1NFDA

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
203
structure length
203
Chain Sequence
DSVTQTEGLVTVTEGLPVKLNCTYQTTYLTIAFFWYVQYLNEAPQVLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALSEGGNYKYVFGAGTRLKVIAHIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
total genus 29
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA01
4FTVD 1M7DB 2VDNH 3DUSA 3QUMB 5DRZB 1WZKA 4RZCA 1WBYB 4NFBA 4QOKE 2VUOA 2XWTA 4I18B 3TJHD 2BVQB 3ZO0A 4BH8A 3C8DA 3HE6B 2JCCA 1CDBA 5DWUH 4Y4FA 1PG7L 5CS7A 3I6GA 1YMMD 2MCG1 1OAKH 5I1EL 1OTSC 5CZKA 4OQTH 3MXVL 5C0AE 3L3JA 1IGTB 4YGVB 1RZIA 3VFSA 4NJ9L 1WFNA 5C0GA 1OT1A 4ZOCA 3FB6B 2ZUWA 2YPLB 1ZHKB 1LK2B 3ULUC 3CIQA 3QISA 2VSCA 5HGBB 4X7SH 2XQYK 4UV4H 5DS8A 3GSVA 2OK0H 1AIFA 5SWSB 2UVFA 1MIEL 4TVPL 3SDXA 5E5MA 1V5JA 2OBGA 2IAMD 3VFGL 1UCBL 4F57H 4L9DA 3S6CA 1I1CA 1I7UB 1KJMA 4FTVB 1R0AH 4X4XA 5K9QG 2D7MA 3QDGE 1P4BH 3PABA 3REWB 4P23D 4WEUD 1YJDC 3GHBL 2C4FT 4YC2B 4AENA 5CGYC 4B5EA 2BY0A 3MTRA 3WXVH 2NY0D 5EORL 3MRHB 5CINL 4W4OC 4O2EB 2I60L 3N0PB 3WBDA 4UV7H 3RL1A 3UAJD 5BZWB 3T2NL 1NJ9B 5FKPA 2YK1L 1DBML 2AJVL 4WO4C 1IGFH 1FH5H 2ZUVA 3EO0B 2IFFH 4LF3A 4WENB 4DEPC 1JPFB 3HZVA 2AEWA 4OD1H 1F4HA 2H2PC 5L6YH 1ZTXL 4IRZH 3X12A 1N5YH 4ZO7A 3G5YA 2X4UA 4PB9L 3T4AB 5KSUB 3CGTA 2EIEA 4DOHB 4UTAH 1MQKL 4TPRL 3QDME 4L5FH 4M1DL 5DEGB 1FP5A 3ULUL 2RIKA 4Q9RH 1HHHA 1QBML 3RWEA 3CLEL 2C9AA 1GAFL 4ZNEE 4FMKA 3U79A 4ZYKA 3IVKB 1FJ1A 5DT1H 5GS0L 4P23B 5DFVC 2OMNA 3CK0H 3NA9L 4JY4B 1JV5A 2R56L 2Q8BL 1CYGA 3MRJB 2NY0B 1X6NA 4U1JB 1VFMA 1HYRC 2YBRA 3GNML 1X5IA 1U8NA 3QDJB 3WHE1 3P77A 3V5HA 2ADJA 2VR4A 4PJXB 5BW7C 1BJMA 4BH7A 3UYRL 4M43L 2EDHA 1H3UA 3SDYL 5EC1A 5E8DH 1CK0L 3TNMB 1T4KB 2CDGA 5D7IE 3M07A 2BVYA 2VITA 4K7PY 1RUAH 4KJQC 4HFUH 5TH2B 5ANMA 4KTEH 1MHPL 4XX1E 4I3RH 3HMWL 3RVTC 5ACMA 3MMEB 5IG7B 2KKQA 4F7TA 4HIJB 4YHIB 4H88L 3HI6L 1JI1A 3FFCE 3P9LA 1CDCA 1NFKA 3MOAH 1MELA 4H0GA 1I75A 3DUUA 4G6AD 3PHSA 4LIQE 4R9HA 1WLHA 3KNBB 2FR4B 3RZCA 1NCWH 2J1KA 2WINA 3VD4A 4PRAB 1AGDB 3QIBD 1FL5A 4LK4A 4LCYA 2MCPH 1S7XB 4PJIF 1BOYA 3LN4A 5L0QB 4H0IA 4I0PD 1Y6MR 1K6QH 4S1SL 4B50A 2ZP0T 1T89A 2YZ8A 1MCEA 2MQ3A 1FNHA 3EFFA 4L8CA 4PUBL 1NCCL 2AK1L 4Q9BA 3TO4C 3WFZA 3SE3A 1HEZB 2R0WL 2CLZA 1JYWA 2V2XA 4CU6A 1QR1A 5EU6D 5BVJB 1MHEB 5EZLB 5GS3A 2VNCA 1EO7A 4FNLL 5FKAB 2VAJA 4Z78B 1DE4B 5C0JB 4G6KH 3TT1H 2DQEH 4P9HC 5IGXL 1DL7H 4UQ2B 4KTYA 5D1QA 1Y18B 4OZFH 4XCFL 1M71B 2D7OA 1CD1B 4PJ7B 5FYJH 4U3XA 1FNSL 4YDLB 1H3GA 2V7HA 1CU4H 5D96B 2DQHL 3DBXB 1EFQA 4K8RL 1X5JA 2DQDL 3QIBB 4R4NC 2CIKA 4I0PB 1BFOA 3IF1A 1PDKA 5CP7B 3CSYA 2AERT 4BQ9A 5D2LE 4PBVC 3H8NA 4RWYL 1U6AL 3QUML 4HXBL 5IBTH 4ZXBB 4Z9KB 2XZQL 3NTCL 3DX7B 2DD8L 5EU6B 4KV5F 4PRIA 5LWYH 3ZYOA 5T33L 1JGEB 1G84A 2OS7A 4IM8A 3QPXL 1JGDB 4BZ1H 1OWRM 1ZHBB 2DWDB 2GTZA 2X4SB 1H3WM 4HMEA 1NKRA 3X13A 5SWZD 4OZIA 3V52H 1KEGH 3TBTB 3SEPA 3F7VA 1BJ8A 1VHPA 1QO3A 3MRKB 3HE7C 3BRDA 1YEGH 3T77B 1NCBH 4PJHE 3V6OE 1NEUA 1UQSA 3NFSH 3DXAA 2A1WH 5FF6B 1BJ1J 2YD5A 4LP4A 5J1SC 1VGEL 4APQC 5HGHB 1CGYA 1UZ8B 1P2CA 2I5YL 1N64L 4YQXH 3EOBB 3OBAA 2IG2H 3ROOA 3QUXC 4R90L 3PWPA 4Z7QE 5JLZB 3T0ED 4GT7A 4TNWK 3BRFA 3VWKB 4GXUN 1KG0B 5SWZB 1YUHA 1L7TL 3FHQA 1CFVH 2W91A 3QUZC 4G3YL 3SGKA 3PWUB 5FGCE 3Q6GH 5GJTL 1R5IA 2E5EA 2H9GA 4I2XB 4KFZC 3W9DA 2IQAA 2V17L 2QQNL 3KDMB 4OGAD 32C2A 3EYOB 4PFEA 2VDOL 1NMAL 4GAJL 3QYCA 1CF8H 2QHRH 2AXJA 4HUWB 5DQ9A 5E9DE 4ODVL 5GGUA 1QSFA 4HC1A 1F45A 3HMXH 4YBQD 5HXMA 1KLUA 3L3GA 1ZGLM 1TZGL 1U3ZA 4OIIH 5F8QC 3FHAA 4LSPL 1J18A 4J1UB 2HN7A 1AGEA 1UM4L 4YXKL 3BP7A 3DRTA 3GBML 3QHTC 5EUOF 4CDHA 3T0EB 4ETYA 4YBHA 5EZJB 2QR0B 4QHLA 3N1FC 2DI8A 3FOLA 4RFOL 4PJGE 1WCQA 5ID0B 1PSKL 3PGDA 3FO9B 3EDDA 2V2WB 2IADB 2F54E 5AYQA 4OLVH 3MX0A 3VG0H 1N6QH 3SO3C 5T3ZE 3G6DH 1B6DA 5BJTA 1AR1C 5J12C 3S5LA 3VA2C 4E42A 5IWLC 1JPTL 2BVUA 2BCKA 1MJ7L 3F7YA 3N1PC 3GSNB 4ODUA 4P2CG 4HKBA 4WV1C 5FGBC 4P2OD 1A6VH 4EXPX 4YLQT 4ZXBC 1NFDE 3O9WD 1R3JA 3MRLA 1JZ6A 1GJIA 2FGWH 4MXWL 3RTQD 1AXTL 5DJ8B 4XPAL 1YN7A 5DJZA 2GAZA 3FRPA 3CLFH 5HHXL 4IRSC 2JCCF 2YKLH 5ITFB 4Q6IA 4HWEH 4UT7L 1SVZA 3O2DA 1F8TL 1YDPA 1Q0YH 5ICXA 1NUGA 5I8CA 4WEBL 4PRPD 1NGYA 2QKIA 1WCBA 4L29B 3UTTD 2J8UE 3AY4A 3GJFA 3VWJB 1GHFH 3DVNB 4BJLA 5I75C 3K2UL 3MV7D 5L2KD 4LRNH 5CJQH 3MODH 4YK4C 3L1OH 1VPOH 4HIIB 4KK5C 4H26B 1JHKH 2V7NB 2HTLC 5C0CA 4G9DA 4FFVC 4QRRA 4HJ0C 5HGAA 2VXSH 3SDXF 2YOCA 5HI4D 5C0NC 3RKDC 5DD1H 4QHNA 2SEBB 4P2OB 1GZPA 1FSKB 1F6AA 3O9WB 3LRGA 2UUDH 1MCOH 1KN4H 3RTQB 4G42B 2AABL 5FYKD 4KQ3H 1CDJA 1JHTA 3OAYK 1XGYL 1HQ4B 3B9EA 3VWKC 1FORL 5JZ7D 1DDHA 1KBGH 1KB5B 1GGCL 3NH7L 5L8LB 3RNQB 3DGGA 3L5XL 3BQUB 3IGAB 1EZVX 3ALWA 3UTTB 1AO7A 1FGVH 3C60A 1OM3H 5JXEA 2ZUXA 3MV7B 4BK4A 3DVFA 4MNGB 1GPOH 3L6FB 3LDBB 4E41D 3MGTB 3M1BB 3NZ8B 1GRWA 1T7ZA 3VG9B 2R0LL 3DV4B 3OG6B 4WW1B 1IE5A 3D9AL 3KPOB 1UWGH 4KROC 2QV2A 4U2ZA 1GC1H 1ZMYA 1J10A 4UOW1 1BIIB 2Q76A 1QUNA 4U1MB 5KVGH 4AJ0A 1YYLL 1MF2L 2L4OA 1LEGA 3EZ8A 3I6LE 4HBQA 1I9IH 1A14L 2VZTA 3WEXA 1WK0A 5EUKA 4KKAD 3OXRA 1C16A 1GCFA 3RL2B 5FYLE 