1NF8A

Crystal structure of phzd protein active site mutant with substrate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
207
structure length
207
Chain Sequence
MSGIPEITAYPLPTAQQLPANLARWSLEPRRAVLLVHAMQRYFLRPLPESLRAGLVANAARLRRWCVEQGVQIAYTAQPGSMTEEQRGLLKDFWGPGMRASPADREVVEELAPGPDDWLLTKWRYSAFFHSDLLQRMRAAGRDQLVLCGVYAHVGVLISTVDAYSNDIQPFLVADAIADFSEAHHRMALEYAASRCAMVVTTDEVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords phenazine biosynthesis protein phzD
publication title Structure and mechanism of Pseudomonas aeruginosa PhzD, an isochorismatase from the phenazine biosynthetic pathway
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 72
structure length 207
sequence length 207
ec nomenclature ec 3.3.2.15: Trans-2,3-dihydro-3-hydroxyanthranilic acid synthase.
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 1nf8A00
3LQYA 1J2RA 4L07A 3UAOA 4WGFA 2A67A 1YZVA 3O91A 3TB4A 3PL1A 3R77A 4H17A 3O90A 3TG2A 1IM5A 1NF8A 1XN4A 3HB7A 1NBAA 2B34A 3O93A 3S2SA 3EEFA 1YACA 3KL2A 3OQPA 1X9GA 2FQ1A 3MCWA 3O94A 4WH0A 3TXYA 1ILWA 4L08A 3O92A 2WT9A 2H0RA 3IRVA 1NF9A 3V8EA 3HU5A 3R2JA 3OT4A 2WTAA
chains in the Genus database with same CATH superfamily
4QBIA 3MJFA 2JJQA 5J59A 1RRVA 2ZBEA 3LTEA 4AECA 4D96A 4B46A 3O91A 5IF9A 4RTKA 4EUFA 1ADCA 2UZIR 1DLJA 4NNPA 4YJHA 1I2AA 3L1JA 4FFLA 3RK4A 4JWTA 4XYLA 5KZMB 1X7ZB 5CGQB 4AG5A 4BY9E 3AVWA 3H9CA 3G02A 1JN0A 4ZQHA 2IGBA 3CWQA 1S2MA 2IHUA 5DYYA 3D0RA 2O8VA 2OK7A 1FP6A 4AS1A 4RK4A 4NQRA 4BPBA 3LV8A 3PQ7A 2AGVA 1JDSA 2X5KO 2G6TA 1H9CA 2PWAA 2PO7A 2P8JA 3UN1A 1HX7A 2A4KA 2D4AA 1Z5GA 1E89A 3AFMA 4H4DA 3FUWA 4ENWA 5DLPA 4CEIA 1M0EA 1J1IA 2Q3FA 2JBHA 2FR1A 4ZYLA 4MVJF 2LW7A 2XQIA 5A4DA 2DFVA 4EI2A 2BR5A 1J97A 4MEJA 2HLPA 2BMFA 4DDUA 4AY2A 4XUCA 3QNUA 3I2HA 2QTTA 1E1DA 1EBBA 4RMGA 2FSVC 3F7NA 2VSYA 4L2IA 1D2AA 4RZQA 5EE3A 5EFOA 2YWHA 1FX0A 3GRZA 2ZYHA 3CUUA 3DO5A 4XGIA 4OH7A 1VJ1A 5BN5A 2CV1A 5E6RB 5BSUA 1ZJWA 3PD7A 1U2DC 2A57A 2EZUA 2X5JO 4P3NA 1DO8A 4PLZA 1HTWA 4Z0TA 3K09A 3KYDB 1W2WB 3Q7SA 4U7HA 2XCQA 1ODJA 1OLSB 3TNLA 1IDN1 4X6YA 4ESVA 2V45A 3QY0A 4NBUA 4QHYA 3EB9A 1XROA 1TEXA 1O89A 2QPAA 2VKTA 3GGGA 4MGZR 3WQBA 3CN9A 2NO6A 4QWWA 5EMJA 1EXNA 3AEXA 5C1DA 2HHHB 3RIHA 5BVGB 4IIFA 5IUKC 2CK3D 2VYVD 2Y0DA 2Y0CA 3PVCA 1I51A 3E9RA 3QU5A 4XPZA 3VYVA 4DJDC 2XXAB 4WXMA 3HN6A 1HYQA 3QBEA 5BN1A 2AFIE 2B7LA 1I3NA 1U9YA 4J4BA 1DRVA 4HWRA 4K9SA 5BY2A 4NS1A 1BEEA 2BHNA 3AW9A 4D9FA 2GETA 2FP3A 2JIRA 2WHPB 4MOWA 2BH2A 3VSDA 1A1VA 1DDIA 2FGJA 1KI4A 2AFHB 2VQDA 3HHPA 1XEAA 1AUVA 3R6DA 2NSHA 4YJFA 3W7VA 4B6JA 2ZBVA 3Q1LA 5CA1F 4YFYA 1QDEA 2Q28A 2Q07A 3H87A 2ZIUB 3I8OA 5M5BA 1JE0A 3QMMA 3AUFA 1HFKA 1Z6AA 2J3EA 3RLIA 4TWRA 3SWWA 3C8HA 4G9EA 5JCOA 4FM9A 3S7TA 1CVIA 1HNWB 2JW5A 4V0LA 3RIGA 4AJ9A 3T1VA 4EG7A 5FUBA 1M3SA 4HDAA 1JSRA 4RLQA 1V8ZA 1RI5A 3RRYA 4FGZA 3M82A 5K03A 1M8FA 1FOEB 1R8JA 2P65A 3QPVA 4YHHB 3EIHA 2G9ZA 3OE7A 1IMOA 3DFMA 3MQ4A 4QFBA 4LWZA 1TTQB 2IKQA 1PD0A 2O2EA 2ZYRA 3FPJA 1NW6A 3CCFA 3E18A 4I3HA 4Z9FA 3O3CA 4ND3A 2IHNA 4MS3A 3L9XA 1O54A 3BX1A 3KVOA 4JI8B 4HQNA 2XLBA 4LOAA 2EFGA 4GC9A 3T7TA 5K4GA 3NJ4A 3D3KA 5HS4A 1SCBA 3JD1A 4BLVA 4IW3B 4KV7A 2IUYA 3U4AA 2OY0A 2W6JD 3DPSA 4N7JA 1DT3A 1C3EA 1G21A 2QP4A 1Z28A 4FJ0A 2DC1A 2HZBA 4NFYA 4BX9A 2J3MA 4M21A 5JECA 3PFCA 2Q7OE 4XIYA 3BIFA 5K0CA 3GPCA 2G1UA 2FEAA 2WKRA 3SC6A 3ST7A 1PG5A 1N7JA 5JTTA 1LGYA 3MLEA 4I1YA 3AWDA 5I8WA 1ZY2A 5L95A 1RVDA 3GLGE 2B8NA 4JYCA 1ZD5A 2QL5A 1LUAA 1GTL1 3AB8A 3OF5A 2ZTUA 3SIPA 2EKZA 4D4IA 2HTFA 1AKMA 1J2TA 3OEEA 4G8BA 3UWDA 1G6OA 3RVPA 3EXHC 5IULC 2ZGVA 1P2SA 4OGKA 1KEEB 2RD2A 3ZWOA 1Y6FA 3FX2A 5CDYA 3ZVMA 2OHFA 1RWVA 3PX2A 2H4JA 1U0TA 1W75A 1MGOA 1XP5A 5FR1A 5CFNA 4P7FA 1GNSA 5DRYA 5IM4A 4GEKA 1SULA 1WW3A 4FZ3A 3S2IA 5AI0A 1TU4A 1VLHA 2C96A 5HJEA 1IHUA 5DSTA 4H60A 2C5FA 5CEFA 2Q5OA 5ALDA 3N2GB 4RDIA 3C5VA 1W94A 4PLTA 4BO6A 1NQUA 4DN6A 4BNFA 3G5LA 4IEEA 4MMYB 3RYCA 1NQWA 4NBNA 1RMYA 1JHVA 3ITDA 3O95A 5FTKA 4B75A 4BV8A 2C2MA 3F78A 3NIBA 4A8PA 4ETNA 1K98A 3WYCA 4BATA 1VP9A 2OHJA 3ETHA 3FVTA 1CLUA 1GL3A 1XZAA 2YZ2A 1WTCA 3KQMA 3ZDYB 1VSBA 3SC2A 3JQAD 3JD4A 5DM4A 3EDYA 5HPYB 3JQFC 2D8AA 3VR2A 4BBAA 2PZMA 3EC2A 4GM4A 4NQZA 1ODCA 1CQWA 1KVSA 1XZNA 1UZLA 4WPGA 3TLYA 1CJBA 2MOKA 5FEUA 1J56A 1NQTA 4XSVA 5TIIA 3U1BA 2YHUA 5FD8A 4OQEA 4IYRA 4ZVPA 1ABFA 2GN6A 3LX8A 4H0NA 3RYIB 3BIXA 3T0FA 4FMCB 3D6JA 1V6CA 2FYTA 1ADYA 4LGCA 4WKPA 3STWA 2FPLA 1E2BA 2RAVA 1J7KA 3P32A 1TGYA 2JI6A 5AW2A 4FE7A 3EIUA 2B5VA 4E7OA 3CMMA 4HYTA 4KQJA 3F71A 3RVKA 1Q1QA 2CFSA 3OC0A 3FETA 2IA5A 3JQ8A 5K3BA 3VKVA 5JSUA 3OQMA 3CW9A 3OU6A 3ZCPA 4HH4A 1G8KA 3QM1A 4FNOA 5DP1A 3PUHA 5JCZA 3VZCA 4CIAA 4ZVQA 3B36A 3C3PA 4X44A 5JNSA 1M74A 3FI9A 5F9HA 1A5BB 4WHMA 3RSZA 3P0FA 5KVCA 4WH0A 3F5DA 5K05A 2FW9A 2WIBA 3NM5A 3AT1A 3UXYA 2ISQA 5JS7A 3V46A 2FDCA 1WMDA 1EDEA 4H6WA 1VHLA 4LBVA 2BGWA 2NTNA 3GBVA 3L5OA 3M5DA 5J47A 2XVXA 4RC9A 4ABYA 2F8SA 2OB2A 2DH5A 3ABSB 4TTQA 3UAZA 2XD9A 3FPHA 1C80A 1MVOA 3GLFA 2V7VA 3AESA 3B5EA 4UBJA 2Z2XA 2VFAA 4JJKA 2XH8A 3L7JA 4C5BA 2JLWA 5I4CA 4P36A 4ACBA 1D07A 3JPWA 1EINA 1VKOA 1FP1D 2FUCA 3KOYA 