1NFDA

An alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
203
structure length
203
Chain Sequence
b'DSVTQTEGLVTVTEGLPVKLNCTYQTTYLTIAFFWYVQYLNEAPQVLLKSSTDNKRTEHQGFHATLHKSSSSFHLQKSSAQLSDSALYYCALSEGGNYKYVFGAGTRLKVIAHIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N15 ALPHA-BETA T-CELL RECEPTOR
publication title Atomic structure of an alphabeta T cell receptor (TCR) heterodimer in complex with an anti-TCR fab fragment derived from a mitogenic antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (immunoreceptor/immunoglobulin)
total genus 29
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nfdA01
3FTGB 1FL6B 1B0RB 5AWNH 3I50L 2BSTB 3IFPB 3RTQB 3V7MA 4NHUB 1D5ZA 5C0BA 3GSNL 4HFUH 2JB5H 4LCCC 5JHLL 2BRQA 3KJ6L 1F02I 4RISH 4RDQF 3QO1A 1HEZA 3WJLC 4W6WB 3G6DH 4PGCA 1MCOH 3TIEB 1FYTA 3DMMB 4K3GA 3ZE1E 4X8XA 2CGRH 1EJOH 3EFFB 4NM4H 4TOYL 5C08A 4Z7VE 4AK1A 2J2ZA 5IB4B 5DHXB 2ZUQC 1CL7I 1NCTA 3QUYC 3FO0H 2P5WD 3RAJL 2C3HA 3QIBC 1MQKH 2W9EH 4XP1H 1SYVB 2Q8BH 4OZGB 5CEZL 2CUIA 4M6ML 5F9JB 3X14B 5E5MA 3GKWL 5DUPL 1OAZL 1ZANL 4AG4H 1S3KL 2EDOA 5IR1A 3I6GB 4LBEA 4YXLL 2R69L 1I1AB 1G6RL 5IVZA 4MJ6A 3G6JF 4L4VB 2JJTA 1D3CA 1PSKL 2AERT 1MCLA 1MRFL 3VA2C 5L8JB 2QEJA 2W0PA 5D7JB 1Q9WB 1W8NA 4PPTA 4O51B 4PY7A 3PL6D 3RGVD 3TH3T 3QZWG 4I1NB 5IUSA 2YXFA 7FABH 3V6OE 4FABH 3VXTA 1INDH 2XKNB 3FQNA 3S7GA 2XZAH 1R3KB 3VFVB 4FHBD 2GFBB 3NN8A 2I24N 3NAAH 4KTYA 4U6TA 3MUJA 3WDHA 1OB1A 1KJMA 2AJYL 1G7MA 4MA3B 4DZBA 5I1DB 3IGAB 4YJZL 3MCKB 4WHCA 1AXTL 1X5HA 1GC1C 1L7IL 1FPTL 5ISZB 4Z5RA 3EZ8A 1XCTA 4PJ8D 3SDXB 3U0PA 3K4AA 4L1HA 4Q9QL 4RA3A 3THMH 3D39A 3DUUB 4ZUSB 4Z76A 1VACA 2QR0B 3DYMA 3BFOA 2IQAA 1JTOA 3I75B 3NPZB 3H6JA 2DJUA 3V52H 1R3HA 5DRXA 5HDOA 3TFKC 3M8OH 4HS3B 2OL3L 1CD1B 4IS6A 1NPUA 3WKNA 2IWGA 1N5YH 2AJ3B 1FBIL 3LKNB 5HGHB 1M4KA 4YE4L 4XMKH 4QNPF 5KS9B 2PR4L 4LLVA 3O3AB 3PXHA 1YPZE 5IG7A 2YZ8A 4Y5XB 3BAEH 1A6UL 3Q5YA 4X98B 1UM5L 3Q48A 4LQFL 1A47A 3IDGB 4JFDE 2D3VA 5F1IB 2NNAA 4ODVL 1G0YR 3U4BH 3VDCA 4OCWH 4PRDA 1U8IB 4OD1L 1J8HA 2NR6C 4L3CB 1ZS8B 2F15A 1QACA 5FB8A 3FO2A 3P4NB 4M1CC 2WP3T 3V6OC 4WJ5A 5CBEB 5LAXA 3BESR 5FO7A 4WO4B 5F3BB 4KI5F 1WFTA 4P5TB 2BRRL 3QWOB 1G9ML 2D7TL 5IHUH 4WEUD 1K4CB 4JDTH 4HUXB 4HUKB 4F7MA 5INDB 4QLRA 3JV5A 4TSAH 1N3NB 3DROB 3FHAA 3QQNA 5IVXF 1LO2L 3T4AB 1XGRB 5M95B 1IL1A 1I75A 1BVZA 5EBGA 2NZ9D 4Y1AD 4TSBH 2FZ3A 2RGSA 3RY5A 1LQSR 2F53A 3PWPB 2YKLH 4HWBH 4JO4L 4PFEA 1CG9A 4YHPA 5SWQA 3FRPA 2J8HA 1FG2B 4M1GL 1NH6A 1ACYH 4QOKA 5I1LA 4Q58C 1G7QA 4D9RE 1JFQL 4P5KA 4G6AC 3L7EA 2OZ4L 4J4PD 3QISA 3IXTB 1GGIH 3QEQA 5D1ZA 4I2XE 1ETZB 3MJ9L 3CX5K 3QPXL 2IADA 1FIEA 2H8PA 3QIUD 2JCCA 1F4XL 1NLBL 1OAQH 4H0HB 5FV2A 3UTTB 4K94H 5ETUA 1DUZA 3SDAC 4P9HH 4W4OC 4Z0BL 4HIHB 4PGCB 2PYFA 1FYTB 3MGTB 3PP4L 5D6DA 4KQ3L 2ICWA 1EGJH 1Q9KA 2GQHA 2ED7A 1UM4L 2PCPA 4LDOB 4X80H 1MCHA 4YC2B 1YEKL 2NW2B 4QXWA 4P2OD 5A16A 1OGAD 2A38A 2V5SA 3VFMB 1F5WA 4AY0A 3CFKB 5E5MB 5CD3A 2IBBA 4K3EL 5SX4H 5IR1B 4LBEB 4KKLC 2WP3O 4GSDL 1AD0A 3DXAB 4J2XA 2G5BB 3AREC 3R06A 4Y2DA 3N1PC 3BRFA 1KPUA 5ITBH 4OLVH 7CGTA 4NO0D 1RIVH 3RVVC 5BZWA 3U36A 4PY7B 3V5DB 4OF8A 4AENA 2IF7A 3FT3B 4OCSL 3ROLA 5EFIA 3VXTB 4TVPD 4PV9A 3FQNB 1I7ZA 4PJDE 1P4BL 4XGZA 2FSEB 5GS0L 1MRDL 2VXTL 5FYJE 3MODH 1OB1B 4PLJC 1F42A 1CVRA 3BP4A 5F71A 3U9PL 1DSFH 4EN3D 3NIDE 5L9DL 4OGYL 1CR9L 2RB8A 3MV8A 4Z5RB 3O3EA 1XCTB 1JPTL 3U0PB 4Z9KB 4XVSH 3CFIC 4S1SL 3ZLQC 1NBQA 3D39B 1LP9A 3GI8L 4CU8A 3O6FD 4GKNA 5F7KC 4LCCA 4MQSB 2XPGB 1EVUA 5C3LD 1B0WA 4AMKL 3RHWF 1RZIB 4DKFL 2IQ9H 1R3HB 5GJSH 5DRXB 5IBUG 3MRRA 5EZOH 1ORSB 1TJHH 1R3JA 4IS6B 2LU4A 3LB6D 2BOBA 2YPLA 3KPMA 3PNWB 4ODSH 1OP5H 4LNRB 1I1YB 4PRPD 1AE6L 4O5LL 2Y25A 1GGTA 4LLVB 4G43B 4RMQA 2YN5A 3KS0H 5IG7B 5GGQH 3CDFA 3QUYA 4KKCC 2HWZH 3TO4C 4OT1L 3C8KA 3QIBA 3OKKA 5HVWA 4HCRL 4K3DH 1T66C 5E56A 2AKRA 4Y4HD 4W4NA 4LLDA 5F1SA 2Q76B 4MVBD 1QEWB 5GRVL 1NBZA 2AXHA 4ZQKA 5FB8B 3FO2B 2MHAA 3GBNL 3RL1A 3O2DA 1UGNA 4JFXB 4R0LB 2B7DT 2XG5A 2DQEL 5LAXB 4LCUA 4ODTL 2C1PA 1IKFL 1MFAH 5F7EL 2EEBA 1YECH 3ZDYF 1QO3A 2ZSVA 3MO1A 3ZKXC 2FJHB 1QFWH 