3BWAA 5BRZE 3QWOB 2C3VB 3VGAC 5I6XC 3DYPA 2EZ0D 1HINH 4JFYB 5I1JH 1T5XB 2VQ1A 1DBJH 3E6HB 1QSFD 1A7OL 3NZHH 3SPVB 4O5LH 1DQQA 1CXKA 3GSXA 4MQSB 1I7TA 4E41B 2GSGA 4DZ8B 2FRGP 4XAWL 4YBQC 1S9WB 5FV2A 3GB7A 2P24B 4EVNA 4YDJA 2XN9D 5AAWA 2X9XA 2CR3A 4Y8AA 1JHLL 3ULUE 3VRJA 3FO1B 5CCKL 2IANE 5KAQF 3C2AL 4OQTA 5JHDB 1CIDA 1X5AA 4FQIL 3B9AA 4U3CA 4ZG1A 5DUMH 3FRUB 4HUKB 1MLBB 4OCSH 4W6WB 4QRUB 3UDWC 4K7FA 4L4VE 5FEBA 2NCMA 2XOTA 4PLKC 5HHOA 4W4NA 7CGTA 1R24A 4ZD3L 1IAMA 3ZTNH 4BFEA 4C56B 3DI3B 2Y72A 1R3LB 4GXVL 1L9NA 2AKRB 3VWJC 3WFDH 5SWQB 1U2HA 2LU4A 1X44A 2EDDA 3IDIA 4ACPA 2JK5A 5I1KL 3OR6B 2XN9B 3G04B 2CD0A 2FHBA 3DARA 2AJZA 2P44B 4WFFE 5J11C 3BZ4A 2GT9A 5FK9B 2WWMC 3SQBA 4R3SA 2X4QA 4UB0L 3OQ3B 1IGJB 2C3XA 2EH8H 1OPGL 4FFWD 5H37H 3DVGA 3J7HA 4K07A 3EJJX 3OPZH 5LGKA 1T80A 1DN0A 4D0DB 4NM8L 3V6ZA 1ZANH 2GK0A 3GSNL 2EICA 3PWVB 3MRQB 2HVJA 3CX5J 4OCRL 3DMMA 1P4LA 2KL6A 4B53A 3ZKXB 5C9KA 1ZA6A 1U8LA 5CMAB 1A4KB 5FUZL 4CW1B 2FJFB 4H1LG 4AMKL 4NC1C 3O3EB 5CZXC 4CMHB 4FABH 2DMKA 4Z7VF 4GG6B 1OLZA 1J1XL 2DMCA 3BQUC 3H9ZA 1H3PH 4IMLB 3HI5H 1FL3B 4XAKE 2C3HA 4OZHE 1DUYB 2FECI 5KS9B 4IJ3B 3WNLA 4OZIF 3W0WD 2DS4A 4QEGA 5DYOB 3WFBH 3BN9D 3N85H 3WLBA 5E8PB 1HSAA 2HFGH 2O61B 5F96H 1YQ2A 5TDNA 5EWIL 5CFHA 3QQ3A 2IQ9H 1FV1B 5JUEL 4JRYE 3P11L 4FXLA 2X4NB 4L9LA 1VERA 4WTZG 4UINL 5FUOH 4X9FA 2AJSL 2AJUH 4IDJH 4GW5A 4LLYA 5MI0C 3AFLA 4KZEL 3VFWB 4LLVB 4OLUH 4G8GD 2FH6A 3ULVH 3WO4C 4NN6B 1DQDH 3MRPB 4WTZA 5I15H 3AC0A 1F3JB 4JQIL 8FABA 4LNRA 4NN5C 3RY5A 3EO1A 2YPVL 5GRJH 2X4TA 4K2UH 4NP4L 5HPMB 4BYHA 4MJIA 1KB5L 2ZUQC 2O5XL 4EUPH 1UB5A 4PLJC 5KSVA 1N59B 3W0WB 5B39A 3REVB 4DVRH 4F58L 1X5YA 3D3VA 3DO3A 4POZD 5JIPA 5TE4H 3TO2A 4ZPVA 1WZ1L 1YQVH 1CFQB 1JZ3A 2HKHH 5GRVL 1P9MA 4PY8J 1DBKH 3RVWC 4YZFE 1A1OA 5DVNA 2XWBA 2WAHA 3ZE1F 3DVIA 4OGXH 4QXGH 1UM6L 4X9GA 4OZFG 3X11B 5CD5D 3IFPB 1JNNL 1D9KA 1NGXA 4G8GB 2D7TL 3QCUH 4WTXA 1SJHA 2EIZA 4NUGL 5ENWB 3GK8L 5FYKL 4OZFA 3RBSA 2ZG2A 5IMMA 4KDTA 4GG8A 4NQVB 4J3SA 4HCRH 5J3HC 3TEUA 3VGHA 2P45B 2GTWA 5D6DA 5E00B 4WHCA 5JR1L 4P4RA 5B38A 2ARWA 3VXOB 2C3WA 3QEGL 1S7WB 4URTB 1AQKH 1G0XA 1QRNA 1OGAA 4U6TA 5E2TL 4S1QH 5HI5D 4FQLH 5TFSL 2BSTB 2P8MA 4P5TA 4TUKL 1TETL 5LQBL 3KPNA 4HIHB 2A6IA 5I19H 4BFIB 4LSVH 3C9NA 1C5CL 5IJVA 1BPVA 5F1IB 1T21A 4Y5VC 3CJJA 1HHJB 3A6BH 3BKML 5D4QA 5INDB 3I3DA 1Q94A 5GIRB 5L8JB 1QBLH 4NN7C 4S2SB 1UXWB 2UZXB 1KCUL 1I8KB 4X6CA 3Q1SH 1VDGA 4AIZA 4M7LH 4U1KA 4DCQA 5ADOL 3PGFH 5AD0B 1LK3L 5IF0A 3MBEC 4X5LA 4ALAL 1U92A 5BS0A 1IZKA 3S37X 3WDHA 4DZBA 5E8EB 4LCWD 4P5KB 4N1HB 1G9NH 3QHFH 4A2MA 4WFEE 5D8JH 1LO4H 4O00A 5EC2A 4GAYB 1PJ9A 5FHBL 4XXCC 3ZSTA 4CRPA 5I66B 3R1GL 3FONA 4MD5B 3MRNA 4H5SB 1T0NA 3QDJE 1F11A 4B41A 3KYKL 5E2VL 3HPJA 4GRWF 4DKFH 3DX6B 3RY6A 4ZAKA 5J9PA 1U0QA 1U3HD 3SDAC 3G5ZB 4GSDH 4JAMB 2I9LB 4G8EB 4NKIH 3KYOB 4XBPA 5B4MD 1DQLH 4UDTA 2PTTB 1G0DA 3MLPA 3OHXA 3ZDZF 1A6TB 2JJWA 5JORB 2K7QA 3WIHL 1YEDB 3LQAL 4JFDA 2RCSH 3RUGE 2H26B 1J12A 1FZOB 3OB8A 2AK4A 2IGFH 1KTLA 5JXAL 2GW5A 1PBYA 1FCGA 5IQ7H 2OJEA 3V7AG 3WIIH 3OKKA 3QCTH 5JW5A 4W70A 1IQWH 1T7YA 4S1RL 3RWIA 2ZCHH 2LAAA 1W0WA 1MCJA 4K94H 5DK2B 3CFEA 3ELAT 3K74B 1AFVH 3MUZ1 1WAAE 4XCYA 4HS6A 5C9JB 1ZSDA 4PJ9C 3HMXA 1U3HB 3JTTA 4PY7B 5DJ6A 2NY3C 4X6BB 5C0IA 5GGVH 3T0XA 4XPFH 5ELIA 1SEBA 2E9IA 1F58L 4H20L 1K3ZA 1IAKB 4XXDA 3HI1A 5D1ZD 3HNTH 3RVXC 4MMXC 1YEJL 2CKBB 3QT2A 3CVHB 3T3PE 3ZL4L 4JJ5A 2VDPL 2AV7B 1LE9B 4KI1A 1D6EB 3QG6B 4PJ8B 3VRIB 4HZLA 4M6MH 3VGGA 3K46A 1QD0A 4XVTL 3JWOL 5DTFA 1LD9B 4RGNC 4U6XA 2XPGA 1H5BB 4PYGA 4PJ7E 2Q8AL 1IAIH 4S1DC 2KBGA 4YUEL 2PO6A 4DN3H 3IDXH 1DBAH 2VLLB 2UWEE 1F13A 4ONOA 1EJ6A 1L0QA 4U6YB 5TF1H 3DETD 4H1LB 5JPNA 1B4JH 1D5IH 3QPQD 1RUQH 4P2RA 1W8NA 1YECH 4NZUH 3AS2A 5T1LA 4QCIB 5LAXB 5HYQB 5D1ZB 2EH7H 4Y5XB 3LSOA 3SE4C 3MCLH 2E7MA 1F3DH 5IB4A 4ZMAT 3CFJA 5DJYA 1DBBL 5EO1A 1KULA 4JZOB 4UUJB 5DHVH 1Q1JL 5EO0A 3BIBX 4OLXL 1M7XA 4OM0H 1QYGL 1ED3B 1OSPL 3MRMA 3UZQA 4EOWH 2OXHA 1PD6A 1QFWH 2ZSVB 1INQB 3H3BC 4TSBH 4EN3C 4YHOH 2DDQL 3VXMA 3UBXI 2H32H 2V9QA 3K4DA 1FFNA 3IXAA 3JUYA 5FA3A 5IW1A 4KKBD 1TZIA 4LLMA 3VFPA 1XF4A 4XP9L 3SQOH 1E4XI 2IJ0C 2JJSC 1KIQB 5DR5L 1IGMH 2EDEA 3FZUD 5IQ9B 4CVZA 4JKPH 5E95B 3LRSB 5IV2A 4NQSA 4I3GA 2QHLA 1ZT4B 4F7EB 2C1OB 3QIUB 4HWZA 4JR9L 4YHZH 1MVFA 1S9YB 4MX7B 1HCFX 1PG7X 4YEEA 3RQ3A 5DD0H 4DAGH 1CTNA 3U0PB 1Z2KA 5DLML 1CE1L 5KJRH 1RHHA 1HKLL 3PHQA 3ARWA 3CCHB 3IDYC 4X6DB 3NVQA 5IESH 2CRZA 3RU8H 3MYZA 4Z95L 4J3OC 5IEHB 1T04A 4GQPH 4P49A 4M61A 4PJ5A 5GGSB 3LKQB 3CC5A 3ALPA 2DICA 1XGPA 4ONHB 4I13B 4XNQB 2D7QA 4PV9A 2ATPA 2A83B 3OKOB 3N9GH 5CJOL 1MFCL 1ES0A 5JA8B 1CL7I 4R97B 5CEXB 4FXKB 1IT9H 4ZUUB 5C0FA 3C6LD 2OTWA 5I1CL 4LSTL 2V2TA 1I4FA 5ID1A 1F4XL 2VXVH 2GUOB 3SCMD 4YFLI 3L95B 5J6HB 1JGUL 1SJVA 3PHOA 5KVDL 1O0VA 1I1FB 4HHAA 2DBJA 4QF1B 3WFEL 1AI1L 2HT3C 4YXLL 4FQPA 2G9HA 4O9HH 4PR5B 4Z7UA 3PGCB 4XNUH 5J7CC 4OD3L 1FG2A 2VH5L 1RV6X 5FYJU 1YNLH 4QHKI 3NIDF 1OHQA 1I1AC 1TITA 1WUNT 4NRYB 1HXYA 5EH1A 4PGBA 1QHPA 4N0CC 3QFJE 1AXSA 4JN2A 4PV8A 5I16B 1FO0H 