3KB2A 4YJ3A 5EIBD 5BR4A 2C7QA 3E9NA 1VFPA 3GYGA 1Z5WA 1RI2A 3DOJA 3M8KA 3TIXB 5JFOA 2P6MA 2JLZA 1Q3TA 3CY6A 4PR0A 4QNNA 4NJMB 2ZJAA 1X6VA 5LP6A 2IY7A 1HT1E 3KC2A 2R62A 3OJCA 2NO9A 3IBTA 1NBIA 4FILA 2BCGY 3FNRA 2Z3ZA 2PEZA 3AR8A 3VISA 3VR6D 1GGNA 1QHSA 4B43A 1P8AA 1GUAA 5CB8A 1UM8A 4J16A 5AVZA 1QRSA 4F3CA 3UMCA 4BJHB 4N82A 2I5PO 4FSXA 3A32A 5FAXA 4QQNA 4OQXA 3EQZA 3OE4A 4RYLA 5DX0A 1GADO 1T1IA 4IBOA 4KWCA 5AK5A 1M1ZA 1T34A 2I1WA 3PNLA 2YDYA 4MMXB 4UMFA 3K16A 3OOJA 4GXTA 5LYJA 3SQMA 1B0AA 1KQ3A 4N12A 1ZEMA 1T9GS 1Q2UA 3A4MA 3WADA 4M54A 2Y4OA 1KPIA 3FKJA 3R0QA 5EPEA 1XX6A 1ZU4A 1DJQA 4I9GA 3SDBA 1E3WB 2HQSA 1HI9A 1UT8A 3UXHA 3AYZB 4ZA2A 1BS9A 5EESA 4C6SA 2NG1A 5KYYA 4EPVA 2LCFA 2V7GA 3AKCA 4EVIA 4XDHA 1V16A 4R8SA 2P40A 5E6UA 1CZRA 1PFWA 2NU7B 2WM3A 2OMKA 4GZMA 4RVFA 1XEFA 2VQEB 1FVFA 1Z6QA 4BJ3A 1U0GA 4OP1A 1OBOA 3FGPA 3O4IA 3ILSA 3BK7A 4F4UA 2B69A 4RKYA 3A9VA 5BQFA 1O0SA 2PRIA 16PKA 2F4NA 4L16A 5TMEA 1SA0B 4D9EA 2IXAA 2XB4A 1TO2E 3H3JA 3H05A 3KKNA 4IDEA 4BO9A 2YH2A 3W5VA 1RXWA 3WX0A 2KJQA 4DT1B 3S7ZA 2WSSD 2O9JA 3GHHA 1S02A 2A88A 4HLUC 4QX6A 5FNZA 4BN5A 4ZYUA 5BW5A 5IZCA 1I4OA 3EG9B 3MGKA 3RNLA 1ZHFA 3LLMA 1NFRA 1I4TD 1TNDA 3WKBA 4CQNA 3W1EA 4DLTA 5KJCA 4EZBA 2MSDB 2PV0A 3NCTA 2RHDA 3MXTA 4NI5A 4KXXA 2HGSA 2C5AA 1IB0A 3R7FA 5JMOA 4LFBB 2FE4A 3F4LA 1S9DA 3H7IA 1E4VA 3K70B 5CCXA 2NTEA 3TZHA 1E4YA 4CIXA 3LQKA 2JLXA 1DARA 2W98A 2R6GA 1LA2A 5CFLA 4P4SA 5C8DA 5ILGA 1X2EA 4J6FA 5JC1A 1MJGM 4PWZA 2QZJA 3GFGA 4A0HA 1GU7A 4FTWA 4GPAA 4HNAB 4UAJA 5EJMA 1R6TA 5HJ5A 3JARA 3L8DA 2O7QA 2E21A 4OREX 4R54A 4IIUA 3P9YA 2P90A 5B1SA 3FHTA 9LDTA 2XWQA 3SEFA 3AU9A 1G55A 1A2BA 4OHFA 3ZIDA 1YIOA 3CPSA 4E4TA 3AR3A 1LDMA 4IYJA 3TOVA 3C4QA 3FD8A 1JQ5A 4MZXA 5LBTA 2GFIA 1C9YA 4WNIA 3P8ZA 2O2IA 2O19A 4CM7A 4F8JA 2ZYDA 1NOJA 3M89A 4I14A 4F9GA 1JMYA 5HW0A 1SH7A 1C7QA 1W9MA 3DTTA 3VYTB 1A0OA 3WK7A 5CLJA 3F8WA 3GFPA 4PYMA 1N7IA 3WNBA 4KBGA 1RYHA 3LW8A 3LWDA 2FMHA 1L7MA 4H1WA 3FYUA 1G5PA 4OX9B 3EH2A 2XUIA 2H9IA 2V7WA 2QMHA 4HB2A 1F2TB 1GO2A 4PO1A 5JISA 1LVHA 1B8OA 2H57A 1NI5A 3KPWA 4C9BA 1TXGA 1P45A 5JY1A 1UPBA 4CHGA 4LMAA 3B60A 2BEVA 2QJWA 3AIKA 2LDBA 4MW5A 5CDFE 1NJ1A 1DAIA 2HXSA 1OJ7A 2M32A 4AY4A 4TRRA 1EJBA 1MT0A 1XJ5A 4RHCA 1MB4A 3KWMA 4HG2A 3ZCSA 5IP5A 4L9AA 4E0BA 1XQVA 3E8XA 1Y5IA 3C1TA 5AOVA 3WP1B 1ZL0A 4MA0A 1DRUA 1WXGA 4UNQA 4X1IA 3OTWA 3HJBA 1N9ZA 2H1HA 3L93A 1XRJA 4UPVA 4E15A 5KYTA 1NDQA 1RAEA 3HUDA 4D46A 4F2WA 2IV3A 3D5EA 3DE5X 1VSUA 5JRZA 3Q11A 1YHNA 4LXGA 4M7OA 2QAGB 4YJ2A 1ZD4A 2IU0A 2R1TB 4RNCA 2PUDA 5AI9A 4S1TA 2JLSA 3K1ZA 4DC9A 2AK3A 1H22A 2BM0A 1HK7A 1V1MA 2YCBA 2ET6A 3MXOA 2ZUEA 5C81A 4K86A 1T4CA 2B37A 3QEJA 3RR2A 5AW8A 4RANA 5IAAA 1A7JA 1XT6A 3JWIA 3WQRA 5CIWA 3VAYA 4HAZA 1YR2A 3RANA 4EB3A 3PWTA 5CGZA 1WM1A 3EJWA 3FNBA 1LVUA 2YXPX 3C45A 3K72B 5FV4A 2I2FA 4U2BA 3KZNA 3S2ZA 3EVAA 4O4IA 1JF8A 2JAXA 2WUVA 5CA0B 3DVLA 4GHWA 1NGSA 2PNFA 3RU3A 3Q6NA 2Y4NA 5HRUA 4X63A 5G1PA 4TLMB 3KXPA 3S8MA 4K6HA 3PGXA 2FGKA 1GDDA 3A9TA 5FA5A 2WWVD 1G18A 1VP3A 4YI3A 4I1PA 13PKA 1IQRA 3NTLA 1RAAA 1RIIA 2NADA 3FDFA 2BC9A 4OK3A 1CQJB 2A1TS 4BEVA 2J41A 4F8EA 5C51B 1K6EA 2CDBA 3KSZO 5HKKA 5ALMA 3FCYA 3NRJA 4BNZA 2YC2C 4KTTE 1CQXA 2IUFA 4LI3X 3AKYA 3D1VA 4DLVA 1ONOA 1GL9B 2D2IA 1XZJA 1ACMA 3PUWA 5CURA 3ZHYA 2E9SA 2PGJA 4YB8A 5HOEA 2QMYA 3ADBA 3JTMA 4PGAA 5EIHA 3SY8A 3DBLA 3T7IA 1M2JA 2PX6A 4IOKA 4EKEA 4JV5B 4OF4A 1VCHA 4JLJA 4ZPXA 2QBYB 1S0UA 3I9JA 1X86B 4O4HA 4KDEA 3PQ4A 1ORDA 4BX0A 2F3UA 3D6MA 1K6IA 3V8NA 5KVVA 2Z5GA 3RFFA 4RFVA 4HDMB 3LQ4A 1NVBA 5DOZA 3QGMA 4QOFA 4OLAA 4L15A 1FUUA 1NUTA 3VTKA 3TE6A 4HVCA 4AURA 3DZKA 1ZGAA 4NENA 3NM6B 4S2EA 3C6MA 4CF5A 3OPYB 2F8TA 2OAGA 1Q12A 2EZ9A 5A5EA 5LXTB 4GG1A 3B20A 3CH5A 3SXUA 1U6KA 1SUFA 2DUMA 2AVNA 2GNOA 1XZDA 4H15A 3KQUA 2C8JA 3BZBA 5EY5B 3WK4A 3KWLA 2CEAA 3KPYA 2V0NA 2A5DA 2O2GA 1OYOA 3I0NA 4OJYA 1RHMA 4E1BA 1SG0A 4EHKA 2OSVA 2QUZA 3DZDA 5FOWA 4BAUA 1I7NA 1RM4A 2REQA 1I7SB 3RU7A 1JKJA 2H7XA 2HT6A 3ZU2A 1N2EA 4Z7NB 1K88A 3EISA 1XAIA 4MVJG 5FUWA 4ZAXA 2ZVDA 4K6KA 1E3TA 4Z51A 3U4QA 5EQJB 1J90A 1KERA 2R751 3VC3A 1HNXB 3LDHA 4PG7A 2PMKA 4Y67A 4JDUA 2J3LA 2VH1A 2H18A 3IQFA 4Q9HA 1WBJB 1EA5A 2UZ0A 4BNVA 1KS9A 4NS4A 2E89A 3MPUA 4JL5A 1ZUWA 2JIQA 2YUTA 3CWCA 3G59A 3M33A 3ETCA 3PXBA 2JI9A 2XMDA 3T35A 5BMVF 1PQWA 4TKZA 5TPWB 5HR5A 2DLDA 5JDCA 1KY5A 1L7BA 1U0OC 1UM9A 5DYWA 4EI9A 3HV0A 3PD1A 1ECFA 1AUQA 5ICCA 4EDHA 1N3IA 1GQSA 1KJ8A 2IF0A 3DYVA 1KBQA 2ZDGA 2JFZA 5T4FA 9ATCA 2IU6A 2JJ2A 5GOZA 2CLOB 2LTAA 4M1EA 2N0SA 4MWEA 4MICA 4D6YA 1MRNA 4S35A 1P4HA 5ETJA 3WGOA 3NLLA 1H93A 2O3QA 2P4UA 1JZSA 1JYFA 1T8UA 1XMSA 2I4LA 4FFBA 4H6PA 2IJGX 3PQFA 3SS8A 1LLDA 1Y82A 3G2IA 4U3JB 4EVRA 3H97A 4DIEA 3UFBA 3BXGA 3HGQA 4B3IA 2OB1A 3I9KA 2VATA 3QX8A 2M1XA 4M99A 4O02B 1YVRA 2V9CA 1V37A 4NULA 5F1PA 2PYDA 4LXUA 2Z4SA 4EJ0A 2GSDA 4OPMA 4MDEA 1Z7GA 1EP3B 1YHYA 4QOEA 5D1NA 4URHA 1FMCA 5HTOA 2NUAA 3TCNA 2QTZA 1XLTA 5IM5A 3ZU6A 5FTNA 3OEED 1R5NA 2FSIA 2JZOA 1Z13A 4DMHA 3T1QA 2EW1A 4B9AA 4Y9TA 3LX5A 4L0MA 3P27A 5BSFA 1FK8A 4KAXA 4N7RA 4YROA 4DB2A 1VGRA 2D62A 2J9FB 2VNKA 1EGHA 1IPEA 4EMTA 3ZUPA 1SVNA 