2BCKA 4X4ZA 3DI2B 4LAJH 3RY6C 3S97C 4L4JA 1IL1B 4GQ9H 1IKNC 2HT3D 5C3TA 3ZSSA 4HWZA 1IQWH 2LAAA 4X7SH 1FZMB 1C12A 3OG6B 4PJCE 2HTLC 1MAJA 5EO1A 3S5LG 5JNYA 4HUVA 5J7CC 5SWQB 3BSZL 5C0FA 4CBPA 4IHOB 1UT9A 3D5OF 3GJFB 3RVWC 3IJHA 2J7LA 3RI5K 5KSVA 1WIOA 2IMMA 3B83A 4QOKB 5DS8A 5I1LB 1KJ2H 2NY6D 3PF2A 4BZ2H 5AYQA 4P5KB 1A7OL 5FIEA 3L7EB 5BOPA 4QXGH 5B22A 1NCWL 3BKML 1TCRA 2F9BT 5L88L 3Q3GB 5KAQF 3D85B 5EZJA 2ERJB 2H8PB 2JCCB 4WEBH 3MOQA 3VFOA 3KYMA 3QDGD 4NQDD 1YN7A 1KN4L 1Z0MA 4LIQH 1X7QB 2D31A 5EU4A 4PJHF 4Z7UF 3TN0A 1AP2A 4HIXL 4NUJA 1HKFA 5FDYA 2CDEA 5C6TL 2R4SH 3C60C 3E8UL 2D7OA 1K4DA 2X4TA 3EYOA 2PCPB 2YD4A 4NQSB 3NBNA 5JMRA 3ECBA 1TENA 4JEGB 5J12C 5FYLE 1JHKL 1UQSA 1EBPA 1ZHNB 1MJUL 5I19H 3KHOA 3G5YA 1RQ5A 3V6OA 2YN3A 5I1AB 2HLAA 2FBOJ 1MWAA 1J1OH 5D2LB 2DBLL 3MACL 4CADA 3L6FA 4HPOL 1NKRA 1MLBA 4LSSH 3JTTA 1BAFL 4OFYA 3D25A 5IMMA 2LU7A 1CFSA 1KYOJ 2P8LB 3R06B 1NC4A 4PJEE 1HDMA 2NY0B 3ULVH 2GSGA 2UWEA 3QCUL 4XAWH 1KFAH 4RGOH 5I8EA 1OT1A 1Q9LA 4LARH 5BZWB 4HD9A 3NIFF 5EFIB 4PV9B 4IEFB 1I7ZB 32C2A 3DRQB 1JHLH 1TETL 3K3QA 1QFOA 3NABH 1T22A 1QR4A 3EYSH 3U6RA 3EYUL 4LCYA 3JUZA 5C0GA 4C58B 3UJTH 4KHXL 2FX8L 1BD2D 4I8DA 2DDQL 1TZIA 5FGSA 1J11A 4HGKC 3MV8B 2P5WE 2A9MH 1LP9B 1YPZA 4NZTL 3ALWA 4RFNC 4GKNB 2V7HA 2AXFA 5K9OA 1NFDB 3VG9B 5JTWA 1K85A 3D69B 1EO7A 4RMVA 5DJ2A 1K2DB 2E6PA 4AL8L 2HT4C 2X1QA 4W4OA 3C6LA 2E9BA 5CZVH 5ICYB 3OZ9H 1R3JB 2VDQH 4G8GE 5HYSA 2ICES 2DOCA 5DI8A 1VEMA 3LKPB 1H3UA 4ONFH 2HA1A 2QQKH 4XRCA 5AZ2L 3GMRA 4YHLH 3SQBA 2OP4H 4NJAL 5EU5B 4R7NA 5C9JA 4GUPA 4HHAA 3TJEH 3AS1A 3ULUE 3QIBB 3OKKB 2CRMA 3BI9X 3BP6A 2R2BA 4LAQH 1NGPH 4R26L 5CEXA 1T6WA 1AKJA 1SMAA 2AKRB 2CR3A 4RBPK 1QKZL 3OAYK 1EEZA 1R3LB 1GPOL 1NBZB 3GO1L 4U6VL 3RL1B 4LL9A 1OM3L 3QG7H 3AREA 1JYNA 4F80A 1XIWA 2MMXA 3RWEB 2JJWA 4LCUB 3UEZA 2OTPA 4C59B 3TZVD 3P0VL 4KI5D 4HIIB 2IFFH 4FXLA 4KDVA 2ZSVB 3MO1B 2LTQC 4J7RA 5D2NE 4OLZH 2CRYA 2Y7QA 3C8DA 4EDXA 2FECL 2BCKB 4X7FC 2NY1B 1CFVH 4XB7A 4CN1A 3RWFA 1JNHA 2YPVH 4LLYA 3DVGA 2O5ZH 5E2UL 3EYVA 2ZCKH 1HQ4A 2H2SD 2HKFH 3EDDA 4R3SA 5A2LH 1KC5L 4I2XA 4HWZB 1C12B 4QRRA 1J1XH 1PJ9A 3JUYA 1TNNA 2HT2D 4M7KH 5DHYA 5JNYB 4HUVB 5MEQA 4H88L 4P2RE 5C0FB 4HG4J 4PREB 4K23H 5FOBA 4C4KT 4G5ZH 1RULL 3IJHB 4PG2A 5KSVB 1BBDL 5DS8B 5F9WB 2B1HL 1FAIL 1T2JA 3VW3L 4ZFOA 1EXUA 1KCUH 1GGCH 3KPNB 3CZFB 1TCRB 3RGVC 3QEGL 5CZXD 4XPFH 5IMKA 4WI5A 1G1YA 4WY7H 4K3JH 3ULUC 3VFOB 2ICEA 3BHBA 2ZCHL 1NJ9A 5ALCH 2Z91A 2D31B 5SWZD 4NFBA 4NN6C 1YZZA 2GY5A 2XN9E 3TN0B 3GK8H 4F7PA 1AP2B 4OB5L 4NUJB 3QCVL 4X7TA 1ZHBB 3MV7A 5GISH 1M1SA 4PJAB 3MA7A 3VMPA 1K4DB 2X4TB 4OSUH 1G9NL 2FB4L 4HK3N 5SX4I 2KL6A 4GKSB 4NT6A 4DCQB 2GKIA 4LRIC 4F9PC 2DQFB 4MCYA 1S8DA 4HWEH 2WQ8A 4G6JH 1NUDA 3G5YB 5TDOA 2HLAB 4U49A 1N64H 1W72A 2ZUXA 5DLMH 4CADB 3NPSB 3L6FB 4JO3H 5HDLA 3JTTB 4XP5L 2DQIL 4CMMA 1QSVA 1QVOA 1YNLH 4RDQG 1IE5A 3D25B 5IMMB 3BN3B 4LHUD 4QXTB 1KEML 1HDMB 4HBCL 2H45A 2PXYB 2IALB 2UWEB 4X7CC 3RY6A 1RZKH 4LVHC 4QTIH 1FFOB 1KG0A 1MUJA 3L3IA 1YEGH 5T1KA 3CUPA 2KQMA 4JGMA 3M45A 4UIMA 5E08H 3IS1X 3WDIA 4C56D 1XH3B 2RR3A 2FGWH 5E0QA 5F3HB 4JY6A 2VZSA 1BF8A 4FQ2L 2EE2A 1T22B 5ICXA 4OZFG 1RHHA 3F58L 1IBGH 3B6SB 1H3GA 4LCYB 3ARUA 5C0GB 3HUJE 2F74A 5DWUH 1H8SA 1UKQA 3CLEH 2FDBP 3VGDA 4YR6A 5FUOL 3RWDA 4YEEA 2CIIB 4XPAL 4JVPA 1TZIB 1VHPA 1YNKL 5D1QA 2BHZA 5C71A 3V4VL 5F1OB 3PHOA 5T1DH 4C4KO 1OTTC 2AEIT 5ALBH 4QCIA 5E99H 5DJ2B 2OI9C 2MFNA 5BV7C 5L8KB 3C6LB 1YYLH 2H32A 2NZ9C 5SWSE 2FH8A 4U3HA 5M7QA 1L9NA 1E4XL 4Z77A 3BD4A 4OLUL 1OP3H 3CFJB 4Z7NE 5C0JA 2D4DA 2QSCL 5T3XD 3O8XA 3WIHA 5JOFB 3TLRA 3GMRB 3K8LA 1BWMA 3MRDA 3BW9A 4R2GD 5EO9A 4R7NB 4MQXC 4TVPE 5C9JB 4OV5A 3BP6B 4NZUL 1AY1H 5HY9B 1EVTC 5T33H 1AKJB 2RQ8A 1U8MA 4J4PC 4JANB 2NTFA 1X3DA 4YHZL 1EEZB 4Z0XA 1L6XA 1G0XA 1IGMH 1DBBH 5JQHC 5IJKC 2A77H 4PJIA 1XIWB 4HJJL 5D6CB 2OX5A 5GXBB 3R0NA 4L8BB 3QQ4A 3JWOL 4NKQB 1U3ZA 4RMRA 3G9AB 1QOKA 3RUGE 2HG5A 5GGVH 4EDXB 1J18A 1GAFH 5DRNA 5F7LB 2YC1B 3TVMC 1JNHB 5KVEL 4LLYB 5HJ3A 3EYVB 3FJTA 3LN9A 2VR9A 5F9OH 3EBAA 1TZGH 1CBVH 5KSBE 5BVPH 4NKOA 1QQDB 5LBSH 1R3IL 1EO8H 1BZQK 