1NFDA

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
203
structure length
203
Chain Sequence
DSVTQTEGLVTVTEGLPVKLNCTYQTTYLTIAFFWYVQYLNEAPQVLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALSEGGNYKYVFGAGTRLKVIAHIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
total genus 29
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA01
3MREB 4RIRA 3MXVH 4PJCB 5D7JB 1MRCL 1RIVH 3WS6A 4P2RD 2RHEA 4NFBA 2VISA 1L9MA 4FQ2L 2I5YL 4K3JL 5C09E 4NSKB 3IGAB 5I1GH 2EYRB 5SX4I 1F6FB 4L4VE 1M7DB 4JKLA 2NY3B 4XB7A 3BAEL 3FN0H 2DYPB 4QHUA 1RURH 1N7ML 2EXWC 5FO8B 5IVZB 1B90A 4GAJH 3QFJD 2R2BB 4QYOB 4CVWA 4F80A 4OV6F 2RCSL 3JVGC 3QH3B 3P30H 4DN3H 1LEGB 3WE6B 3SGJC 2F53D 2MJWA 4TVPH 3EO0A 4NPYB 2V5YA 3HG1A 5D7KE 3NA4A 4Y5VB 2D4DA 3CX2A 1H3PH 1CE6B 5F96L 4EXKA 4G8GB 2FBOJ 4XPFH 4YBLB 1P84J 4ZFZB 4I2XE 1S7TB 2VIRA 4PJ8D 4D8PB 4JHAH 3U0WL 3JZ7A 1OP5H 3SJVE 2F58H 3BHBB 3SE4A 1AJ7H 3D39D 5IW3A 4P5MB 2KZ1B 2OS7A 5FM8A 1ZHLB 1HHGB 3BDBA 1W2KT 4RGOH 1MIEL 5F7DA 2R2EB 3O4LE 4L29B 5L0QB 3TJHC 4XPBL 5J11B 1TZGL 1UZ6E 2E9WA 1U42A 5BRZB 5HHMB 3D0LB 5L2JB 4P2QA 3IFPB 4GS7C 1KEGL 1OAYL 4OQ1A 4P9HC 3V9FA 3UPRA 3GKZA 4OZ4A 1JNNH 1XGYH 4PRPA 5JOFB 2DQHH 4LEOA 3C5ZC 4JRXB 1F8TH 4X6DE 3SKMA 1EHAA 5DHXB 4QHKI 4MCZB 4UDUB 3RNQA 3W82A 2C9AA 2FECL 3NPSB 3QUYC 2XNAB 2BFVH 5T5FL 2VXTL 4LFHD 1GOGA 5DJZA 1J0YA 3FRPG 4OD3L 1K8DB 2A1WH 4FQLH 2ESVE 4YBHA 4ZPTB 3KPSB 4GW1B 4Z8FH 4XBGB 3GBLA 2EC9T 5HTSA 5I71C 4P5KB 5KVGL 3DMMA 1KTRL 1AD9A 4KXZH 1P9MA 3KPRD 3BESR 4DVBB 2OM5A 1RI8A 4U0RB 4TTGA 1A1OB 5KVDH 3D25A 4ZNEE 5C07E 3G5YA 1I3RB 4M7KH 3CFKB 3SO3B 4NNXB 2F19L 3GSXB 5D2LB 1FRGL 1UXWB 2V7HA 3UAJD 3VD7A 5FO7B 1JV5B 1RZKL 3V4VL 5FHBH 1HKLH 3AUVA 1YECL 4LMQI 5F7KC 3EZ8A 4YIQB 3JSSA 4PG2C 2W0KA 1FPTH 5E7BA 1TZIB 1VFAA 1XFPA 4M6NL 43CAB 2VDRL 4LEXL 3OKNA 5EUKB 5T1LD 3TZVC 3RWGB 3BZFA 4FS0A 3QNXA 5KSBB 1SM3L 3O45B 4TNWK 3BQUD 4Z5RA 1EXUB 1L0QA 1P7KB 5FXCH 5DUPH 4Y16B 5DSCB 5C6PB 3R06B 5MI0C 2HTLD 3JV6A 3TBVB 5CGMA 5EB9A 5DMYA 2DMCA 5DS8B 4CGTA 3ARBB 3GSOA 2BVOA 4LSDA 4M61A 1RZJL 1DQLH 1BVLA 3PL6B 3BDXA 3MRQA 2QKIB 2BRRL 4J1UB 5D5MA 5IB2B 3AREC 3DURA 2R0KH 3W9DA 4WEBL 3L3HA 3FT2A 1OB1A 4M7LH 1TITA 1C5CH 2ZZUT 3IDYB 5TE7H 1XCQA 3INUL 4U1HA 1FN4B 1RZIB 3NN8B 2EH8L 4Q0XL 5C0CE 3MLRL 4P59L 4UQ3A 4D0DB 2J8HA 4ZG1A 3CLEL 3OGCB 4Q2ZA 5ADOH 1XR9A 4U05A 1QBLH 5CJQH 3TCLB 1WAAF 1AGFA 2VLJD 3VFTB 4U6HA 4YXLH 5C0RL 5I2IA 1BFSA 1FNHA 3CFCH 1QR1B 4NP4L 4KRPC 3RZCB 1HOCB 4O58L 5FIEA 5ELIA 4NT6B 4O5LH 1YPZA 2ENYA 4BZYA 4NQSB 5MEPB 5SWZB 4F33B 3VGEA 4WUKL 1DN0B 4NUGH 1OAXH 4CJ0A 3UJTL 2FSEB 3LZFL 5I1KL 5C0IA 1WZ1H 5JOPE 2AK4B 2FIKA 1OGTB 1MPAL 4YDIL 4OIIH 1RZFL 2OLDA 2KBGA 3MUY1 2X7LA 1AQKH 4UBDD 2YHGA 4U3XA 1IEBB 3FOLA 5B3JE 2ZKHL 4UIKH 4GAFB 3PNWB 3AS3A 1IGJB 3NIGF 2HG5B 3HE7B 4MHHI 4GUPA 4OLUL 3HUJA 4G6FB 3MA7A 4CKVX 2OMBA 4K7FA 3BWAA 4TUKH 1KPUB 5T3ZD 5I1JH 3IF1A 4M7JH 3U30B 1LK2B 3L7FB 5HD8C 5FCUH 1U58B 1CICB 4QRPE 4KGJA 1DDHA 1R24B 5F7WC 3WNOA 2Z8WC 1T04A 2D7OA 15C8L 1CL7L 2Z93B 1FBIH 2X05A 5EOQL 5FGCE 3UBXI 1N59B 4G7YH 2CKNA 4XRCB 3GSUA 3DX7B 4HQQH 1DFBL 2VZVA 1J10A 4POZD 4ZO8A 4MJ2A 4W68A 1JMZA 5EU5A 1EAPB 2BX5A 2HWZH 4K71B 4OFVA 2AI0H 2OXHA 5HY9A 2VSCA 1YDPB 1SY6L 2HFTA 5GHWH 4JKKA 2GW5A 3VXTB 4FABL 2XI9A 1RUQL 2CDFB 1RD6A 4ORGB 4BQ6A 4D3CL 2J6EA 4KC3B 4P2RB 5CZXD 1RZKC 5JXEC 3SGDH 1FL3A 1A3LH 4YDVB 2YN3A 1IQWL 3BT2L 1BJ8A 2CD0A 4O9HH 2CIKB 4J3OC 4ZUTA 3VXUA 1MWAA 2OL3A 2PYEA 4OLXH 4QCIB 2VR4A 3OKOA 1BIIA 4F2MA 1KGCE 4HKXB 2DQUL 2PTVA 3VI3F 1VKXB 1NCNA 5E2WL 1AFVH 4NQXA 2AV7B 2Q8AH 3CVIL 2ICWI 5LAXB 5ERWA 4NQDA 2GTZA 2HKHH 5D7IE 1JF5A 4E9LA 5J1SC 4U2YA 2O5ZH 2CH8A 3V7AG 8FABB 1Y6MR 3CDYA 4UTBL 5FUOH 3LS5H 2ZG1A 1CLZL 4CMHC 3GJFH 1MCRA 2GSGB 2X1XR 4Y5YB 1KG0B 3DHJA 4ZFOL 4CW1B 4S1RH 1ZWIB 4F7EA 5BZWA 5IBUG 3IXAB 4NZTH 3D39B 2HJKA 2GFBA 4HPOH 3LKQA 5AUMA 1A7OL 4XVUD 2J7LA 3QUMH 2VDQH 4MD0B 4CU8A 4QHLA 1RU9H 2DQGL 2FX7L 3QDMD 4M93B 2EICA 4KPHL 4J3TA 1BZ9A 1HWGB 2VH5H 1FNAA 1I1AB 3HZVA 1T03L 2DTMH 3THML 1KPVA 3CLFH 1S7VA 4BSWA 5L7XH 3NFNA 3ARFC 1LGVA 2GJ6E 2E7LC 1EEZA 4OF7A 3QJHA 5L2KD 1JGUL 3CSBA 1MJ7H 2FX8H 1T5WA 4JDTL 4PJFF 4Y7MA 4N0CD 3ZDXE 1T7VA 5CWSB 2LV4A 2PO6A 1JPGA 3O6KL 3W39B 2BC4B 1X5YA 4PY8I 4DGIL 4OGYH 4N5UA 1LP9A 5IW6A 3SCMC 4NYLA 1IC7H 2H1PH 4U6XA 2AXHA 5DUBB 4GT7A 2P5WA 4GG6F 1QRNA 3PHQA 1QRKA 3ZTJH 4BJLA 3IKCB 1A6AA 4HJJH 3VMNA 1C12A 2Z8RA 1XF2B 4BUHA 4RAUA 1RUMH 3O3AB 3KPRB 1WT5C 4OM0L 3VG9C 3LKOB 2P45B 2NY1B 4GG8B 4LKXA 3S97C 4OKVB 5GSRB 5MERA 3BPLC 3AMLA 1H15B 1PX4A 2F5BH 1KENL 4UAOB 5HGBB 4HBCL 1PYWB 1IKFL 4M02A 1NCCL 1XGQB 3NCCB 1CDJA 1QSFD 3C9NA 2BJMH 2DLFH 3FL7A 2IANA 4X83A 1N6QH 2ZUWA 1J8KA 2AGJL 5GGVL 4ZFGH 1UJ3B 2XIDA 1I85C 1BPVA 4LRNH 1X7QB 1UB5B 4PJ5A 4MAYD 2G2RB 4K8RL 2M2DA 3SKJH 4ZYKA 2WWMC 6FABL 5DQJB 1H3TA 1MIMH 5D71L 3P2TA 5T1MA 1CTOA 3VXPB 1EX0A 4PS4L 3HR6A 1PG7W 3OJ2C 4MQTB 3NGBC 1RJYB 2Y36H 4WWKB 1I7UB 1U8QA 3MJ6A 1S7WA 1QQDB 4RRPA 3NVQA 1DLHA 4YEEA 1MFBH 1NLBH 4JN1H 4X0KA 1MI5B 3PWPE 1J1PH 1EFXA 4X7SL 1FSKB 3I3BA 