3UXEA 2BY4A 2IYQA 4DAOA 4XKJA 4EQZA 1Z4MA 1BMTA 4IDGA 1EUYA 1QF6A 1ZGZA 3EZ7A 3P0JA 3ZHOA 4EF4A 2G17A 4CEHA 2D5BA 1ULHA 4YY3B 2ZYUX 3JASB 1U28C 4IIJB 1SKYE 2ORIA 4M37A 3E53A 4UOZA 2J0QA 2O8NA 1NVTA 1QYCA 5JS2A 3UZUA 5CA1A 5ELMA 1XCGB 1IEQA 4MQ6A 4HY3A 4JUDX 3WJAA 5AJYA 3PNVA 3QXCA 2P9HA 4JDPA 1C9JA 2YOFA 2XUKA 4I5FA 4PZCA 4Q1DA 1X3SA 4RMHA 5HK9A 1IL0A 1O97C 1ZP6A 2DWUA 4F46A 1GM5A 3VR2D 1ZLYA 1J8QA 5JY6A 3M1IA 4S12A 1PKXA 5FR2A 4FI3F 4HTAA 3UUEA 3OPVA 4KX3A 4EX7A 2IH4A 5KOJA 5DBFA 1X7YB 3KJGA 3IAS6 3NKVA 4A9AA 1E3DA 2VK4A 4BQQA 3MGCA 2QYSA 1FFCA 2OT3B 2AMLA 3BG5A 4GQBA 1W6RA 4RHUA 5DYGA 3QFHA 3RAFC 2VDNB 1ZOSA 2BFFA 1FDWA 2WTNA 3EA0A 2XDAA 2SBTA 4KEAA 2X2PA 1YZNA 3H5LA 5KYXB 2QS9A 2A7QA 3U31A 3CRRA 3EGCA 3U1TA 2QL6A 1KC1A 2H4WA 5AOBA 2Z4TA 2WU3A 5A6SB 1YS7A 2JCXA 4F4DA 2ZRCA 4QQKA 4X8LA 5GZ1A 4BO4A 2P9TA 4O2RA 5AI4A 3IIEA 1KJ9A 1W34A 3HI4A 3GK3A 5IANA 4J0GA 3CHYA 4GMXA 4LRTB 1JQAA 1UT5A 4JLUA 4ARUA 3CX6A 4FD3A 4PLGA 3DR5A 1NNSA 4O3MA 3EPPA 1GV0A 4O1MA 5HFNA 1JAYA 4ZC8A 4BV3A 2VP2A 1SC6A 2JI7A 2WIDA 2ONCA 3KETA 2PJUA 3AHHA 2YWBA 2EP5A 3D7RA 5BW8A 2QJTA 4GM1A 4I55F 2QX7A 2XR1A 1YQGA 1KEVA 3MQFA 2QWXA 3LVRE 1XYYA 4G09A 4OM8A 1SIBE 1ZM4A 1G3IA 4WZ6A 1QVAA 1E2KA 2CE2X 3FGZA 1R3DA 1I2DA 1ZMXA 4A8JA 1BE8A 4N40A 3MCZA 4A26A 5JMTA 1UP7A 2DHEA 4AS2A 3E5RA 3S29A 2JFYA 2QSZA 1LLCA 3IMFA 5CR9A 4C03A 3OUUA 4DLSA 2O0MA 3PDHA 1DBWA 4A92A 2OZPA 3FFWA 3CZ5A 3VI3B 1CRLA 1ETHA 3EVGA 3JX9A 4QRHA 1YRAA 1IEXA 3Q8KA 2GTIA 5F52A 4BBZA 3ENVA 1SXGA 1CVRA 1FFWA 1G2PA 2WF9A 2WAYA 2ZUTA 3IJPA 3ICVA 4DPLA 3CNOA 5IJ0B 1MH1A 1VQ1A 1A8HA 1EG2A 2Q3DA 2WEKA 2YV1A 1D7AA 5FOVA 5IFLA 1CUBA 3OMXA 4YHBA 3KOXA 1OBHA 3AEQA 4CIVA 1TRKA 1MG5A 4BKOA 2GEFA 3LOUA 2CHVA 1OWOA 3LG2A 2WKQA 1RAFA 2NUTA 3I4LA 1HMPA 2JEOA 2WHEA 3UHAA 4ZVTA 2QV0A 3AUSA 2HA7A 1UPXA 1P1FA 1V3VA 2QXYA 3DAHA 5AXCA 2GM3A 3VR1A 1G2QA 4O2BB 3TW8B 1IXSB 5DT2A 3LHSA 4MVWA 1EWKA 1KETA 4BV9A 5B1HA 3RUDA 4DLAA 2A9PA 1GZ7A 2VH2A 1A9YA 6CHYA 3ORFA 4DUGA 3R4VA 3MERA 1E5VA 3IIKA 1EXVA 1JDVA 1E2NA 1KMHA 2HRDA 1DEOA 2O52A 2XB6A 2YYAA 3Q7RA 2XYGA 4QUEA 2OO3A 2FW8A 4PZYA 5IH3A 2IWHA 1FFSA 3WWYA 3GGSA 3L05A 4IXDA 3GXOA 3QP9A 4GECA 4ZCTA 3I9NA 3SZGA 3ZR4B 2YVKA 2PS9A 1AKEA 1LBHA 1D4OA 1E60A 1R4MB 2ZVJA 3NNSA 3RSLA 3V1TC 5K5EA 2HTEA 2VG8A 4KRFA 2ZR9A 1ZA1A 4LTDA 3WO1A 4MW6A 1QO9A 1I6KA 4KN8A 1N2CA 2EAUA 1BE1A 1K0FA 2ZBDA 2O8DB 1H66A 5IFKA 1NBWB 3JQ7A 1ISJA 2E82A 4P4LA 3B48A 3TX6A 1UDBA 4G9BA 4RHFA 4RIHA 3DEKA 4MJLA 4F4IA 2DFKB 4RJIA 3RABA 2FPPB 3OQ6A 2ZM5A 1XF1A 4MHSA 2I7CA 4PNHA 2XY4A 1MOPA 2WRZA 3ONVA 4MMZB 1S01A 3IUJA 4LYFA 2WW8A 2BR4A 3EDOA 2ZJ4A 2R6AA 4FGKA 1VBKA 2ACWA 1MC4A 4JB0A 4AMVA 4ITVA 3T4PA 4CCAA 3EASA 3GLIE 3H4MA 5FA8A 1Q83A 1YRWA 2VRWA 5EUMA 4JUFA 2AE1A 1VMIA 2C9ZA 2PO5A 1VHWA 1QBGA 1TUBA 2IIVA 1Y4ZA 1RS0A 3F97A 4B3JA 1UZMA 1QJCA 3D3JA 4CMIB 2JCVA 4WK2B 1K08A 2VCYA 2GYVA 2B83A 1OLXA 3MTJA 1NLMA 3CPJB 3RK1A 4D02A 1ZQ1A 2FTKE 4I81A 1WA5A 3FY4A 4IJ6A 4K9KA 5ALVA 3EF0A 1CDDA 3ICOA 1PEDA 1I13A 3G0OA 3ZZ1A 1SKMA 2ZYSA 2AZDA 3DMYA 4FVTA 1U3UA 2DPHA 5AT1A 3ZK7A 4CKCA 4ETMA 1KI6A 3GVXA 3HB0A 4GYKA 1PN3A 2JDIA 4OP3A 1KRWA 4FU0A 4KV9A 1XNJA 4MLZA 3HJAA 3S68A 3IURA 3V4FA 1NXPA 4MSUA 2P30A 1G3RA 3BMQA 2GDZA 1YNSA 2BEWB 3KUDA 1AG9A 4JSRA 3LWBA 1N6PA 1B2RA 2MINB 4MJXA 2JASA 1BH6A 1LRKA 1QFXA 3DBRB 4OI4A 4C0HA 2QZZA 1NMXA 3T3OA 1BJRE 1UDRA 4TN1A 5I9BA 4KPUB 3OE5A 1O95C 3ET5A 4I6EA 1U63A 3ZU4A 3JAMA 3TXAA 5DSXA 1IOWA 2QENA 2FN4A 4FGLA 4DRZA 4OJTA 4U1RA 4FB5A 4YT8A 4EHAA 2ZRIA 2NUPB 3R23A 2Q62A 4ZHQB 3OVMA 5HBGA 4UVGA 2H8GA 4RXMA 3R0IA 2Z8ZA 3SR4A 4YAKA 1JIUA 1M2VB 1XZHA 5MFPA 1L5SA 3LOQA 3G9UA 4MVJI 3STXA 4LGYA 2VJDA 3UG7A 2PBLA 1SQ0A 5I7FA 3LE8A 5K8JB 4LPSA 3FNFA 1GWNA 5ANRB 5FPSA 4IOLA 3NTQA 3OESA 4RWEA 3TKAA 3QE0A 3ZE9A 1R15A 3TW4A 5SZHB 3L4KA 1ISRA 4KIJA 4N76A 3OQHA 1U3WA 2WVHA 5FRDA 1U8FO 4RPIA 1JG1A 1T2EA 3ELYA 3MTQA 4M9UA 4NE2A 5C8YA 1GPUA 3NDIA 4GYWA 2DE0X 4J4TA 4QLBA 3GN2A 1EJ0A 1YHZA 2VJQA 1QNFA 2R5NA 1C4KA 1B00A 1RYNA 5IPFA 2R6JA 3FOWA 4MWGA 2YV2A 1XD2B 1SXJC 4J0JA 2O0JA 1WEKA 3EUWA 1R5JA 1RJ9B 4NJEB 2J5KA 3ZBQA 1KSFX 4E7PA 3OQJA 5C8XA 2AYZA 2X76A 2XCSB 1DT5A 3R6GA 1S2GA 1VL1A 3EIQA 3ODGA 4HWPA 4OB6A 2OBYA 1T1JA 1T5IA 2EDCA 2O1WA 4K6FA 4DV1B 3T7DA 1X7XA 2QTBA 3GIDA 4MR7B 4PWYA 1P1RA 3A28A 2E0IA 3TN7A 2QT0A 1H1LB 1HG1A 3RQSA 1EHYA 3LQ1A 4F4FA 3MFQA 1W36B 4IVNA 1WOMA 5HF9A 1Q6YA 3BREA 3HXQA 1R0YA 1IVYA 8OHMA 2R25B 2PKCA 1UMBA 1SG6A 1BTOA 3ETJA 4JJ8A 4TLDA 2EV9A 2E6UX 1PWEA 3TQIA 2YZ7A 3HVIA 5I7EA 3AGQA 3GEDA 2ILTA 4HAUA 3LHFA 4O8CA 4Q3CA 5J4HA 2BM8A 4OFBA 3IR7A 2XJ9A 3VQTA 4C4AA 1O4VA 3DM9B 1RWXA 5IJ9B 3FPKA 4F9TA 2PWPA 2CFCA 2RHTA 3N87A 5HKKD 2AG8A 2Z9CA 4J1TA 3V7NA 5KWIA 1OXBB 2O3UA 3W7AA 4B6SA 1U6JA 3NEYA 1EFHA 5DTIA 4MQUA 1E8DA 3OM8A 2X42A 5HF8A 2HLNA 4XIGS 4PCAA 2R86A 2PD4A 3F5FA 1NUUA 4DA0A 1F9EA 3K0AA 2HV8A 4H77A 5CCBA 1OH5A 2HIGA 1JALA 5DULA 1WDKA 3U3JA 3M6UA 2R6ZA 1T2NA 5H9VA 1Z08A 2X1LA 1LI7A 2GCEA 2WIAA 5E8JA 1EBUA 1MR3F 2NO4A 3QYAA 3R44A 1D1PA 5FOQA 5JYCA 4TVSA 3RV4A 2P4SA 3VPSA 2G9QA 5A9RA 2GF9A 3OWXA 2Z1MA 2EBHX 1V1RA 4GQIA 4NMHA 2O54A 