKLA 2HXGA 5TF0A 4BX0A 1S8NA 2OCPA 1U8XX 1KZ7B 2VAXA 5IJ9A 3N5CA 3G0BA 5GGXA 4YV7A 2P65A 1ZITA 3N59A 5CHEA 1WCXA 3R20A 4JLOA 2HF8A 4CW7A 1NX9A 5HQTA 2FG5A 1QTNA 1VHTA 4XQEA 1BW9A 3T7KA 2WFAA 2WWXA 5J2TB 3MMZA 2WHRA 1C0EA 2O7NA 1J5XA 3PDUA 2VHXA 1GUBA 4X60A 1OF1A 3FCXA 3QVGA 3T3NA 3GBPA 2PL1A 3K2EA 5LL6P 1MH1A 2ZIVB 2C7RA 2Z6QA 3DVSX 1GKUB 3PNLA 2X8WA 4FNAA 3GEPA 4ON9A 4HNTA 1CY4A 1H4QA 1SGWA 5AJVB 1P9OA 4PQGA 5KPDA 4Q1DA 3ABSB 1KI2A 5ALDA 5ALVA 4NESA 1NZDA 4RQUA 2P7HA 3CZCA 1O9GA 4G0NA 4PWZA 3RWOA 3H4TA 1K98A 1GGMA 1OH7A 3DBVO 4E5KA 3V2IA 1GOTA 3QX9A 4I7EA 3F3YA 4HO1X 2ES4A 2P40A 3NOQA 4YMSA 4CNBA 4QT4A 4G0WA 3E6AA 2VDLB 1ML4A 1YB5A 3B5IA 1F2UB 3PC3A 3HVHA 3L6OO 1G8GA 2QRVA 3DO8A 3B1JA 3L4EA 3BCSA 4KQJA 2FU5C 5DW0A 5AXAA 3WKAA 3I2JA 3ZW7A 2Q4EA 3A36A 4G41A 4XD7D 3PXUA 5DTQA 1KTIA 2FJ0A 4CEIA 1U9CA 2PWAA 2RJOA 4BVJA 5JD4A 2XDAA 1J6UA 1OQAA 2CB0A 2IODA 2BW0A 4O4IA 2YBDA 4XIIA 3WQRA 1Q1AA 1UAGA 4YDQA 1JA1A 1D4AA 2Z2JA 4F9FA 1GPMA 1IG0A 1MB2A 4ZQIA 4CV2A 3H4MA 1V35A 1V3UA 5AVWA 5IBPA 1KMCA 4FYKA 4MWDA 4KLNA 1PCXA 3GHYA 3DP7A 3EZ7A 2ZRKA 4RDIA 2PGDA 1XPUA 1BCRB 1P0IA 3PR3A 3V33A 4C5BA 1KYQA 2IYLD 2HF7A 2XV1A 3K1JA 4DS3A 1AH2A 4CV1A 5JNTA 5TRTA 1SZCA 2R8BA 2JLUA 3EE6A 2A5JA 1MNQA 4MAFA 1QRSA 3RHFA 2AJDA 3MJ4A 1CEQA 2VYNA 3JQGA 3WL8A 5JFTA 3QWBA 2JGLA 4WRRA 1CULC 3RAEC 1BCSB 2PRSA 3PA8A 1P7CA 1JKMA 1E64A 3ZCUA 1RKVA 3IR5A 4XGQA 1B73A 3SQNA 5D1NA 3D1LA 3QMWA 3S8EA 3VO8A 1UAAA 2GCPA 2I1LA 1N4AA 4U7JA 3VMMA 4JP8A 4YT2A 1H85A 2Q41A 1N1EA 4O5OA 3RU3A 1XP8A 4CM9D 2WE8A 3RM3A 2EFDB 1DAEA 1XAJA 3PPYA 4KE6A 3NIBA 2C2OA 2Z30A 5K3DA 4UM7A 3WDKA 2GXUA 1EXMA 1FSZA 4XPZA 4B35A 2ACVA 5BSVA 2QX6A 1TVEA 4W5NA 3TTYA 2QTWB 2ZRIA 1UKCA 5T3YA 2M6KA 4E30A 2AK2A 3HGTA 5DI9A 2GZ3A 4ZCQA 1KS9A 3UUWA 5BWBA 4I8IA 5KTNA 2XNDD 2H0RA 3IODA 2PYZA 3T9BA 3PTAA 2YZ7A 2CYCA 2FPWA 1IE3A 3GWGA 4DCUA 2A5LA 2VH5R 2FQWA 1E1LA 4DXDA 1RE0A 2WNIA 1F1JA 1DT5A 2QI9F 2YY5A 2ZYSA 1TB4A 2HZBA 3HJUA 3I76A 3UFXB 5FTKA 1FRQA 4L4XA 1X7DA 3IQIX 1JJAA 3L7BA 3ANYB 4G3XA 4EHDA 2CV1A 4A4DA 3A1FA 2CDRA 5G40A 