2DMCA 3HFML 3WFHB 3VXRE 2VLRA 5IMOB 4OI7A 4NKDA 3RPKA 2VQTA 5DTFA 5JIKA 1EXUB 3PQYA 4UAOC 1KCRL 2VAAA 2D7PA 5T5FH 5DUML 2DQCH 1FIGL 1B4JH 3DX8B 1BFTA 2NPLX 5ITFA 1B3JA 3U0WH 2E8YA 4CU7A 1JF6A 1KELL 3IFLH 2ICEB 3BHBB 1FCCA 1UB6B 4BA8A 1EHXA 1O7SA 4AIXA 4XC3L 3TV3H 4OKVA 5I18H 5TFSH 4X7TB 3MGOA 4M9OA 5DZLA 1DL7H 4EN3C 5KSUA 4K9EH 3MA7B 4FXKA 2FJGA 3SKMA 1KXTB 3QUXA 4S2SA 4WW2C 4F3FA 4Z7QF 3JWNC 1EO5A 4PJEA 5TDNA 3MRBA 3D0LA 3O6FC 1B2WL 1LO3L 1LE9B 4MCYB 1S8DB 3MJ7B 1G9EA 1RJZA 2H9GA 1DJSA 3BZFB 1D5IH 5TDOB 2GY7B 2DN7A 2I5YH 4XC1L 4PB0L 1P53A 4LGSB 1RIUL 2NMSA 3MOAL 3LB6C 3H42L 2R0LL 3RKDD 4CMMB 4YWGL 1QVOB 1T04A 2FJFB 3EJJX 3HCVA 1UC6A 1A6ZA 3TCLA 5F1NA 4NFDA 4F37K 1JWUB 4Q74A 5TPWH 3MRKB 4G9FD 1KG0B 4LU5H 1A21A 3L3IB 2YEZA 1NEZA 1TQBB 5T1KB 1V3MA 3S9DB 4UIMB 1JF1B 3LD8C 1I3GH 1VADB 4ZG1A 5KTEL 4GW5B 1DBJH 4Y16B 2VO5A 1CQKA 4XMPL 1RHHB 4MVBC 1H8OA 3FQUB 2VQ1B 5K9KA 2F74B 2V9TA 2ZOLA 2BX5A 5IQ7H 3RWDB 1I7TA 2VMFA 4HS8H 1JV5A 5D1QB 4MMZC 1GHFH 2N7AA 3PHOB 4NQEE 1N59A 4UQ3B 1A64A 3PL6A 4WFGD 1FORH 1CFNB 5EORL 4LHUG 4QCIB 1ZGLM 4ACPA 4CNIA 4CVWA 5HVHB 2W38A 1YEEL 3CFEB 4QYOA 2HT3C 3G6JE 5E6YA 3KPQA 3WKML 4Z77B 3MNWA 5J06A 5C0JB 2XZCH 3O8XB 2G5RA 1KTRL 4PJ8A 3KLAA 1Y6MR 3MRDB 4LLAA 4AH2A 3BW9B 4G42A 3HC3H 5EO9B 4LRIA 4NP4L 1JYVA 1A8JH 3EYFA 1CGXA 2NY6C 4OV5B 2J8UE 3BJLA 4Z78A 3OQ3B 4Z6AT 3J7HA 4EIZC 4EQ2A 3NCCB 1XR8A 4DN4H 1ZTXL 2NTFB 2VISA 4ZS7L 3QFJB 1A0QL 1GVIA 4Z0XB 1BD2E 3BO8A 4EQ3A 2ZSWB 5D1XB 1HSBB 2CSPA 2NY4C 4ODHL 1DQMH 4PJIB 4NSKA 3DX7A 5DJ0B 3MTRA 4KH2A 3REVA 3PUCA 3QQ4B 2X4PA 3CVHH 4KRNA 3D2UD 2Z93B 4WW1A 1N7MH 4BH8A 3NZHL 1TMCB 5DRNB 2JB5L 4Y4KB 4UOW0 1U3HD 4XZUB 5DJXB 1WISA 5I76A 4PIRF 3S5LA 4IRZH 4G6FD 4QNPE 1N4XH 3KGRA 3E3QC 3SKOB 3G6DL 3LZFH 1QFHA 2GEEA 2WM0A 3QHTC 1BZ9A 1MCOL 1SEQH 3QJHA 1I9RH 2KZ1B 5CKGA 4DTGH 1FFPB 4FFVC 1Q0XL 3H0TA 3NA9L 5KSAD 2HFEB 4NM4L 1FDLH 4JFQB 4IOIB 1IGTA 5DHVA 1F00I 5C07B 5H37H 1R5IB 2VLRB 4NKDB 2E7LA 5DTFB 3T0ED 3T77B 3WEXA 3PQYB 1MF2H 2I60H 2F58L 2HLFC 4DKEH 1P84J 5EPMA 2W9EL 1NBYB 4XP1L 5FHAH 4U1MB 4LASH 3BH8A 1EMTH 2Q8BL 3TA3D 2PYED 4Y1AA 3P30H 1YJDC 5BMFH 4UU9A 4AG4L 3UP1A 1X5AA 5ITFB 1NDMA 4KI5E 2UY7A 3HZYA 2ID5A 5GIRB 4XXCC 3X17A 4H0IA 3DUSA 5IEKA 3NFPA 4OKVB 5IVXE 1AGBA 1IZJA 2IBZY 4JFHD 2XWBA 4KHTL 1OLLA 7FABL 3D6GA 3X12A 3QUXB 1C1EL 4DVRL 4J4PA 4IDJH 5C0CD 2XZAL 5TDNB 3V5HB 4I18C 3TNMB 5MENE 2B1AL 4LSTH 3QIUA 4BUHA 2H9GB 4J3WA 2RJMA 3FN3A 5EDXA 1KEGH 1JGVH 2R0KL 4XHJC 2AGJH 3WHXA 5GS0D 4LSRH 4NRZA 1IEAA 2NY5H 3MYZA 3F6IA 1GZQB 3U0TA 3QUKB 3MMEA 1C5CH 4O2CA 3HCVB 4PJXF 3PXJA 1A6ZB 1NAML 3KPLB 3L3OA 1RZ7H 4YDLB 4MCZB 2V5YA 3O3DA 4ZSOB 2YEZB 1IC5L 2P8MB 2X09A 1NEZB 4P2OA 1OGAA 4X6CF 3V52L 1BX2A 3N9GL 1IGIH 2BHUA 5KW9H 3S88L 4GMSH 2JTDA 1I8LA 3LRGA 5E1HB 5D7KE 5DGRA 1RHFA 4MJIB 5FYKL 4NO3B 3BAEL 3W39A 4LF3A 3ZL4L 4KTEL 2ZOLB 1BIIA 4X99B 3ARTA 1AH1A 1I7TB 5CJOH 4FMKA 4O02H 4PRAA 3OG4B 5DVOA 4KI5C 2BSED 5CJQH 3UXFA 3MUY1 4NO0A 2BERA 3PL6B 3BEVA 4OCWL 5CINH 3FB8A 2VDRH 4AIZA 5TDPA 3MXVL 2GSIA 4CNIB 1KTKE 2WWKT 1AGDA 5JIIA 2F5BH 1E28B 4U6XB 4FQPA 1XF4A 2QHRL 3LQZA 3RHWK 3WN5A 4DAGL 3RZWA 5IHLB 2C1OA 5DUBA 5I6XC 4NWUH 1R0AH 3PE9A 4CDHA 5D5MB 4WENB 3S35H 3BDYL 4X5WA 2VERN 2HT2C 4X5LA 4JDTL 5ADPL 5AZEH 3LKOA 4PJ8B 4ISVA 2BMKA 2CK0H 4HPYH 1IC7H 4QHUA 4WW2A 3RWCB 4TSAL 1NLDH 2BVTA 4G42B 5F72S 4C56E 2YHGA 4FQLL 1EFXB 3QXWA 4P5MA 3BEWA 3OGOE 4BFIA 1T7ZA 4Z78B 2PTVA 2E8ZA 3LQAL 3QXDA 5DD0H 4TSBL 3RUGA 5C0EB 5BS0B 2YKLL 2VISB 5ICZB 3O6LH 1XGTA 3BYTA 5CZXC 4PLNC 4KFZC 3O81A 1EUTA 2J4WH 2WV3A 5F88A 2DBJA 5D8JH 2BVEA 4PRPA 5F93C 4JFEE 4TPRL 3MLWH 3DURA 1J1PL 1AXIB 5EUKA 5L7XH 4FQCH 4NSKB 5DD5H 2HRPH 2OSLA 3REVB 4YDJB 3V0AC 2X4PB 2VZVA 3I85A 5HHVL 4N68A 4OGXL 1UWGH 4ELMF 1GGIL 2V9RA 4WW1B 3HRZA 1I8MA 1MJ8H 3GSVA 4BH8B 4Y4HA 3JSSA 5I76B 1QPPA 2EDEA 4X9FA 3S5LB 5F7YC 4GBXB 3SJVE 1WIPA 3X11B 5JLZB 2IPUG 1BZ9B 4ODXB 2PW2A 3QJHB 5IT2L 3MLUH 4HS6B 1KBGH 1T1YB 3KPSD 1ND0A 3B9EA 1PKQE 3G6AA 1IGTB 2FD6L 4JKWA 3ARXA 1JN6A 1BFOA 4NQUA 5BVJA 3WEXB 1EZVX 2NY7L 1IM9B 1QD0A 15C8H 5EPMB 1NGXA 1VDGA 5C9KA 