3EZ6A 4DLPA 3HXTA 1W4BA 4JLDA 1TOAA 1X2BA 1E9VA 2HFJA 2W4MA 4G5GA 5CH8A 2AHRA 3TSZA 3U7IA 2ZB2A 4TUYA 4FGWA 2FZGA 3HI6A 5T7BA 2QTGA 2WMDA 4JEIA 2AC2A 1M1YB 5KDOA 1T26A 4MS1A 3CW2A 1QGAA 2N1MA 5LA6B 4F2HA 2EZ4A 1WVGA 5KWSA 1Q0ZA 2VJAA 3I92A 2WPDA 1BD4A 3ODPA 3H5IA 4BO8A 3SBDA 2JD0A 1N0VC 5U1PA 1SCJA 4FFMA 4WNAA 5CVTA 2HLHA 3ZJ4A 4RIIA 1C9KA 1NLZA 4DLKA 4EBFA 1FZTA 3K0CA 4QUDA 1SK8A 2YJ4A 3DFFA 3GD7A 1EUDA 1PK9A 2Q3EA 3IBGA 5EKDA 4KGXA 1GYPA 2POQX 2RJOA 4EHDA 2IOFK 5T6BA 4EAAA 2UYOA 1JTVA 5EOVA 1POWA 1RRKA 3C39A 3CJRA 3RT7A 3ZD6A 1DVRA 3G0DA 3R40A 3CZ9A 5B5SA 5GJCA 2ZREA 2AN9A 2FXIA 4GDFA 3AWIA 4ERXA 4LJ8A 2I1VB 4ZO6A 2FPGB 1DRKA 1OI4A 1E9BA 1TYZA 3LBAA 4CFZA 4C3UA 1N7HA 1H5QA 2CHQA 5B53A 5B6IA 4DV2B 4ARZA 2I6UA 4ATNA 5KWJA 2O7SA 3DXFA 5E4TA 4ZD6A 2DBQA 5CNJA 1GGVA 1X0XA 3O4JA 2G1JA 1Q7GA 4N3BA 4QDUA 3NEJA 5C3MA 2Q7XA 1AUOA 4B71A 3T94A 3BULA 4R4JA 2JJ2D 1DQNA 4TROA 4UBKA 3I61A 1J24A 3A36A 3L6CA 1PFKA 5K3DA 4DQUA 5BYBA 3KKMA 3IDZA 4MAFA 2ZYWX 5CP8A 1IWOA 4P4GA 2JGAA 2R6R1 3PSHA 1NWCA 4KC0A 2FX3A 3NBAA 2ZM6B 2PE5A 2Y05A 1S2NA 3PIDA 4UM9D 4AWAA 3CZPA 3GO4A 2QD2A 3D3EA 4PNZA 1ZESA 3RNOA 1A1SA 3I52A 3Q0TA 4FYPA 2EFYA 1AD2A 2Y9PB 2OCKA 4AD8A 5JXIA 5IBRA 2OXIA 5WRFA 2X22A 1QU2A 1F12A 1M10A 1PZGA 1QR6A 3W8DA 1I4DD 2ID7A 1TM4E 1ZD8A 3NHPA 4FOLA 2ZIVB 4L3OA 4NZZA 5KOIA 3STVA 1VIAA 1RYMA 2BUCA 1AXRA 4KJXA 2EW2A 1GZ6A 5HX7A 1A7KA 2ODEA 2JIPA 4DR1B 3SJBA 3VU9A 4AJEA 2H00A 2I29A 4UXJA 2RSLA 2ENUA 2AF3C 1T4BA 3VBCA 2PCJA 4MPRA 5K6AA 1HV8A 2IYSA 3D2AA 1V11B 3D43A 3IUSA 1S9HA 2OM6A 3IEPA 2FFAA 1HDYA 1OIXA 2CLCX 1OAOA 1MOZA 3MMNA 1P80A 3KR1A 1QANA 2OR3A 3OCWA 5I3CA 4UARA 5JXGA 1TZKA 1NVVR 2VRBA 2ZSJA 3GMSA 3L1UA 5BSTA 5F1KA 3RS7A 3INTA 1ZOIA 4L28A 4MUNA 4YR9A 5ALUA 4L95C 5DX1A 3DZJA 1HLGA 3UFXB 3ZH9B 3WGHA 3B3QA 3GNLA 4EW1A 4F72A 3WK6A 3DE1X 4E5PA 1RTTA 1YR9A 4NPCA 4IJKA 1N2JA 2E1RA 4PZZA 1VIVA 3DAGA 2HWXA 3CUTA 5G41A 5EA2A 4OHUA 3RC3A 1CNFA 1NQXA 3FCEA 3GAFA 2YVAA 2YVQA 2ZU6A 5EP3A 2WP8J 3NXKA 1KVRA 1TLFA 2AEEA 2PR7A 4FFOA 1KGSA 3ZV6A 2ZJ7A 5JC8A 4KO3S 3O21A 1DIBA 1XP8A 1VJDA 2KBFA 4DJFC 3W6ZA 2HDHA 3D6FA 4O4LB 1RYDA 1W0CA 3QX9A 4GX5A 5JNWA 1B15A 1PW7A 2H2HA 2HQ1A 3ZZTA 2JBAB 2OILA 1EXWA 2IBMA 3A1TA 4RVUA 4YT2A 1IVNA 3GEGA 5HG0A 2ESRA 2E4VA 4E32A 1GRQA 2RGAA 3DFUA 3EE6A 2J7KA 3UIEA 5NLLA 3SZLA 1FS5A 1Y4AE 4PSAA 1ZCBA 3M34A 3C15C 4LJRA 2I62A 2I2AA 1QUFA 3AEKB 4LF8B 1T2UA 3C3XA 3ESXA 3W6OA 3G13A 1JNYA 2ATEA 2PMBA 2EG5A 3PITA 3LLSA 3EUEA 1GZ4A 1XMIA 4HGQA 1ZVJA 4I4NA 4WFKA 5J2TA 1O57A 1TTTA 1IM2A 1XELA 4LMBA 4KXFB 4OQZA 4QBFA 4CG0A 2EL9A 2HSWA 4KXQA 3BGOS 1KHTA 3OTQA 4D0LB 4PO8A 4TT8A 1WP4A 1PNRA 1ZN8A 2X6TA 3ORQA 2C3YA 1KKMA 3PXEA 1JHRA 1U1EA 5C3UA 4KO2S 3TMKA 5KVAA 3NTVA 2EP8A 5E0KB 5LN1A 1PJLA 3RS4A 2H2DA 4JLVA 1SQSA 1KP3A 2HJ9A 3N2ZB 4GZLA 3ZCRA 2YWEA 1ENOA 1PG2A 1P5RA 1FUEA 2AMYA 3A4IA 3HDHA 4YMUA 3BTUA 3E3AA 5F64A 1L5GB 4FB4A 1XVTA 2JB9A 3RG2A 1Z6YA 5HK8A 1N8TA 3QW4B 3TZBA 4OHMA 2VP9A 3SJAA 2QX6A 5BXYA 5ENDA 2GJ9A 4M0DA 1FLVA 4R0NA 4Y9DA 3SN6A 4CL2A 2G0NA 3COPA 3GA7A 4UZFA 1HDRA 1D6JA 5HDBB 3GEBA 3U5TA 3O1JC 5F7OA 4BTVA 5KDDA 2OHIA 2FG7C 2J33A 2X14A 1NP7A 4B73A 4ZT5A 3L8CA 1SC9A 2PSSA 2GM5A 3L4BC 1CIPA 4Q82A 3JATA 3MCVA 3HJNA 4CCYA 2ZQ5A 3CUKA 3HB1A 5KQGA 3AVVA 1EM8B 5FPYA 1JIQA 1ACLA 1TB4A 3BAZA 3TL6A 3VH4A 2CXPA 4P53A 3ENWA 3RTDA 4BVHA 3RKRA 4KIGA 3N6VA 1JFTA 1U3VA 2Z04A 4RWZA 1DX4A 1WF6A 5CFOA 4RLHA 2GZMA 5IDQA 3KEOA 4IJWA 1A77A 5CG1A 1Q1ZA 1D0VA 4PZDA 4Z0HO 5A4JA 3OIYA 4I50B 5HZGA 5JH7F 2O4CA 3BL5A 5LLSA 2RARA 2LD4A 2ZIAA 1VYVA 4R9NA 2BGNA 4RETA 3THYB 3ZTTA 1B16A 9MHTA 1JKFA 4EG8A 2H07A 1Y98A 2ZRLA 4LJYA 4U2CA 2QN6A 1AKTA 2H5IA 1ZKDA 1F0NA 4DUGD 3N0VA 4U7WA 4JI1B 2ATXA 4I5GA 4UXHA 1RXEA 5KSPA 3TPZA 2GO1A 4F71A 2NGRA 3REQB 1RYEA 1IUNA 1P1HA 3IHKA 3LRPA 3TZLA 1QKIA 4P7BA 3G88A 3ILHA 1E5TA 4H7IA 3WA6A 3BICA 5HUJA 2PVCA 1AM4D 1IPFA 4WZAA 3KQSA 1ZKMA 2DPXA 4M87A 3CVUA 4YIHA 4FEYA 4U39A 3CV3A 4BP3A 3VJRA 1KPHA 1LZLA 2MYPA 1WHTB 1R0BA 1BX1A 4CM9A 1RP1A 3S1AA 3KM0A 3P2KA 4MRAA 3JZDA 2ZAGA 2I6XA 3DR3A 3R5KA 4FFWA 1W29A 3HKCA 3TK1A 3L7LA 2KW5A 4GR5A 5JLAA 3ZWXA 2Q3CA 1F20A 1Q22A 4RJJA 3K20A 2P9BA 1R5OA 4MO9A 3ZV3A 2P35A 3NTXA 2QL9A 3E3OA 4DS3A 1I94B 1FLAA 4I99A 4S1PA 1BGVA 1VB3A 2IYUA 4F21A 4LG1A 1Z4LA 3A1SA 5BV8A 4B44A 4HYYA 1EBFA 2DB3A 5CEEA 4XPIA 4YI5A 3DE2X 2Q4EA 4EO7A 3W5CA 4PXAA 5G4KB 5M3BA 2ZUSA 3HM9A 1J9ZA 3BIWA 2IS1A 3INNA 4ZU6X 2VJNA 3R5SA 3GPDG 3T1HB 1A96A 1GQYA 2OFWA 5C0OE 3WRVA 4WGFA 3GUUA 5K3OA 1C4WA 2OAQ1 2V7TA 5AVJA 2R84A 1J00A 2ASVA 2DPLA 5IT4A 3K5WA 4GSLA 2N1BA 3SEZA 1NJ5A 1AKQA 1Q7RA 1XN4A 2J9ZB 4IPTA 4BZQA 2JDID 3GZTB 2JANA 1VSQA 1EFCA 5JD5A 3P4YA 4L3WA 2GS9A 2RGXA 3IJEB 2Q4OA 1YJCA 3GRFA 3ONWA 1I7LA 4L0CA 5KC9A 4KIWA 5K4HA 1SCUB 3BFKA 4J29A 3RJ9A 1YA4A 2FQXA 2BFWA 3I62A 3PXCX 3P0HA 3F2IA 4TWAA 2HJHA 2OLKA 4OEHA 2XBLA 3C2QA 5EP1A 4YREA 1HDEA 5JQGA 3L1KA 1V9LA 2YXDA 3LDAA 5J4LA 2WYWA 1MTZA 2OCBA 2RCYA 4JFAA 4MGYR 4W7SA 1CP2A 2ZJFA 2Q4DA 2X4LA 2PX0A 2PPVA 3Q3IA 3UC5A 3O84A 4IUDS 3ZCTA 2CNBA 1XIVA 2PX4A 1K97A 3IL2A 2RGRA 3RRNA 2ERYA 1Q84A 2H51A 3GLHE 3GLKA 1WZEA 3AXTA 3LKVA 