1IC1A 1FC1A 2BNQE 3B3IA 5F7HA 1EMTL 4MA8L 4XBGB 5JW4R 5EU4B 3UJTH 5ADPH 4PJ8C 5IB3B 3FQXB 3HCVB 1B6UA 3DX9A 2DM2A 4JO4L 1X4YA 3I50L 35C8L 5EZOH 1W0VA 2VE6A 2XTJD 3C6LB 1XCTA 3AB0B 2MSPA 2W65A 4TOYL 4K3DH 4N9GA 5F1OB 5B8CA 4KDVA 5DGQA 1U58B 1CXIA 2EDJA 5JOPD 3K8KA 3MBXH 4JZNA 2WBKA 2DTMH 1VEOA 4ZFFB 5GISH 5KVFL 3MLZL 4JPVH 3MLUH 3QJFB 3TCLA 4NC0B 5BV7B 4WI3A 1R3IL 4KVNL 1LQSR 2DI9A 3B9KA 3T08A 4HPOH 5HGGS 3QB7C 2N1KA 2OYPA 5JMRA 1VFAA 3BHBB 3OJMB 2MOVA 5AUMB 3O11B 4L8BA 1RULL 4GAGH 1YEFH 4JDVB 2NZ9C 1XFPA 3INUL 4LCUA 5AYUH 4P9MH 3IETB 2XRAL 4TUOB 1K2DA 5IK3B 4GRMB 2NW2B 1KYOJ 3F12A 4QXUL 5I73C 4LGSB 4ODSL 2CKBL 3DROA 1LGVA 1FBIL 3CVHL 2P5EA 4Z6AT 1K85A 4WU5B 4XHJC 2XTJB 4M1GH 1N8ZA 2IBZY 1X5KA 3EOYG 4XCCL 4OJFL 3D25A 2EDFA 5BZDB 5IVNA 1KCVL 5IVZA 5TDPA 3GI8H 1BD2E 3FJTA 4H8WH 3FB7A 4K9EL 4HXAL 5HJ3B 3SBWC 1NBVH 4IMKA 2R1XB 3FAWA 4BK5A 3OAZK 3VXPB 2IH1A 1EHLL 1I8LC 3B5TA 3MCKB 1KIRB 5DMJB 3QIUC 4FQ2L 4RBPH 2XG4A 4JO3L 2X4RB 4Y8DC 5F70A 3Q5YA 5F88B 2ORBH 4YWGH 1IM3B 3SDDD 1KPVA 1JYVA 1NGQL 3BKJH 3JTSA 2X4OB 4K3EL 1RURH 2E6QA 1A6AA 4NC1E 3TA3D 4WCYL 3KS0J 2ZG1A 2EYTA 2RHEA 1FAIH 4GKNA 2WUCH 1NANH 3MLXH 4BSWB 4R97C 3U6RB 5KSBA 3QJHB 1HNFA 4X6CF 4QYOB 5SX4I 1OGTB 3KPRA 1A7QH 3HNSH 2ZJSL 3QBTB 3EYFA 3DX8B 4EI5D 3BSZL 1T20B 4ORGB 4PRNA 4ERSL 1WFUA 3P0VL 2ENSA 2XICA 3BO8A 3FCTA 5IBLC 1TJGL 1VACB 4G43B 3NAAH 5HPOA 3EJYC 3KPSD 2O5ZL 4MHHI 3JV0A 5IB5B 4UIMA 5JA9A 3QXDB 2B39A 2MHAA 4RFNC 4Y1AE 5GGTL 3SDDB 4LSQL 3GKWH 1I8MB 4NBZB 2PYFB 2B2XL 2ED9A 4MS8D 3P30L 2BY2A 2C1PA 4FQJH 4NRXA 1RZFL 2V9TA 3TA3B 1YMHB 1KLGA 2F5AH 5I76B 2W9EL 3VGEA 5I8KL 5HDLA 4Z7NF 2JB5H 3EDEA 1HHKA 5EOQL 4HBCL 3HUJB 4JFXB 2OX5A 4KMTL 4KUZL 1NL0L 3D39A 1S9VA 4M5ZL 5F7FA 2VLRA 4TRPH 5ESQB 4NO2A 1R5VA 3X17A 3OKNA 4EI5B 1P53A 3LKPB 1CDUA 1NKOA 1TPXC 3HS0A 1H8OA 3ARGA 4EUPA 1NMBH 2BRRL 2R4RL 3KPSB 2VABB 3TFKD 2DOCA 2A9ML 4LHUG 3D0VB 4PJFA 4OCYH 2P5WD 1W8OA 4JQXC 1HH6B 1Z9SA 3F8UB 5JHDE 2ICWI 4YX2H 1X5XA 1CXEA 1G1CA 3SJVA 4DUWA 4UAOC 4PYHA 1KELH 1MJUH 3ARFD 1TJHL 3O8XB 4PJAE 5E2UL 3T2QA 1PKQE 1QQDA 2D31A 3CX5K 2IMNA 3I02A 1A3LL 4L8SA 5GGRA 3LD8C 2ESVA 1TFHA 5IP4A 1JF1A 5J56B 1FNGA 1NFIB 1DN2A 1RK0B 4QT5A 1MEXH 4D2NA 1Z3GH 2HG5A 5IR1B 4UIKL 4Y19E 1BVKA 4C56E 2OQJA 4LASL 1CD8A 3VXSB 2AI0L 2LTQC 2YR3A 3C6SA 3W39B 4HCRA 4P2YA 4XGZB 1RAMA 1AXIB 1IAOB 5EOCH 4AH2B 3KXFA 4ONFH 5E08H 2OSLA 2Z91B 1MCSA 1R6VA 2Q86A 2PW2A 5GRWA 5A16B 3PV6A 4X6EA 1BGXL 4OM1L 2GJ6D 2P5WB 1GGBL 3VH8A 1RD6A 3UPRA 1AGFA 4LAQH 4YXHL 5F9DC 5BV7L 3ARFB 1EEYB 3WNPA 3BUYA 1Q9LB 2VDKH 3IDGB 4F9LA 1VKXB 3U82B 5E4IA 3UTSA 4U6HA 2DLFH 3MV8A 2CDFB 3BPLC 4XNMA 3ES6B 2X1WL 3Q3GB 3LPWA 1OCWH 4JFQA 5GHWH 2XFXA 1SBSL 1FZMB 1HILA 3D2UA 3TVMD 4J2XA 3TBWA 1A2YB 3QEQD 3LQZB 1JGLL 2IFGA 4PJCE 5FO9A 2XTLA 4LRIC 4M1CC 3NGBB 1MRCH 4FQXA 5DMKB 4PS4H 4A2LA 5D1XD 3MLVL 3D85D 4D9LL 1MI5A 2GJ6B 4NRZA 4GKZB 1P7HL 43CAB 2PTUA 4NQED 5FDWB 3QFDB 3RGHA 3O3DA 2V9RA 3BH8B 2ZUSA 3QRGH 3HG1E 5E6IC 5HTSA 2FBJH 4IEFB 4KKLC 4X5XB 2XWTB 4JHWH 4MNQE 5L7XH 5EPMB 3QO1A 2DN7A 1LE5A 1K4DA 3EFDL 1Z9OA 4U7KA 4PRDA 5CBAA 2RBLA 3FQWB 1CG9A 1BWWA 1H8NA 1XZ0A 3EYQD 1XGTA 2CJUL 2DQCL 2F8VA 4FG6D 4XPHH 3ZLQC 5ITBH 2JF1A 4PJEA 3K4AA 1BBJB 3GRWL 3NPZB 4JPIB 3TVMB 4HKXB 1XH3A 1T6WA 3KPRD 3SGDI 5I1HL 3QQ4B 3TPUA 4FZ8L 1DQML 5DUPH 4CN1A 5D1XB 2QBWA 2VXTL 1DEEA 5ECJE 1HN1A 4F2MA 1S7RB 3D85B 3JVGA 3PJSB 4Q74A 4HAFA 1JWUB 1AIFB 1FVEB 4M00A 3TBYA 1MPAH 1IARB 3HKFA 4JZJB 4NQEB 4QHMA 3H9HB 3HC4L 5C71A 3SKJL 2XXCB 4RGNE 1WJ3A 4Z8FH 4XMPH 4Z18A 1IBGH 4DW2H 5C0RL 3EYUH 5KN5A 4H25A 4CVXA 3CFIC 3O8XC 2Q7YB 4Z7UF 2FYYB 2PCPB 3I84A 2VJXA 3GMMB 3O6KH 1J05A 3N1MC 4WHTA 3BGFC 2Z92A 5AWNL 2XY2A 5IVXE 1CR9H 4KJWC 4PTTA 3WHE0 5T1KD 1TVBA 1ZEAL 1P7QD 5HYJE 5M94B 4RIRB 3ARDA 4P57A 1B9ZA 1GVIA 1BLNA 3VD9A 3H2WA 3UJIL 3HFML 3UX9B 4Y5YC 4L3CA 4L8DB 2FZ3A 1M6OB 4HKJB 5HYSG 4MDIB 4OKVA 3NN8A 3MRGB 3BEWB 4K7PH 3RWEB 1ACYL 4QKXB 5IFJB 2NR6D 3HPLA 2VL5B 1S7UA 3G6JB 3KLAA 3JV6B 5HYSA 4WTWA 4LHUD 1KT2B 5L2JA 1LO0L 5DHVA 2AEPL 2JE8A 4X7TA 8CGTA 3DSNA 4M6NL 4DGVH 5D71H 1T5WA 4JKLA 3KJ6L 3AM8C 1U8NB 1ZGLB 2IH3B 4V2BA 1KJ2B 4YBLB 1JL8A 2BSED 2BVOB 3DUHA 3MR9B 5I74B 3MRRA 2WSKA 4GRLD 4HK3J 2H32A 1RMFH 4NKMB 5T1KB 2AEIT 3ARVA 1P7QB 1YYMH 2MKWA 1ZT1A 5MHSD 3AMLA 2FIKA 5LKNA 4WI4A 2NLJA 1KN2L 2VIRB 3QUYD 3EHBD 4NUJA 4HGWA 2VERN 5ANMB 1T0MA 4NQDA 4QHUA 3MLTB 1AY1L 1GOHA 4NYLB 3QO0A 3GIVA 2BY3A 3H3PH 5AG8A 43C9A 3LMJH 2FX9H 2YD8A 4HH9A 1XR8A 3GO1H 4OZGB 4OCXH 1J86A 3RZCB 3C87A 3MRIB 3JWDL 1EO8H 4LHUB 3LH2H 4V1DA 3O41A 1V7MH 2B0SH 1KSRA 1GGTA 1D7FA 2WM0A 2DQGL 4LOUD 4Q9CA 4PJBE 3BGMB 3B2UC 4ODXB 2HLAA 2Y36L 1DQJA 4HT1H 4M7JH 3H9YA 4PGCB 2B8OT 4GRLB 5I1IH 1MFEL 3HRZB 4Y4FC 7FABH 4X9IA 1K3IA 4XB7A 3O4LE 1XF5B 4JQVA 1AP2B 2DQTL 1J8KA 2Z31D 3QUYB 2EEBA 2FL5B 4MQXD 1PG7W 3DURA 4N0YL 1KTDA 1FIGH 1X5HA 2XYCA 1WFOA 3T09A 1MFBH 5CIPB 4R8WH 5D1QB 3RNKA 1JVKA 4O2FB 1MUJA 5IHUH 2W0LA 4XPTL 1RZJC 3ETBF 3U36A 3VDAA 4I77H 4M8VA 3I2CH 1XEDA 5KSBF 1MHHB 4UTBL 4N0UA 3K4ZA 4ELME 3BEVA 4XI5D 1BIHA 