3BH8B 1A3LH 5B4MD 4KJQD 3H9SD 3P11L 4Y1AB 5D96B 3SKJL 2GAZB 2WWKO 3QWRA 1NDMB 4TULH 4DOHE 3HZYB 2X5PA 3ZDYE 3TT3L 2AQ3A 1UCBL 3LDBC 5IEKB 5J89A 2H26B 1NGQH 1DP0A 3QNXA 4WHTA 3H7LA 3GSOA 2XWBB 4P99A 3J8F7 2OMNA 1QYGL 3X12B 3T4YB 4K7PH 2DAVA 4HX1A 5LXGL 3BPCB 4XPHH 3OGCB 1PLGH 3QIUB 4P48A 2HFGH 2EDHA 5K9JH 3WUWB 3QDGA 5E8PA 4NQDA 3CDGA 4PV8A 1MCFA 1NC2D 3FMGL 5C8JA 4NRZB 3F65A 1IEAB 2Z92A 1MCRA 1CDGA 1DSFL 3U0TB 3MMEB 1RUPL 2YD5A 1DEDA 4XVSL 4O2CB 3B2VH 5TE4L 1MLCB 2C9AA 3L3OB 3HE6B 4R90H 2PTUA 4R2GC 2Y36L 3LS4H 4P2OB 4U2ZA 4OZFA 5A2JH 1OGAB 3OX8B 1FLRL 5EZOL 1X44A 2R1XA 2X41A 4M93C 3QP3A 3SKUD 1PX3A 1TJHL 3AU1A 4Z7UE 3KYNA 3NTCH 2DRUA 1D7FA 4Y19D 1WWBX 2MWCA 1F11B 1T4KB 3LMJH 5JUEH 4JPKL 5GGQL 3W39B 3CXHJ 1FNSH 1INEL 4UINH 2HWZL 2JELL 3M1BB 2P5ED 3O9WB 1T80A 4NWTH 5JXAH 3F12A 4M43L 4PYHA 4PJ7B 4AIZB 2H1PH 3QNZA 5H35A 3VFTB 2GSIB 3NCMA 1AGDB 1RUAH 3UJJL 1XF4B 4XXCA 3WN5B 5IB5A 2C1OB 5IW6A 5DUBB 2ADGB 2XZQH 3EKCA 5A40E 4OZGF 4RMUA 3QJFA 3SQOH 4G9FE 5DK2A 2VDNL 4IM8A 2BMKB 4P3CH 4RFOH 4ZO6A 3R1GH 3EFDH 3HNTL 3NIFE 4URTB 5TQ0L 1QFWL 2NX5D 3I2CL 1NCDL 2OLDA 2PO6D 1O5DT 4I18A 1RD6A 3EDKA 4PR5A 3ZE2F 3MZTA 3QXDB 4XNXL 2V17L 3MRMB 4O2EA 5C0AD 1IQWL 4X7SL 1KB5L 5DC4B 5C09D 1WT5C 1XF1A 4MB4A 3TEUA 4ALAL 3T08A 5AG8A 4D9LL 1IM3A 5EUKB 1T1WA 3UTQA 4DN3L 5L0QB 4OBRA 2OSLB 2PW1A 4QXGL 4NO2A 1Q38A 3QULB 1I8MB 4MLSA 3GSVB 5CSZB 4YHIB 4XBPB 5HHOD 3SDXF 4Y4HB 1JGLH 2GW5A 2LQRA 4KRMB 3RVXD 4WU7B 4JO1L 4MA8L 4WEBL 1JRHH 1J5OH 3OSKA 1IFHH 1MCBA 3WSQL 2Y5EA 3I6KA 4F57H 3UBXI 2PW2B 1J7VR 2ZNWA 2JIXD 1MFDL 3TZVA 5KVMC 4R4BB 1ND0B 2BC4B 4PJGA 1RUQH 1OP5K 3KPOB 4L1DA 3RKDC 1CDYA 3ES6B 4PRID 1CLOH 5GRUL 3BH9A 5KS9F 3O45A 5BVJB 5IVXA 4QRTA 3U4AA 4RQQB 2V5RA 2EO1A 4UZGA 3ARSA 4MA7H 1SJXA 1U95B 4LSSL 4HQQL 4KAQH 4FP8H 1IGYA 5F8RC 4M03A 5FK9A 3NCBB 3ARGB 4K94C 3ULVL 2YUWA 4P9HC 3QNXB 3OR7A 1HWHB 1QSEE 1KFAL 1S7VA 3GSOB 4PJ5E 3WL9A 1IGCH 4NN5C 3RWGA 3VFSA 5J8OA 1RJLA 4U05A 3SO3C 1MFEL 2YD2A 4I0KA 3O2WH 1JHLL 3NABL 4OF6A 4P46B 1ROWA 4W81A 2DLEA 3EYSL 2IPTH 4KVNL 2VDLH 3LH2L 3CDGB 3UAJC 3S34L 1OGTB 4PV8B 4CVUA 1YC8A 3UJTL 5SWZA 2Z92B 3GUTA 3MFFB 4L8SB 1HXYA 3T0EE 5DEFB 4AEIH 5SX5H 1M71B 2Z4QB 3CJJA 2VDMH 4I5BA 4E42A 3QDMD 4UIKH 2R0WL 4E41D 2HFFB 1EHAA 43CAA 3NMEA 4JRXD 3DECA 4OZFB 2VZUA 4S1RL 3UTZA 1R5VA 4WHYG 4NN7C 3MV9D 3RFZC 5HDBF 2R1XB 4EI5B 4B7IA 5CZVL 2R2HA 2VDQL 4KROB 4TN9A 1T0PB 1CK0L 2ZZUT 1MJJB 4ZNEE 4QHKJ 3KYNB 4YHKL 3D9AL 2ZWLT 1CTOA 1S7WB 1UM6H 4JFHE 4ZD3L 4HIEA 2NY3D 3DIFA 5TF1H 1ES0A 1CWVA 5J1AB 1DVFD 4LHUA 1ZT7B 5C0CE 1U8QA 3AB0B 3FFCA 3KXFD 4LAQL 4DGYL 5E8OA 2L7JA 4KY1H 1X5IA 3D1MC 4RGMB 5IOPB 2W0FA 3IDUA 3MYJA 5H35B 4C56A 1MHPH 2AXJA 1I3UA 2Q3ZA 4G8IA 3QDJD 2I26N 4YFDB 2Y9RT 1U3HC 4XPBH 3S37X 1F6AA 4J3TA 3O4LB 1E6JL 3AS2A 4G3YH 4MZ2A 5FGCE 4V1DB 5IB5B 5IW6B 4WWKA 1ZLUH 4WV1B 3TYFA 4FRWA 2W91A 1KYOK 2IFFL 3DVIA 3Q6GH 3FCTA 5DK2B 3TIDA 4IRJB 4M7ZB 3HR5A 4OLZL 5KSAC 4PP2A 5EC2B 3TNNA 3TBSA 1X5YA 3KYKH 3BN9D 3CSPA 1CDUA 4HUNB 3T0EC 1LO0L 4GAGL 3I3EA 4PR5B 3VXSB 1OAKH 3D3VD 4LIQE 1FVCB 3P9MA 5ESVA 3TA3C 5IB3B 4M7KL 5I1JH 2GT9B 2EC8A 1SVZA 3C5SA 4N0RA 4K23L 3HC0A 4HWUA 4FMFA 1V3LA 1BFVL 1WBYA 1G7HB 2BSSA 3B5HA 3VRIA 3O2DH 5LWYH 4BKLA 5DMGC 1PEWA 1GGCL 3CGTA 1BOGA 1T21A 2A74A 3S36X 3BIAX 1A9EB 3BJ91 2E9WA 2VTFA 12E8H 1A4KB 5CP3H 3HA0A 5JHDD 4Z18A 4OD2A 5IKCB 2YZ1A 3I6KB 1P2CA 4OJFH 4U6HB 5GS0C 3TZVB 1JI2A 2QADD 5AYUH 4X6BA 5GGTA 1NGYA 4YGVA 4PJGB 1GC1H 5K9QI 3EO0A 5F6IB 3HS0A 4IJ3C 2BDNL 2HRLA 5MEPA 3T3PE 3BH9B 5T1MA 3E6FB 3U1SH 4I4WA 3A67L 4QRTB 1TQCB 3WJJC 1WCBA 3CU7A 3VD7A 3SE3C 3GSNA 1N64L 1YY8B 5I1CH 4MX7A 4M8VA 2VOTA 4YHOH 4JO3L 1EEYA 1FNGB 1MCJA 1NUGA 3S3SA 3W2DL 1YNLL 3P0YH 5HGDB 1NCNA 2DQGL 1IGYB 3CX2A 4N1EA 5FK9B 4OLWL 2AVGA 3GB7A 2R29H 4JVUA 1IAIH 1RZKL 3PABB 2VSDA 1S7VB 3QUZD 3VFSB 4NQCD 3LEYL 5E08L 4ODWA 1UXWA 1A5FL 2ESVE 1WT5A 3C6SA 1VKXA 3OKEB 4N0CC 4TQEL 3MLZH 4MWFA 2X4SB 1MCDA 4FQXB 5DD1L 2VSCA 4PJHA 5SWZB 1G7JA 4HG4K 5DFWH 1ZA6B 3VXUE 3UX9B 1HXYB 1CGSL 4RSVA 1KN2H 2CDFA 5T1DL 1G6RA 1BQLH 4I5BB 4E42B 3OJMB 3F8UB 2BJML 4XCFH 2ARJA 