3PPWA 4H3VA 3IBSA 5DI3A 2HHCA 4UAVA 4MQBA 4JQCA 5EXXA 1PWXA 2FCAA 4Q9JA 1AQLA 1MPXA 1QK3A 5B4VA 5K0FA 1U8ZA 5CB0A 5KO2A 2WKPA 2VP0A 3EH1A 4WY5A 3RCBA 5K7SA 1V8OA 3KEGA 2DAPA 1J5PA 2DPGA 3GPIA 1UJMA 3B89A 1X1QA 3HCWA 1ZSNA 3WLHA 4RTJA 1OFVA 1PLKA 1U9IC 2VUTA 4I3FA 4C87A 1MPTA 1FLNA 1WTAA 2QRQA 3KJNA 5A0FA 1RXSA 1AQ6A 3K9GA 4UHCA 1TMOA 3IEKA 1SKAA 4O4JB 1NP3A 3G9XA 3FR7A 1NYLA 1TA0A 1S7GA 4DJAA 5G3YA 3WIUA 3KP1A 4RFLA 1VRCA 3ZH2A 3MK31 4FZRA 3TNYA 3EG5A 4KWEA 2QR5A 5AHOA 4PVDA 1N1GA 2OFOA 3C6BA 2C2BA 4KX5A 4BJ5A 5JT1A 4QYSA 5JEDA 2QQ0A 3H9JA 1UQTA 2QGFA 4PAGA 3CCCA 4BVAA 5AI6A 4UUBA 4EYOA 1QZZA 2C82A 3GRPA 1WQ3A 1YOBA 2FN8A 4UUNA 1BCRA 1G8MA 4C0AC 3PRYA 3QLVC 2VUUA 4GUDA 3LBHA 4JQZA 2ZR0A 1YKSA 1ST3A 3FCSB 3VMFA 3AUKA 1KQPA 3DOCA 3NALA 2RGNC 2Q3LA 3SFZA 3UMMA 1YFKA 4B34A 2FR0A 5FBLB 3OQIA 5FWYB 3MRVA 3F5QA 1N2ZA 3KXLA 2Y1OA 4FX5A 2IV7A 1GFSA 3VZDA 3CA8A 4RFSB 2DKFA 1QWSA 3QJ5A 3SD7A 4BVEA 5B7QA 1QH8A 3KFLA 2QN2A 3DZIA 4NICA 2AFIA 3HU3A 4DR3B 5AM3A 4HRXA 4ZYWA 5JARA 1JEDA 3HVJA 2YV3A 5TQJA 3DDZX 5HUHA 1UPCA 5E6SB 5TXGA 4OI0A 2FXVA 3S0JA 4R1SA 4KO4S 2JRCA 1NF3A 2WUFA 4G67A 1BO6A 1LK0A 3PQ2A 3K9BA 2JVJA 3WLJA 1C30B 5FI3A 1Z63A 1B0UA 3CM0A 3B9PA 2IYVA 1LDYA 3OU7A 3V2GA 2W6MA 4L5BA 2CDAA 2YQ4A 4MW9A 1QV9A 4RH1A 1CYDA 3VGPA 2WSMA 4WOJA 5CYOA 1FRZA 2BGLA 3HPQA 4ENUA 1OPRA 1XHEA 3CU5A 2WUEA 3E7WA 1WNFA 3IHTA 1WB6A 3OIGA 1MIOA 1R0LA 1X1RA 2V58A 2GN2A 4GAEA 2IWRA 3IAAA 5C2JB 2XTAA 4ZP1A 5FWXA 5HIAA 3K1AA 4C0JA 2ZRFA 1VI6A 3V3KA 4DRXA 1H4VB 5LKRA 5E4YA 1LDNA 1DLIA 3HS3A 4KH0A 3TFOA 2WKWA 3RK0A 2CF5A 4YR7A 3Q7IA 4IMIB 1Z6XA 5T3UA 5BSRA 2E3JA 4QYIB 1B8VA 2ZYIA 2WPDD 5G0WA 2A94A 3WK8A 4D3FA 3DHVA 1RKQA 2CLKB 1QE3A 1HSOA 1RCFA 4UREA 3TZCA 3QSYA 4J0QA 5JIBA 4MYRA 4EQ6A 2REOA 4GXQA 2QQ5A 1QQTA 5F4BA 2HA3A 1J2JA 1E66A 3P0EA 3RVDA 2KI5A 4EJSB 4A91A 4EBBA 2VHVA 4AG3A 4N7BA 2WV9A 4INPA 3AR9A 3SF0A 3GLGA 2X40A 3FOAA 3JQCA 2JJYA 3HVHA 4JB2A 3RJZA 4B85A 5EE0A 4C05A 1CEEA 2O6HA 1FNCA 5CM9C 3G2NA 4HC4A 2J32A 2GEJA 5E1MA 1XB2A 3G2LA 5JXHA 5LJLA 5MN4A 2B8JA 3W2TA 2OORA 3ECSA 5ALYA 2GJ4A 4FOTA 1HOTA 1N92A 2QLFA 4IL5A 4NWIA 2V1XA 4RPJA 4RVGA 3HVRA 2VVTA 4P32A 1JEJA 4J1NA 4URVR 3I2JA 3SHQA 4RCZA 3CONA 4BKQA 2PRZA 5P8WA 1CVLA 4DQVA 2Z1NA 2KQUA 3NP9A 5L7YA 1LU9A 2C2WA 3W5HA 3GA0A 3QELB 2WR8A 4PBSA 1OJLA 1EFPA 3OICA 3TXXA 4WCFA 3GD5A 3AP3A 1RPZA 3FXAA 2HSDA 2C9OA 3CEAA 5LVAA 4HQOA 4MAAA 4PC3A 2Z30A 2Y8EA 4W5HA 4NXMB 2BGTA 1JIIA 4BB5A 1A4RA 3DVSX 1ZK1A 4BVJA 2JGFA 3HUTA 5EXDA 1M2FA 1VM6A 3UJCA 3Q9SA 1BVRA 4IEIA 4FEGA 2C9YA 1RMQA 1H8EA 3QEMA 1OILA 4FQ7A 4N49A 4RKQA 4Q02A 2WSBA 4EX6A 3VUFA 1K5PA 1UKEA 3DV9A 1Z33A 2XKAA 3DVQX 1Y6ZA 3U13A 4Q00A 3ZLJA 3IDOA 2X9GA 4R7TA 1CP3A 5D3MB 1KJJA 1L5ZA 1HE8B 1DQSA 2E55A 2VHUA 4J2OA 1P5JA 2C29D 5IAKA 3HO6A 3EJ6A 3KPJA 5K45A 3Q9LA 4RGQA 1H65A 5JCJA 2R2GA 1R6UA 2JI8A 1LZKA 1PO7A 2BMWA 1SBTA 2GK7A 3OJWA 1GPBA 3N70A 4MWDA 4PX9A 3K32A 3T9BA 3WYAA 5CFRA 1CZKA 4YPFA 1UBTS 3SOZA 1E7QA 5J2UF 1CUJA 3IAS1 1I4LD 4BVBA 4CWAA 2BTQB 4V39A 4OIFA 2W2KA 4DFDA 4BB6A 3R3VA 1XDSA 4H9GA 4L9SA 3TNDA 1I7QB 2G40A 4DV6B 1NXXA 2I2XB 4Z53A 2OLEA 3GNSA 4OQNA 4NDAA 5HBRA 3U37A 5JW6A 5HTKA 4DF3A 4K9NA 5L7WA 1DADA 1ZK2A 1NX9A 1T36B 1Y6RA 2GQ0A 2IYRA 3TD9A 3U9LA 3WRXA 2E6KA 4BXOB 2ZXEA 2IFTA 3KEFA 1X9HA 4UC0A 3H4TA 3W2EA 4RENA 1RC1A 2IEZA 4A5SA 1YH3A 3I9LA 3LT2A 4FLMA 1CETA 2GASA 2IPAB 3BTSA 4OBXA 4QOHA 1V2GA 3N75A 4C4XA 1ADFA 1NYQA 4PQEA 1GCIA 1OZAA 5JSZB 2VHXA 4DIUA 5JXWA 2O1XA 1UR5A 2R1VA 3K8OE 1N4AA 4LRYA 1Y37A 1GCGA 2K6GA 4N8DA 3O8RA 1UDAA 1XSEA 5BV0A 1JTEA 3G1TA 2YJZA 3EGXB 2O5CA 3AONB 2VHYA 4KOEC 1PJ8A 3C85A 2IZOA 1O3YA 1AT1A 1ZFNA 4LOHA 1U8TA 3R76A 4Q4HB 2GA8A 5JRDS 3EZ2A 1XK6A 4RJ2A 3LCRA 1G7SA 1A9XA 4FWIB 4AF8A 3R9IA 1PFUA 1E2QA 2JVKA 2GT1A 4LE0A 4OJQA 4PSVA 4QFDA 3ACDA 4LDQA 5TGDA 1F51E 3GZJA 1Q3HA 1ECGA 2Z57A 3BB4A 3ND6A 3PXXA 5K8TA 1ARZA 1M6WA 4WZZA 1AN0A 3JZAA 4XCVA 2W6ZA 1U02A 5E2IA 1N78A 2W6IA 3K8QA 2CCKA 3QBTA 3RWMB 2IF2A 3ZY2A 2CEKA 5BQ3A 1YOVA 1IEWA 1QMGA 2X19A 4QATA 1ZEJA 1LLQA 2PY6A 3H1TA 4TLLB 4BMVA 5JBIA 1LBSA 4KUEA 3CEJA 1AUXA 5AKHA 3RFUA 3KUCA 4NH0A 1UC9A 3I9V1 5DHUA 3U19A 1Z6TA 2FSUA 1DDOA 2QI9F 3KYIB 3AVQA 4NARA 4U0KA 5TR9A 3MD0A 4TRNA 4Y2XA 2D3WA 1W0JA 3TL3A 3ZWNA 2PZLA 4ZYXA 1XZKA 1CZLA 1PLLA 2WABA 1HKUA 2A59A 5AJUA 3TQQA 3ABIA 4AWBA 4DABA 3JSXA 4INAA 8GPBA 1PR2A 4AO6A 4E5UA 3N8NA 4MGHA 1F8FA 1MX9A 2ZYAA 4G63A 3T15A 4W8HA 1GA1A 2I6TA 1DUIA 3DL0A 4XDYA 4I8IA 3F6CA 4TMYA 5FEMA 2JFHA 1NXWA 2QT9A 4MCHA 3TNFA 4TN5A 1KE2A 3BSFA 1NG1A 5DFAA 4URXR 4G5SA 4JKIA 4WA7A 2RKWA 5D5QA 3OY7A 2O59A 3R0JA 5DNWA 2A1IA 3VAZA 4BLUA 1ZDMA 3U48A 3VTAA 2WMNB 1ZO8A 3ZY3A 1JLLA 1DKUA 2PPLA 2K4MA 2OXRA 4GU5A 5LLDA 4YRBA 3NVKI 2O8BA 3LUFA 4HQFA 5KYWA 5TJHA 3GL9A 1L5FA 2ALJA 4RDHA 1P29A 4EMBA 5HXAA 4HUQA 4Y6SA 3EARA 3QKIA 2VT3A 3DZFA 2D1YA 2FV8A 4KR2A 1C1DA 5IKXA 3B6MA 1DMSA 1ZN7A 1E3MA 2Z8XA 5TRTA 2B4KA 3BXEA 1G7RA 3OZCA 5B1EA 4R5MA 3A04A 5FFFA 1WCIB 1OH6A 3N05A 1PS9A 1V5IA 3C1AA 3C8DA 3JQDA 4RNDB 1EFTA 4Y18A 4KPFC 1EZZA 3UPUA 3QTBA 2R96A 521PA 3EDRA 2CXUA 2OXFA 2B1IA 5IK2A 4E2WA 1GAXA 1XZQA 1XCOA 