4JVUA 4JFEE 5IKCB 4AIOA 4IBLT 3AS3A 1FO0A 5M95B 3GMRA 3IF1B 1AGBA 3WN5B 1NDMA 5D7LA 2XKNB 2WIIB 2N7BA 1EHXA 4FQQA 4LEXL 4YDIH 1NBYA 1CT8B 1I7ZB 3HNVL 4XTRC 1E6JH 4MA3A 5HVGB 4RMQA 1UJ3A 2E27L 4L1HA 2Z31B 3IAGC 1LEIB 4Z7VB 3ZE0E 1MRFH 4JG1L 2FEDD 4LP5A 3FT4A 4G8IA 1CBVH 4DVBA 1UB6B 3W2DH 4OGZA 5DRXA 1TTUA 1QNZH 3H9SD 1OSZB 4JM2A 3P73B 1INDL 1QKZH 4I5BB 3ULVF 5T3XD 3V2AR 5I30L 4FN0A 1NBZA 4WGVB 1Y6KR 5CGMA 1A1MA 1J0YA 4M6OH 1RK1A 3IJHA 4XBEH 3TF7C 3MLSH 2GQHA 4XRCB 3RA7H 3BT2H 2BC4A 2IBZX 4AEHH 4FXGB 4NZTL 1RJLB 2ADFL 2VYRE 3D6GA 4PJFF 3U4BH 5A43C 4WI2A 2YC1A 3QNXA 4G6MH 5CGTA 4QRTB 3WIFB 4UILL 2C3GA 1MRDL 1KC5L 1MJJA 5TQ2L 3O3BA 3OKMB 4QRPA 1HDMB 3GM0A 3FQTB 5GGQH 3H9SB 4XVSL 4XB8A 5K9JH 1CICA 2LU7A 4LCIL 3D18B 4QRSA 4FQCH 2BFVL 2ZOLB 2J4WL 2IQAB 4U1GB 3FN3A 4OLWL 4ODWA 2HFFA 4L4TA 3RZCC 1SM3H 1UFUA 3RIFF 2HRPL 4BZ2L 3WDJA 2WMPA 1BFSA 3QH3B 4OT1H 5J4MA 4J8RB 1IC7H 4OV5B 4XVJL 1GZQA 3GMOA 5D6CA 4CVWA 4KKCC 1T89C 1YEEL 3BP7B 4LFHD 3GMLB 4F15B 5MENE 1D5ZA 3GUTB 4DKEH 2HP4A 5FGSA 3UTZB 2F19H 3LHPL 3SE3C 1KJ2L 5MP6L 3LKNA 4KPHH 1IGIH 2YMXH 1A22B 3OZ9H 3FL7A 4NQDD 5GRUL 2AS5M 4P3DA 1QSED 3IFNL 2K9UA 2VLJB 3QI9A 3FT3A 4HPYH 3G5XB 1AHWA 4YNYB 1U8KB 4FP8L 1VFOA 3A67H 5D1QC 3S3SA 2EKJA 1NC2A 1UACL 5HHVH 4AEIH 2DKMA 3O0RL 3PQYD 3BH9B 4U1LB 1EV2E 3JBG7 1EJOL 4HKZB 1WF5A 4PPTA 5SV3A 5FV1L 1KYOK 1F3RB 4X6FA 3MLWL 3CDGA 3PNWA 2BCKB 4G6JH 4N8VA 5F1NA 3GJFK 1FYTD 5TE6L 1BFVL 2NW3B 2X1QA 3VXUE 5GS1B 3V4PH 3CUPB 4LKCA 1P1ZB 4U05A 1OF2A 1MNUL 5I8EB 5KBNC 4NT6B 3VXTA 4XP5L 2VDQL 5CEZE 1ZLUK 5MEPA 1HYSD 1QSEB 3ISWA 4DJMA 3P4MB 2G2RA 1T1XA 5C08D 4HWBH 2QQKH 5C0BA 3TH2T 5I1EH 5GS2H 4PJEF 5J8OA 2D9CA 2A6JB 2LAGB 3RVVC 2EKSB 5ICXB 5LXGL 5JIKA 3GSWA 3PQYB 3EDJA 4N9OB 2NX5A 1OAQL 4RFEA 4GLRH 2CR6A 3ZKNC 4C83A 3LKOB 5C6TL 4TVPH 1KENL 5DJDB 1J87A 5LJYH 3VFGH 1UCBH 4U7MA 1M4KA 4G5ZL 1DTUA 4QY8B 4D3CL 4WFHD 3VDCA 3O6MH 5DHYA 2D4DA 5C8JA 3NACL 1OWWA 1U8PA 1L0XA 3QZWG 3P2TA 3GHBH 2CKNA 4GFTB 1MH5A 1TTFA 2WZPD 2BK8A 5K9KA 3VFNA 2I9TA 3ARZA 1NEZA 1K5NA 4PJIE 4AM0A 3CZJA 4RX4A 5EORH 4R7NA 3VJ6A 1JHTB 1BOGB 2WQ8A 1BQHG 1T22B 1DANU 2X44D 4UOW0 1X4ZA 4KH2A 3BWUC 3NCJH 3MREB 5F21B 1CE6B 4KGLA 5E2WH 1BQHA 3SGKC 3ZKSD 1AO7B 2LE9A 4F80A 2P7TA 1ZTXH 2ICEA 3GHEH 4PB9H 3DYMA 3HRPA 1AKJD 2D03L 2VMFA 4N8PA 4N5ED 1RZGB 5EFIA 4TPRH 4DKAA 3C5ZA 4M1DH 5T1MB 4POUB 2X7LB 2D7NA 4ZSOA 1XR9A 4MAYD 4FQ1L 3CLEH 1A7NL 5IEKB 5TQ0L 3MUGA 4YE4L 1VCAA 4WJ5A 1A6WL 3KYMB 5GS0H 3B8YA 1JI2A 3LV3A 5A3ID 1MREL 4OFYA 2R56H 3KWWB 2Q8BH 3IFLH 2PR4L 4GKOA 1OTTD 2J6EL 3GNMH 1E4WL 1Z9MA 4IDLA 3R4DA 3EJZC 4E5XA 4OZ4B 2DQJH 1MSPA 5JPMA 4JHBA 4PP1C 2NNAB 5EUKB 3UYRH 2H2SC 1OL0A 2ERJB 1XF2B 2A77L 3D69B 3NFNB 2F53A 3UBXG 3TBSB 3V4UL 4KV5E 4MXVF 1BEYH 4WNQB 4KAQL 1U8OA 4GOSA 1AKJB 3PWNB 1S7QB 3STBA 5T3XL 3MRBA 3HMWH 4NO3B 1YEHH 4RMTA 4UDUB 1OAZL 2EO9A 3CPLA 2UYLB 5HBBA 4MAYB 4YHYC 3GB7B 4H88H 3HI6H 1QFOA 3M17B 4YDJB 4MJ6B 1FVCB 2W9DH 4O51B 4LARL 4XT1C 3V5KA 4KI5D 2DQUL 3LKRB 5TPWL 4Y2DD 4HC1L 2XNAA 2BRQA 3KYNB 5FM8A 1IEBA 5E6ZA 5BQ7A 3QDMA 4KUCF 4YAQB 5DDHB 5JDJA 4AY0A 4QRQA 4HJJL 5I18L 4PUBH 4U1NB 2AK1H 4Q6IC 1HNGA 1HOCB 5HVWA 3B2VH 3PP4L 1VA9A 3TBVB 3AY4C 4PGEB 2DYPD 3EYVA 1KUMA 1MAKA 4ZQKB 2NY5H 5DJXA 1K8IA 1FNSH 3BXNA 3OXSA 2HWZH 4Y2DB 2DQHH 4LCCB 4S11A 3VXSE 5DEFA 4K8RH 2GFBA 2DQDH 1QLFA 3K8LA 3TYGL 1QTYT 4OAWB 4Z76A 4K3JL 1KCSL 3W5MA 4Q0XH 4Z7WA 3ULSB 1UH4A 5KANI 3VXRE 3ILQD 2AXGB 1UENA 3MNWB 1AD0B 4F37F 3WS6A 4P2QA 4R0LA 4AEFA 1MOEA 4RWYH 4HXBH 3CFDB 4N90E 4Y16A 1P4LB 5F3HA 4HFWA 4OLZH 4Z0XA 1M05A 2N56A 1ZA6B 5J6GB 1IL1A 2DD8H 2G60L 5FOJA 3GIZH 5EUOE 3CU7A 4NZRL 4X99A 4F7CA 3IFOB 4LPUA 2ZUTA 4PJDB 3C09C 4XCEA 3QPXH 1Q72H 4FS0A 1FN4B 3C60C 1EXUB 2DYPB 5F9JB 3QUKA 1I8IB 2CPCA 5JXEC 5ISZD 4YFDB 1A8JH 4W68A 4JM2F 1JYNA 3DGCR 1EEQA 5I1AB 2O5YL 4ZFOB 5DD6B 2A0LD 3SDCD 1MCFA 1ADQH 1RZKC 3O81A 4NO5B 4NZDA 2M26A 1DR9A 3FB5B 3S35L 1NGPL 1XIWD 2FO4B 2X1OA 2APWA 1L7IH 4R96B 3V95A 2NY4C 1N0XL 4HUXB 5TE7L 4ETQA 1N3NA 5I1DB 3VW3L 2XV6B 5CJ5A 1VGEH 3ILPA 2OR9L 2R0KH 3E2HC 5IROA 5EIVA 2IF7A 1DLFH 1N26A 4GW4B 1A7RH 4OTXL 1N64H 5B21A 2AJYL 3UTPE 3NPSC 4R90H 1WICA 5I17B 4MAUH 1C7TA 1FRGL 1GIGL 1LVEA 4IOFC 4QOKD 3S4SG 3NFPA 4U1HA 1Q9OB 3LRHA 3FQUA 2B4CC 2BVPB 5ISZB 1YA5A 3UYOD 3EOTH 1JRHI 3ARRA 4JDTL 3O3UN 4LLUA 3GMNB 2JCCE 5D5MB 4LPWA 3DO7A 4W6YB 3D0LA 4XNXL 1WBZB 1G7HA 3CFBB 1NDGB 5C0AD 4IIQA 4JRXA 1DEDA 5DFTA 1W2KT 2Z8SA 3SDCB 1X5GA 12E8L 3SKOB 1MIML 3RGVD 2D4FA 4QTHA 2VDOH 1NMAH 4GAJH 4ZFZB 2HLFC 1XIWB 2QSCL 5DJAB 4D0CB 1II4E 5FXCH 4B7IA 1TZGH 2EC9T 4OV6F 1KCKA 5DUBA 3BPNC 3QZWB 1N2RA 3V0WH 1WBXB 5C09A 1UM4H 1KJVA 3SDXE 4O2CA 2FECL 4YXKH 3L3DB 3QDGD 1CI5A 1QPPA 2NXYC 2FSEA 1WIPA 3IS1X 4GJTB 3FT2A 4QOKB 2UY6A 3KLSA 1N0LA 2BVEA 4JKKA 1TENA 2GTWB 3MA7A 3Q2CA 3QEUA 2W0FA 4RFOH 1L4IA 1PSKH 3RWGB 5EZIL 1URLA 4UT9L 2VLKA 1PYWA 1FL6A 1HWHB 1A9EB 5C0AB 2Z35B 4P5TB 1LP9A 3H0TB 2JJUA 4YPJA 3VGDA 4NNYB 4QLRA 1RIHL 4RAUA 3BPOB 3RGVB 1GOFA 4K23H 5ICYA 1JGVH 5F7MC 1NBQA 4G7VH 3RJQB 1AE6L 5CSZB 4ISVA 