4DUVA 3QH3A 1IEHA 1QSFE 3G5XA 3QIWB 1OWWA 2R2HB 2HH0L 4HWBA 2PKDA 3BMVA 3T0VA 2DF3A 2YSSA 3QAZB 4JB9H 4JN1H 1S5HA 4HGWA 4HIEB 3DIFB 1ES0B 1N0XL 2JCCF 4Z7QE 3DBXB 5DJYA 4U2YA 3Q1SH 1X6LA 2OXGA 4L9DA 4YO0B 3FFCB 4OFPA 4HKJB 5DQJA 1AY1L 2YK1L 2OYPA 3DMMD 5I1GH 4J6RH 5E8OB 1NGWB 3TT1L 5DO2D 1KLGB 2RAMA 4G8IB 4YPGB 3KR3L 2P7TA 4JDZB 1F6AB 4LKCA 2MOVA 2A6IA 4LLQA 1RU9H 3QI9C 4KUCF 3WCYA 2P8PB 3ILPA 3T0WA 4WWKB 3HAEG 4YHNA 4JM2B 1I7UA 1ZV5A 4OGAD 2QQLL 5FKPA 4P9MH 1RZ8A 4HT1L 5D2LF 3I6LD 3BDXA 1U8KA 5GGVL 1TFHA 4LSQL 4P4RA 1I1AD 3QG6B 5HI3D 5LCVH 3W9EA 3ZTNL 4YXKH 4L4VD 5E2TH 5EZIH 3AXLA 4Z95H 4Y19E 4EDWL 4XNMB 3NH7H 3ZHLA 2Z35B 4Q6YA 5JO5B 1PG7W 5B4MC 4KJQC 4M62H 4NKMA 1CBVL 3LVEA 2CIKA 3FO9B 4YBLB 5BVPL 5HYIA 1MAMH 2P24A 3C5SB 2EDFA 2AV1B 4YZFF 5HYJA 1S9XB 3HC0B 5I8OL 2OM5A 4FFWD 1WBYB 2BSSB 3VRIB 4KC3B 4X4ME 4BKLB 3HI6L 1T7VA 5JR1H 3K0WA 2FWOA 4NIKB 1BOGB 5EIVA 3RIAK 3NACL 2YUVA 5HI5D 3QEHA 4TUJA 3IDIA 5T5FL 5I16B 1MEXH 5IHBA 4I3GA 4JFDB 1B4JL 4R96B 1AI1H 3UCRA 2XY2A 5IWLC 3NGBC 4XXDB 1LP9F 2CKBA 1N6VA 1NFDF 4BSWA 1P2CB 1UYWH 3AM8C 3S96A 3SE9H 5EWIH 3TV3L 2NX5E 2OTWA 5TFSL 4Z8FH 3O2VH 1DL7L 1WBZA 4LGPB 4X6BB 3VE0B 1U0QA 3MRCB 4JPWH 4K9EL 2A0LD 2K1MA 5IB1A 1OP3K 2NY2B 1T03H 4UUJA 5T1MB 4IRSD 1ZLVK 1WCBB 3GRWA 1G7IB 1ORQB 4M9PA 1D5IL 1MCNA 2ORBL 3GSNB 1UWEH 5EA0H 2DQJH 1EEYB 2HVKA 3RJDA 4XP9H 3BPLC 5KSAA 5I1EH 4L3ED 3GB7B 2FL5B 2B2XL 5HHOE 5BXFA 5TPWL 1PYWB 4Q0XH 4CW1A 1HHHA 4F33B 1U6AL 4WO4D 2BSRB 3QA3A 4MNQE 4P5TD 1P5VA 1UXWB 2AP2A 1FC2D 1I3GL 4WUUA 3EOAB 3FL7A 1JYWA 1C16A 1OCWH 4DGVH 2PYEA 2D9QB 5INCA 4XCNA 1MJ7H 1Q94A 4MB3A 1DBJL 1PZ5A 1E6OH 4JO2L 1U3YA 4K8RL 1VKXB 1QRKA 1IAOA 3U9UA 4GG8A 3WO3B 3WNNA 4GH7B 2C3GA 2DLHA 1G7JB 5IQ7L 4PRIE 4QHKI 3ULSA 2CXGA 3PWPD 1W72H 2FR4A 1GHFL 1NFIA 1CGUA 2CDFB 1F45A 3EJZD 4OCNC 5AEAA 1G6RB 4CGTA 1KOAA 3GMLA 5B39B 2X1OA 2WIIB 5C0CA 3KVQA 5IMLA 3M17A 1S7SA 4JR9H 4P49A 1MCCA 3HMXL 1A22B 3FB5B 3TBWA 4QRUA 1ZHKB 3G5XB 5EU7E 4TRPH 3SE8L 4B5EA 1ED3B 1NMCC 2FEEI 4JKLA 2H2PC 4M4RA 1CDIA 2XZCL 4JQVC 1S5HB 2KKQA 1RMFL 5CP7A 2YD7A 2G2RA 2Q7YA 1IQDA 4U1GB 3VGFA 2R1YA 3UTTD 5DJYB 4X6EB 3I3DA 4MXWL 3W0WE 2W0KA 5GGVY 4NGHH 2IPKB 4ZFGH 2V5MA 3DV4B 3VFUA 1W2KT 4PJAF 1VERA 3GI9L 3O0RL 3UBXG 3NZ8B 2P7TB 4Q7DA 5FUZH 3RVXC 4EZMA 4PRHA 2A6IB 3BQUB 3HG1E 4LLQB 4PJXE 4HKZA 5J57B 3RZCD 1DQML 4PJDB 1JK8B 2OL3B 1UJ3C 1MRCH 2XKUA 2BVPA 4YHNB 3DO7A 1OVZA 1VENA 2WIMA 1YMMA 2E6QA 3H3PH 5FKPB 5EZLA 4E41E 4GS7C 1RZ8B 3DYPA 5DZOA 1A7NH 1U8KB 5DRWA 2DWDA 3N1MC 4EBQH 4P4RB 4YDIH 3WIHH 3DXAD 3W9EB 2VXVL 1LHZA 2LFGA 1FNFA 1OQOA 4HCRA 3AXLB 3QHFL 1N4XL 2UWEF 1KUMA 2Y5TB 2A6JB 3FQXA 4CMHC 4NKMB 2W9DH 4DTGL 2EH7H 5J6HA 2ZUVA 3SCMB 1U58A 3VRLF 5HYJB 3CSYA 4G6KH 1HHGB 2OJZL 2EDLA 5EU7C 4KK8D 2AJVH 4H20L 4UV4H 2Q6WA 4DFHA 2J3SA 4LMQI 1D6VH 1GOHA 1WC7A 2VLME 4U7SA 3VGEA 3ZYIA 1M6OA 4DKEL 3T1FB 3P4OA 1S7XA 3O6MH 3VFGL 3MBXH 1QNZL 3HC4L 3MUGA 4XBEL 4DZ8A 4AQOA 5BMFL 3D39D 3VWKA 5BO1H 4MDIB 3GSUB 1RZJH 2W0LA 5CGTA 2D03H 3QPQD 3PWJB 3STZA 4AEEA 2FHCA 2VC2H 1JGEB 2WINB 3CFBA 5D7SL 4LOUD 4LLWB 3HZKA 4MD0A 4MLIA 4QXUL 3C9NA 3D3VE 3NCYS 4RIRB 2J5LC 4UUJB 2EXYD 2M8XA 1LNUA 1Z3GH 4OTXH 4OIAA 3EAKA 2VDOH 1F3RB 5I9QB 3NA4A 3DTXA 1JGVL 5TE7H 3S36H 2AGJL 4ZXBB 8FABA 2G9HB 2UZXB 4OLXH 4YIQA 2APBA 4OZ4A 2HVKB 1I3RB 3KPSA 1SMOA 4ELME 5GS3A 5KSAB 4P2YA 2XWJA 3T0XA 1MVFA 2NY3C 4PP1C 3T65B 5BXFB 3O3UN 5KG9A 1KACB 4IBLT 4BUGA 1HHHB 3DWTA 1RUMH 3QA3B 3JWDH 1IGIL 4WI6A 5ELIA 1FAKT 4WUUB 4NDMB 3PV7A 2QHLA 3H9SA 2PYEB 4F15C 4XCNB 1P7HL 1Q94B 2ZNXA 4WDIA 1MCPH 1ZVSA 1A3RL 3U9UB 5DJZA 3MRLA 3DSFH 1P6FA 4HDIA 3RDTB 1QRNE 4O00A 2B8OT 1WLHA 1F4AA 5CJOL 2NXZB 3OKOA 4O02L 3CK0H 4KGJA 2CMRL 4NCC1 1DQJB 4QGYA 1RK1B 4KXZH 3ZZ1A 4OCYH 1P84K 1SYSA 2MSPA 5IMLB 5IBTL 3M17B 1S7SB 5IIEB 5A1AA 3TBWB 4NO5A 4QRUB 2V2WB 3AM8A 5HHME 1R0AL 4YEFA 1NC2A 1FZOB 4RGNE 4M48H 4YHYB 3D85D 4DKAA 5L2KB 4NM8H 5KBNC 3MREA 2GJ6B 3WFCL 5T3ZH 1IQDB 5FUCE 1NLDL 2R56H 4PJ9D 4D8PB 2MPAL 5JW4Q 3FOMA 1I3VA 3IAPA 4P57A 1TPXC 1FGNL 2YRZA 5HGAA 4YDKH 5DK0B 2E7BA 4GG6A 2VWEE 1V3JA 3VFUB 1N6QH 3O6LL 