1N6UA 5DUMH 2UZIL 4KK9C 4X9IA 1BZ7A 4MA8H 3SO5A 4R97B 4HWUA 1DQQA 2BVEA 2OJZH 4V1DE 4OFKA 3HNVL 3O4OC 4XPAL 2OQJA 2CDGA 4RGNC 2VLJB 2D7NA 2R0WH 2Y06H 3E3QC 5FO8A 1TVBB 4ODVH 4HUNB 3ULVH 4GKSB 3GBNL 3GSRA 4JHZA 4D9LH 4OUUA 5JUEH 5IM7A 1CF8H 3LH2H 5GS1B 4DEPB 1TQCC 2V2WB 1X4XA 1I8LC 3QH3A 3JWDH 4R7NB 1OGAD 2AJXH 4UIMB 2YRZA 5GGQL 1FFQA 5F7YC 5DRWB 2ADJB 4G8GA 4TUJA 1OM3H 5JMOC 4YX2L 1OPGL 1S9YA 1A4KA 3QEGL 3QG7L 1Q94A 1JNJA 5C0AA 2HT3C 5MEND 5I8KH 1KN4H 4CN1A 1JK8B 5GPRA 3FOMB 4B5EA 3TVMC 2W9DH 3QXAA 1KSRA 4P5MA 3GMMA 4PRBB 5HI5D 1KB5H 3DYPA 2R0ZH 1J5OH 1NDMA 4L1DA 1CGSH 3T2NH 4U1SB 5MEQA 1EK3A 3P11L 4OZGE 4S1QL 3TO4D 4D0BA 4PJIB 5GISH 3G6JB 5C09D 3GI9H 5F70A 1G7QA 4HWEH 4L4VD 1TTFA 4QLRA 3B5GA 5T1DH 1WJ3A 5F9OL 5B38A 2C3VA 1Q72H 3D18B 3UBXB 1MJJB 1Y18B 3RJDA 5JOFA 2R2HB 3KVQA 1HILB 3RHWF 1YQVH 5JTWA 1AR1D 5DEGA 1Z3GL 4KZDL 3QR2A 2ATKB 4L4JA 3QNYA 3QIUD 1Z0MA 5F8QC 3WS3A 1K4CA 3T0XA 5KZCD 2I9LA 4X4XB 3BXNB 5EUOA 1FO0B 3L3DB 1EJOH 4JFDE 1C16B 3SGDI 5KANI 3MUGA 4MNGB 4HWNA 3NABL 5BO1H 2FD6H 5D7KD 3DGGA 1YN6A 1YUHA 4PR5B 4XPHH 1LO2H 2CIIA 2BOBA 3FO2B 2DS4A 4NKDA 3IS1X 2XWJA 1UXSB 4RQQA 3SDXB 5EOCJ 2O5XL 2PW2B 1EMTL 1BJ1J 4PRDB 1AGEA 3SJVD 1FIGH 1FG2B 3F12B 5IT2L 2W07A 2NMSA 3DVGB 5TF1L 3RWCA 3GSXA 3DETD 4H1LG 3LN4B 4XP9H 1UXWA 3MUJA 3O4LD 3D85D 5F7NC 5J6GB 4MXVE 4YPJA 2NY5C 3RY4A 1ROWA 3QJFA 4LSQL 1DEEA 1JWUB 4BZ2L 2NTSP 1AO7E 2EE3A 1E4KC 1JUFB 1WBYA 3QIBC 2JB6B 43CAA 4P4KC 4O51A 5DZNA 1WEJH 5BCAA 4JREC 2GJJA 3WCYA 1I1CA 3FONB 3FB7B 3VFUB 4OZIB 1VEPA 3VXOA 2XG5A 4FXKA 2FWOA 4MJ5B 4U33A 1F4XL 1AKJA 4PJEF 5E99L 1RVFH 4JM4H 5EO1A 5JHDB 2XPGA 1JNHA 3TNNB 2QSTA 3C2SA 3IDXL 4I0KA 3LQAC 5CUSL 3RI5K 1IKNA 4PLOB 4YE4L 2E3VA 1FZMB 2BSED 3ARBA 1WZMA 2IPTL 1P69B 1KFAL 2APFA 3HI1B 1AXIB 5I18H 4HKZB 5C0DA 4J1UA 2ESVD 4U3HA 4M3JA 5SX5K 3OR6A 3GSNL 1X5ZA 3PABB 1CGWA 1G1YA 1UM5L 4OTXH 1SHMA 1FLTX 3GMLB 5IB3A 4LHJB 3VFVB 5C07D 4M1DH 4KU1A 1QLRA 2Z31D 3SDCC 2CKBL 3DX8A 4HULB 3KAAA 5LWYH 3QUXD 2VLLB 3CK0H 5C08E 3MRMA 3CDCA 5FO9B 1JF1B 5DI8B 5L2KB 2J88H 4PJCF 3MGTB 5FOBA 5DYOA 4LGRB 2V5TA 1YYLL 4NT6A 5FDYA 3MODH 1L7IH 4GKNA 4S10A 5A2LH 2EDKA 1CD1B 3KPOA 2CLRA 4MDIB 3C8KA 4A6YB 3RPIB 3E8UL 4UOJA 4MCYB 4P46D 4O2CB 2ZUUA 4R96B 1I8MA 2FL5B 4PJBE 2E6PA 1GPOL 4X80L 5I1IL 1AE6L 2EXYD 3B3IA 4TQEH 3ZZ1A 3RWDB 1EH9A 1X5AA 1JGLH 3VFNA 4G6MH 5EDXA 5HYJE 3QA3B 2QR0A 5CBEA 1IAIL 2PXYC 2VN4A 1JHLH 3DUUB 1U58A 1CICA 3OJDB 4JQVA 4UT7L 5C0CD 3DXAE 3UTPE 1R24A 2B7DT 2WMPA 2JTDA 2NTFA 3AM8A 3UJJH 2QHRL 3DO3A 1HHIB 4I9WE 2APVA 3BJ91 4PV8B 4QTHB 1T1WA 2A38A 4ZXBC 1CDUA 1SVZA 5IMOA 4Y5XB 4NQCA 2NR6C 5IESH 3MRKB 1J88A 3WN5B 5GRJH 3A67L 4AEEA 1NFDB 4HKBB 2XZCL 3UDWC 5IFJB 5TQ2H 4R6UA 3HCVB 3AXLB 4JZNB 4WW1B 1KCVL 1N5AB 3EKCA 2MCPL 5JOPD 4PJ7E 2P7TA 5L8KB 4JY5L 4KJPC 4QHKJ 4L4TB 3U7WH 2EC8A 1BM3L 5CJXC 1G9NC 1U8NB 3UC0H 1D9KC 4HAGA 2YN5A 3NA9L 3VWKB 1YY9C 3QEUA 3MV9A 4H8WL 1IGCH 3LD8B 4OB5L 4R7DB 3SBWA 2EIDA 3J7HA 1NGQL 5ALCH 2O93L 1JE6A 1T20A 5B3NA 3S36L 3ZDYF 2SEBA 3QFJA 3L3GB 4F9LC 3KPQA 4BH7B 4QRPD 5J7CC 3D9AL 1D3CA 2ITCB 4Z7VA 3VW3L 1IC5H 1Y0LB 2HRPH 3BH9A 4Q9QH 3MO1A 1CVRA 4O2EB 4M8VA 2WM0A 1M05B 2F53A 4WV1C 3PF2A 3P73A 1T3FB 1MFEH 2ZNWA 4NKOA 4PJAA 4U1KB 5D2LF 1RIHL 2RR3A 2DD8L 3NTCL 1J0ZA 2YS4A 3NCMA 4PJ8A 2F9BT 2XKNB 3TM6A 1S9KC 4Y5YA 2H8PB 1U3HD 2Y07L 3N1PC 4F58H 1JFQH 2C1OA 3D39A 4P9MH 5DO2C 1YY8A 3IU3B 4OJFL 3L6FA 3DRTA 4PJXB 1WIOA 3TH3T 1SJVA 5KSBF 2Q8BL 2WP3T 4KJQD 4PBWD 4FG6C 5IFHH 1ZLSL 4DVRH 2IQ9L 3ULVC 3HMWL 2XA8L 3V4PH 1KEML 4AM0A 32C2B 5DEZA 2NLJB 1IAIM 2XRAL 2WINA 5C09B 2IBBA 3KJ6L 1EBAA 1W72H 4KKAC 4Y2DD 4L4VB 2YMXL 4X99A 2FHFA 4ETQB 5FYKU 3QIWA 2H9GB 3RWFB 3P0GB 2DL9A 1YEHL 1KGCD 1D5IH 5E5MA 3UPAA 3GBML 5DLML 4APQD 1A6ZA 3EOTL 3ARGB 4HSQA 4PUBL 3QIUB 1N5YL 2AQ1A 3H0TB 4BKLB 4WUUE 2DJSA 2BC4A 4JPIA 2P8PB 1A9EB 2ARWA 4R26H 1DQJA 4WJ5B 2DTSA 3ZTNL 2V17L 4MS8C 5GRVL 3LKNB 4KQ4L 5DHVB 4RWYL 1EVTC 3CSPA 4YHLL 1SEQH 5GS2H 4WI6A 3SKOB 1G6RB 4LLDA 4PTTA 1OWRM 4OCYH 4PJ9C 5DT1H 3MCG1 3O3AA 2EDTA 3KPRA 4GW4A 3HFML 3UPCA 4P23D 3QQ3A 3CMOL 4IRZH 1JIBA 3SJVB 3K74B 3JWOH 2W9EH 1TJIL 1B0RA 3ZKXB 4BQCA 2ED7A 2I5YH 1ZE3C 1Z9MA 5FGRA 5HHNA 4N8CL 1G7PB 2OR9L 3QUKB 2EYTA 1MQKL 3ILQD 4N0FA 5A2JH 4DCQB 1PDKA 1OL0A 2FO1A 1OVZA 2VDOL 3P9WB 4HK0A 2V9TA 5T1LA 2VE6B 5IB4B 1TJGH 2VXUH 1GC1L 1UJ3A 4ODHH 3HMXA 4JFOB 3BQUA 2A6IB 1CQKA 4MA3B 1GGYA 2A9NH 4OZHF 1BX2A 2GJ6D 4HFUL 3BVNA 4JAMB 5E4EC 3DTXB 2DQFA 4NZRH 1A5FL 5CILL 3BPOB 2WIMA 4FFWC 3WS6C 2X4UA 2IBZY 4WIQA 4XPTL 5F21B 4XWGH 2A83A 2X4SA 2BVQB 4HS3B 4GO6B 3T0EA 1RJYA 2YRPA 1I7UA 1W0VB 2E7CA 1S7RB 2ESVB 2IMNA 2X4QB 5E0QA 1AC0A 1VACB 4RGNE 1TIUA 2IPKA 5IEKA 3GI8L 3BZ4B 1HHKB 4KK5D 4G6KH 5D1XB 1F3DJ 3E3QE 1FYTE 3O9WB 5C92A 4ODWA 2IG2L 3KWWA 2VLRB 1FZOA 1FFNB 1CLOL 1X5JA 1OP9A 4G7VH 3U7AA 4IMLA 4TPRH 4BM7A 4Y4HC 5DD6A 2ZOKB 4EDWL 3QUXB 1U8IA 4IRSC 5IVXA 1OAYH 4XBEL 4PD4J 1MELA 1I3GL 4YFLI 4RBPK 1PVHA 4KRLB 3VGFA 3DUSB 4LBEB 1F90H 4NN6B 5B8CB 1KNOA 1FLRL 4LCYB 4XCYB 1MHPH 2HT4D 1WWBX 1P7QA 2D7TH 4LSUL 