4TSKA 4XB1A 2WJ6A 3Q7EA 4RA9B 2O23A 3M1LA 4B3HA 5KSZA 3D81A 4YMGA 3BQ9A 2DHCA 1HFEL 1ZK0A 4CDRA 7REQA 1XZPA 1JEYB 1B41A 2P9ZA 1EUCA 3GROA 3W6UA 5BQOA 1GU1A 5JJKA 3WGTA 1V26A 1YCHA 3LUJA 1ICEA 3DQQA 1M8GA 4C2AA 2I34A 4LF6B 4NOLA 4PGHA 4CG2A 4K87A 5EJ4A 1QPGA 1MDFA 2WT9A 3MW8A 5GAJA 3TGLA 1EVLA 2Q5CA 4P3YA 4YJHB 1X7ZA 3FYDA 5EZ5A 3ZXYA 3ANTA 3ZBPA 3ZJYA 4OQLA 5K3SA 1EFAA 4Q5IA 4RY8A 3NJRA 2W4QA 1NI4B 4NEHB 2IEGA 4UTOA 4ZVMA 2WFZA 1GKKA 2Q9AA 4UM7A 1NXQA 2IHJA 3GIWA 1TA9A 1DWPA 1ULSA 2YOGA 3F6SA 5A7HA 5CPFA 3X1KA 2BISA 1N2BA 3NV7A 3KQLA 1YDFA 2V6FA 3BSWA 3R8XA 4TXHA 3U09A 3I3SR 3WE7A 4CM9D 3SKVA 3D2LA 1ODKA 4CEIB 1GZDA 2OOKA 1XJWA 4WACA 4DG8A 3PRJA 4MRNA 4DREA 3PRHA 2EQBA 1WRBA 2P5UA 4I1VA 3ZWPA 1S1MA 4QIHA 5AW1A 1VZ2A 3N2IA 4JCOA 1UKCA 4IM7A 1LPNA 3AL2A 2MSKA 1LLUA 2H1LA 3ISTA 4O5OA 4PHCA 1FB5A 4DQ0A 3ZQ4A 4XH9B 3QX3A 4CPDA 3R7AA 3H84A 1G4UR 4L2IB 4LHSA 3AFOA 3DLTA 5FI5A 1I6MA 1FX0B 1BX0A 2QNBA 1Y9AA 2YHAA 5JO0A 3DHNA 4MIOA 2HR1A 3NBKA 2G67A 5E6RA 4N0QA 1NJGA 2HDWA 1P2DA 1UK9A 1M34E 1X1SA 3D8TA 3ETGA 5FYDA 5ALTA 3B12A 2IE8A 2C98A 2CWWA 4JP3A 1FFYA 2NAFA 1YD7A 1E32A 4OHOA 2AH5A 4BYGA 3KYDA 5BPFA 1ODSA 3PEFA 4MDFA 4BZWA 1OLSA 1K9VF 5LL6P 3SR3A 4UDNA 4ZU1X 4UTVA 1LB1B 1GUYA 1SCDA 4MIEA 4GOLD 1SHKA 5K4AA 3ZOZA 3BGDA 3ER6A 1O6GA 4FZVA 1T2FA 2WJIA 1EVZA 4REMA 4TZTA 5HFJA 2Q5HA 5BWMA 1HL7A 1MOSA 1EVKA 1P0CA 2HRZA 4P98A 3L06A 2GN1A 3LDGA 4ND4A 1RQXA 2LRHA 4X45A 2HA4A 2P9CA 3ZN2A 1QRDA 1ATZA 4JA2A 4C0WA 3ESDA 1SVSA 2BEJA 5F12A 4ZEOA 4E5MA 4HQ0A 4X00A 3V8BA 2ANCA 4N3GA 3H5OA 1RRFA 2J6CA 3V9AA 4B09A 3PXDA 3SYRA 1WSDA 1XRSB 3EDQA 3KLMX 3LCUA 4IIGA 4F85A 1SAYA 2DLCX 2CUKA 2NPOA 1P5FA 4ROSA 2DUJA 4U6NA 4UCWA 4ZI7B 4XQEA 5ICSA 1IBLB 4XUDA 4I8DA 4Y7CA 1J06A 1RTKA 5C5EA 5FOUA 1TI7A 1LC0A 3WGIA 1E63A 4TZ6A 1BD3A 1GAEO 2JL1A 3AY7A 3KR2A 1VLJA 1BE0A 1J2YA 1MJGA 3IV6A 3M6LA 1NU6A 2YQ5A 1CSEE 1H0HA 5FOXA 5KKAA 3W77A 1NE7A 4KFCA 4POAA 1IDOA 4Q18A 1L5LA 5KQSA 3OCUA 4XB2A 4EA6A 3T12A 5CD9A 1QIEA 3V34A 3P9QA 3PUKA 1VMEA 4QUHA 2RONA 4AKIA 5I51A 1ZVVA 3G8DA 3IP1A 3D8UA 4R2XA 2H08A 2Q2OA 1CFJA 1QO7A 3TTSA 3I6ZA 2W6QA 1ULTA 3K53A 1D9XA 3WMWA 3WLOA 1Q91A 2EU8A 2VZ9A 3BVPA 1LH0A 4NTZA 1W35A 5LIPA 2C84A 5FI0B 1NY6A 1HSZA 4CV1A 5DHFA 1G21B 4AJ1A 2VYNA 5JFGA 4MZDA 2JGDA 4D92A 1V3QE 1J0CA 2QE6A 1IZ8A 4CKEA 2C3MA 4G81A 1LNSA 2JGRA 3Q2OA 4FZJA 2C59A 4XSGA 4J90A 1Y89A 1BWSA 1BA2A 1EP1B 2HPVA 4CODB 4CRWB 3PUJA 1NMZA 3IE1A 4DIKA 4YACA 3ETLA 3N74A 5BV1A 3KSBC 1M0WA 3FPLA 3CISA 4IMRA 4WW0A 4AJNA 3ZHBA 3GEEA 3WGUA 4MCAA 4DDTA 2VCEA 3OIDA 4CDNA 4UMDA 3DAPA 5B7NA 2YYYA 5EJGA 6ADHA 1CS4C 2RGDA 4AJIA 1KEEA 4JEMA 1CJSA 5IYZF 2OD2A 3ZWKA 4MV7A 3QZUA 2NO0A 8MHTA 2CF6A 4QREA 4G0MA 3ESZA 1ZCAA 1VL0A 3AZPA 2G0TA 3CMCO 3GVHA 2DBVO 4MP8A 2VBGA 3DO8A 5CH3A 1UFVA 2C2GA 3PI7A 5JLJA 3NWOA 4KSBA 1FXSA 4FGSA 3SU8A 2X7XA 1FNBA 4MX8A 4YJGA 2G4CA 4CTOA 3RASA 4Z7OB 4EKGA 4HGRA 3ZCXA 1H2HA 1WP9A 2RAFA 4U2DA 1GOTA 2FW1A 1Z62A 5D7NA 3W8FA 5LD2C 1K7EB 2AI1A 4HQKA 1GTSA 2CZCA 1ZXXA 2H7CA 3BHIA 4JOCA 2CXOA 4RF3A 3EEQA 2Z2KA 3V4LA 1F8GA 2X23A 1JIVA 4Q3NA 4TRMA 1ID8A 4MULA 1TMGE 1J23A 4HDCA 3QVWA 1CC1S 3RS2A 2FPIB 3SC2B 1H05A 3UMGA 4D25A 3N1UA 4WUTA 4EUEA 4RJTA 1NA5A 3HXKA 1OGYA 1G16A 2ZFUA 2VDWA 4WT7A 4D3SA 1UBEA 4Y98A 5KTOA 3L0SA 4OHXA 3ECCA 3LC1O 1BXRB 4GX1A 3JQ9C 2VAWA 2FSFA 3PL1A 5E9JA 3RYIA 2F90A 4XDGA 3FSRA 4OXYA 4D97A 1T5OA 4GVLA 3Q0EA 3HB7A 3ZDCA 3HN7A 4EPWA 5F73A 3H04A 4JI4B 1T3SA 7ABPA 5C5CA 1DAOA 2DKNA 1JVNA 2WT8A 3V3TA 3JQ8B 4KBFA 5AVOA 4ZYZA 3GAZA 4WN3A 4A82A 4BLOA 2UYYA 1QP4A 1NVEA 2ZI4A 2UYQA 5FL7A 1C3VA 3A4LA 1ZVQA 2R6FA 3SAJA 5B12A 3AR5A 2AI2A 3T4UA 5BV7A 3GP8A 5C37A 5T5QA 4P7GA 3ZIAA 2ZBPA 4X9XA 1XWIA 1QF9A 1ZLXA 3UW1A 1LTHR 3QFSA 4FPXA 4D9BA 4A23A 5ILOA 3OFNA 4CIYA 3RS8A 1SU4A 4XDZA 4DXHA 3TJRA 1YB2A 3P2IA 3SX2A 2R7MA 4C08A 5I7SA 4RHYA 3V8PA 3MJSA 4MVJH 5F1YA 2UYHA 1NN1A 1G8HA 4CF3A 3QLUC 2QM8A 1M7GA 1F60A 2AL7A 4KK3A 3PKIA 4DUPA 2IYFA 2DMRA 3M6MD 5BRAA 2F3PA 4OHYA 2IYTA 2A5FA 1P7CA 3F8SA 1KK1A 2P91A 4E5VA 3DUWA 3I2FA 4YBZA 5FBKA 4RABA 4MPTA 1UJ5A 4CN8A 2HJGA 1T35A 4LNUA 4I4IA 3WWEA 4YPOA 3G7NA 2PUTA 3PRKE 5IKPA 1T2AA 1T5BA 1XTPA 221PA 4JKOA 4RY2A 5ADUS 4TL6A 3F7MA 2XA1A 3L8ZA 5ENZA 3T9FA 1UAYA 4BFTA 3KT3A 4NJMA 1RLUA 2CJXA 1ZWKA 3LYUA 5LP6B 3G2PA 4LRXA 3UBTA 1M5RA 5FBWB 3MT7A 5FTLA 2CYBA 3DXYA 4LV5B 1OI7A 4UTZA 2F8MA 1V96A 4MEBA 4PN3A 1EB8A 2O8CA 3AY6A 2G5GX 4EGSA 5CTAA 3JVUA 2P9JA 3Q2IA 1USUA 1ZNQO 4BRZA 1Q0LA 5CLGA 4TYNA 3OURA 4U00A 4UHJA 1H8ED 2VA9A 5F9MA 4OHZA 1W73A 1W4LA 2CMDA 3KVNA 3ZX4A 2QLTA 1I0IA 1R16A 4Q4JB 3C3CA 4KRXA 1TVKA 3NT5A 3SC3A 3HDQA 1Z29A 1JAZA 3F5SA 5SZKB 2Y93A 3OZVA 4B8ZA 4C0LA 4F5WA 5LUAA 1DC8A 1QIJA 3GFSA 5LKAA 3HDJA 4MP6A 4OFZA 3DAYA 4PAQA 3WGQA 3KS9A 1Q1GA 4E5KA 5FPKA 3DC2A 1GXSB 4HZGA 2OHXA 4PGGA 3CG0A 4ON9A 4W5QA 2BUBA 4RE6A 1RQ7A 4X3PA 4YNBA 5LYJB 2IPLA 2VYQA 3CH6A 3L0BA 1X8KA 2BP7A 2FE1A 3ZIUA 1NLYA 1VB5A 4NFSA 3ZHVA 8ABPA 3BQMB 3D7MA 3ZXUB 3D5TA 4HRAA 2FN7A 1E3WA 1B6GA 1W2GA 2Q2VA 4JR1A 5DTMA 1B2LA 4EJ2A 1NSYA 2F9LA 2JFFA 1CNEA 1ZYUA 3N7TA 3BXPA 1HLPA 3GUZA 2WZDA 3O92A 1IG3A 4P4NA 4S2UA 