2GHWB 1T1ZB 1DDHA 1XF3A 5D8JL 4F58H 5EIIA 5FO9A 5ABDE 4PRHB 1AJ7H 1GCFA 4Y19A 4KUCD 1P7KA 1P6AB 4ERSH 4HKZB 1AGCA 4OCRL 1F8TH 5K9QG 2Q86A 2UZIL 5L7XL 4FQCL 5DD5L 2HRPL 2OS7A 3DO7B 1P7QB 1KXQE 1YMMB 4TTDD 3GM0A 5ACZB 2P5EA 2DI8A 4HWNA 3I02A 3BVNA 5IQ9A 1UWGL 2XQBH 1MJ8L 2DWDB 2A83B 4POZD 3O11A 3OAZK 1E27B 1RY7B 3CVIH 4EUPB 1ZK9A 3T2OA 1AQKL 5ACMA 4M8QA 4ZTOH 4C57C 3K8KA 5GS1C 1KBGL 1FJ1A 5J6HB 3W5MA 2X4NB 2EC9U 2VL4A 1CT8A 3FQTA 3P2TA 3CSYB 4N8CL 4KTDL 4HEME 2FX7H 1DBKL 1D9KC 2VXUL 4ZDHA 2NX5A 3OR6A 5I71B 1M6OB 4DK6A 4PB9H 3WD5H 2PO6A 4L29A 4OM0H 3LPWA 1S7XB 1A3LL 3MV8D 3QUZC 3FB7A 3VWKB 1JUFB 1MI5B 4NJ9L 5C0AA 1NMBH 3VGAB 1RK0B 4OZGE 5FKAA 4LEXH 4XAKD 5C09A 4JQXC 3V5KB 1BF2A 4JREC 4BYHA 1LO4L 2VWEC 1KULA 4J8RB 5CCKL 4L8CA 3I6LE 4XNQA 3FQRA 4HJ0D 2VITB 5LVEA 4GKZA 4NOFA 3G04B 1LK3H 3ILQD 4WHDA 3ZE2E 4L4VE 4K7PL 4F7EB 1L4IA 3HZKB 5HPMA 4FQQB 3C9NB 5TE6H 1TDQA 4MA1B 5GGSA 1PLGL 5HHOA 1NMAH 1S9WA 4KK6D 3LRSA 4EI6B 4N5UA 3IXAA 5D2NB 2HFGL 5E6ZA 3EOYG 2RCSH 4XNUH 4GXVH 3DTXB 1B4RA 1J86A 4M5ZL 4GRMA 3L3HA 5E8NA 2AQ2A 3AS0A 4YIQB 4I0PD 2JIXA 4OZ4B 3U7WH 3SDCB 1H5BA 5ESAB 3KPSB 3B2VL 2J8OA 3OPZL 4U7KA 5I1IH 5ISZE 3SDXE 3IB4A 2UUDH 4O4YH 1Y0LA 4PJIF 2YA0A 2Q8AH 1G6VK 2KQNA 3QRGH 2YD1A 2ZPKH 2CR6A 3DMMC 3SKNA 43C9A 5DO2C 2F8XC 3MPCA 3NTCL 1ZVSB 3ARYA 5I74B 3SE4C 3KLSA 3MRLB 4KMTL 4IMLA 4M5YH 4U1LA 3OHXB 2XT1B 1SBSH 3NCJL 3A6BH 1KLUA 3OKOB 3VXPA 2NY5C 4OGAC 4QHNB 3H3KA 1FL5A 2XN9B 2DB8A 2AJSH 2H1PL 5FDWB 3PDOA 3TPUA 2R9HD 1SYSB 1TTGA 4U6YA 5DK3A 1RUAL 1I1AC 5E1AB 4BZ1H 35C8L 4NO5B 3ZKQD 4JLRA 3DSNA 2BVQB 1NC2B 2B5IB 1VA9A 4KPHH 4YDVA 3PGDA 4P4KB 4PRBB 3MNZA 5E94A 4XVTH 5EUOE 2AK4A 3GMMA 3MREB 4MNGA 2DIBA 4PJXA 3EFDL 1XGPA 1N2RB 4OQ1A 3QDMA 3FOMB 4FFWC 5IFAH 1I9JL 3LN4A 2DJSA 1HHJA 5HGAB 5T5NF 4X6CA 5GQBA 4JRXA 1DLHA 5CSBA 1F2XK 4GG6B 4RWHA 2NW3A 3MV9A 4N8PA 1JZ7A 1W0VA 2YBRA 3HAEA 2M2DA 1DDHB 5EIIB 2RBLA 1YUHB 3PWPE 5FO9B 4TVPH 1ZXQA 4RAVA 4JPIA 2X10A 3OKDB 1DQQA 2IH3A 3P4MA 4BQ8A 2O61A 2FBJH 5EBLB 3N1FC 3BRGC 1DVFA 1HNFA 1FH5H 4LCIH 2P5EB 3I02B 3KXFA 4I3RH 3HUJB 4W70A 2XI9A 1DEEB 3RNQA 1I9IH 5HDBE 5I17A 2A0LC 2AEPH 25C8L 1OW0A 2HJFB 5HVGB 4H8WL 1MIMH 4EXPX 4GAYA 1PGRB 1JRHL 2PXYD 1PG7X 4Y5XC 5C0BE 3QDJA 5E4EB 3ALPA 2DI9A 4TUOA 4BELD 3SEPA 1HHKA 1CFTB 4F57L 3GSWA 1FO0A 2JB6A 3UTTE 1FJ1B 2OCFD 1CT8B 3FQTB 3CXHK 2Y6SD 1ZMYA 3QCTH 3VD5A 3A6CH 3GMOB 1FYTE 3MCLH 4U1KA 2DQUH 5MHSD 3L5WB 5E95B 2BNQA 3OR6B 1MPAL 2PO6B 2WW8A 3B5TA 3GJEA 3NOIA 4K7PY 2FO1A 5DT1L 5EOCH 4WO4C 5L8LB 1A4JA 3D3VA 4P5TC 4PTUA 2AJXH 1NMCB 4YXHH 4O9HH 4Z7OF 5C0AB 1RZFH 4F9LC 4FP8L 5HYQA 5EOCJ 1MFCH 1SM3H 5DR5H 5J3HD 2XOTA 4FN0A 4ZPTA 3L9RA 3C6LD 4GKZB 4JG1H 1WBXB 5J11B 4OUUB 1I85A 5I30H 1JMXA 4HV8A 5DZNA 4ELMA 5D5MF 1TJGH 3EJZC 4DKDC 5GGSB 1NBVL 5IB2A 1XMWA 2VUYA 1YQ2A 3LRSB 1G84A 1VCAA 5JHDA 3IXAB 4NBYB 2EKSA 2P42B 3V6ZA 1JIBA 2ZKHH 4RFEA 3L3HB 1AKJD 3AVEA 5E8NB 3L5XH 2CJUH 2JIXB 1A2YA 2PF6A 4ORGB 1H5BB 4WI7A 2APVA 2VDML 4KZDL 4UIKL 2FIKA 5KSBB 2F5AL 3C2AH 4HK0A 3D39E 4JHWH 1Y0LB 3B4NA 1XGQB 3DV6A 2J6EA 4BH7A 1KENH 2VYRE 4GMTL 3VXRB 3EDEA 4GW1A 5DVMA 4CVXA 3HRPA 1OL0A 5ENWA 1CICD 4MAUH 5GS1A 1GZPA 2X9WA 2FATH 1UM6L 4YC2C 4KXZI 1KCVH 1B90A 5TF1L 2BY1A 5I1HH 4U1JA 4XVJH 2WZPD 1IAKA 3HPJA 3VXPB 1B6UA 2CLRA 1FL5B 1H3XA 3QUZA 4JKMA 2ZOKA 4NQCA 1DBMH 3SBWC 2VQUA 5IESH 4U6YB 1FFNA 4F7TA 4XPBL 4JQXA 4FNLL 3GJFK 5TGBA 3RNKB 4XNYL 2OXHA 2JJTC 1K5NA 1UACH 2UZYB 4OFDA 3E6HA 4NQVA 4OZFH 2CRIA 2G75A 4KK5D 2HJLA 2KUTA 3RX5A 3HNVL 5E94B 3NFSL 3Q6GL 5EO0B 2AK4B 3WDJA 3GMMB 1KLFA 4MNGB 3HLAA 4KUZH 4M1DH 2AW2A 3OXRA 2COQA 3C5JB 3KYKL 1S7TB 3QDMB 3TYGL 3UBXA 1LO5A 3WXVH 1DLHB 5GGRB 4JKKA 1CU4H 2NW3B 2IGFH 3MV9B 3FTGA 1FL6A 1W0VB 2YBRB 2BSTA 5JORA 5I1JL 5H94A 4NHUA 2F53E 4JPIB 1DQQB 2O5XH 4QF1A 1WEJH 3P4MB 3QPQC 1IC4H 4IOSD 5LWYL 1F4WH 1KJ3H 3AFLA 1DVFB 3ZSTA 4QOKE 2ADFH 1JHTB 3B9KB 5IBLD 2X9XA 1IT9L 4XCYA 3SDDB 3TIEA 3RNQB 5I17B 3DMMA 1JPGA 4LOUC 5SX5K 1YEFH 5EU6B 3EFFA 4X4YA 4EIGB 1CIUA 4GAYB 1BGXH 2EXYC 1TCMA 3QDJB 4I0CC 3SE4A 3VJ6A 4ONGL 3BZDA 2D0FA 5T1KD 2JCCE 1HHKB 1ZT4A 4IMKC 