2XN9B 5T5FH 4JJ5A 1MCPL 1JZ8A 4JPVH 2NY6D 4PLJD 3PWLA 1OAQL 2HH0H 2YKLL 5CJOH 4HWBH 3GSWA 5T3XE 5EC1A 3UTZA 4P46B 3BKML 1WFOA 1KJ2H 1T1ZB 3FOMA 3U2SA 4QXUH 4U6TA 3X12B 4CVZA 3TESA 2BNUB 4NO5B 2A77H 1Q9KA 1KCUH 4BSJA 3IDGB 1CIDA 4OT1H 3PWPD 4N8VB 3WFBL 1YEIH 2EDYA 1QR4A 2EXWD 1QBML 4WFEE 3GM8A 5IOPB 4JZJB 2OP4L 3BRFA 4UNTA 3GMRB 5C0CB 2CLZB 3V5KA 3D69A 4MMZC 4G9FB 4XP1L 2LVEA 5ESAB 4YXHH 4V1DD 4OI8A 2G75A 1XH3B 2KDGA 2Q6WB 4CU6A 4LCCC 2OJEB 3SQBA 2CGRL 4M6NH 5BMFL 5I1EH 2BZDA 4KVNH 1WBZB 4GMSH 1JWMB 1SM3H 5DQDL 3BXNA 5TF0A 5ACLA 1RK0B 4UINH 3DX9A 4MNGA 4JDVA 5DRZA 5DJ8B 5D72H 4ORZC 2PW1A 3GJEB 2X5PA 2A73A 3QG6A 4PJHF 5IROA 3ET9F 3GO1L 3RX5A 4PBVC 3TJHD 2IH1A 2J6EL 3BKYL 5FYLH 4WEBH 3RTQC 1KIPA 3HC4H 1EVUA 3MUHL 3VG0L 4JO3L 3GKWH 5D7SL 1MWAL 2OL3L 5A16B 7FABL 5KG9A 3MROB 2EH8H 4Q0XH 3NZHH 5TPWL 5FB8B 1UCTA 3IJYA 3C5ZD 1H3WM 4R0LB 3OKDB 2BMKB 5GS0C 2UVFA 4ZTPL 1FDLH 1DQML 5EOTB 2WBJC 1FV1A 3H9HB 2H32A 3QUYD 3MNWA 4NM8H 4QNPE 4D0CB 4K23L 1LO0H 3K1DA 2VKWA 5FGCB 5BQ7A 4BFEA 3S8WA 3FB6B 3OSKA 5IR1B 5DJYB 1TJHH 1XGUA 3TH4T 4XC3L 5T33L 4IOIB 1NMBL 1U3HB 3QPXL 1QBAA 3CFBA 4JFDD 3RKPA 4NBZB 2UUDH 1IEAB 3L5JA 4DKFH 5J13C 2KKQA 3HR5A 1CFSA 1YMME 3NIDF 1JNLL 1A7NH 2YPKB 1WZLA 3WFCH 3AAZB 2GI7A 4HDIB 4TULH 4Z0BL 3TO2A 3V0VB 2VZTA 5GGVY 3IB4A 5HDLA 1A0QL 3AU1A 3S6CA 1IM3B 3QDMA 1C5BL 2Q76B 4Z7WB 5D9SA 4Y2DB 3WSQL 3WLWC 3ULUC 3TZVD 2XFXB 1ND0B 4GXUN 4MA1C 1AD0A 5C9KA 5C0EA 3N1FC 4YHMH 4OKDA 3UTSB 4H1LH 3TN0C 4PGCA 4APQB 4ERSH 2YA2A 1CL7H 4RMTA 3IFNH 5DI8A 1JHKH 3V5DA 5L2KA 1J0IA 5CIPB 2P44B 2MOVA 1AO7D 4GKZB 3G04A 4HG4J 5ADPL 4EBQH 3CDGB 2VMFA 4L8DA 2P24A 1B0GB 2ADFH 2ZOLB 4IIQA 2DAVA 1N6VA 4JGUA 3ARED 4WNQB 3EBAA 5CINH 3FFCE 1FGVH 4LCWB 4CN4A 1D5MA 1G7IB 1KJVB 4JVUA 3HB3C 5EU3B 4ELKA 4NQVB 2O5YH 5D8JL 1ZLVK 1X9QA 3LEVL 4O2CA 5ESVA 2VL5B 4FABH 3WL9B 4QRRA 2FL5A 4WI7A 3FZUC 3UZEA 4FQPA 2D7MA 1BBJA 4D3CH 4WI9A 2FIRT 1TQBB 2R56L 4MA7L 5D1QC 4NRXB 3BT2H 3Q6FB 4HV8A 1T1YA 3I85A 3TPUB 1KN2L 3VFRB 1QSFA 2CRYA 2BY0A 3REVB 3GHEL 3VH8A 4M6OH 4PRIB 1RJLB 1ZTXL 1T2JA 2EDXA 1TVDA 3DROA 4YAQB 4KRPD 2DQUH 4NKQB 2A2QT 1E27A 4MAUH 4QGYA 3RVVC 1WFTA 4X5XB 1FNSL 4PREB 4MXWL 1YJDL 3GIZH 5IHZB 4YHZH 3PGCA 3MRRB 2FB4L 4WTXA 4MAYA 1VADB 5C08D 1A6PA 5I9QB 3VE0A 3SDAC 5D2NA 5E1AA 3BW9A 1F4HA 4YK4C 4JM2A 3IJHA 4PJIF 4OCWL 2VO5A 3G6JF 3P4MA 1CDHA 3W11C 1CG9B 1CLZH 3SKUD 5D7LE 3O6FC 1YEFH 3A6CH 1IC4H 4YHKL 1M6OB 1QFUH 4AIZB 3KR3H 1U8PB 4Z7OE 5B39A 4KKNA 2HFGH 1MY7A 2BHZA 3UX9B 4PJGE 3WD5H 2X9YA 2A6KB 4LDEB 4I48A 1JRHH 4XVTH 3QRGL 1OD7A 5HD8D 3L95B 5DMKA 1HXYB 1ACYH 1I1FB 3GIVA 3KXFE 3DV6A 4R7DA 5IJVB 2FECI 5BV7B 4J2XA 3NPZB 4ODTL 2BNQB 5CMAB 1NMCB 4J6RL 5TGBA 1F11B 1RZGB 2B1AL 3I3DA 4WFFE 5HYJD 2FEDC 5E8EA 4N0UE 2B4CH 5ICXB 1UQSA 5F3BA 5GRXG 3GFUA 3AY4A 3SDXF 1BQHB 3DXAD 3UTPD 1FVCA 4RA0C 3B6SA 1MEXL 1U8KA 3SE8H 1OGAA 4I9WD 3DI2B 1QKZH 5DD1L 3EDJA 3H9ZA 4JGJA 5JO5A 1NANH 3H42L 3PWVB 4BELD 1AXSB 2WUBL 3ULVE 1KCLA 1DBML 3S34L 3O8XA 5HSFA 3WJLC 3BP4A 2BXZA 2WUCL 5MENA 2H8PA 5JXED 2E5EA 1D6VH 4PGEA 1QLEL 3LKSB 5FHAH 3LSOA 2R4RH 4DTGH 5GRZA 3IU3A 3GM0A 4PJXA 5DA0B 2R0LL 2EIZB 3D2UD 4D94A 3GMNB 4OM0H 3QT2A 3MBEC 4OZIF 2OTWA 1SQ2N 3RWHA 4XNXL 1I9JH 5IHBA 1UZ8B 3FN3A 3DVFA 4N1HB 3TO4A 3T09A 1FL6B 1KENH 4L9LC 5CHNA 2UWEE 1OTSC 1IAMA 2XQBL 4MDJA 4Y4KC 1DP0A 5J1AA 1DBBH 4MB4A 4RMVA 2NY2B 1WWCA 4V1DB 1BBDL 1Z0NA 3RWJB 4HJGB 4NKMA 1MJ8L 2DQJH 1NJ9B 4L8SB 4JHWL 2JCCE 1H3VA 3QIUA 3MLTA 4P3CH 2NW3B 1M1SA 4M5YL 3H0TA 4K8RH 4AH2B 1XF5B 5EBMB 6FABH 1F3JB 4LLUB 1CT8B 1IARB 4PJDB 3MV8E 1RJZA 2HJFB 5D71H 5E6IC 3WYRA 4MB5A 2D9QB 5ACZB 1N8ZA 1QUNA 1RPQA 5HYQB 5ILTH 4HUXB 4I2XA 3SKOA 5HI3C 3GEWB 1LD9A 2RB8A 2Z91A 3HTLX 2ICEB 5I16B 5SX5H 4GSDL 4WW2F 1IGMH 5T5NF 4GS7B 1B2WH 4JKMA 2X1QA 1RHHA 1KBGL 4CMMB 4M5ZL 1INEL 2C1PB 1A7PH 3CFJA 3GZKA 5AAWA 3O4LA 3D85A 1YJDC 3C5ZB 5GGUB 4YGVA 4XPAH 5A2FA 4DCQA 3EHBC 4Z77A 3ZT7A 3QUYB 4FZ8H 2VE6A 5IB4A 1N0XL 1EA9C 3SCMD 2JJTA 1FAKT 4NQUA 1P53A 5LXGL 1UWXK 1NSNL 1U92A 4JAMA 1T4KA 4X6DA 2JELL 2W65A 3DYOA 4WHDA 4A2LA 5ETUB 4OD2A 4G8IA 2XKUA 4HIEB 4WUUD 3QCTH 4L5FH 1KXVC 2ADIA 1HQ4A 2I9TA 1U95A 1HYSC 1TPXC 4PP2A 3NCBB 3QG7H 1A1MA 3LRSA 4YO0B 5DQ9B 1MFDH 3VXQA 3CXHJ 1YNKL 2X4TA 4YUEL 5J56B 2AK1L 2BSTB 5J57B 3S37X 3F7VB 5KAQF 3CXDH 3HG1E 5EO0A 1CL7I 3CX5J 3FQNB 3TIEA 3ARDC 2MNUA 4TUOA 1A6UL 2DBJA 4GRLB 4CDHA 3IFLH 5A43C 1OLLA 5HHOA 4ZNEA 3P11H 4RGMC 5TDNB 5C07A 3S37L 1FFNA 1NFDF 4KUCF 4CVXA 5E94A 2Z31A 5E2VH 1VDGA 4LU5L 4XP5L 4G42A 2E7BA 3X3GH 4JG0L 4EI5C 4HGWB 3FMGL 1CE1L 3QEQA 2WWMD 3DHMA 3SQOH 4EUPA 1FNLA 3ZHDA 3EOBB 3UMTA 4NO2B 5MI0B 1FH5L 2DM2A 3KDMA 2ATPB 5K59E 4NCDA 1A1NA 3P4NB 5IBUB 3AFLA 5E03A 3FB8B 2COQA 5FGSA 1FNGA 3C5SA 3FAWA 3B2VH 1P4LB 2R29H 2YK1L 1PKQB 3AREB 2BVPA 1KPRB 4P5TA 3IAPA 5JW4M 2H2PC 5SV4A 4JPKL 4XGZB 1RZ8A 4K3GA 1CLYL 4PRPE 4P57A 2FGWH 2HFFA 5CJBA 2QSCH 5DVOA 5I1HL 1OAUH 1OSPL 4O02L 1ZS8A 5TJWK 3U7YL 3ULSB 4KK9D 2AJZB 35C8L 4JO1H 1LO4L 1IGFH 4QXTB 3MRBA 3ZT6A 2YD9A 2PCPB 3IDGA 3MRPA 4PJEA 4RGND 1V3MA 5AYUL 1CI5A 