4MHHG 3P9MB 1JPTH 2X9YA 1FVDA 3EKCA 5C2BL 5DWUL 1HI6B 1LEKB 5EU5A 3QXTA 4U0RB 4MDJB 1OAKL 3EGSB 1MWAB 3OKYA 3QDGB 5GXBB 5E6YA 2FH8A 3DMMC 1JN6A 5GSRA 3V9FA 1F3DJ 1JNHA 3BW9A 3FTGA 4WW2A 5CEYA 5E5UB 4UV4L 4XPAH 1UGNA 3HLAB 2X09A 2OK0L 3RWJB 4X4MA 1CFNA 5TDOB 2XXMB 2FX7H 1IVLA 5MEQA 2BJML 1D5BB 4WU7A 1R0AL 4X5WA 1P4BL 4IRJD 4JHAL 4KWUA 2EYRA 3IJSB 5E5RB 1YY8B 5T1DL 1R5WB 3L3HA 3WXVL 4KXZH 5ANME 5GGRY 1PZ5A 1I85A 5HDQL 1Q9KB 1CXFA 3TYFB 4UV7L 3MRDB 1D6VL 4L9LC 2X40A 2BNRA 3FFCD 3GJEB 2R9HC 1MY7A 3CXHJ 4LVHB 4L3EA 1UH3A 5A2LH 2APFA 5ETUB 2QQLL 2P47B 4ZTOL 2ADGA 2J8OA 5L6YL 4IRZL 1N5YL 1V8HA 5ERWA 4NDMB 2RFXB 3ZT7A 2VAAB 4L5FL 4Q9RL 2X89A 5ESVB 3TZVA 3RDTD 3BP4B 5D70H 4JFFA 4PRBB 3IXTA 1GGCH 4KRPC 1H15B 2YPKA 3IS0X 3TIEB 1JYXA 4IRJB 5DT1L 5D7IB 4U1SA 5DVKA 4OKDA 4J3VA 5HI3D 3CZFA 2YSSB 4G6FD 3GMQA 5A2KH 3CK0L 1S8DA 1P9MC 4LKXA 4HQQL 4NWTH 2P8PA 2VKXA 3U9PH 4UQ3A 4LLDA 3LEYL 4F7MA 4NQCA 4ZFOL 4CKVX 1HK6A 3AUVA 2PXYA 2GY7B 2P8LA 3FFCB 4R6UA 4U6XB 1XT5A 2R0LH 2GITA 2EDNA 1IC5H 5IJKA 2V5YA 1D9KC 1FHGA 4MQ7A 5E8DL 3CAFA 1TJIL 2GSIB 4HFUL 3CXDL 4KTEL 3IDJB 1YYLH 4HUVB 4KDTC 2IBBA 3N50A 4TUJA 5JPNB 1EEZA 5DJ0B 2GJZB 4U49A 5D6DC 1N6VA 3RDTB 2LVEA 5T1LB 1DVFD 4MCYA 3ARED 3I3BA 3ARTA 3W9EA 5M7QA 2EE6A 4G6FB 1NCWL 4P5TC 3U7YL 3VCLB 4PRIE 2E7HA 2QSQA 5DJCA 4NIKB 4BSVA 5HDOA 5HHPB 4Y4KD 5E8NA 3I6KB 2HT2D 4DWHA 2JB6B 3S34L 1A7OH 1NCDH 1X7QB 2K3TA 2X10A 1QLRA 2PYEA 3V6FA 5D7KE 4BKLB 4OZIE 3GMPA 5IHZA 4JANB 3FQNB 5FO8A 5GJSL 2EDTA 1FFNB 5H94A 3PWLB 1RJYA 5CCKH 3QULB 2F8XC 3HC3H 1NAMB 3VFPB 2UUDK 4MB5A 3T0AA 3NABH 5D2LB 3DXAE 1DL7L 2VO5A 3DTXB 1TVHB 4G8FA 5DA0B 4CVZB 3S4SB 4YIQB 3AREB 4WI7A 4QWWD 1E27B 5GRZA 3GSUA 4MD4A 5HGDB 5L9DH 5E2JA 5MEOA 3BYYA 3L7FB 4MNHA 4ZAKC 3RY6C 3T8XA 2DF3A 1XGRB 3PWPE 2A74B 1D5XB 4LLWB 5ACLA 3PL6A 2Q87A 5I1KH 4G9FA 3F5WB 1G7IB 4DGYH 5A40E 3WL9B 3QR2A 1KNOB 4PJHB 3T4YB 5DRWB 5LWYL 5GSVB 1I9JH 1QFUL 4WVRA 5E9DD 4D8PA 1XGQA 1F2XK 1CGVA 4M62H 3MFFB 5EIIB 2JIXA 4Z7WF 4NM8H 5SX5H 3U4EB 4JPKH 3GSNH 4ZS6D 4YDVA 5BCAA 4F33B 4N5UA 1KEGL 3X3GL 1I1YB 2WBJD 1AJ7L 3EO9L 5E4EB 1B0GA 5F72S 5FUZH 3O6FA 4WIQA 1FG2B 1ZA3B 1JUFA 1F90L 1NCUA 1J1XH 5HY9A 1JMZA 3NFSL 4HIXL 4GBXA 4PBXA 3KPPB 4OSUH 1U8HB 3SKMB 3DPBA 3VXNB 2F54D 2W9LA 1J9CT 1E4XL 1U8JA 5FGCB 2VLJE 4PP2B 1U3JA 3U2SA 5JQ6H 1BMGA 5F7NC 5TF0A 4AQ1B 4E9LA 4GW1A 2JJTA 4WUUA 1DP0A 3L9RB 4NGHL 5T3ZD 2NMSA 4YPGA 3S36H 2W60B 4EIGB 5E9DB 5EWIH 1CGSL 3WUZA 3TWCL 3RVUC 3X14B 2PO6C 2ATKA 3FFDA 2NYYD 2EDWA 1KPUB 3MYJA 4YHNA 1L9MA 2WWKT 2BSSB 4UINH 3L3OA 2AJSH 1M7IB 2CXGA 2FGZA 5DURD 1O7VA 1OTUD 4KZEH 1JWSA 3STZB 1CFVL 5KSAA 5BMFL 3MJ8A 1HKFA 4LSRL 2WBJB 3Q6GL 4G80A 1CF8L 4LSUH 1JTTA 2HT4D 3ARBA 3UTQB 4ZUTB 4FA8A 1B2WL 1UA6H 2DM7A 1PEWA 3HMXL 3MV9A 3PUCA 4O02H 3BZEA 1KIPA 2F54B 3OX8A 2EXWD 5DF0A 4EI6A 4LLAA 1K2DB 5F7YC 3TN0D 2D2OA 3EUUA 4GRWE 1JF5A 5HHNB 4X8JA 1G6VK 3W81A 2Y9RT 4XC1H 2HJLA 3JV4A 2P5EB 4RMWA 2ICWB 1R3HB 4PRHA 4AK1A 4H0HB 4Y4HD 2ED8A 5D7JD 5C07A 1JCKA 3WHXA 4BELD 2APBA 4M3JA 4M5YH 3ZDZE 3X3FH 3ZDYF 1UM6H 1P84J 2Q6WA 3L7EB 1A6ZB 1JNNH 3KPQA 4WWKD 4EDXA 2ZG3A 5C0CE 2D7TH 3VFTA 4P5MA 4QRRE 5D2NA 3OJVC 1JZ8A 1WC7A 4NUGH 1N6QL 1NFDB 5FYKH 1F4YH 4YR6A 5F9WB 1TZHA 3THMH 4ZUVB 5DO2C 2FB4H 4HWNA 3HR5B 1ETZA 1J1PL 5KTEL 1S7SA 1RVFH 1T2XA 2ARJA 1MCCA 2VZ3A 3AAZB 3S7GA 5JR1H 3OKEA 2DTSA 4P46D 3QEGH 1U42A 1KCRH 5EOCJ 3SKNA 3HZMB 3IU3B 4UBDC 3HAEG 3TN0B 5EOTB 5E2TH 2NY6D 4C58B 3JTSB 5TFSH 5LQBH 1TETH 1LP9F 3MGOB 1WV7T 1M7DA 2J8UB 3QUMA 2I07B 1FE8H 2IBGA 4PGZA 4Y4HB 5DRZA 1AO7E 2VISB 5D7JB 4P4KD 1CLZH 1WBYA 4I18A 3JUZA 1KCUH 2BVQA 5DZOA 2E8ZA 3HE6A 4F8QA 2YKLL 1WVZA 3DRQB 4ALAH 1NUNB 4HWEL 4PRNB 5FCSH 4OI7A 4MVBC 1NAML 5BVPH 1Q0YL 4YGVA 1SYSB 3FB6A 5DA4A 3RY4A 1CXHA 1RJZB 2YPLA 1ZHKA 3H7LA 3LZFL 1LK2A 3PDOB 2CRIA 4RAVB 3TGXA 2R69L 5HGBA 1F4AA 2UZIH 1FFPB 4WW2F 5CJQL 3MODL 4KZDL 1ADQA 1VPOL 3I6LD 4P46B 1G7QA 3LY6A 4J23A 5SWSA 1JHKL 1G7MB 3KYKH 2R8SH 5E2VH 2YEZB 2CQVA 5IVXF 4UZGA 1GC1C 1I7UA 4FTVA 5FYLD 4XMKH 5BRZD 4PREB 4P0DA 2W0PA 3HC0B 5ABDE 1LHZA 3IJYB 4P4KB 2BDNL 2MPAH 3TCXA 1MCOL 5J13C 2XQBH 2NY2C 4LVNC 4KQ3L 3MRHA 4O2EA 1R3KB 1OTSD 3T0DA 2ITCB 3WIHH 4TTGA 3LQAH 5BZWA 1YMMA 1NJ9A 3IDNB 2YXFA 1NSNL 1S7TB 5B8CC 1YEKH 3EO0A 3UZVB 3ULUD 1KFAL 1JPFA 3D48R 1T1ZB 2IAND 1FGVL 2E8YA 3WKML 2FO1A 4DK6A 3B9KC 4NFCA 2QL1A 3T4AA 2FJGB 5KSUA 3OJDA 3RIFK 5FA4B 5DEGA 3QXUA 3CH1B 2IAMA 2YD6A 4L4VD 2DAVA 1V3KA 5BRZB 1KEMH 3HA0A 2W59A 1Z0MA 3I75B 3UYPA 2Y23A 1UWGL 5CGYD 5I8OH 4MWFB 1F58H 4H20H 4P23A 5HHOE 3UP1A 3G6AA 2FD6L 4JY4A 1AR2A 1YEJH 3MRJA 5KVGL 2DQFB 4U1JA 3ZL4H 1BECA 2VDPH 1EGJL 3BIKB 3QDJA 4WO4D 4CDGC 1CFSA 4MXQC 3KXFB 3JWOH 1I9IL 4PJXA 4WFFD 1UM5L 4BA8A 4HDIB 2Q8AH 2H2PD 2IANB 2B1AH 4IMKC 4N0FB 3TNMA 1T4KA 1HINL 4JY6B 5TH2A 5DFWH 3P0GB 1DBJL 3K80A 3MMEA 1U8QA 5IG7A 5I71B 5DI8B 4HIJA 1U8IA 2IWGA 1G9ML 4YHIA 3FO0L 5F6IC 1BZ7B 4J7RA 5DFVD 3F65A 3MXWH 2C7UB 1PFCA 3KNBA 2FR4A 5C0EB 4UU9B 4M48H 1QHOA 3QIWB 1Z0NA 4PRAA 1AGDA 5F9OL 3NIDE 2AW2A 4XNMB 4D0BB 3OSKA 4Q58C 1S7XA 4XAKD 