4OJFL 3UO1H 4KVCL 3ZKSD 3PWLB 4LRNL 1LEGA 2XV6B 1CXEA 5AYUL 5F9JA 2H3NA 3X14A 1BZ7B 1GC1L 1F90H 1PD6A 2DLFH 3FN0L 4Y16D 1J0YA 4W68A 3P77B 4ZTPH 3I6GA 4HZLB 3X3GH 4NCC2 2BNQB 1I1AA 5E2VH 4R0LC 5DMYA 3ARVA 4L4VA 3GJEB 1YEHH 2IG2L 4OLYL 5JW3L 4ZPVB 3DVNA 5IGXH 2J8UB 5CKAA 1QR1B 5TQ2H 3DI3B 4FZEH 2BNRB 4PGZA 4PJ7F 2HTKD 5IEHB 5HYQB 1R3KA 3VFVA 1S7UA 5T1LB 1A1MA 2GFBA 2R29L 1IAIL 4ZPTB 5EOQH 4OM1H 4Q9BA 5CMAA 3GHEH 4BQ6A 1TPXB 5I1DA 3MCKA 4M61B 4NZJA 2W60B 3LSOB 4HV8B 4S1QH 3CXDL 4Y5YB 4XPTL 5C0DB 5IB2B 4GAJH 4M4PA 3DUUA 4ZUSA 3IU4H 4UOJA 4R6UA 4YZFE 3ARDD 3BD5A 1QBLL 2EKSB 2Z31B 2R15A 1WTLA 3WS6A 3I75A 4UTBH 4WUKH 3WHE0 4K8RD 4X5XB 3S3JA 1MWAL 4HS3A 5HI4D 5IFHH 3EYQC 3QFJD 1A2YB 2QADB 1KN2L 1GXEA 1OD9A 4OCXL 4R8WL 5D1XD 4FQJH 5EULV 1UCTA 2ERJC 3LKNA 3CIQA 3MV8E 4JPVL 5HGHA 5KS9A 4XCFL 4PJ9C 3T04D 1LP9E 3LY6A 4O58H 3GIVB 1PQZA 3Q0HA 4X98A 5DJ6B 4XAKE 4IRSA 1NFDE 5F44A 2YRLA 4UT9L 3FFDB 3CLFH 5D6DC 5ENWB 5FF6A 4Q6IA 3IDXH 1GZPB 1JBJA 4Y4KD 3B9DA 4JN1L 5GJTH 4POUB 5CUSH 5F7DA 1A7QH 1BEYH 4UMGA 2EIDA 4WI8A 4U1JB 4OIBA 5CILH 5IHZA 4L3EA 2NYYD 1IAKB 3HPJB 4JFYB 1GGUA 1P4IH 3SDYH 5CBEA 1TLKA 2CLRB 4TTDC 4H1LB 1NAMA 3U7YH 4WO4A 3CZJA 5F3BA 1A6VH 1FZKB 4P5TA 3K74B 3UTOA 5JOPE 5C07D 4HUXA 4I3SH 2VLRD 5INDA 3SY0B 4POZC 2EH8L 2ZCLH 1KPRA 3PQYD 1SY6A 2NY0C 3DROA 5I0DA 3RA7H 2QBWA 1K5NB 5C2BH 4FZ8H 2YUXA 1F2QA 1UB5A 4C55A 1BP3B 3E6HB 1XGRA 1T7WA 1V7NH 2PTTA 4DGIL 1MFBH 2J88H 2HJLB 3B8YA 3OAUL 5GRJH 3PWPA 4P9ML 4AIOA 5B8CC 1BM3H 2XFXA 5MI0B 3HLAB 4FQ1L 2IAMB 3O41B 2X70B 3L5JA 3WFZA 2FX9L 3WIFA 3WFDL 5LCVL 4YXKL 2AI0H 1DR9A 3VXOA 4P2QB 2E7MA 1LO5B 4LMQE 2VXQH 1QHOA 1ADQA 3QUXD 3KLDA 4U1HA 4M62L 3IXTA 5JORB 5H94B 5E03A 4QRPB 5JPNB 2DQHH 1ETZA 4TSCH 1EAPB 3VG9C 4QF1B 4GRLA 1A9BB 3FHQA 4U33A 2ED8A 5DQ9A 3ALXA 3UTTA 3V4UH 3SGDI 1MCWW 4GXUN 4HJ0C 4M7LH 5BRZA 2CPCA 2Y06L 3CMOH 4HIHA 4WCYL 1JZ3A 4XCYB 3ILQC 4L4TD 1CD0A 1VESA 4JFFD 1KJVA 1JPGB 3MGTA 1FSKB 2N7BA 1AI1L 1Q8MA 4X4YB 1REIA 3BE1L 1PDKA 2H41A 3EO1B 3KPRB 3VJ6B 4J1UA 3T1WA 2NW2A 1MOEA 4DUXA 1NUNB 2F19L 2WUBH 2XA8L 1ZT4B 3VFMA 1YEJH 5EC1A 1UYWL 3RZCA 2B0SH 3SE9L 3ZDZF 1ZLWH 1LEGB 4Z8FL 3O2VL 3EIFA 2H3NB 3CFKA 4JQIH 1QHPA 3MLTA 4MJID 5T3ZD 1CF8L 2ITDA 3VXMB 3SBWA 3K1DA 4M3JA 3ZHDA 4HXBH 4PJAE 1P9MC 5T3XH 3DOSA 1AO7D 3DXAA 5FM4A 2G5BA 1DANU 4ZNCD 2XTJB 4H5SA 4ZFOL 3BUYB 2UYLB 2DMKA 4G7YH 1EK3A 5JXED 5KN5B 2X2YA 3V5DA 3DVNB 1RFDH 2ZG1A 4WFED 3FT3A 3BYYA 5J13B 2VNCA 4XP9L 2FSEA 1S7UB 2A1WH 4JJHA 4LFHD 1A1MB 2NY1C 3T0AA 5CMAB 1UA6L 4KMQA 2GI7A 2R4RH 2UVFA 5F7HA 3JV0A 2UWEE 3KDMB 5D7IA 5GGTH 5LGHL 5I15H 1PVHA 4DGVL 2CLVA 1CLZL 4XWGH 2EZ0D 1CE1L 1E6OL 2R9HC 4JAMB 3VRLE 5F9WC 2EYRB 1EFXD 3AY4A 2XPGA 2PETA 3I50H 4XVUD 1RZIA 1OQXA 5BS0D 5MHSE 1R5WB 2UY6A 3GSNH 1W72L 2ZJSL 4UTAH 1ORSA 5I1KH 1BBJA 5JHLH 3IDMA 3P4LA 3PNWA 1JNJA 1KV3A 3SJVB 2R8SL 1G1CA 2X42A 4R9HA 4LNRA 4XH2A 1GJIA 1I1YA 4CVZA 1HYSD 5FYJL 4HK3J 4YQXL 4KJWD 4G43A 4R4ND 1PKQB 1PQZB 2YR3A 4IRSB 3TN0C 4PRNA 2F54D 3ISWA 4IMKA 4MS8D 1Y18B 3QXTA 5FF6B 4Q6IB 3B43A 4PGEA 2JKXA 4R7DB 4UT6L 1A6AA 4HULB 3SO5A 6FABH 2Q76A 3RAJH 1S5IL 1A7PL 1QEWA 1YQVL 5F7DB 4GBXD 1AC6A 5E4IA 1F97A 2AK1H 5IHZB 4M6MH 4L3EB 2NCMA 1JPSH 4FQIL 4JFXA 5CFHA 3GKWH 4R0LA 5DA4A 5DUPH 1OAZH 5CJBA 4WI9A 1S3KH 4NGHL 3NPSC 3BKJL 4ZFGL 1NAMB 4YXLH 4PJGF 5HHXL 3IAGC 3B9AA 5J56B 1G6RH 4LPVA 1ZSDA 4QWWD 2AQ1A 2BXZA 1KPRB 1PSKH 2FJHA 1IM9D 2PXYC 2X4QA 1UB5B 3JV6A 1AXSB 1II4E 4LK4A 2PTTB 1WITA 2UV3A 3KAAA 3H3PL 1V7ML 2R0ZL 5CJXC 1MQ8A 1FZMA 2XFXB 2DICA 3U79A 4YDIL 4KRPB 3WIFB 1CQYA 2XRAH 4IHOA 3SOBL 3GJFA 4JJ5B 3VXOB 4OI8A 4DQOH 1DQTA 1L7IH 1OD7A 1XZ0A 3UC0L 4Q9QH 4U1HB 5H2BA 3C5ZB 2W9DL 4JN2B 1JGUH 4FFYH 3Q3GA 3D85A 4QRRE 4G6KL 1OP9A 4Y5VB 4GRLB 1HCFX 4UV4L 1KGCE 5DURB 3V7AE 5J3HC 3RP1A 1D6VL 4PJ9A 1X7QA 5DQ9B 5BRZB 3C6LC 1HH9B 1IGFL 3W82A 4APQB 2VLJB 3O6ML 3U4EB 4HMDA 4K3HA 1FBIH 4YE4H 1KJVB 3OKLA 3G08A 4XT1C 1A6UH 3LEVL 5DC0A 3HE6D 3K80A 4K2UL 4LQFH 5T5NG 1DLFL 3PGFL 4NQSA 4J1UB 4WVRA 4OI9A 2D03L 4ODVH 2Z0BA 1KB5A 5EC1B 3RZCB 1ZHNA 5DQDL 3RBSA 2X7LB 4OD1H 1NCBH 5I1AA 1N26A 3MLTB 5D2LA 