4EA7A 2HT1A 1WNTA 3UG6A 1V16B 4JUAA 2DZDA 1TYAE 2E18A 4NG4A 2I91A 1F8UA 4UD2A 2OV6A 2WWYA 4UXIA 3IKTA 1VCOA 2WYHA 3S8YA 3PC7A 4BHTA 3HRKA 1TLLA 3FLMA 4D81A 4TMFA 2NV6A 5FBQB 2YIVX 4BP8A 3NU1A 3BFXA 2PLWA 5JS6A 4NZYA 2BMJA 2OHHA 2WD7A 3V55A 1S96A 4DDVA 5HKAA 3M6FA 1EX9A 5DW0A 5J43A 3OQOA 1XNRB 4RZXA 4BYMA 4R68A 4DT1A 3H9BA 3SF8B 2Y92A 4WMLA 5FLEX 1G5TA 1VI2A 2GFQA 3EG9A 2Z43A 3QHPA 3WP0A 1R66A 3SX4A 2QG6A 4V03A 3JWGA 3L0CA 1EFRA 1J22A 3BKWA 3FWHA 3DM5A 1O9BA 4N6GA 3USZA 2PU5A 4UFPA 3DDOA 5ENVA 1HT2E 1JR6A 3Q8XB 4M1KA 2R8RA 4G1UC 1IOVA 4G1BA 4P0TA 3ROGA 1QPBA 1KVUA 1Y7LA 2NXJA 2HI0A 3W05A 1CUUA 1QGYA 2H9AA 3BGVA 5KHAA 4Q03A 3DMHA 1A7UA 3KUKA 1TIBA 2YICA 1T91A 5EHGA 3ZW8A 4C01A 1Z9BA 1VG8A 4P4SB 3ZDXB 4DIOA 2V7QA 3I6YA 2LIVA 1V8FA 1LLFA 2W6ID 1B4DA 2GD2A 1XMOB 2BZ0A 3BXFA 3JARB 1SQ6A 5CPBA 1E4OA 2RHWA 4LF9B 2W2TA 5EEGA 4Q9NA 5HSGA 1F14A 7YASA 1JEQA 5IMSA 2OQRA 3QU7A 3GCWA 4JEUA 4MUFA 1VGQA 4B32A 2ID9A 3E2IA 4H18A 4JXXA 3M70A 5A7GA 4F11A 1S89A 3UQZA 1AS2A 1LFDB 5LQDA 3TZQA 4R0VA 1BDJA 1NSTA 1W0JD 3P2MA 2JJ1A 4AQDA 3UO8B 2R7LA 3TOZA 1KYYA 1Z8NA 5GJBA 1E9AA 1UXGA 3JQRA 3PDJA 3TAHA 5L45A 4ZT2A 2QRMA 8LDHA 2QNIA 5ESDA 3EIFA 1WMEA 4X1OA 1KJZA 5EUQB 4KXUA 4RXTA 4GO1A 2CKMA 1BGXT 2EFEB 3V7UA 2G9UA 4BOYA 4UFNA 4YCAA 5J2UA 1GPDG 1BS2A 1U4SA 1RHKA 4WY8A 1F2TA 3GJ8A 3NOQA 3GJXC 4UBMA 1P0MA 3HQ4O 1FFDA 4N54A 3AHJA 4LBYA 5HGXA 1QGUA 1FVHA 1YK0A 3TI9A 3C6YA 1ZS9A 1W85A 2WJWA 2BEVB 1U0JA 2ZWAA 1MCZA 1XL1A 1PT6A 4NKRA 2L69A 3ADKA 4X71A 3TI7A 2X8BA 1VJGA 1Z2NX 4LECA 3EBLA 3NPAA 4KR0A 4LFCB 5HJ7A 1SHJA 1Z4QA 3QIVA 1PUJA 3NFYA 2W2MA 3FCOA 4G0QA 4HDNB 4W5NA 4MV4A 4W1SA 3QPAA 3DAOA 3O03A 1H0SA 3B6JA 4L6IA 4UEKA 1H2FA 4X1IB 5KTPA 1PR5A 1KTVA 2AN5A 2Q8NA 1PFGA 1SVMA 1XE3A 3TBKA 1KJIA 1IQ0A 2YDXA 1RRCA 2W8ZA 4RKEA 4EUSA 3UK2A 2CMGA 3R24A 1GPMA 2H5EA 1D2NA 3USCS 5C4MA 5IK2D 2OC4A 2VDMB 4FLFA 1E9RA 5BWCA 3DEIA 2CHUA 2YIJA 1KOLA 3GJSA 2W6PA 1DRJA 1QAQA 2DG2A 2HBRA 2MDTA 1MAWA 3H5AA 3M3HA 2J8ZA 4MW7A 2QVLA 5BUQA 1T4CB 3HZZA 4DNOA 4QDKA 1QVRA 4LHEA 1EGVB 1KA9H 5CB4F 1ORWA 2HRCA 1NZFA 1FP4B 2XYVA 4YP6A 1ISGA 2BBSA 1PL0A 1YE5A 4IIYA 3E2PA 2W2LA 3V2HA 1R37A 1MBZA 5CA0A 3Q88A 2J1LA 4O4IB 1NUSA 2QORA 3MMXA 3WNDA 1P0PA 4QOIA 2IS4A 3ZBTA 2H4XA 3ABZA 4U8GA 3TQSA 3OQBA 3NB0A 3CGGA 4L5CA 4WN9B 3FGOA 1TK9A 5KIAA 5IF3A 2XQGA 4YRQA 5DDIP 5EP2A 3V4ZA 4ZVSA 1O8BA 1E77A 3L46A 4H7PA 4D43A 2ZETA 1VE5A 3W9UA 1PWHA 3VKFA 3OZEA 2X8JA 3MCUA 1L3BA 2J6BA 3SZ3A 2HDOA 3RSSA 2CNOA 1WW8A 1OMOA 2PFSA 3F0TA 3A3YA 2CL6X 5SYMA 4ER5A 4NCIA 1ADGA 1WS6A 4RGBA 2OXEA 2XGGA 3WZ2A 4B4OA 4DZZA 2OCDA 2YJ6A 4HXYA 1E1CA 1V8BA 2BMAA 2AG6A 3NEAA 3DBLB 5JCOC 4UQOA 4ZC1A 1DAKA 2CLSA 5J40A 3M6XA 4BDTA 2GGSA 2N3ZA 5KKNB 1EHIA 2CUTA 3CT4A 4YP7A 5BW6B 3VH3A 3VJMA 1JJFA 5I5GA 1IUKA 3PNMA 2JIZA 1QQ6A 4HDMA 4JHXA 5HKLA 4Y2YA 4WBNF 2C3OA 3IUMA 1KFKB 1Q6ZA 2B1QA 2AZMA 2ECPA 4L8GA 4R1TA 3THSA 3SP1A 1Y9JA 2PXXA 3TJZA 1E0JA 3T6KA 3WHPA 1SXJE 3RGGA 2I2BA 5EAIA 3ZHXA 2D5IA 3EXAA 1FU8A 5I7WA 3IO3A 3R5JA 1MQ9A 3GLVA 4F96A 4F5DA 2IYNA 3WI7A 1EE2A 1ZMTA 2H54A 3O8BA 4ND1A 2ZOSA 4V0NA 4E2FA 4FYMA 2OQVA 1I6LA 5K8IA 3PPIA 2JJMA 1Q1NA 4C0BA 4MKZA 1NRXA 5JZSA 1Z74A 3TQFA 3H9QA 2JC3A 4Z4IA 2GCPA 2P78A 3GDHA 2BGMA 2QTAA 1Q0HA 4RAOA 2E5LB 3FCXA 5L4NA 3LCVB 4BE7B 4D9GA 4M6WB 1MLDA 5L51A 4CM5A 1EA7A 1GTMA 4MYHA 2ORWA 3RW9A 1I5EA 4E31A 1U99A 3M3DA 1NVAA 3IP7A 1JKJB 1EH5A 2H9YA 1O94A 5FBZA 3AEZA 2AFVA 1I36A 4ZO4A 2B3TA 1MX5A 3ITEA 1NR1A 1U8YA 2E37A 3BL8A 3LRTA 5JWOA 2NT4A 4F3TA 3PLRA 1XQ9A 3B6IA 1C4XA 1KAOA 2B4YA 3PEUA 2NXEA 4GLFA 4R3WA 3I53A 4OY3A 3U4QB 1AN9A 3OZBA 3UTDA 2J3QA 2B4RO 2J46A 5G40A 3A4NA 4TLBA 1RRPA 2ODNA 2RGWA 2Q1TA 4OHBA 4PYOA 5ALKA 1OTXA 3B6KA 4A27A 3LNCA 1JMKC 4DWOA 5DASA 3EEYA 5DSZA 1PWZA 2ZYGA 3L79A 1R00A 3WLTA 4ERNA 2ISSD 4BFZA 3P9KA 4R2HA 3NRBA 2ZI3A 4OUDB 4RTRA 3EGVA 4DEVA 1S6YA 3PQ3A 4Y2RA 2QG9A 5E4JA 3JQBC 5EIAA 2RI0A 3NIGB 4EHBA 1NM5A 5C35A 3LT0A 5J5CA 4N8EA 2H0QA 3GDFA 4HI0E 2Q7DA 1JPVA 5J4YA 2G04A 4AZ3A 3LK7A 1AK9A 3SHVA 1BH2A 3AX6A 3OA0A 4OHKA 1A9TA 4B81A 2PSJA 4RVOA 1V7CA 1EDOA 3A1UA 3I72A 4C2TA 4LWPA 4D6PA 4YUWA 3JV7A 4A2PA 5CLLA 1BDIA 2QKYA 3AOEC 1EK1A 3DMNA 4P80A 2NO1A 3CQ9A 4MINA 3U3XA 3AHCA 1DG1G 3KJFA 5D7BA 3AL0C 4U3JA 1SXPA 3KQOA 3I58A 1NX6A 2UZ4A 2X4GA 3LCCA 1U0HC 2V6GA 2Q5QA 3OOWA 2VYND 3K73O 1Q1EA 1NRWA 4PR3A 4QECA 4DMLA 4EHFA 4B84A 4GNKA 4K81B 4XGRA 4JBLA 3VO8A 4FIDA 3BD6A 1ZK4A 2FRXA 2PN1A 2QNRA 1YS6A 2RHRA 2ZAMA 3FHCB 1Z06A 3QFRA 2GPTA 4MR9A 4WOCA 2ZIFA 2CUNA 5FPQA 3ROZA 3GV0A 3MWKA 4LX8A 4KO8A 2XADA 2JCGA 4IQ8A 3VVMA 3DO6A 2NUAB 1CF2O 1E7RA 1SBNE 3TM4A 2IEDA 2OENG 3CFYA 5AO9A 1EX1A 4GE0A 4UEOA 3ZWCA 4GP9A 4U7GA 1XQWA 1K3UB 3H86A 5B2ZA 1GZUA 3NEPX 2J9FA 2ICAA 1IXKA 1PEAA 1VKHA 1CY6A 1WWKA 3LUGA 4QHSA 1IQUA 4BQOA 1MVNA 3QVKA 2WWFA 3GJ6A 4JSYA 4WLUA 4C0XA 3SZOA 5E4FA 3PIIA 2HXGA 4KITB 3KTAA 4R6XA 1C9MA 2YFYA 4BFCA 1QIFA 2IH2A 3PPVA 1K75A 1DFHA 3I01M 2P79A 3L0YA 4DANA 2V59A 3QV1A 3JASA 1JG4A 3U0BA 2Q9UA 2MTBA 4IIJA 3SEAA 1LSUA 4YMTA 1FVXA 3A9SA 5IBQA 3VX3A 3C3YA 1W44A 2O7RA 3HEAA 1ZJZA 1FYDA 2C7BA 1RCTE 3GY0A 4ME6A 5I9TA 3W34A 2X7HA 2ACVA 