3U46B 4XPGH 1PX3A 5DUML 4WO4B 4OLXH 5T3ZL 3MRFB 1QYGH 5IHBA 1Y6NR 4DEPB 2K1MA 2HH0L 4M7KL 1GGIL 3PIQB 4CL7A 1FIEA 2VWEC 1HEZA 1IMHC 4KJQD 5DK0B 5T5NG 3V0AC 1VGKB 4EJ1C 1MHEA 5EZLA 2M1KA 4JRYD 3RVTD 4D94A 1P6FA 5FKAA 4Z78A 3QNZB 1DE4A 5C0JA 2AGJH 4EQ2A 4RQQB 4UQ2A 1AC6A 1Y18A 5DR5H 1U95B 1M71A 4X9BA 4HV8B 1CD1A 4PJ7A 4P46C 2Y06H 1EFXD 2DQIH 4JR9H 2EDQA 1ZVSB 4LDLB 1ACZA 1EZVY 3DBXA 4CBPA 1XF3B 3QIBA 4ZO8A 2YWYA 4I0PA 3BP5B 3OPZL 1XH3B 4OZHB 2YUZA 1MFAL 3HZKB 1V7NH 1ZANL 4MJIE 5CP7A 3ULVC 5FM5M 3TO4D 3B6SB 1F6LL 1OQXA 3NOIA 3D3VE 4OLYL 1YN6B 4KRLB 3DX7A 1JPGB 1P5UA 5EU6A 1ZS8B 4JRYB 5HHQB 1JGEA 3ARGC 4FABL 3GSQB 3KVQA 1JGDA 4YHKL 2R4SH 4LSTH 5I1CH 3KLHC 1H3PL 1ZHBA 2DWDA 2X4SA 3HI5L 2XZZA 1F4XH 1JGUH 3SGEI 4ODTL 5KVDH 3WFEH 1EFXB 3TBTA 1ITBB 3N85L 2P42B 4YXLH 2HFGL 4R4ND 1BX2B 5GZNC 3ZHDA 4OD3H 3HAEB 1ZK9A 2VH5H 4L8SC 3VE0B 1VADB 1J05B 1SYVB 2IQ9L 1IKNA 4M03A 5FYJE 5AZEL 1D3CA 2X9WA 5FUOL 1TVBB 4IDJL 3TO4B 5D9SB 1OB1B 4MA8H 5HGHA 1UZ8A 2EO1A 1QRNE 1OGAE 3EOBA 5E94B 3ULVL 1DQDL 5I15L 3ZHKA 3ARXA 2Y07L 4NNPH 4I48B 4JO4H 35C8H 4LBEA 1MY5A 5JTWA 5ILTH 5EO9B 5JLZA 5GRJL 1RQ5A 3T3ME 1X5LA 5I1LB 4Z7OF 1QA9B 4NSKB 4ZOAA 4WGWB 1KG0A 4X6CE 5SWZA 4WRLA 4DVRL 1T2QH 4J4PC 3PWUA 5KVFH 3MLZH 5TE4L 5T5FL 5I71C 3QCVL 1KTRL 3HE7D 2VZOA 3STLB 5BS0E 4I2XA 1R3IH 4KVNH 4WFED 3KDMA 1SEQH 3QNYB 2NTSP 4HUWA 4JJHA 4F9LC 3FO2B 1RULH 4APQD 3AXLA 3QIWC 5FYLL 2GCYB 3QXAB 2XG5A 3INUH 3QDJD 4GQ9H 4WUKH 4J1UA 4AG4H 1G9NC 3QUXD 2BXZA 3OGCB 1Q0XL 4ODSH 2CKBH 4QHUB 3WO3B 2R23B 3CVHH 4FQXC 4Z7NE 3T0EA 4HCRL 5EZJA 2QR0A 4XCCH 1Z6JT 3G5VB 3LCYA 5ID0A 1KCVH 3QUZD 3FO9A 2BMKB 2V2WA 2VLME 2IADA 3O41B 1AQKL 4K9EH 4IOSD 1UEMA 4JFDE 1CIUA 5KVEH 4R7DA 2AK4E 3HE7B 1H3TA 1B4RA 1EHLH 2OL3B 4H1LH 4HLZG 1DQJB 4FQ2H 4JO3H 5C3LD 1QBLL 4APQB 4DN4H 1CVSC 1YJDL 4M7LL 1KPRB 4CUCA 4YDKH 1BVLB 3PGFL 1RIUH 3ESVF 4F37K 3QUXB 5F3BB 1NGQH 2DIBA 4YHLL 5FCUL 3GSNA 3VMOA 1T7WA 3QHFL 3VFOB 5KANG 4K94C 4BFGA 5D8JL 1LO4L 1J0KA 3RP1A 3JVGC 3RWDB 1FNEB 4S10A 5C6PB 1RSFA 1DUZB 3QUZB 3OMZA 5DJ8A 2D0HA 5JO5B 3RUGB 4UNVA 5ITFA 2DLHA 1XCQB 4ERSH 4DKFL 1K8DB 2C5DC 5GZOC 3P0VH 3MLYL 2EXYC 1AR1D 1UCTA 4NO0D 1OP5H 2O5ZH 4L29A 4PLNC 4FQQB 3DVNA 4GKSB 3WS3B 1ZLVH 1C7SA 4HIIA 4H26A 4LSQH 2V7NA 5FECB 5EBWB 4P2RE 4MA7H 4ZXBD 2H1PL 3ARDC 4RAHA 4P2OA 3O9WA 3QCTL 4JM2B 5I8KH 5EOQH 3LN5B 3FOMB 1ZHLB 1WTGT 4NM4L 4IRSD 3RTQA 4G42A 2ZCHL 4TTDC 1JK8B 1ZWIB 1TQCC 2CUMA 4OB5H 1NGZB 1HQ4A 3S35X 3SO3B 2QADC 1PKOA 1S9XB 1O7SA 3FN0L 3RNQA 2R4RH 4RMUA 3VXME 5J12B 4NO0B 3BVNB 4PRPA 3IGAA 3QG7H 3UTTA 2UWEB 1ONQB 1VEMA 3HNTL 3WJJA 3ZTJG 2WLYA 4KK5D 3MV7A 5L2KA 4RBPK 2HTLD 1IGYB 3VMPA 4FFVD 4HJ0D 1JPST 4MNGA 3L6FA 5C0ND 2E7LA 4HUUB 3MGTA 3RKDD 3M1BA 5DC9B 4WV1B 3JZ7A 3DV4A 4WW1A 1IAIL 3KPOA 1JFQL 2YD3A 5DMGC 1N4XL 2HVKB 2Y7QA 4DN3L 1S78C 1FFQA 3IDXL 1DBAL 3BESR 4OFKA 4IRSB 1BIIA 4U1MA 1LO3L 3VWKD 2AAVA 3QHZL 4LASH 2AI0H 1RUQL 3ZZ1A 4P48A 1EO5A 1YECL 4ZS7L 4ODWB 2FEEI 2XA3A 2BZDA 4P9HL 4PJ5E 4PJXF 3RL2A 3UPCA 5I75B 4AL8L 4EDWL 3QWOA 2EH7L 2C3VA 1BGXH 4YK4B 3MCLL 4OM1H 1JNLL 4JFYA 4I9WE 5L88H 3RRQA 1W72B 2FIRT 3T0BA 3VI4F 3WD5H 2R2HB 3QWRD 3BPCA 1T5XA 3E6HA 3MO1B 4L1DA 3RWFB 3SPVA 4HIEB 4E41A 4DZ8A 5BV7H 1JWMA 4FRWA 1PEZA 1S9WA 2FBOJ 2P24A 4EOWL 4RA3A 4KROD 1PAMA 4JQVC 3CH8A 4IHOB 1RHFA 1UJTA 5IIEB 2GIYA 3SE9L 4FHBD 3DOSA 2E6JA 1RY7B 4Z7UE 2Q3AA 3FT3B 3FO1A 1AHWB 3UC0L 2HJKB 5DRNB 2Y25A 3VFVB 1G7LB 3BKYH 3QFJD 1SBSH 3SGJA 3SN6N 2BNQD 3O6LL 5B3JF 3FRUA 1MLBA 3BE1L 1JGLH 2GY5A 2XT1B 4QRUA 3MUJA 4QGYA 3C8KB 3MLVH 4X7CC 5FIEA 4YHZL 4D9LH 3K3QA 5I1GH 3LPFA 2X2YA 3F7RA 2XWJB 3LS5L 5ACZB 1R3LA 1I9EA 3ZKMC 2AKRA 5IESL 3DHMA 3RU8L 1SBBA 4LVOC 4LKCB 3P4NB 2WUBH 1P84K 2ZOKB 4KROB 3OR6A 2OL3L 2XN9A 3G04A 4ZDHB 3VXTB 4X98B 2DKSA 5FK9A 3WIHA 1ULVA 4HF5L 3CDFA 4A6YB 4PGDB 1IGJA 3WLWC 1IT9L 3QFJB 4OD2B 2H6PB 5CHNB 4JM2C 5E56A 2BNQB 2R1WB 2AXFB 4D0DA 4FFZH 2HFEB 1T2JA 3MRQA 1KACB 4PLKD 4X0KB 2BSRB 3VGAB 4MLIA 4RFEB 5I6XB 5CUSH 3R06B 4C83B 5CMAA 1A4KA 4CW1A 2FJFA 3EDKA 2JLLA 3U0TB 3O3EA 2P5EE 1YNLL 4E0RB 1A5FL 2XZCL 1P7KB 4GG6A 1TIUA 3H6JA 3VWJD 3IDMA 3VXQA 4FQHB 4IMLA 5KZCD 5H8DA 1FL3A 4GMTH 5C8JB 3WUWG 3SKJH 1BD2D 1DUYA 4KK9C 5KS9A 3S9DB 2ZSWB 3OG4B 2WWMD 4M6AA 5C2UB 1IEAB 1A6PA 5DYOA 5ADPL 5E8PA 1OARH 2O61A 4MSWB 1UXSB 3EYSH 1IC4L 5E1AB 5EZOL 4XPBL 2IEPA 1INEH 1FV1A 3DSFH 5IB2B 1EIBA 4TSCL 4H8WC 1CICC 1N5AB 2X4NA 1FLRL 4JREC 5J06A 5KOVC 2HRLA 2Y5TB 5EBLB 4LGPB 1Y0LB 2P7TB 4WY7L 3BMWA 4LLVA 4GS7C 1OW0A 5CZXD 3HFMH 2I26N 3MRPA 3BQUD 3C5ZB 4HPOL 2X41A 3U83A 1IM9D 5HPMA 5E99L 3PWJB 5KZCB 4ELKB 4GAGL 4NC2B 4J3UA 5KSBE 1BD2B 1AD9B 5J11B 4P9ML 1N59A 3W0WA 3REVA 4KJYB 2AEPH 4WDIB 2VWEE 2HMIC 4YO0B 1CFQA 3K1DA 3VFRA 4ENEC 4NHUB 4NCC1 3V0VA 2OP4H 4XWGL 2EYSA 3QI9C 5DEZA 1AHWC 4Y1AD 4LEOB 3MLRL 4F7PB 3ZYJA 3X11A 3IFPA 1NMCC 4G8GA 3VA6A 3ROLB 1NBVL 4JFPB 3BRGC 5ALCH 5ENWA 1T03L 3NBNA 1VENA 3ARPA 4NQVA 1IM9B 1OVZA 2E9JA 4HH8A 1MLCB 2IMMA 4PLJD 3ULVE 5E00A 3D39E 3QQNA 1B0RA 2VLRE 3VXOA 3JWDH 2P43B 5EB9A 1MFDH 3VD3A 2BOBB 3WE6B 