4P2OA 5KSAB 1T21A 5TF1H 1FYTD 3L5IA 3GRWH 5JW5A 5GJSL 4PGBB 3T8XB 1LEKB 4WEMB 4KRPB 4HPYL 2JIXB 5IQ7H 1BOGB 2VQUA 3Q5TA 4Y8AA 3LPWA 4LSQH 1INQB 3LRHA 4C55A 1I1YB 1Q1JH 1ORSB 1R5IB 3K8KA 4OFDA 5EWIH 3V6FA 3QEHB 1ZHNB 2HT3D 4HC1A 4JFEE 1BQLL 5J12C 3I75B 4O4YL 3QI9C 1K8IA 5BJTB 3HPJB 3TVMD 4WGVB 4MD4B 4NZUL 5CUSH 4ONHA 2R1YB 4I18A 4QF1A 4YE4H 3I6KA 3TGXA 2IPTH 5H35A 1YZZA 4QY8B 2W0FB 2NZIA 5T3XD 5C3TA 3D0VB 3FO9A 1CK0H 1OCWL 3RNKA 4LASH 1UM5H 3F6IA 5E00B 1H8SA 1UB6B 5ICYB 3RUGE 3UYRH 2DKUA 2NY0B 4JO2L 1ZA6A 5E8OA 1CD9B 4DGYH 1PG7X 5HYJB 1PX3A 2F8OA 3G5ZA 4WFED 2EH7H 1A02N 3H8NA 2AKRB 2EIBA 4HXBH 3KHOA 4QRPA 5IBTH 1LMKA 3WBDA 3U6RA 4D0CA 1S7SB 5LGHL 4EQ3A 1XR8B 1PG7L 1QVOB 3F8UB 4ZPVA 1DUZB 3T08A 5C7XH 3FB6A 3UYPA 2P47B 4LP4A 4DZ8A 5E2UL 4JZOA 1QBBA 5E6ZA 4KDVA 4LHUD 1OT1A 4IOIA 2YUZA 1U3HA 1U9KA 2WP3O 2HVKB 1F6AA 3A0OA 4RAVB 1R3HA 2FLBT 3NFPA 3ULUE 3D2UB 1UH3A 2AJ3A 3HZMA 5GGTA 1YPZE 3BO8A 2DMKA 4LAJH 1HSBB 2CMRL 4PJ7B 2B4CC 1QSVA 3MV7B 3GUTB 4FHBD 3RY6A 2ZNXA 1S9XB 4TOYH 1IGYA 3QIBD 5BXFB 2PR4H 1NCTA 4P4KD 4NWUH 1LK3L 3NFSH 4BH8A 1MFAL 4RISL 2XFXA 3MLZL 4UT7H 2BVYA 3C8HA 1WTGT 1ZHBB 4CL7A 4U7MA 3HUJE 5CIPA 1JGEB 2ZCHL 3MRLA 2D03H 2XXCB 5CEXB 4CMHB 2P48B 2E27L 1G7HA 4S1SH 1GYAA 5CFHA 1PW3A 4NQEE 5D7IA 3X3FH 4HK3N 1B0GA 5FA4A 5EBLA 3BGFB 5JQ6H 5HVHB 1A14L 4FRWA 3A67H 4XAWL 3TBSA 5ENWA 1KJVA 2Q7NA 2YXMA 3T3PF 1KCVH 4U6YB 4P23A 1CGUA 2C7UB 2MCPH 3VWJA 3PDOA 2V2TB 3P0VH 3OX8B 1YMMD 4JY6A 2X2YA 3ZSSA 3SDCD 1BM3H 5C3LD 3WIFA 4KAQL 5B38G 5L6YL 5DJ2A 1L6ZA 3TPUA 4HS6B 1RIUL 2K7QA 2FO4A 5JXAH 1BLNB 3U9PH 4XX1G 5KS9F 5EBWA 3W2DH 3IFOA 5DJ6B 3Q6GL 3BYYA 1F2QA 4RBPH 3HMXL 1PQZB 2QSVA 2YEZB 5FYKL 1KF9B 5I1CH 1IAOB 5KJRH 3SCMB 3D9AH 3RWEA 1U8LA 2JE8A 3VXUE 1MVUB 2PYEE 4G8FB 2GJ6A 1T6WA 2XTLA 5HJ3A 4X8XA 1HEZA 3PUCA 1P7HL 2FJGB 3MGAA 3ECBA 1CDYA 1ONQA 4Z76A 1P4BL 3FCTA 3RIFF 1I7ZB 1EDQA 3D48R 2DD8H 4G80B 2QADB 1IT9H 3MTRA 3VG9B 1MRFL 1Y6KR 5E8DL 3KJ4C 3BPLB 3GNML 1L9NA 1M6OA 1XIWB 2VDPH 4F7CB 4U1IA 1T22B 1NPUA 1JI2A 3FFCD 5LCVL 2LABA 3IETA 5CS7A 2PXYD 4NO0A 3QDAA 4WI4A 2XA8H 1CFNB 1KEMH 1N3NB 3B5HA 1EEQA 2G5RA 2XRAH 4KY1L 43C9B 4M62L 3M45A 2G5BA 3KYNB 4FFYH 3LN5B 4LF3B 3RY5A 2YMXH 3VGBA 5EORH 1BP3B 3BEVB 3MOAL 4ZXBD 5CSZA 3WXVL 2IH3A 4YJZL 2XICA 1YEHH 3MRGB 4AG4H 1T89C 2NR6D 4F3FA 3EOTH 2BNRE 4Z7NF 2Y72A 1LO3L 5JW3L 3BSZH 4YLQT 1HZHL 2P5EE 4FQQB 5K9KB 1CFTB 3MBXL 4LSPL 4PRNB 3S88L 4JRYB 3MOBH 3WIIL 3ABZA 1SYSA 1NFKA 2FATL 3C60C 2R1WB 1CDCA 4KJPD 4YHLH 4NRZA 2WWKT 5EZOL 4S0TD 5IF0B 5D7LD 1AGDA 3DBXA 1D9KD 4NDMA 4U0QB 1YY9D 4XCNB 1TNNA 1A2YA 4PFEA 1NL0H 1K4DA 3OV6A 5ANMA 3O4OB 4OZHA 3QIWC 3VFGL 4LQFL 4RGNB 1LP9E 2GJZA 3PWPA 5T3ZL 3QZWB 4YQXL 4XXDB 4Z7QE 1SJHB 4N8CH 4A2MA 4HT1L 5I66B 1MQKH 5CCKH 1CU4L 3JVGA 3KXFD 2Y25A 4L3EB 1K6QH 4ZFOB 4ZUWB 5F1OB 4O2FB 4R4BB 1WWWX 3TBWB 1NJ9A 2DQCL 3CCHA 4XNMA 4ONGL 4KZEL 1GC1H 4WFFD 5EZIL 4LSSL 2B8OT 1U41A 1GSMA 5FV1L 1TNMA 3GHBH 5KW9H 3TNMB 3FQTB 3RDTB 3T4YA 1BGXL 2W92A 1N64L 5I8EA 1FFOB 4ENEC 1KCSH 4Z7WF 3RL2B 5DO2D 3VFSB 2LE9A 5BS0E 4FG6D 3PWUB 4HUXA 3ULVD 5LJYH 4ODXB 4OCLC 1IBGL 3H9SE 2IBGA 1U93B 1QFWM 1NLDH 3C6LB 3CAFA 4QHMB 2E8ZA 1UYWL 3VFOA 4X4ZA 2N7AA 2EYSA 1K2DB 4HLZG 5CLTA 1B4JL 3O2WL 4JG1L 2X89D 3C5ZA 2ICES 1EIBA 4OZGA 2MPAL 3BH8B 5J3HC 1YEKH 2IADB 3CVHB 3O3BB 4B41A 3QUYA 5CP7A 1I3GH 1CXKA 1FNEA 3QUZC 4K94H 4POUB 1EO8H 4ODSL 5IMKA 1XF4A 3MJ9H 3OXRB 5E9DD 1L7TL 2NNAB 1JMXA 4YDLB 4MS8D 1U91A 3T0EC 1IC1A 4MNQB 1DL7L 3L3IB 4NJAH 4PJ9D 3KPNB 1TVHB 4JFDA 3UJIH 1GZPB 1A6WL 3MV8D 2VQ1B 1OARL 3FO1B 1IAII 3G5XA 1K85A 3PP3K 3WUWA 3BKMH 2QQLL 2JF1A 4CAGA 3HI5L 2J8OA 1PLGL 5F89A 3U4EA 1RUPH 4Y1AB 4FFZL 4PG2A 4E5XB 2WANA 5C0AE 4P4KB 4OAWA 2OP4H 3TZVA 5TH2A 3VXNB 4ONFL 2YD6A 2VXQH 4Q6IA 4HGWA 4XP1H 3SDDB 2NY4B 3KPPA 4N0YL 3RPKA 2BSSB 5I73C 5ESQA 2FYYB 1AO7A 4EDXA 3MJ8A 3P4OB 4JCLA 4HF5H 4Q58C 4AQOA 1IM9B 1J05B 3EYOB 4YPGA 4JVPA 5I19L 4AEHL 5FUCC 4CNIB 5B4MD 3ARPA 5DRNB 4JE4B 4UUJA 4EI6A 4OFYD 4DFHA 2X4PB 4OGZA 1MCFA 3ARXA 1QSEA 1NGZB 2IGFH 5EUOE 3J8F7 1NUGA 3MZTA 1SJEA 4E0RA 1MAJA 1RK1A 4LLVB 2OZ4A 1DE4A 3BPNC 5CZVL 4S2SA 1JVKA 3HG1D 1XAUA 1KIQA 4JANA 4HS8H 5FM4A 5ITBL 5FOJA 2IQAB 1SBSH 3B9KC 1LEKA 2ZSWA 1UADC 2DOCA 2CR3A 2Y1VA 4ZUVB 2YD4A 1INQA 1DZBA 1DQMH 4LFHG 4LKCB 5BVJA 1NEZB 5C8JA 4X6BB 4U1NA 2DQEH 5C08A 4ZSOE 4I5BA 4KDWA 3BD5A 4JFPB 1GGBH 3TIDA 3WNNA 4UT9L 3S5LB 1MHHA 3FT4A 2PTUA 4LIQL 1NBZB 1ETZB 4M6ML 4G9DA 3OMZA 4MD5B 5BJTA 5CGYC 1TFHA 3HC3H 5T33H 4M1GL 2DI7A 4KROB 3T0WA 3VRLE 3PE9A 3QPXH 3KLHC 3ROOA 3UEZA 4XVSH 4XBPA 4XTRC 1RZ7H 4CBPA 1V7MH 1L4IA 5F7EH 4PRPD 4MWFA 4MQXC 3SE9H 1FGNH 2PXYB 4QOKE 4YNYA 1C08A 2V6HA 4WEUD 3GSVB 1WFNA 4PJBA 4ELMB 3V95A 1NUNB 2I27N 3AROA 1VENA 2DIJA 4RFNC 4PJDF 3I9GL 1JTTA 4QKXB 1JGDB 4HCRA 4JFYB 1C5BH 2VUOA 3MRDB 4XCCL 1MCHA 1YN7B 4FQIL 4ZXBB 4BK4A 3QDHA 3EYVA 5A2IH 2B2XH 4Y88A 4NNPL 2YC1A 1WFUA 3DXAA 5DGRA 1JHTB 3LEXA 5BW7C 4OGAC 3G5VA 4LLWA 4HH9A 3MNZB 1S9VB 5ADPH 3WHE1 2PTTB 2UYLB 4FTVE 1T0PB 1S8DA 4QTIL 1KTLA 3MLVL 3JTSB 4TNVF 3RA7L 1NC2B 