4BAZA 5CA1B 3KBOA 3RT9A 2P2YA 2QRGA 3GLQA 4IXWA 1DKRA 4XOUA 2XLCA 2ODBA 1MO5A 2ABWA 4PSDA 3GGDA 4XD7A 3BFPA 5ALHA 3GJ4A 4AULA 2F00A 3KWFA 4BNHA 1LNQA 2FZEA 4EF5A 4MYDA 1KZYC 1YACA 1ZAYA 4ANFA 4ARCA 4A36A 4JVLA 3G0BA 1DQYA 2QP9X 3BMNA 4BCCA 1K7YA 3NATA 4ZV7A 1NMSA 5EWMA 4F6LA 5KOJB 2GNPA 3UCEA 1SOVA 2YMPA 3HRIA 4LOKA 3NVMB 3TUIC 3MMSA 2VOJA 2PLAA 4TWIA 4XGQA 3IEMA 2GZRA 3EIWA 5AJTA 3V4RA 4F7WA 1HLDA 3L6BA 1NPYA 4O8ZA 5DM60 2WTBA 2A0XA 3HYCA 6AT1A 2WJ3A 2PR2A 2XIQA 2CHGA 2Z5FA 3ML1A 2HA0A 1JQLB 2K2WA 1KP9A 2QG4A 4I1IA 4WSOA 5AWFC 1EP9A 3FVVA 4OYYA 4WJKB 4M9CA 3WV4A 3NH9A 3FZYA 5LWHA 4G37A 4O2AF 4JB3A 1RFLA 1H6DA 4HEJA 2OPBA 4KXWA 3I3OA 4K6MA 5TJ9A 4NECA 1LQUA 2HCFA 4IWYA 5FL7D 1MO3A 2EJVA 4RDXA 3KR9A 2OZKA 4TYMA 4B4KA 1F7UA 2NXNA 3HNRA 4PZEA 5DWDA 1DIGA 3OP4A 3ZIAD 1R6VA 3HCDA 1PTJA 3HA2A 3OZRA 4EYKA 1B3RA 5ICGA 1K27A 1NI3A 1NBME 1JECA 1FDRA 1HOXA 1UQRA 1F5NA 1ZMBA 2Q29A 2YRXA 1XXHB 3OFND 2FSPA 4H6XA 2NVWA 3TINA 1JDUA 4DCOA 4IRXA 1D6SA 1YS4A 5FXMA 2XNCA 3L1HA 4M0FA 1PHPA 1NKVA 5DIZA 1ZNYA 2L42A 4A8JB 1V0JA 1V71A 1QG2A 2P6OA 3M6AA 3HLYA 2VOEA 2FF5A 3W4IA 1VSTA 1A98A 3PG5A 5ALQA 3WA7A 4R9VA 1TCBA 2C2OA 3SQXA 2WJJA 3WGMA 2M2IA 3RYHB 1P19A 1QCCA 1S3GA 3G9ZA 4PG5A 1Z6PA 3RARA 2AN4A 3S2UA 3ZU5A 2PK3A 3E9DA 4LWOA 1TDJA 3TX2A 4BFSA 4JLKA 2WQ7A 5IZCC 5IJ0A 3K4PA 4DILA 4QUIA 2WVJA 3CEPB 3C3KA 4YN3A 1II8A 4LSMA 2GN4A 3ZE7A 1NKTA 1P4RA 2Q45A 4AYXA 4I1RA 1YVUA 721PA 2V9PA 1LQTA 4YRSA 4B8YA 2DUNA 4DV7B 1UEIA 3FUUA 1LDGA 2NUTB 2QB5A 2RB5A 3A4TA 1E6LA 1G19A 4I2VA 4JIMA 4NYJR 4QICA 4RV5A 5COQA 3V8MA 4OP2A 3RTAA 4C29A 5GINE 4LZOA 4YXFA 3TPFA 4LHXA 2SCUA 5E0OA 5LQNA 3QVGB 1KZGB 1L5OA 1UMCA 4YCBA 5I7RA 2AMVA 2VP5A 3QVXA 1L5QA 1U2QA 4TVBA 5TQ2B 4EI8A 2GJKA 1G6Q1 3D1JA 2Y67A 1LPBB 5KYVA 3TD2A 4EP1A 1QTQA 3EHDA 2NU8A 2XUJA 5K8LA 2AEJA 1KMHB 4DLWA 3DBHB 3CLKA 4RH0A 2C8VA 5DCWA 1Y7PA 5DGXA 1J09A 3UJDA 4MW0A 1DOHA 1BMFA 3SZUA 3ES9A 3IQEA 3CUWA 3IV9A 2AB0A 2JGKA 3LKZA 1R0ZA 2GCGA 2GLTA 3DGFC 3KZVA 4JX9A 1MDBA 2OBBA 3IXQA 1XTUA 4JL8A 1UXKA 1XPUA 3THRA 3PPYA 3VSBA 3VKHA 4J0CA 1P1IA 1OXVA 2JF0A 4EG4A 3AP2A 1SO8A 3FMVA 3GVIA 1RHUA 4IIVA 4U63A 3OT1A 4PFSA 3G5MA 2A30A 4X20B 4XWTA 3DBOB 5CNKA 4HNRA 3UH1A 1T8RA 1X8LA 3PEEA 4O1HA 1UANA 1ZH0A 4AMZA 2QPTA 3E8SA 1K2VN 2QRNA 3CNNA 4V24A 3ZTYA 2PJZA 4PS0A 3L40A 1YK1A 5KTRA 5DLDA 1JG6A 5KQRA 1DIAA 3MB5A 2HU5A 2C57A 3R0VA 2XE8A 3GLUA 3OZTA 3DONA 1KEPA 4L4YA 2V96A 1LBTA 3QE4A 4BWYA 1P0FA 5CDGA 3AG6A 2V65A 3VR6H 1EFRD 3C7KA 4DR2B 3QLTA 2J87A 5DBEX 3D0OA 3K2EA 4BGVA 2O07A 4DJTA 1Q44A 1D2HA 3J80A 1FNDA 1J5XA 5FO1A 5A0VA 5K6RA 4KBYA 4V1CA 3K70D 1TUBB 2YN0A 3OBIA 1KOFA 4Q66C 2O8CB 1Z35A 2QJRA 4CMIA 4DC0A 1DQRA 1OAAA 2BGRA 5TY0A 4B5LA 5EHZA 5SV2A 5DB4A 1UEXC 4NBRA 4JJEA 4QSMA 1QRRA 1OLXB 2Q3JA 4O0MA 1TAUA 1NJ8A 3M4JA 5LQKA 2CVQA 1MU0A 2DTDA 1RWWA 2HPAA 2V7QD 3II6X 3MJCA 4KI0A 5ALOA 3O8LA 3GGPA 1KQGA 1QB8A 2KS6A 1A3CA 1CJTC 1OFUX 2XCLA 3CBGA 1N1DA 4L02A 4U9UA 2O2HA 2HSGA 1BOOA 1KI6B 1V7QA 3OEHA 1G66A 1ID1A 2IVZA 2OZVA 4MVJM 5FP0A 3ZVRA 3ZJVA 2XUGA 2B1RA 1VZ3A 3RU9A 1ZICA 1Q14A 2BEWA 3Q72A 2WNIA 3BMQB 5JCXA 1L5YA 4FYJA 2MYNA 1NVUQ 2NO7A 3F9CA 2PKQP 4Q1VA 3B1FA 2JJ1D 3H4VA 3TOXA 4DV0B 1BEUB 1OU4A 2R3SA 3DVRX 3HCEA 5DP2A 1G3UA 2V4ZA 3T3EA 3E3NA 4PFQA 2EFDB 3DOHA 4HNUA 1N75A 2BE9A 1XPJA 3T06B 4L8FA 3UQYS 5ALNA 2Z98A 2QLMA 4X7BA 1GTRA 2NUPA 1F4VA 2P7IA 2ROQA 1T9CA 2CD7A 4CE6A 4FOSA 3UA3A 1NVVQ 3ERCA 2AD1A 3IKJA 2RGGA 1GG9A 3TB4A 3DB1A 3ZUGA 1X1TA 3D7SA 2AR0A 2RGYA 3A6FA 1RC0A 3GW8A 3QSGA 4PRZA 2WF8A 3H18A 2XHEA 3P9CA 3EGWA 2RGCA 4G8DA 4NPHA 4II7A 3TSOA 2M98A 3JXEA 3N7UA 1SUAA 4X97A 3D2CA 5AVWA 2GBLA 4ND5A 5EHXA 1RC8A 3CUYA 4I5DA 4C4PA 4RS3A 3HLTA 4M55A 4EH1A 5C9ZA 2F3QA 3FVWA 4Q1AA 1AHIA 1MIHA 1P2TA 1A5ZA 4NEQA 1YKFA 3PC8C 3PCXA 3ZVNA 2OAP1 2ZRJA 2ORED 2A0UA 4EAQA 2OESA 3AHEA 5B3JC 3IUYA 1I3LA 1P1KA 1G291 1I7PA 1T0JB 3OLXA 3PNQA 2PMDA 4FYWA 3VJKA 4UQLA 2B82A 4NJEA 2Q0SA 1RJ9A 3IE0A 3QJYA 4EHIA 5JAUA 1UWLA 2RHHA 3GVCA 1THZA 2AJLI 3GYBA 3KSUA 3QK7A 4PX3A 4RHXA 5ERXA 1N3BA 3EGDA 1TJ4A 4Z86A 4DIDA 2PMCA 2X5XA 5FPPA 3T7SA 3B5IA 1RQ2A 2PWBA 1X7XB 1U4NA 4MR7A 1INLA 5JRJA 4AKTA 3BWVA 5IN5A 4N48A 4M1QA 1R9MA 3TFWA 1U2GA 2FWIA 2FFBA 2V3CC 2WY2D 2HO4A 4QASA 1PR1A 4PZ0A 2YMQA 5D84A 5KYUB 3UJ8A 2VUIB 2VQSA 2W2LD 3HSKA 5THQA 4NCKA 4F5YA 1XO1A 4BNJA 5HP4A 4UHBA 4IXTA 3V32A 1QFMA 3RAPR 5EIOA 4J43A 1CFZA 5LQAA 4EK9A 3RSQA 4WXPA 2YN2A 4FFSA 4ZJPA 1OH8A 3I5UA 4OLJA 1CIVA 2ZSKA 1OH7A 2B7CA 1C3LA 2C03A 4W1QA 1EXMA 5AOCA 1KAHA 1OSNA 1X15A 3AEUA 1SZDA 3BE6A 1WV0A 1Q77A 4HO1X 1NBAA 4IDNA 1OGIA 4R3NA 2H7YA 3OZAA 3VTFA 3LF2A 3ZD8A 2XAAA 2XTZA 4MVJE 2VK8A 5D3QA 4LK2A 2GFHA 4ZCRA 5BYKA 4BFXA 4D9NA 2HYIC 2Z4RA 2BHLA 4C7MA 2VQ3A 4WDQA 3WL4A 1E7MA 4KE9A 1KYZA 1X87A 2GEUA 2SKCA 3JD3A 3UM9A 1CEYA 4F3RA 2B5OA 1BDMA 2XYRA 1ORTA 2FQQA 3K0AB 1N8SA 3QBVA 4AP9A 4DA9A 4E11A 1VHDA 3QVVA 1L7DA 4QFCA 1GGMA 1YAJA 4PZLA 1PNOA 3B9RA 4TT3A 5AM1A 3CZAA 2WKSA 4ZAWA 3BHMA 3IPRA 5JDCC 1P7YA 4YRZA 2BJWA 1XEXB 4U2GA 2JIZD 2KMLA 5FB3A 4HVTA 3ZCUA 3B52X 2VJPA 1Q1BA 1HQYE 3M2PA 3PQCA 1MEEA 2ZE5A 5DN9A 5JHHB 3HDYA 3KD2A 4UBLA <