1HSBB 3ZDXF 2BSTA 1W72L 3RVWD 1RURL 1CN4A 4HIHA 4BFIA 5F1IA 1QP1A 1HHJA 2Y36H 5INDA 5JHDD 5GIRA 5EN2B 5MI0B 4PJFE 4S2SA 1UXWA 4Y1AB 1I8KA 4WI8A 5JDSA 1CCZA 4K3HA 3WO4B 2QLVB 3HNSL 3MV01 3SJVE 1HHIB 5AD0A 5CILH 4F3FB 4Z0BL 4NN5B 5E8EA 2MQ0A 3SY0B 5J3HD 2ESVE 4P5KA 4ZODA 3ALXA 2ZUQB 2JJSA 5FYKU 5IOPB 4Y19D 1L0YA 4C56D 2R2CA 5K9OA 5I66A 4TYUA 5LCVL 4MD5A 4UT6L 4H5SA 3CSBA 3RI5F 3KXFE 3DX6A 1YNTB 4Z7WB 4JVWA 2BNUA 4JAMA 4G8EA 3T0WA 1OD7A 4P2QB 4AEEA 3KYOA 5LG1A 3O2VL 3RWHA 2PTTA 1JZ2A 4ONGH 4DTGL 2X70B 4LEXH 2PN5A 1T1YB 2EECA 1EAPB 1A6TA 1FZJB 3MBED 5CJXA 2ZCKH 4KDWA 2E27H 1JE6A 4PJAB 4C54A 1PKQB 4A6YL 2H26A 1FZOA 2L7UA 1J5OH 3BP6B 3U4AA 4O58L 4LCWA 4PB0L 1NMBL 4NKQB 4DGIL 4P99A 2QTEA 5DJ2B 4Z5RB 3UTSE 4HW6A 1INDH 4Y19B 3MV8E 2BOCA 1KXVC 3C5ZC 5DK2A 1KXTB 5H35A 3SDAD 5E03A 1MJUL 2HA1A 4Y5VB 5C9JA 1L6XA 1U3HA 4PY7A 4X6BA 5E8OB 3GGWB 3GSOB 3B9DA 4NN7B 4MD0B 1IAKA 1NAKL 1MI5E 4QNPF 5K59F 4NZTH 1Z3GL 2ADFH 2F5BL 2ADIB 5ESAB 2QEJA 2CKBA 5F7DA 3MBEB 4M93C 3CVHA 1NCAL 2AV7A 4LDOB 1D6EA 3QG6A 3VRIA 4UILH 3HG1D 5EOCL 1MRDH 1KC5H 2VZSA 4QXTB 3PP3H 1LD9A 4MNQD 1C5DB 5DMIL 5TQ2H 3S96B 5E08L 3TIDB 1H5BA 2G75B 5FOBB 4P3CH 3FB8B 1TQBC 1XF1A 2GEEA 2NXZB 3RPIB 3DO7B 5F89B 5A2IH 2VLLA 3D0LB 4HMDA 1G7HB 3FQRB 1C12A 5D72H 4PJEE 2IALB 4PJCB 2J4WH 4U6YA 4H1LA 2J2ZA 4PJ9D 4OFPA 3RHWK 2YD7A 3SDAB 2NY3D 4O4YL 4QCIA 2VDKL 5LAXA 1YNKL 1P69B 3F7PC 3RVXD 3WUWB 5HYQA 3ARQA 1LWRA 2G5RA 5D1ZA 5IB1B 4Y5XA 5HYIA 1ORSA 1RZ8B 3LEXB 2DLFL 4IS6B 3UO1L 2CGRH 3QXVA 3K81A 4OUUA 4RMRA 1OCWL 5GHWL 4JZOA 4UUJA 4JPWH 1CD9B 3KPLB 3R0NA 2GKIA 4RGND 3HG1B 5DK3A 1ED3A 4S1DD 4MNQB 3LHPH 5MP6H 5CWSB 2ZSVA 1INQA 2R15A 1S7VB 3IFNH 1PYWB 2J88H 3EOAB 5I9QB 4HULB 4FP8H 3Q0HA 1JTOA 2OZ4H 4RAUB 5HYJD 4PJ9B 3S88L 1GGUA 1QVOB 2NY3B 1NLDL 3VFMB 5ICYB 1KIQA 4RMVA 5IQ9A 2FBJL 2A6KA 4ISVB 4JHWL 3LRSA 1HXMB 1ZT4A 3LQMA 4F7EA 2DL9A 2H3NB 2C1OA 1ORQB 3UTOA 1S9YA 1HZHH 3MLWH 4MX7A 1WEJH 3NCYS 2F9BT 1MHCB 5EU5B 4XPHL 2JTDA 1WQVT 1JRHL 3WS6C 4R0LC 3U0PA 2PF6A 1J0HA 3RAJL 1BFVH 3MC0A 3CCHA 1T66C 4RGNB 2XA8L 4Y16C 4X6DA 4KHXL 4TULL 2VN4A 1DJSA 4UNUA 4EN3D 1JNHB 5IEHA 5J1TC 2Z8RA 3BX7C 5GGSA 3FTGB 3ECBB 5DUPL 2D3VA 4XNQA 1BBDH 1Z5LB 2A83A 3OKOA 5CEXA 2OJZL 4FXKA 4ZUUA 3QSKB 3LVEA 3QWQB 5IVXB 3CDCA 3L5HA 4I4WB 2P4AB 1CLYH 4WU7B 1A6UL 5HYJB 2GUOA 5LXGH 3L95A 5J6HA 4Z8FL 1I1FA 5CIPH 4MXVE 1UT9A 4QF1A 1OP3H 3EYUL 3WJLA 1OAQH 4YGAB 2A9NL 2OR8A 4RSVA 3HTLX 1UYWH 3L3KB 5I0DA 4PR5A 3PGCA 2Z9TA 5C6TH 1KENH 4XC3L 4GG6F 4RRPG 5IROC 2YN3A 4OGYL 5I16A 3NACH 3LB6C 4CN4A 1EPFA 4EN3B 4LMQE 1U91B 3S3JA 2YZ1A 1J0ZA 1F4WH 5KS9F 4XBGA 4V1DE 5EU4A 4JN1H 3CFKB 4RRPA 4HK0B 4LDEB 5IB3A 3FQXA 2VXUH 3MNZB 3HCVA 4NHCL 4OUOA 2HJFB 4R4BB 2APXA 4XCNB 3IKKA 4HS8L 2CLRA 4K7PL 3C6LA 3MUY1 3SCMA 2NXZC 3O4LD 2CDEB 2X1PA 2E9BA 2HT3D 4IIQC 1U58A 1NGWA 2ZNXA 3IU4L 4ZFFA 5JIHA 3VU2A 4DGVL 3O45B 4ZTPL 1X6LA 3QJFA 1I1AD 4HS3B 4LLDB 4N0CD 2V5TA 1SJEB 3IDYB 4FQ1H 3BHBA 2DM3A 4JFZL 5TQ0H 5AUMA 1A6WH 4JDVA 4PJ8D 4N0UE 2B1HL 3IETA 4JFED 4TUOA 5ALBL 4ZUWB 5IK3A 5CBEB 4GRMA 2NW2A 5DQJB 4PJBB 1ZAGA 2PR4H 2VDLL 2J6EH 4TNVF 1EEZB 4WU5A 5F7EH 5FO7B 4PG2C 5D7LE 3H3PL 3O4LB 2H8PB 5BZDA 3GO1L 5I9QC 3QA3B 1BF8A 3LH2L 3OKDA 3RWCB 2B0SL 5HJ3A 4EKXA 4NQXA 2R1XA 1UZ6F 2XI9A 1C5BH 1S5HB 5T3XH 1I1AB 3LOWA 2YA1A 2PYEB 1OAZH 3MCKA 1KIRA 2FATL 3KAAA 3GMPB 1BF2A 5DQDH 2NZ9D 5I1IL 2JKXA 4ELMB 2QQQA 2GI7A 5F88A 1QR4A 4JFEB 1IM3A 3ZE2F 2A73B 1PVHA 3GRWA 4RGMC 4XHJD 1PY9A 1FIGL 3V6BR 3MGAA 1MFBL 4XH2B 5INCB 4R8WL 4OCMC 3QDHA 4WW2C 2FJHB 4RMSA 5IHUL 4JVPA 4AYFA 1T1WB 4HJJH 5KW9L 5I18H 4BSWA 4I77L 1LDPL 4MD4B 3U6RA 2XZAH 3QJHA 4RGOH 3F62A 4Q2ZB 4QYOA 1OGTA 1A7BA 3PDDA 3DX8A 3PP4H 1VB9A 4ORZC 4ORGA 1AGCB 4QRPE 1K9TA 2R2BB 3WSQH 1VACA 3QIUD 1K4CA 4G43A 2F74B 1G6RB 1G7PB 1MCBA 5IB5A 5IMLA 1I85C 4PGJA 3QXDA 3BDYL 3BD4A 1E6JL 1IFHH 2BY1A 1BAFH 4EQ3A 3RFZC 3SDDA 1JBJA 1I8MA 2AQ1A 2PYFA 5I73B 1MRFL 4D8PB 1KCSH 1CBVL 3TA3A 1YMHA 5I76A 4L4TE 4ZUSB 1HHGB 1QNZL 2G5BB 4CADB 3DNKA 5C0DB 1FZKB 3HUJA 4JFXA 4YHPB 1QKZL 2AJXL 4S0TD 4XVUC 1RUKL 4OF0A 2DBLL 4WEMB 5LBSH 1KV3A 2VZ1A 3TZVC 3F7QA 5MEND 2G60H 4HEPG 4EI5A 1JMXA 5IBLD 4JKWA 4RNRB 3LKPA 3ZT5A 4JGMA 4OLEA 4KJPC 4C59B 5ICZB 5BXFA 3I9GH 3EJYD 1ND0B 2IPKB 2Z0BA 4JY5L 2BHZA 3KPSA 1BQLL 2VABA 5GPRA 3RA7L 3ZHLA 1BZ9B 2EC8A 1FGNH 1P4IH 3D0VA 3OKLB 2O5YH 3MJ7B 3U4BL 1HH6A 4G6ML 2PXYC 1EBAA 2NY1C 4TQEH 5F6HJ 3S35H 5IJKC 1KOAA 4ZFGH 1NGPH 4MYWB 5IT2L 4BQBA 1N0XH 3WXWL 3VW3H 5HYEA 1BM3L 1NFIA 1RK0A 2OR9H 1YPZA 3WFHB 5IR1A 3O2WL 4OTXH 5KSAB 3VXUD 2AJYH 5MENB 1FFOB 4HWUA 5E7FA 4JKMA 3W39A 3LEVL 5J0BA 3G08B 4XGZA 1FRGH 1IAOA 2AV1B 3E0GA 1GIGH 5CEZD 2Z91A 2MMXA 1SM3L 3LIZH 1H0DB 3SOBL 3C5JA 2Y6SC 4JDTH 5A16A 4OT1L 1IC7L 2OI9C 4RFNB 2P5WA 5C0BE 4X8JB 1KCLA 5JHLL 2R29H 4KK6C 3O3AB 4RISH 2ZPKL 3E6FB 4DKEL 2P49B 1CGXA 3ARFA 1NC4D 4DUVA 5JOFA 2QSCH 1EEYA 4XWOC 3KPMB 1Q9LA 4XNZC 1NLBL 2NX5E 3IDGA 2VC2L 2YMXL 3OR7B 1CFBA 4K71C 1VKXA 2V5RA 3P3YA 5IMKB 1J1OL 1EUTA 2CDFA 3IAPA 5D93B 3Q3GA 5D2NB 3A67L 3VXUB 1SHMA 1UWXH 1WWCA 