5AZ2H 4ZO7A 3DVNA 3M1BB 4JFED 2FDBP 3MACH 4U31A 4K3EL 5E2TH 2UVEA 3RTQD 1UA6H 2M26A 4MZ2A 3EO1A 5D7LB 1RULL 1D9KB 4ZFFA 4YHPB 4GRWB 5D8JH 4PGDB 4I3SL 4B0MM 1L0YA 5E8PA 5I8OH 1CBVH 4NGHL 4PJ7A 4PJGB 4NO3B 3EDDA 2P8MB 1VCAA 3STLA 5GS0D 2VITB 3TT3H 3IDNB 3IXTA 3MGOB 2D9CA 3V6ZB 2WBJD 5FGBC 3QDGB 2AEQH 1CIUA 3RVWC 3P77A 4LLYB 3KXFB 3FHAA 5SWSB 3HNSH 5F9DC 5GIRB 4WV1B 4AZ8A 5H8DA 1ZHBA 1KYOJ 5A3IC 1WQVT 4IIQC 3PP4L 1FNSH 5HHPB 3FQWA 3P40A 3E6HA 3WDIA 4N0UB 5FF6B 3TA3C 2UZXB 3GSNB 1ODAA 5TDPB 1KB9K 4HUWA 4TNWF 3T0AA 4LPUA 3KYMA 5IW1B 4X6FB 1UWXH 4QXGL 4G43A 1CTNA 1MH5B 1ZLUK 3CH1B 1FVEA 4DW2H 4OCWH 2GTWB 2G9HA 4C54A 2YPLE 4HIJB 4LSVH 4ZD3L 5C0GB 4Z0XA 4Y2OA 3I2CL 4C4KT 2FJFA 2CKBB 1KCRL 4H0GA 2J12B 4U6YA 2C7UA 4PRAA 3B8SA 4YHOH 3TBYA 4TRPL 3NBNA 3OWEA 3BZEB 1V3KA 1X4YA 1P84K 4X6EB 4NQCE 3WLWD 2X42A 3ULUD 4DK6A 1XGRA 3S4SB 3HZYB 3UO1L 4RNRB 3ARFA 2EDJA 3X13A 3TN0D 1JZ3A 3GMQA 5DXWA 3T1FB 2Z4QA 3PXJA 4AIOA 4LSRL 2AXGB 4GQ9L 4ZO9A 3FFDB 4V2BA 2UWEB 5T1KB 4J6RH 5FDWB 5D2NC 3QXUA 4WO4C 4ZAKA 1C7SA 4JM2C 2J4WH 4ALAH 3WEXA 2X9WA 4L1HA 1GJIA 2ORBL 1KT2A 5JORB 2DLTA 1SEBB 3MV9E 4AL8H 3ILPA 1T1XA 3NCJL 4G5ZH 5TFSL 3HB3D 2GAZA 5I76B 3LEYH 4PJ9B 4WUUA 1OSZA 1RFDH 1WT5A 2V7NA 5DK2B 3FZUD 3RX8A 4NQED 5EU6E 5FV2A 1ZSDB 2ZSVB 4Z7VE 4JN2A 1EV2E 1M71A 5D1QD 3DV4B 5F9JB 1G9EA 3LN9A 1YNTB 4NNYA 3T77A 4AK1A 3KYOB 1LILA 2IC2A 5F3HA 1C5DA 4PJAE 4J8RB 5DDHB 4XNXH 2C4FU 5JPMA 4K94C 3L1OL 5TE4H 2BCKB 3ZL4L 1N3NA 2D4FA 5GJTL 4YWGL 4XMLL 3RVVD 1TCRA 3N9GL 2Q1EA 1BIHA 2AQ2A 2GQHA 5EIIB 1I85A 4JKPL 4JFFE 4U1MB 1IVLA 3BEVA 3SDAD 3C5JA 5E4EB 1NGWA 4L9DA 3MRGA 2NW2A 4KV5E 1XGTA 3S35L 4RIRB 4YDKL 1IGIL 3O8XC 5GRUH 3W11D 2Y5TA 2VISB 2Q7YA 3O6FD 1Q38A 4FQQA 1D6EA 1CFTA 1DSFH 3H3BC 1GGUA 3MOQA 2DBLH 1GGTA 1HDMA 3VXUD 3W0WE 2PYED 4YC2C 1MCOH 2Y7QA 2WV3A 4K3DL 4QHUB 1DN2A 3O41B 4NC1C 5IF0A 2EKJA 3RRQA 3X14A 4XCNA 1TETH 1NC4D 5JDJA 4WHTB 2D3VA 1F4YL 5I6XB 2QL1A 3EO0B 3HG1B 1FYTA 2FEDD 4JPWH 3F58H 5I66A 1XGPA 1AXTH 3D3VE 1I8LA 2VIRB 3EFFA 3QDJE 1JYXA 4MYWB 3BGMA 3ARTA 1A9BA 1FORL 3CZFA 1NDGA 2ZUXA 4PG9A 3TV3L 1R0AL 4XCFL 3VXRA 5F7DB 1G7JA 1B4RA 4HC1L 1G7LA 3T65A 1NSNH 2BNRD 1KV3A 1GHFL 1CFQA 1RMFH 3TVMA 2P5ED 1PSKH 1X4ZA 4P2QB 3VFSA 3MBED 4OLZH 4YHIA 2VR9A 5FYKE 3UPRB 4OZ4B 3QAZC 3TT1L 4PRPB 1BZQK 1GOHA 4LEOB 1U8MA 4MJ6A 4X7TA 1OTSD 4EOWH 3SKMB 4U2ZA 4QHMA 4Y4KD 1H8NA 4HUKB 4HXAH 3VRIA 5DJZB 3OQ3B 3HLAA 3ES6A 5EC2B 2VWEC 1I7RA 3T0EE 2JJTC 4LU5H 1A64A 2KQNA 1T2QL 3C09C 5BVPH 3KNBA 2IADA 3CVHA 4JG0H 4UOW1 3FMGH 5EBGA 5HYSA 4P3DA 1R3IH 4AQ1B 2OBGA 4EIZC 3STZA 1FG9C 1KJ3L 1VFOA 1AD9B 1ZGLA 2NNAA 3MRJB 5E6ID 4JR9L 3D25B 4P48A 1FH5H 4UNVA 3U83A 4WHYH 3G5YB 1DBJL 2VLKA 3KLAA 5C2BH 4LHUA 5HI3D 4DKEH 1ULVA 2V7HB 4EJ1C 5D6DC 4FMFA 1EAJA 4JFEB 3ZHKA 3VJ6A 1CLYH 5ALBL 2OK0H 4FZEL 1OAZL 3HPLA 5C2UB 3LPGA 1OSPH 1RV6X 5GGTL 4O02H 1VFAB 4JHBA 5BS0D 1A7RL 3OKNB 3W5MA 3U7YH 1PZ5A 2IAMC 4R4FH 3CMGA 2APWA 3BZFB 3QNXB 4LPCA 1PY4A 4K9EH 4Z5RB 3H9SD 5KVEL 1MCWM 3T1WA 3KS0J 5I17A 1S9WA 1UM4H 2AEPH 3Q5YA 4LHQB 4YDJA 3QIBA 3IAQA 1AY1H 4P4KA 3A6OA 5GJSH 1MCNA 3JV6B 2WSKA 3OAUL 3GSOB 4WDIA 2BVOB 5FUCE 4M61B 3TJEH 1BEYH 1BVLB 2LTQC 1Q9WA 3MRQB 5D5MB 4UI2A 5FYLD 3DURB 3W9DB 5F1IA 2CUMA 2OMNA 3L3HB 3FT2B 1OB1B 1FQ9C 1XCQB 3L3JA 4LP5A 4U1HB 4Z7UA 3BD4A 1J05A 5J13B 3EYOA 1HYSD 5MEOA 5H94A 4J4PC 5IHUL 3FT3A 4UQ3B 2HN7A 3VXME 4L8CA 3MLXL 1N4XL 2E9JA 5C0FA 3WXWH 1XR9B 5JDSA 1FAIL 5DRNA 1MAMH 2DDQL 2EDHA 2E6JA 1QHPA 5K9OA 1A7BA 4KRMB 4PLNC 3BKCH 1AGFB 4P2OC 5I2IB 4PB0L 4U6HB 4K7PL 3DARA 4NN7B 2EIEA 3O6MH 4NWTL 4E41A 1OT2A 1YMMA 2LAAA 4F7MA 2IMMA 3BUYA 3SDCA 1X5FA 5DFWH 1YPZB 1OCWH 2CUHA 1E4WL 2VERN 3RJQB 4HUUA 4EI5D 4EQ2A 1QEWA 3M8OL 3FQUA 5C0IB 3LHPL 2FIKB 4JKWA 1BD2A 2UZYB 5DD0L 2C4XA 5C0AD 5AZEH 4EVNA 1U6AL 3FOLB 1O0VA 1NEZA 2I07A 3IU4L 3BWUC 4GUPB 4CUCA 4UB0H 4TSCH 2H2PD 3HUJB 3QUMA 5KVFH 3MA7B 3PWJA 4K7FB 3BWAB 4HFWA 4IRJA 3S5LA 3FTGA 5D7JC 5I15H 4M8QA 5E2UH 3IF1B 4NQEB 2QQKH 4QRSA 1DDHB 1T04B 3MRHA 3CUPA 4ODUA 3FFCA 3MRNA 5DHYA 2CQVA 3U4BH 4BFGA 4DQOH 2PXYA 4HIIA 3NIFF 5LBSL 3GSUB 4OLWH 3VFMB 2BRQA 3T0DA 3BDYL 3LOWA 5EU5B 2AJSL 4MNHA 5HGDA 5DMIH 4ZMAT 4JFYA 2AV1A 5M95B 1GRWA 3R0MA 1VFBA 5HY9B 1VSCA 4Q9RL 5CEYA 1V7NL 4Y5VC 1BHGA 5IWLC 3OG6B 2VOTA 3MLZH 3VGHA 4YK4B 1F4WL 1QFHA 3SKNA 4KUZL 3ZYJA 3QI9D 3UDWA 4OI9A 2ZCHH 1T66C 4M43L 1FL3B 1ZT1A 2X44D 3PHOA 4GH7B 3GMPA 4WTZA 2VZ1A 2UYLA 4ZUTB 3VXUB 1MWAB 2OL3B 2PYEB 2WWKO 3H3PL 2FCBA 4ZOAA 3K81A 3ZLQC 5HHXL 3OKOB 1BIIB 5DD5L 5L0QC 5J11C 3VMOA 4J23A 2I60H 1KELL 5CJXA 5D7LA 4K2UL 3TF7C 1NC4B 1EZVX 1FZKA 3QB7C 4N5EC 5ERWB 4NQDB 2GTZB 1HIML 4FQJH 5F44A 3VI3E 4QOKD 4F9LA 5F6IC 1CDIA 1AKJD 1IFHL 1BFVH 3NPSC 3OGOE 5DJXA 4QRRE 4WV1A 2XZQL 4FQCL 5BZWB 4F7EB 4HH8A 2HJKB 2W0PA 2GFBB 1QTYT 3DIFB 2QQNH 3LKQB 3QCUH 5AUMB 4M3KB 5IW1A 3C2AH 1T2XA 3WO4B 1MH5A 4U0RC 3L3OA 1J8HA 1R5VA 4QHLB 3VWJC 5E8NA 2BXYA 3HNTH 2NY7H 3BP5A 3U4AA 2GT9A 4FTVD 1BZ9B 3SO3C 4I3RL 3RU8H 3R8BB 3HZVB 2DM4A 4WTWA 5EIQA 1KPVB 3HI6L 3HC0B 1S7VB 4BSWB 1IRAY 1YEEH 4N8VG 3NFNB 