2I2FA 5KNDH 3VBCA 2B4YA 3D7RA 4PXYA 1G4HA 4DN6A 1TYEB 4RF2A 4O6VA 1NBIA 1E2IA 1JU4A 5JD3A 2ZRMA 4NJEA 4Y7CA 1TLFA 1P6XA 4GI7A 2R65A 4YNBA 1T0JB 3O3MB 4BMCA 1Z6AA 2A92A 4IDBA 3SS7X 1WZIA 3X43A 2A30A 3KT3A 3MRVA 3QLJA 4X91A 1COWA 4J75A 1R66A 1Y4SA 1WU7A 2FWAA 4JJKA 4N0PA 4JI8B 3MWJA 2XLCA 4BHTA 3V8QA 4M0KA 5EKDA 2GPSA 1IEQA 1OPRA 2P7IA 5E2IA 2ZYTX 4B1FA 2OGWA 3EG5A 4L8WB 3DEFA 3ZS8A 3EXIB 4E08A 1AV6A 1FVFA 3ER9A 2DXIA 4CIWA 2R44A 1S2DA 2VPZA 2OECA 3PC8C 1TZJA 3TGPA 2HWYA 2JKVA 2CZCA 4OI4A 3ANLA 4RF3A 3QG5A 2B5VA 2O1WA 5G1NA 4UD6A 3IA7A 3ZCVA 1WTCA 1G9SA 3DV2A 3WB9A 1GZDA 3D4NA 3TL3A 5FV4A 1JKJA 3N8IA 4G9BA 4ZVUA 5EE3A 2V8OA 3O0TA 3OQBA 2QAGC 4UAJA 2H63A 1V1MB 3QJYA 1RM5A 2XNKA 2XUJA 3THWA 1ZISA 1I6KA 3E53A 4U2DA 1SUWA 3WXMA 4Q9HA 1GDHA 4LV6A 1LTKA 3ZY5A 2IYQA 3I04A 1AF4A 1Z4IA 4I5FA 4IVRA 4C7OA 1BXGB 2F8SA 3WSTA 1VIYA 2J3HA 4OA5A 1N3LA 3IYLW 4TQUS 1U0TA 3QUCA 2PM8A 3I8XA 1ZVKA 3WG9A 3RYFB 4XWYA 2BJHA 2W22A 4Q1BA 1UAYA 1UPBA 1DWQA 3BWDD 4MUKA 4Z3DA 1C8LA 4EYKA 1U7DA 1S02A 1TC2A 5FL3A 4IHJB 2F1IA 1VKNA 2GHTA 1MP0A 1OFUX 2H65A 1HDXA 2HA2A 1XNQB 1E59A 1UM9B 5NULA 4KI7A 3VFDA 1WCV1 1E2FA 1M83A 1HNNA 1VRCA 1X8XA 3QVKA 2QMQA 1WRBA 3FOFC 1Y3AA 3B6EA 1NT4A 2FMXA 1TKRA 3CRQA 3CNHA 2E49A 3E3AA 4KH0A 3CX6A 4WK0B 1NP3A 2VP9A 3HYNA 3RTBA 3A4IA 1YZLA 2YUTA 2D06A 4R4JA 2Q45A 4LDNA 3SICE 4DA9A 5K0GA 4TSFA 1DJMA 1VE1A 2EJVA 1SVSA 3R7WA 2QOEA 5KBYA 4DUZB 3L6RA 4RNDB 2OYCA 2J7KA 4MS4B 3GAZA 3JZDA 3BWBA 3L0YA 4QPDA 3RFTA 4OBBA 1T0IA 5KB3A 4A6DA 1HK7A 2E4YA 2D4HA 4FONA 2M6RA 4KL8S 4QOSA 4D26A 5AOAA 4OB7A 3L9WA 1M8GA 1VA4A 2L42A 3NC0C 3AHFA 4B81A 5MGBA 1IBMB 3L7YA 1CCWA 4O4IF 4AU1A 3SQXA 3EZ6A 2PG3A 2OZKA 4OTZA 3EDOA 4R8SA 1J21A 3K35A 2I6SA 4XARA 2A3NA 1M1YB 2CFTA 1N7IA 2GHRA 2ZBVA 4U2BA 4JYPA 3JARA 4JR2A 5TQ2B 1FW6A 4D1YA 2PNFA 2QSZA 1U2QA 2OG1A 4IWXA 4MULA 4TM8A 3EEBA 3ET5A 3FLBA 1JWLA 1GZVA 3PQDA 4EA6A 3QELA 1D1SA 2X5NA 2RHHA 5LZ5A 3WRXA 3RV4A 1Z7EA 3H5VA 2FTKE 4MV6A 2WF7A 2HNBA 4PGHA 1VSTA 3TW0A 5JS7A 1GL9B 3FTFA 4XQCA 5JJBA 4IDNA 2GETA 4ZI7A 2J5BA 3I37X 1ESZA</