2DB8A 1FZMA 1TPXB 1A3RL 3TC9A 5HHVL 2LQRA 1A2YA 4JDZB 3LQZA 5H2BB 4AEIL 2YHGA 2CIIB 1EK3A 3Q6FB 4TSAL 5DMKA 2Z93B 3V5DB 1PZUB 4CMMB 2GJ6A 4GKZA 5HVHB 3MZTA 1E28B 4UAOB 3L5WB 4P59L 43CAA 3PL6C 4N68A 5FDWA 1RIHH 3WFCH 3QFDA 4JB9H 3V4PL 3BH8A 3LD8B 1NC4B 4DKDC 1AE6H 4MJ5B 5LGJB 3L3IB 1KGCE 2HTKC 4X5XA 5EPMA 4LPYA 1OT2A 2PW1A 5EBGA 2VR9A 5C2BH 3FQWA 4HWBL 5I2IB 5KG9B 5DHXB 2QQKL 2LTQB 4ZSOE 1BBJA 4JFOB 4JPIA 3TVMA 4HKXA 1HH9A 5EIQA 3TJEL 4M1CD 3QEQA 1U2CA 5DVMA 4X6DF 3F58L 1MFNA 2NTFB 3QQ4A 4MLSA 4PJIB 4MJ4A 2VUYA 3O6FC 5D1XA 1S7RA 3D85A 4XZUB 1N7ML 3PJSA 1G7QB 1JWUA 1FVEA 1RU9L 5GS0C 4GBXC 3MOBL 3H7BB 1C08A 4JZJA 1H3VA 4MCZB 4NQEA 3W11C 3IDUA 2BJMH 2IPUG 3O6ML 3H9HA 3PG2A 5E6ID 1SY6H 4KKLD 2UZYB 4JHAH 2ICCA 2VL4A 5T1DH 2JJTC 1G6RL 2F53E 3BOVA 4POYA 3BZFB 3T65B 2IC2A 3BPLB 4PTUA 5HDQH 2R1YB 1ZLWH 2D0GA 2E9WA 3BJLA 2Q7YA 2YA2A 2FYYA 2PCPA 1G7JB 3GMMA 3MROB 1YMMB 1D6VH 1BP3B 5HHME 3U7WL 1FFRA 3T3MF 2R2EB 4Z77B 3NCJL 2QQLH 2WQRA 5E2WL 4ZTOH 5KSAC 4RIRA 5EBMB 5KVMC 3TESA 1VFBB 3GHEL 2WBWB 4HX1B 1X5ZA 1A4JB 1E6OL 3OJDB 4L8DA 2AJ3B 3C08L 3ARBC 1M6OA 4Y2OA 4HKJA 4MDIA 3BAEL 2IAMB 3QQ9C 4M3KB 3WDIA 3B8SA 3MRGA 1B90A 1MVUB 2J12B 3BEWA 2OLDA 5FDYA 1DLHA 4LVEA 5A1AA 4NNXB 3PXJA 5E6IB 5IFJA 1E4KA 2VL5A 3G6JA 3P0YL 3JV6A 2KDGA 1YY9C 3G6AB 1KT2A 2V5SA 1XGUB 2OTUB 3O8XD 4X80L 3IFLL 4HQQH 5K93A 1CDHA 2IH3A 1ZGLA 3U0WH 3LEYH 3W82A 1VFUA 1CFSB 2DQJL 1UKTA 1KJ2A 2ZWLT 1IGCH 2YA0A 4KJWD 2BVOA 3MR9A 5F97E 3MNVB 5HYFA 4NKMA 5T1KA 1I3RB 1P7QA 1RFDH 3VXSD 5D93C 5D2NC 3S8WA 1TJIH 1BEYL 1J8HD 1LO5B 2VIRA 1DFBH 5DSCB 1NQBA 3CXDH 5TGBB 2OZ4A 4I8DA 3VXRD 2NY5C 1J0IA 5F7UA 4Z7WE 1U8QB 1YEHL 3MLTA 5DD5L 2ZCLL 5IBUB 4P2QE 4NYLA 4N90D 1QEWB 5KAQG 1U8IB 3MJ6A 4CU8A 4K8RC 1BFTA 1OAYL 1TCRB 2W9DL 4OZGA 5HVHC 3MRIA 4LHUA 3U7YH 5HD8C 3T1WA 2ZUUA 3R8QA 2X1XR 2WNGA 3GSRB 3JSSA 3S34H 4D9QE 4AT6A 5DVLA 3BGFB 2X4PB 2ZKHH 3TNNB 4I18C 3BGMA 4ODXA 4KQ4H 2W92A 4PGCA 4GUPA 1NUFA 4GRLA 5EA0H 3HE6C 3U9UB 1D5MB 5CZVH 5MERB 3HRZA 1QFHA 2EC9U 5GJSH 1E0OB 3TM6A 1JJUA 1XF5A 4RWHA 1AP2A 1J8HB 2C4XA 4Y5YB 3QUYA 2FL5A 3B2VL 1IQDB 2R0ZH 3VXRB 3IKCB 4F8TA 5CIPA 4M4PA 4XP1L 4FFYL 4O2FA 3CNKA 3MACH 4KK8C 3MRCB 1TCMA 2NY5L 3MJ9H 2A6DB 3UTPD 5CEZL 2JJVA 3P4OB 5EUOB 2HWZL 4JLRB 1MHHA 2GYSA 1LMKA 5JNYB 1Q9WB 4XP4L 1U93B 1UVQB 5IKCA 5CKAA 3OTTA 4Q0XL 3DYOA 5J1AB 3B2UD 2HKFH 3EBAA 3WN5A 1S5IL 4YC2C 2ED7A 3TJHC 2XKNA 3GFUA 4MGXA 4Y4FD 1LNUB 2ITDB 2WIIA 5FUCC 4OLZL 1CT8A 1I7ZA 4U4BA 4ESKA 4JEGB 4IOIB 4JRXE 3GIZL 2FLRT 2Z31A 1LEIA 4Z7VA 1QFUH 2IPTH 3BD5A 4LPVA 1Q72L 1UB6A 4MZ2A 1MWAH 3ZDYE 4XHQA 1OSZA 1PQZB 5CD3B 1I9RH 4HJGB 3AU1B 5DXWA 3MA9H 1U8MB 3P73A 2RQ8A 4NKDB 4I5BA 3HUJF 5C09E 3V4VL 1A7PH 3X3GH 3DUSB 2IAMC 1AJ7H 4CJ1A 3EO9H 1MCLA 1ADQL 1N6UA 4RZCB 1F90H 2CK2A 4OFVA 3IT8D 4P23C 1L7IL 4HIXH 1G9EA 4BH8B 2JCCB 4Y4FB 4XRCA 1FLTX 3CVIH 2NY0C 1JPSH 4XTRD 3T2PA 2R0KL 1E4XH 3I6GB 4N1CA 4FXGA 2VLKE 1RJLA 1DLFL 5IM7A 4M02A 1A7RL 1I3VA 2J6EA 3UAJC 3L3JB 4R26L 1LP9E 4NGHH 1RZIB 3VFSB 4QRTA 5C0GB 4LBEB 4MAUL 3WIFA 1CGSH 3TWCH 4V2CB 9CGTA 3OKMA 1OAXL 5DS8B 1IILE 1HDMA 3FQTA 1RIVH 3GSVB 3H9SA 5CJ8A 4D9RE 3EOTL 1FNLA 2FWOA 3SDXB 5E5MB 1YPZF 3D18A 5IFAH 4GMSH 1KJMB 5BMFH 4JM4L 5B22A 4LSRH 4X4XB 2ZOLA 3PABB 3NIFF 2KUTA 2XACC 2CLVA 4AENB 3SHSA 1CL7H 5FHAH 3BFOA 1QSVA 1B2WH 3AXLB 3RL1B 1PLGH 2WK2A 3QH3A 3V0WL 4J8RA 5FKPB 5L0QC 4X4ME 1F42A 4M9OA 4TN9A 4OV5A 2OTPA 3CMOL 4LF3B 3GMLA 3HZVB 25C8H 1CZ8L 3GUTA 3QP3A 2BXYA 1DSFH 3UTZA 3X12B 3G5YB 2X4UB 1A0QH 2CMRL 3V79C 4LIQH 5SX5K 3FMGH 1HHHB 2VLJA 1CTOA 3G5XA 4YNYA 4ZYKB 1U8KA 3VI3F 5CAYB 3UPAA 3S5LG 2BNRE 4R7DB 1FJ1B 1AQDA 4L3EE 4K23L 1OAUH 3RZCD 1JGVL 4YDLC 4G6AC 5TJWK 4G7VL 1J1PH 1JV5B 1WSST 2YRZA 4J12A 3BH9A 4OF6A 4U1LA 5D96C 5KTEH 3CFCL 4HKZA 3RI5K 4JRWA 2YBRB 4LFHG 3QIBC 4KKCD 3P77B 4MA1B 3V5HB 2ADJB 4I0PC 4BH7B 3ME0A 3GBNL 2JELL 1C8PA 4JFFE 5EC1B 2NW3A 3KJ4B 5GS1A 3FRPG 4XP6L 2CDGB 5JW3L 3CUPA 1TVDA 1P1ZA 2VITB 5I8EA 3DIFA 4XMLL 3BGAA 4NT6A 3VDBA 1OQOA 2I24N 1T83A 4KTDH 1QSEA 3E8UL 3P4MA 4F7TB 5D1QD 2NY7H 5HVFB 2FX8L 2APTA 1IKFH 4NQCE 2F58H 2FX7L 1A9BA 3EIFA 3OV6A 3P9LB 2A6JA 2ICES 1NAMH 3DUUB 3DJ9A 2EKSA 3N1QC 3B9VA 2WINB 2MQCA 4Q97A 3LZFH 3PQYA 5K33A 4LPTA 1FL5B 4LCYB 2R69H 3LN4B 3OB0H 4KZDH 4NJAH 3LKOA 1IKNC 1GXEA 5GQBA 1NUDA 5DJDA 1RPQA 3EFFB 3TH4T 4L8CB 3WKNA 4QY8A 1FYTA 2VDRL 1CXLA 3MQIA 2CLZB 1FPTH 2LV4A 2V2XB 4KKNA 5IW6A 4NWUL 1QR1B 1S3KL 5GRVK 1AH1A 3CX2A 4PRID 1WZLA 2BDNH 3OJ2C 1V3JA 4JO1L 2VQTA 5D7KD 2DJ4A 5C08A 5C3TA 1BOGA 4L4JA 1T22A 4KMLB 2PYEE 2VDMH 3RVVD 1NSNH 2EIDA 5D70L 2V7HB 3MREA 4N8CH 1KFAH 1CE6A 4PRPB 3RBGA 5E70A 1IAII 2BHUA 3ZKND 3WKMH 2CIKB 5L2KB 4XNYH 3S37H 4NWTL 1BFOB 3DXAD 2BERA 3U9PL 2I25N 4QO1A 1RZGA 3CSYB 3BDXA 1MAMH 5T1MA 1EH9A 2X7LA 5SX4H 3VRLF 2AVGA 5IEKA 1E4JA 1IC5L 3KYMA 3V7MA 3G6JF 4PRIB 4TVPE 2Y7QB 3PWPD 2D9QB 4GAFB 2FD6H 3KWWA 1ZKAA 2GTZB 2EE9A 3GEWB 2BHYA 3LS4L 3T0EC 1EGJH 1UWEL 4WWID 3X13B 4OZIB 4OZ4A 1MCIA 1UM5H 3F7VB 4Y0GA 2NNAA 4G9FE 2Z4QA 1QFWI 1HIMH 1QO3B 1XF2A 4U6VH 3NFNA 3D69A 1RZJL 3TBSA