3PP3H 2W1NA 1H5BC 2XY2A 4DN4L 1EEZB 4H88L 5D2NE 1OTTC 1CFVL 1GGIL 3QJHB 4KQ3L 5I1LA 2NX5A 2ZCLH 1MREH 1T5WB 1C1EL 4Y4KB 1QFWH 4P9HL 2PO6B 1JPGB 1S5IH 3K0WA 4RNRA 2X89A 1LP9B 5IW6B 3T1FA 4NYLB 4KY1H 5CEZH 3PGDA 1ZT7A 3T04D 2P5WB 3FFDA 3MCLL 3PHQB 2W38A 1A6AB 4Y16C 4PJFE 1C12B 1WTLA 3O2VH 3V0WL 5HI4C 4RAUB 3VGDA 1KB5A 5E9DA 4BZ1H 3LDBC 1CLCA 4LKXB 2C3GA 1MQ8A 2GK0A 3U1SH 3PL6C 5JW3H 4QT5A 3HS0A 1OW0A 2JCCA 2A6DA 1E0OB 4GG6E 3OR7A 5F8RC 1NAKL 1QLFA 2EC9U 3IDYC 1CDBA 1YA5A 3C9NB 3MV8A 4ZOCA 3VFPB 5F6HJ 2FATH 2IANB 2ZSVA 3K3QA 4W6YB 5LVEA 5DR5H 2YPLD 4X9HA 4IJ3C 3MMEA 1NAMB 1MRDL 2JJVA 5EZOH 1YNTA 1NCDH 3IS0X 4LLAA 4BQ9A 5J6HA 2GYSA 3O6LH 2D31A 3NAAH 4PJ5B 4KHXL 2HLAA 1Q0XL 4LQFH 4UTAH 4ZYKB 5JHLH 2BCKA 2P8LB 4PTUA 5IKCA 4YQXH 3RZCC 5T1MB 5KSUA 1ZAGA 4NQCD 4F8TA 1LWRA 2QSQA 4HT1H 2VZOA 25C8H 4U1MA 3DLQR 4JGMA 1MF2L 1QNZL 1RQ5A 1U8QB 3TYGL 5HHQA 1U3JA 3QRFM 1DLHB 2X1WL 4OFPA 2DQCH 4R8WH 4X0KB 2K3TA 5EZIH 1EFXB 4OM1H 5CD3A 4NC1E 3OB0K 5DEFA 4ELMF 4LDLB 5JIHA 1TPXB 4YEFA 1FO0H 3HE7C 5GSVA 4LRIC 1YEDA 1BZ7B 3EOAA 3BE1L 4K9EC 1DQQB 3MV9D 1U0QA 1W0YT 2OQJB 2CDGB 4OFYA 4XZUA 4YH6A 3NACH 3O41A 1ZHKB 4WY7L 3U30C 1P4IL 2DN7A 5EU6D 3GSRB 1NCBL 4RGMB 4OUUB 1IBGH 5IM7B 4GAGL 5IIEB 4CRPA 3MRFA 4Y4HA 2EDOA 1EGJA 4WHTA 3FN9A 2OZ4L 4IRSA 4OIAA 4M48H 2C3WA 3MLSL 1G0DA 1HINL 3LV3A 1UYWH 4OLVH 1D5XA 2ITDA 1WSST 1B4JH 3QHTC 4TUJB 1S9YB 1A4KB 1GZQA 5CP3H 3BYTA 1Q94B 5EU7E 5C0AB 3LPFA 1VGEL 3BKJH 4GRWF 4UILL 3WFEL 2OTPA 4JFFD 4Z7OF 3QXAB 2AABH 4X7FC 3GMMB 1ZT4B 4Y19E 1KC5L 4PJGF 1OAKH 4UDTA 4WGWB 5KOVC 1NDMB 5MEQB 5IK3A 3MLWH 1YYMH 4D0BB 3REWA 4HIXH 3IKKA 1G7QB 2J2ZA 4GRMA 4NJ9H 2VSDA 3W0WD 2APXA 2B1HL 3QIWD 2NQCA 2VWEE 1OARH 5B38B 3O2DH 2C3VB 5HDQL 1U8JA 3SDYH 5J9PA 5IMMB 5DEGB 2MQ0A 1PLGH 3QNYB 4UT6L 3WS3B 1K4CB 2I9LB 5EUOB 2RJMA 4JFQA 3WFHA 5JPNA 4HCRL 5L9DH 5MP6L 3MUGB 4LCCA 4TNVK 5EC2A 4F37K 1L0XA 4AT6A 1FVDA 2VC2H 5JW4N 4ONFH 3DGGB 4WU7A 5E1HB 1A6VL 1YN6B 1YUHB 5DK0A 2CIIB 3MLYL 2BOBB 4NKDB 5TQ0L 4JQIL 3OKLA 4UV4H 2XWJB 2DLHA 3D3VD 1ED3A 3BUTA 4RQQB 2HFEA 3QI9B 3QDJD 3LIZL 2CLVB 3MRJA 1AGEB 5HHOE 3EUUA 2J8UF 3RWCB 1ZLUH 2HMIC 1VA9A 1YEJL 5I30L 4XH2B 1RHFA 2VRAA 4JFEA 4OD1L 3RTQA 2UWEF 3QEQE 4A6YH 1XF1A 2DQIL 3QJFB 1DEEB 3M17A 4M93C 2ZUQC 1P6AB 4XMPL 5IQ9A 1WBYB 3OZ9L 1XZ0A 1F97A 1R3LA 1I1AC 4O51B 3C08L 5FYKD 3LRGA 1W8NA 4Q6IC 2EDEA 3PDGA 1ZOXA 3HE6A 3VXOB 3KPMA 2YD5A 2FWOB 4FXKB 1AGCB 5J3HD 2WBJA 1A21A 1AKJB 1TZHA 2R69H 5EO1B 1QACA 4H20H 2XPGB 1JNHB 3BOVA 3QUZD 1BQHG 1S7QA 3RUGA 5H2BA 1FFPA 1MCSA 1A3RL 3FQRB 3MXVL 3T0ED 5C0DB 1RIVL 2VDMH 1EEUA 3OR6B 4PJEE 3O3EA 4I77H 4X6CA 4IMKC 4C4KO 2AJYL 4XNUH 4M9PA 1UGNA 2A0LC 1QFWI 2NY1C 3FN0L 3G08A 5IB3B 2ZPKH 4LIQH 1RURL 4JVWA 2EDNA 5IFAH 1QLRB 2DQTL 5HHVH 4UAOC 4GAJL 3DX8B 4KI5F 1KIRA 3B83A 3AS1A 5ITFA 1I9IH 4JFZL 3MRMB 3P30L 4DN3L 4HIHA 4F7TB 5FOBB 5DYOB 3V52L 3V0AC 3BIAX 4CDGC 3P9LA 1H3PL 2HVJA 1G9MH 4GKNB 4XPFL 1P7QD 1I8KA 1NBYA 3KPOB 3TN0A 3I9GH 4JHAL 2CLRB 2RIKA 5L8JB 4KJYA 1HCFX 2F74A 3QHFH 2F58L 3C8KB 3AB0B 3MYJB 4PJCE 1AJ7L 2HTLC 4QRUA 1WK0A 4JB9L 5BOZG 2KH2B 1I8MB 2JLLA 4K07A 3IDUA 4NFCA 4RGOL 4DUXA 1KTDA 1UM6H 4WWKC 2D0HA 3PQYE 3B3IB 1UCBH 1W72A 3VFNB 1FSKC 3AMKA 1VERA 2QR0B 5CBEB 4JO4H 4NQEA 1J1XH 1JNNL 1XGYL 3OF6A 3DO7A 4XMKH 2DQHL 4R97C 3VXMD 5D1QA 4Z78A 2NTFB 1OTUC 1F8TL 2XV6B 1QP1A 4RDQG 1F00I 2EDFA 2Y4SA 1K5NA 1FNFA 1MLBA 1T1WB 2BFVL 5DFVC 4YHNA 3ALXA 5DJAA 4NGHH 3VFMA 2QHLA 1J0JA 2A1WL 4NUJA 4OSUH 5GS1C 5DURD 4PIRF 5IMOB 4FQLL 1BQSA 3F5WA 4L3AA 4NQCB 5F9WC 5FYJE 5E08L 2YUVA 3T4AA 4Z8FL 4FN0A 4NKIH 2DLIA 3N1GC 1HCVA 1PJ9A 1FYHB 3SDAA 4MXQC 2R23A 4QEGA 3KLDA 5KVDL 5I8CA 2P7TB 3QXWA 4DAGH 1OLZA 4H25A 4M7KL 4LSTL 5BRZE 5HHME 3O6FA 5CGYD 3ZYZA 2DWEA 1QYGH 2V5MA 3VD5A 3KLHD 1Q0YH 1UVQA 3H6JA 4XTRD 1HKLL 2DQDH 3QEUB 4QGTA 3WUWG 1HH6A 3MV9B 5K9JL 5DHVH 4MQXD 1FPTL 1HHJA 1T20B 2MSPA 4UMGA 3I2CH 5HYEA 1KCRH 1G6RH 2SEBB 3QFJB 1KCKA 2APBA 3KPQB 2MHAA 1NC4A 5E5UB 5KBNC 4Z7VB 5DUPL 2JJUA 5KN5A 3BH9B 3MO1B 1N0LA 5ECJE 5GGRA 3ZDZF 5DFTA 3PV7A 2F53B 4Q9BA 2P1YA 3P73B 3EAKA 3KPSE 4N9GA 4NKOB 4WI3A 4XP4L 1NCWH 1AGBA 4PJAB 3B9EA 1AHWA 3ZDYE 5TE6H 2WK2A 3UROR 2DIAA 4PJ8B 4I4WA 1YQ2A 3IDIA 1DQLL 4LPVA 4OLEA 5FA3B 4OGAD 2L0DA 3ZMRA 2R0KL 3VD9A 2C1OB 1EEYA 4M7LL 1C5CL 5TE7L 2H45A 1YY8B 4XCEB 3L6FB 3DRTB 3VA2C 3DIFA 3T0VA 1RSFA 4WU5A 4LLMA 3WJLA 1JPST 3BX7C 2K9UA 1V5JA 4AM0B 2BNRA 4PD4K 3NCJH 5ADOL 5TFSH 1FFRA 2P5EA 1ZV5A 2WINB 1OD9A 2EDRA 5CJQL 2NXZC 3QWQB 3MBEA 4X99B 3OKEA 3W0WB 3QIWB 3CFCL 4MB3A 5INDA 3LQMA 3HC0A 1U3ZA 5T3XL 5D5MF 1MCDA 4GMTH 4HWZA 4L9LA 2FBJH 5E5MB 3ARQA 3V6BR 2YWZA 5J06A 1U8HB 1A6ZB 2CK2A 4OQTH 3RVWD 4Y4KA 1UWEH 4NUGL 1OAXL 4ZAKC 4JPIB 1S78C 3L1OH 3SPVA 1WZ1L 1DQJB 3OKYA 4OIIL 5A3ID 4HWBA 1SYVA 1AQKL 3ZE0F 3CVHL 1NCAH 4UIKL 4ZDHB 4W81A 4N1EA 5KTEL 1KJ2A 4L8BB 3D3VB 3I50H 2LU7A 4PTTB 4LLDB 1JPTH 1UWGL 3QDJB 1LDPH 3NH7L 4GW4B 3QQ3B 4GW5A 4QRRD 4KMQA 5E6IA 4TUKL 1FZJA 3K4ZA 3QCVL 3WMSA 2FJHA 1YPZF 4K7PY 2R15A 4OCNC 1B0RB 5I1JL 4M7JL 5INCB 5HHNB 3WKMH 5FCUL 2EYTB 3V6OC 1ORQA 4N0FB 4OF8A 2AXFA 4HEPG 3VFPA 4NBYB 5EG6C 1FBIL 4GLRH 3B9DA 2YD3A 4HK0B 1NAMA 4X4MA 5C0JA 5T1LB 5BS0A 5SWZE 1E4XH 2CUIA 4HQQL 3TLRA 1M4KA 3BQUB 3HUJF 4LARL 2NY5L 3H9SA 1EHLH 4RZCA 2HWZL 4NHCH 1BX2B 3BVNB 2BK8A 2DMBA 2P8LA 2DQFB 4WO4D 2PN5A 4JM2D 2G60H 4WW2C 5GHWL 4X4YA 2X4UB 5FKPA 2A83B 2X4SB 2PUQT 3T0EB 3WNMA 3IDMA 5ANME 4OZHE 5JIKA 1F58L 3LQAL 3RFZC 2IPKB 5IEKB 4WFGE 4O9HL 1FORH 1R0AH 3QXDA 4XCFH 2ZP0T 3G6AA 4ODWB 4AEIH 1LNUB 3KWWB 4LCUA 1BMGA 3Q0HA 1FZOB 1GHFH 2JB5H 4IMLB 2X4RA 1JP5A 5I0DA 1ZANH 5DD6B 2R9HC 1U8IB 4RA3A 5IVXB 1T80A 4OV5A 1ZHKA 3ARDA 3RGVA 3TT1H 4EIGB 2Q3ZA 4M00A 5IIEA 1BVKA 4I0PA 3RQ3A 1SJXA 1KNOB 2PKDA 4XNYH 5FUOL 4EI5A 5ISZE 1P7QB 1NBVL 1NGXA 4PB9H 3RAJH 4JJ5B 5I73B 3BN9C 3PWLB 4S1RL 3D87B 5H37G 3TBTA 5IV2A 1X5KA 3NZ8A 1SMOA 3O8XD 4NZTL 3GSWB 1T2QH 2LQRA 4EN3A 5EC1B 3DRQB 3UTZB 4HPOL 1IMHC 4N90E 3U2SB 1D7FA 2V9RA 4CVZB 3TWCH 1ZT4A 3QUML 2F54A 2VDQL 1Q9KB 4JR9H 4LPTA 1RU9L 2X4OA 1DBJH 1LO5A 2YD1A 4HZLA 2VH5L 5LQBH 5CSGA 3P9MA 1CZ8H 4JLRA 3CLFL 5DWUL 3ZE2F 3BN3B 5L7XL 5AEAA 3VWKC 3V5KB 1SVCP 3D69B 5F71A 1H9VA 1O7VA 2J5LB 4MJIA 3LD8C 4HG4K 1MJ7L 2FX8L 3BPNB 4YZFF 4GAYA 2G75B 3SOBL 3V8OA 5IMMA 1A4JA 3MA9H 4RWHA 3IVKA 4WCYL 1W0WA 4OGYL 5DURB 2H1PL 3E2HC 4H5SA 3DX9B 4JDVB 1XF3A 5DRZB 4HJJL 1TLKA 2FHBA 3SEPA 5GZOC 4HUVA 2PW1B 4XXCC 5IVOA 2A73B 3QG6B 3B5TA 1BOYA 2KUTA 2Z92A 2R1XA 3WFDH 2AAVA 2IH1B 3QI9A 5CIPH 2ARJQ 2CLVA 1DVFC 1KIPB 2F5BL 2Q20A 4DUWA 4OCSH 4IDJH 3CSGA 4ZSOA 1UKSA 4Y19D 5KG9B 2DLFL 1WC7A 1LP9F 1HN1A 4PJHE 3UTTA 4XH2A 4Z7QF 1N6QL 1FE8H 3IJYB 3JV5A 4ZFGL 3GDBA 3H7BA 3LKPB 4UNUA 1G9NL 2VAJA 3BEWA 3S96A 1FV1B 2H3NB 2H32B 3N85H 3MNWB 4K7PH 1T6VN 2R8SL 4NWTH 3CFDB 3SKJL 4KRNA 3PXHA 3TCXA 4RMQA 5BQ7B 1DJSA 1JGVH 2X1PA 4QOKA 1AGCA 1E4WH 3ARGC 1XGUB 5CD5C 4FXLA 1MCIA 1MSPA 1RUAL 2Y36L 3QHZH 5KSVA 1WLHA 1CR9H 3PWNA 3CFBB 1QSEE 4L3CA 5DJCA 1PZUB 4PV9A 1X6LA 3FQRA 1MFBL 1NLBL 4JN1L 3HR5B 1J1PL 5LGJA 1CFSB 3FO0L 1S7UA 2IEPA 5DUML 1WVZA 2YPVL 3TO2B 1AH1A 3IJSA 1D5ZA 4LMQE 4MA8L 5GRWA 3AU1B 5EULV 5C70A 3U0PB 3Q3GA 2OJZL 4NRYA 3B2UC 2DI8A 1Z5LA 1IJ9A 3QDMB 1JYVA 5HHOD 5D9SB 2Y06L 2ZUVA 4FTVA 4KGLA 4KTDL 1WCBA 2IAMD 4ODVL 3ULVL 1IQDA 4D9LL 4JFXA 5JUEL 1AD0B 2BVTA 2N4IA 5C0EB 3LH2L 3QZWG 3OB8A 4PGCB 4HMCA 4U6VL 3QEQD 3JWDL 1AQDA 3V5DB 1VPOH 4F7TA 2O61A 3QQ4A 4XPGL 2CXGA 4JCMA 4XC1H 4UU9A 3G04B 5LBSH 4LQ1A 1S7XA 5BZDB 4OGXH 2VZSA 1XCTA 1OM3L 3VRJB 4L8DB 1NQBA 2P24B 4ZUUA 2WIIA 4IIQB 4R2GC 1BWWA 1CYGA 5BV7H 2HTKC 5I8KL 1KN4L 1I3VA 2D7QA 4P5TD 4KTEH 1MI5E 4J3SA 3MYJA 5EOCH 1D5MB 4FFVC 2VLME 2W9DL 3BPOC 3VDAA 4ELKB 4IRJC 5ESVB 4GLRI 1CGTA 1KB5L 3VDBA 4QRRB 2F15A 3U48A 4J4PD 1J5OL 3T2NL 1CGSL 2HKFH 5E7FA 1BBJB 4KK6C 4P4RB 1E4XI 3L3KA 3VI4E 3OB0H 2GUOA 5CEZE 3IDJB 3QPQC 4M43H 5GISL 4HV8B 2WQRA 5CZKA 5D1XC 3GI9L 4P2OD 4HWEL 1T1YB 1QSFB 5T1DL 1BJMA 2C4FT 3O9WC 3VH8B 1Q72L 3GSQA 2VXVL 3DROB 2YPLA 3SGEI 2YSSA 1E27B 2OCFD 2VDLH 2LVCA 4M7LT 5ID0A 2FX9L 3PGCB 1GIGL 4XNQA 1EJOL 4RCAA 4MAYB 2VYRE 3VE0B 5D2NB 5E1AB 3BW9B 1UACH 2CRIA 5D96C 4JM2B 3IJHB 5HYSG 5BO1L 5B8CC 3U9UA 2FD6L 2HAZA 3P4MB 4XPHL 2WLYA 1LO2L 2FZ3B 1CXHA 4LAQH 5AWNH 3A6BL 5EA0L 3EFDH 5B39B 2RFXA 2AXJA 1FIGL 4LHUG 1YMHB 1DUYA 5JNYB 4I48B 3I6GA 3G6JE 4XP9L 3DGCR 5EUOF 2B5IB 5DMKB 3K2MC 3GIVB 1JBJA 3ZE1F 3PQYD 2VABA 4PP1C 3DV6B 3M07A 3RWIB 2X41A 5TGBB 3BISA 1WEJL 3BPCB 4JZJC 5E8EB 5EU6A 1UQSB 5F3BB 4IOSD 4NC0B 2C26A 1CFVH 1EGJL 1FVCB 3B6SB 1LQSR 1U8KB 1RVFL 4JM4L 1OGAB 4P9HH 3Q2CA 2QTEA 5JO5B 4KFZC 3QNZA 1F42A 2ERJC 4MQ7A 1T89A 4XVJH 1NGPH 3O8XB 5I18L 3SDXE 3BP4B 5FA3A 5MENB 5FYJD 1E4JA 1T66D 2DJ4A 4M03A 3JV4A 1WUNT 2XY1A 4PGEB 4OCRH 2XWBA 5HPMA 3VRLF 4JFFA 4FQHA 3LSOB 3L9RA 4TVPE 4XCEA 1HXMB 4OTXL 4XHQA 3MRCB 4YC2B 4G3YH 2HA1A 2OTWB 3ME0A 3RWHB 3C60A 3EGSB 3H3KA 3TO4B 1T0MA 2YD8A 5BRZD 2BSRA 4GKOA 2B0SL 5HHMD 5CHNB 4HGKC 3JWDC 5LWYL 4MDJB 5B21A 3CK0L 5J1AB 5DJ0A 3W0WA 5D70H 4N5ED 4RFEA 1TENA 4OZIE 5CBAA 2J88L 2GCYA 1Q9LB 4NKMB 3CGTA 4ZS7H 4R0LC 5HGGS 3MODL 1U8HA 2IFFH 2EKSA 1L7IL 3L5HA 3OJMB 4FQ1L 5JHDE 1R5WA 3AS2A 1MCCA 3MLTB 1QPPA 5KZCB 1U8OA 1JPSH 4OF6A 4C59B 2XZAH 1I7TA 1WCQA 5C6WH 1RJZB 1CDGA 1NEZG 2A6JA 1KXTB 3KPSD 4HHAA 1N8ZB 1CS6A 1I9RH 2AS5M 1OW0C 3GK8H 4ZDHA 4CADA 1LDSA 4L8BA 4I2XB 2A9MH 3D3VA 3QO1A 1QNZH 1LD9B 3V6OE 3S5LG 4DFIA 2Z91B 3QDJA 4Z95L 4TQEL 3VWJD 2EZ0C 1BAFL 1MRCH 2H2SC 4G6ML 1RHHB 5INCA 4FQ2H 4K3JH 3GRWA 4QRQA 2LAGB 2XYCA 3CFJB 3QAZB 5DZLA 3O4LB 3MXWL 3UTQA 3D85B 4XNZC 3UJJL 3CDFA 4YGVB 1OTTD 3U46A 4Z77B 3BAEH 4OCMC 1N7MH 3CSYA 1QPXA 4WY7H 4Y2DC 2J1KA 4AYFA 1ACZA 3QBTB 1NCBH 2WLZA 5HGAA 4GAGH 1CXLA 3SE3C 3ZTJG 5GS0L 2RCSH 3C09B 5GRJL 4GBXC 1U92B 1DQTA 3MLSH 1T4KB 4X6DB 2W65B 4Y16D 5DTFA 2R4SL 4X98B 2EECA 4OD2B 3QUZA 4G8IB 1NFIA 5HI4D 2VQTA 5F96H 5CGTA 3NCYS 2ADIB 1E6OL 1HQ4B 2I9TB 1G1CA 1U95B 3BMWA 4KHTL 4PP2B 3U0WH 3PL6D 2GITA 3K7UA 1A1MB 3LRSB 4WTZG 1X3DA 3VXQB 1M7IA 1VGEH 2X4TB 1T7ZA 3U7WL 2FGZA 2GSIA 3UC0L 5EO0B 4PLKC 3TIEB 1MIEH 4TUOB 1IGCL 4NO0D 2X4NA 1MCBA 1LNUA 1CXIA 2ZG3A 4XPBH 1TZGH 3HA0A 5ALCL 5HHOB 5C07B 1EO7A 1HI6A 2ADGB 4NHUB 1TQBC 5I1AA 4CVXB 5E94B 1W8OA 2Z31B 4G42B 5JZ7C 3L7EA 1KEGH 4MX7A 3OPZL 1IC5L 4Q9QL 2A74B 2ID5A 3QEQB 4ZUSA 4EUPB 3VXRE 1LVEA 3RZCD 3EDKA 2V9QA 3ULUL 2N1KA 1NFDE 3CC5A 4AENA 3KDMB 2CXKA 5SWZD 1CQYA 1KOAA 4D9RE 1A1NB 2BVUA 1T0NA 2VXTH 1FNGB 2LTQB 3RVUC 3C5SB 4HCRH 2FEEL 4OD3H 2BVPB 4P5TB 4F58L 3F7PC 1RZ8B 1JFQL 4P57B 2HFFB 4P9ML 4MSWA 4L4TE 1A6VH 2PYFA 1JWSA 3DRQA 3FQXA 1ZS8B 2CO7B 5IFHL 3HE7D 4Z7VF 4AEFA 3CU1A 5EZJA 5KVGH 2ICWJ 5AG8A 3V4PL 2GY7B 1SBBA 1IL1A 4YFDB 2Z35A 4DGVL 3MRBB 1JF6A 3MRPB 4PJEB 1W72L 1A3QA 4PJAF 1P5VA 4P2OB 1JN6A 4WFGD 3ROLA 3OKMA 1T21B 2F19H 5JW5B 1FRGH 5I30H 3ARZA 3WHXA 3T0BA 1ZGLP 2BHYA 1RZKH 3V4VH 1D5IL 3VXMA 3WIHA 1YECH 5BV7C 3S4SG 4XMPH 3ZHLA 2E9IA 4LPXA 2VDRH 4LEXH 2L7UA 2VLKE 3EO9L 3B9KA 3MQIA 5TDOA 4R26L 3V6FB 3ALPA 1RY7B 4J7RA 4OZFA 1K8IB 5ISZD 1EUUA 4JFHE 1X5LA 5GRVK 2EEAA 5DT1L 4ONHB 1WAAA 4I18B 4N68A 1F3DH 4QF1B 3I6KB 4YR6A 5H35B 4IRZL 1RZJH 1A3RH 4WI2A 3JWOL 4F8QA 4LVOC 3FB5A 4D9QE 2BRRH 2W9EL 5H37H 1HH9A 3FO9B 3LMJL 3RNKB 3TEUA 3WDJA 4N90D 3INUH 4OLYL 4PY8J 3BP6A 2AJYH 2QJDA 3PQYB 1KB9J 3W81A 5DC0A 2W60A 3MLRH 4P59H 1FJ1A 1ZA6B 5E8OB 3CLEH 3GMOA 4UV7L 2DQTH 2JKXA 3E6FA 3HE6C 3LKPA 1TJGL 3EYFA 1FP5A 2VXUL 3G5ZB 4ODHL 2OSLA 3F7RA 4OCXL 2H3NA 4H26A 4QRPB 3LKRA 4X9BA 5C0RH 4JFZH 4F57L 2A9NL 2NY2C 4Z7UE 1UC6A 2BERA 3U6RB 3CFDA 4RX4D 4NP4H 1MHCA 1X5IA 4ZPVB 4NZRL 3V52H 2VNCA 4O58H 5EPMA 5GZNC 4L8SC 1F45A 2Y6SC 3WLBA 4DZ8B 4JZOB 4WVRA 4XWGL 4WUKH 3QXTA 2VAAA 3UJTH 4NZDA 2DLGA 5HVWA 4U3CA 3LZFH 1S5HA 2VZUA 5BW7A 5I1KH 1MUJA 1F6AB 1MPAH 4YDIH 4E41E 1R3HB 1RZFH 3MZGB 4G6KL 3ALWA 5GGSA 4HBQA 3NFPB 4JB9H 3EYQC 2AJ3B 2ZKHH 3OKKA 3HZMB 4JY4A 3BO8B 5DRXA 2HMID 3O3DA 3TYFA 5EU4B 3BI9X 4OLUH 3F65A 3U0PA 4G7VL 2W0LA 2VDNL 4TPRL 3U36A 3EJJX 1BD2E 1IGYB 4NN5B 2ZUSA 1I1AD 3UZQA 4BH8B 2P4AB 1QFPA 5LG1A 1OF2A 1J1OL 2EE6A 1F90L 2KQMA 15C8H 4C58B 3C6SA 4YXKL 1MHPL 5EOQH 5FGBA 5F6IB 2D7TL 3MRLB 1E6JL 1G7HB 1DFBH 3CU7A 5BZDA 1J12A 4JPVL 3VRJA 2HH0L 4X8JA 5I75B 5CJOL 1CCZA 5D7IB 3IAGC 5FA4B 3MRIA 4HWBL 5EBLB 5E08H 1LE9A 3K80A 1ZA3A 3BRDA 1UENA 3TA3A 3TBSB 1HSAA 5EZLA 2BOCA 5IVXF 1SY6H 1KJ2L 5ENWB 4QXUL 1IGTA 2A77L 3NCEB 4P23B 1RUQH 3VWJB 1KCUL 2VLRE 2A0LD 2NY1D 1QSED 1NGYA 4OT1L 3PDOB 4LSTH 4P4RA 4JY6B 1YEIL 4ETYA 3IDJA 4X9FA 3X11A 1IQWH 5FECA 3WIFB 3LB6C 2LFGA 5DJ2B 1CXFA 2OI9C 4FNLL 1H5BB 3T3PE 3OXSB 4Q97A 3I02A 4BQBA 2FO4B 4YXHL 4GRLC 5K9JH 3PIQA 1DCLA 5EBWB 1NAML 5I1EL 1Y6NR 3IFOB 3T2OA 5E2WH 1DBAL 4KVNL 4GMSL 2XN9E 3VXSA 1LHZA 3RWEB 3CVIH 1U8LB 2MQ3A 2GJ6B 1WBXA 2H26A 4UINL 5HJ3B 1V8HA 1HEZB 4WO4A 3ECBB 5D72L 5KS9E 1ONQB 4XI5C 4XP4H 4Z76B 4UTBH 3K46A 3FCTB 3JWOC 3CFEA 2OR8A 2FZ3A 3LDBB 1NMAL 1A8JH 5DC9B 1T5XA 1JYWA 4WWKD 4HGMA 5F7LB 5FYLL 1VHPA 1ZVSA 4U1IB 5FFLA 3HC4L 2QLVB 3GGWA 1MI5D 1YMHA 3BP7B 4PJFA 3GKWL 5JNYA 2VLMD 3IETB 3VU2A 5FK9A 4NO0B 2OR7A 3NZHL 4OUOA 1A7OH 2MQCA 3H9YA 4FA8A 4IJ3B 4G9FE 5EO9A 2B39A 1OTUD 3SGKC 1GXEA 2DQGH 5CEZD 2FX7H 4GG6A 1FDLL 2G5BB 1ZLWK 3RWIA 4KPHH 2GHWB 5KSAC 1E28A 5DFVD 4NM8L 2EEDA 3BPCA 1T03H 5CSZB 3THMH 2IH3B 1LO0L 5T3XH 1AHWC 3MJ9A 1P6FA 4FXGB 4F3FB 1HWHB 1JGUH 5C0NC 1TJHL 4JDTH 2UV3A 3V5HA 1J8HE 4BFIA 4JRWA 3O6KH 4YHYB 3BZDA 4MXQD 1MCQA 3CJJA 3QULA 5AD0A 3FHQA 4DGIH 2NY6B 4DKFL 1I4FA 4NIKB 3KPLA 1EUTA 5F1NA 1SYSB 3CVHH 2IBZX 1A7NL 4Z7NE 4NRZB 3WFCL 3HAEA 5KTEH 2NX5E 4TULL 1AGDB 3DBXB 4NDMB 1HXMA 1AP2B 1UWGH 2JK5A 8CGTA 3MRCA 4MLIA 3NH7H 1NCUA 1A2YB 4W70A 4LL9A 1K4DB 5ANMB 4OZHB 3HN3A 1B6DA 3QCVH 4E42A 1ZVHA 3EGSA 3LVEA 2GJZB 3PWPB 1BFTA 4PY7A 4HBCH 1IKFH 4ZQKA 1VFMA 1NCCH 1UFUA 1FC1A 2XQYK 4YHML 2X10A 4ERSL 3WNKA 2JJWA 1DBKL 3IFNL 1JHKL 5I74C 5E9DE 2NY0C 2EEBA 1Q9LA 3DSFL 2AGJH 5GGVH 1KLGB 3CCHB 4XNMB 2CSPA 3HRZA 4PLJC 4U1LA 4EBQL 4LARH 2NY5H 2XT1B 2ADFL 4R3SA 3RKDC 3T4YB 4PYGA 3BGAA 5CINL 5I8EB 5L88L 2HLFC 1FGVL 4WI5A 4KVCL 5ISZB 4PS4H 2O5YL 4XB8A 3QWRA 2K1MA 2AQ3A 4Z9KB 3V79C 3RVTC 1NBQA 4ONOA 1TDQA 3RL1A 3T3MF 3LQZA 4IHOB 4MVBC 1F58H 2XOTA 3LQAH 4Z7WE 4X7SH 3S3JA 2NXZD 4TVPD 2DRUA 1ZK9A 4OIBA 1AIFA 3VFOB 3MX0A 1Z9SA 4Y19A 3W9EA 4LPWA 1A6TA 2EYSB 4M6OL 2UZIH 2DB8A 3STBA 3UTSE 2CK0L 4C56A 4I3GA 3ARFD 2QQQA 4JQXC 4MAUL 5HYFA 4OZGB 5CJ8A 3HNVH 3GIZL 4YHZL 4ZAKD 5CP7B 3CPLA 1FNEB 1WWAX 3OHXA 3QISA 1S78D 3GBNH 4LVHC 1WGOA 5IMKB 1XF4B 1RZJC 1U91B 1EHXA 3PV6A 4LCWE 3D1MC 1NBVH 5JHDD 1LE5A 5GGQH 4X98A 1YEFL 3FRUA 4ISVA 5SWQA 5I71B 3A6CL 1IC4L 4GOSA 1QFUL 3KR3L 4Q6YA 4YX2H 4JFDB 2HFGL 3OAZK 1OPGH 4HX1A 2IALA 3QEGH 5M7QA 3WD5L 3BGFC 3G5XB 5HVHC 1JRHL 3WUWB 4XVTL 1PEZA 4HKJA 5ICZA 4NQTA 5D6DA 1ACYL 2YBRA 1TCMA 1VEOA 5F89B 3U4EB 4PRIE 4JM2F 3RGVC 2ZUQB 4S1QH 4NHUA 2ADGA 2CO6B 2OTUA 4OAWB 2IAMA 4I0PC 3HZKA 1LEIA 3TZVB 5TH2B 2B4CL 3KHQA 5DWUH 4PJHB 4Q6IB 5C9JA 1PAMA 5D93C 1OOAA 2A74A 2FNBA 1P2CA 4IS6A 5F9OH 3N1MC 3KPPB 3SE8L 3VFWA 4KMTL 4PRHE 3SOBH 4NCC1 5ESQB 1AO7B 4KXZI 1QKZL 4EDXB 3MJ8B 5D6CA 1HKFA 1I8IA 4WCYH 1Z3GH 4KZDH 5DJDA 4EN3C 2KPNA 5IMLA 2Y5EA 3ESUF 4YPGB 4BFBD 4QWWC 1NEUA 2UUDK 1D6VL 3BIBX 2VZ3A 3NABH 5FHAL