1IVLA 1FGVL 3LOWA 1RV6X 4B7LA 2ITDB 3MV7E 4WEMB 3VG0L 1P4LB 2J1KA 5FCUL 3TBVB 4ZFFA 2P8LA 4QKXB 4D3CL 4LPYA 5FCSH 4PGDB 3GEWB 1XIWC 3E0GA 4H5SB 5FFLA 4ZOAA 2FH6A 3O9WD 1S7QB 3H2WA 1DFBL 3LKRA 3T2QA 1HXMA 4X6FA 5E6ID 1A6PA 4YBHA 5J1SC 3K4ZA 1IAMA 5KVFL 4MJ4A 4BFEA 1CICC 3OKMB 5B8CA 1X9QA 1JF5A 3DRQA 4WI4A 4MSWA 3PG2A 5FYLL 3HI1A 1NEZG 2KZWA 5HXMA 2CKBH 5DD6A 2P46B 3UROR 4JO4H 4NNYB 4LLMB 3QQ3B 4OFVA 4Z7WA 3HNSL 4PBVC 5D7IB 3T3MF 4JM2F 1K6QH 3ARBB 1UEYA 4EOWL 4M1GH 1Q0YH 1KB9J 2CLVB 1WJ3A 1MCPL 1Z9LA 4PG2C 2GTZA 3ARRA 3L7FB 4FXGA 2BFVL 1JFQH 1NFDA 3IVKB 3D69A 1EHNA 2OZ4H 3DSFL 1K2DA 3U82B 1OAXL 3GRWH 5EN2B 1FE8H 4OF7A 1C8PA 1J0IA 3CK0L 4KK5C 5ICYA 1BBJB 1I7RB 3IDMB 5D93B 4LPXA 1F4XH 4XMLL 1NLBH 4XH2B 4CVZB 4OCYL 3LKPA 4LFHG 2WQRA 1H3TA 1CDCA 3L3DA 1QLEL 2E3VA 4LDEB 4CJ1A 4JG0L 5EU5A 4PS4L 3ROOA 3PP4H 4PRNB 4KQ3H 1U8LA 2EC9T 2Z8WC 1QLRB 2QLVB 2EIZA 4N90D 4U1NB 4LVNB 4M48L 4PGEB 5E8DL 4BFBD 4F7CB 4S0TD 1A6AB 3WLWD 4I0PA 1ZT1A 5KJRH 5GHWL 1R3LA 2R56L 1F13A 3RVUC 4A2MA 1N8ZA 1P9MA 3HPLB 3UTSB 4ETQB 2Q20A 4K3EH 3RWEA 4YDKL 3BT2L 2QV2A 1D5MA 3R0MA 5CBAB 1A1NB 4HIIA 5I73B 3GSQA 1QSEB 3IF1A 5E8EB 1YMHA 5FGBC 4PJ5B 1ZSDB 1YEIL 3HI5L 1LEIA 5CP3A 4F58L 2YD8A 4HC1A 3ULUL 4ERSL 2X4QB 1F8TL 3JV6B 1TQBC 4OCSH 3WFEH 4X9IA 4PJIE 4X0KA 2ICCA 5GS0H 3QWRD 1E4JA 3GNMH 2VXTH 2DKMA 5DJAB 1UG9A 4GOSA 4Y16C 1JI1A 4ZO9A 2V2TB 4PREA 4GW4B 3BRDA 2C4XA 3ARGD 3V0VB 3RQ3A 3VD9A 1WTGT 3MJ8A 3C09B 4KKAC 2WWMD 1CR9H 1XZ0B 2ADJA 5FGRA 3DLQR 1YN6B 5D1QC 2ARWA 4ZTOL 5DYOA 3KPNA 2FNBA 5H2BB 3CZFA 2K3TA 4XHQA 5JW5A 3EZJB 4P46D 2VR4A 4AMKH 5HVHC 1FVEB 3BIKA 4OLEA 4PJ9B 1T0NA 2WLZA 2G60L 1CZ8L 4HMEA 4M00A 3BKYH 3UYRL 2VLRE 3A0OA 3WD5L 1IJ9A 1VEOA 4LVEA 3QUML 3NCFB 2P44B 1XT5A 3QXAA 1AE6H 3PQYE 4O5LH 5F8QC 3OKLB 5E70A 2GK0B 1ZHBA 3G08B 5CIPB 4PJAA 3O8XC 4NBZB 4LEXL 4Q9RL 4GKSA 3HE7A 4DCQA 5DF0A 4HLZH 4DUWA 2AJZA 4HCRH 3ARDC 1A6TB 2DQFA 1KB5B 4LSVL 5ANMB 3BZEA 4EI5D 4P3DB 4L8DB 4KROD 1XFPA 1U8PB 2IJ0C 1C7TA 3P73A 1OPGL 1F6LL 3GBNH 4N0UA 5D1XC 3WUWG 2K9UA 4ZFFB 2DQEH 1U8OB 4QXTA 3VWJB 2PXYA 1IKFH 2IALA 1G0DA 5F7EH 2RCSL 3ELAT 3X3FL 4GXVL 1NANI 1YNTA 4UB0L 1FFOA 4OCMC 2OTUA 3LKRB 3FB6A 1OTSD 3L3JA 4CDGC 1HXMB 4X6FB 1BJ1H 5BV7L 1UH3A 3IDNB 4UI2A 1FQ9C 5CJXA 1XH3A 5B8CB 3S4SA 4QT5A 5HVFB 3MFGB 4MSWB 4Y4KC 5F3HA 1RZJC 1UXSA 3HI1B 1BJ1J 3O4LD 4M7JL 4H26B 2KPNA 5DD6B 4V1DD 2Y23A 3B6SA 4HW6A 2NYYC 1IILE 4Z7WB 3W9DB 3QRGL 2CIIA 3BSZH 1UEMA 1LDSA 4YAQB 4ZSOE 1JL8A 4IRJD 3TH4T 2D0HA 4UILL 2E7CA 5IVOA 5GSRB 2GTZB 1YDPA 3VD3A 4FXGB 4OQTL 3GGWB 1FNEB 1A7OH 4MJ5A 3VXSD 1NCWH 2X4RB 5T3ZE 4MAYD 4JHAL 4N5ED 3A6BL 3BPOB 3AMLA 2HJKA 2ZG3A 3ZDXF 5JW4N 5L88H 4ZAKD 4ZO7A 3KJ4B 2FLBT 1VFBB 5E2WL 3WNLA 1QFUL 1JWSA 1KN4H 3JZ7A 3CFJA 2QSVA 4HAFA 4GO6B 5JOFA 4Z7OE 2WBJB 3L3DB 4KDWA 4BZ1L 4HIXH 4WFEE 3V8CA 3ROOB 3VRJB 1QLFA 3LQMA 5C6TH 4Y4FB 1U8LB 2GJJA 3E8UH 3JWDC 1K3ZA 5MP6H 4AJ0A 1DN0A 2EIZB 1S9KC 4MXVF 5HY9A 4U0QB 3RPIA 1E4KC 3QUXC 4HKXA 1MFNA 4JANA 4XVTL 1GYAA 3EJYD 3MV11 4I0PB 1ZT1B 4XPGH 1ULVA 2YD9A 4ETYA 3WXWL 1N8ZB 4BZYA 5AUMA 1NSNL 2DBLH 5D6CA 4YX2H 1BAFH 1D5MB 3RU8H 4L8BA 1A6WH 3GSQB 3IF1B 1YMHB 2CD0A 4WHYH 3TWCL 1CICA 1KIRB 1LEIB 3MRFB 3QCUH 4TVPL 4CU6A 3RIFK 2YC1A 4P2CG 4YK4B 4YDLC 1F4YH 2L4OA 2P48B 3VCLA 1FH5L 3FOLB 5F96L 4HKBB 4X0KB 3NFNA 4I3RL 5JA9A 2BVOB 1QQDA 3EYUH 3VXUB 3S3PA 1MIML 1T83A 4G9DA 3MJ8B 5E9DD 5IMOA 3UJIH 3WFHA 2VE6A 3ARFA 3ARPA 2UUDK 1AFVH 5EB9A 2ADJB 1FRGL 4I13B 4NZRH 1I8IB 2ZUWA 5DYOB 1UZ6E 5JXEC 1UJTA 4OZIA 4LDLB 3PL6C 4OF0A 4BFGA 5JW5B 1OSPH 4JZJA 3DX8A 2VRAA 1S78D 1CL7L 1TJIL 3A6CL 3MCLL 4AL8H 3BIKB 4QHMB 4R4FL 1RIHL 4M6NL 4FQXD 1T0NB 1UB6A 2W59A 1JP5A 1FFQA 3VFNB 3CFDA 3QXAB 4QEGA 1J0JA 5KOVC 3LIZL 4PG9A 4NJAH 4PJ8C 4QRQB 4Y1AE 3HE7B 1E4WL 2EZ0C 4KJYB 3ZO0A 1SM3L 5DR5L 3TFKD 2ARJQ 2AJZB 4R26H 3LEXA 1LE9A 1T7XA 3MJ7A 3FKUS 4RX4D 3BZEB 2DD8H 3QIWD 3BZFA 5DRZB 1QKZH 3F7YA 4GT7A 3P73B 1H3VA 4N0UB 5FGBA 5D7LA 2FJFA 4KJPD 2V5TA 4DVBB 4KJWC 1PY9A 5C7XL 3P0VH 5ID0B 2EIBA 4R4NC 1LMKA 1JWUA 3FFCD 1NQBA 1YNTB 3MRKA 2ZKHL 2OTUB 3FB6B 1J0KA 3L3JB 5F21B 3L3GA 2EICA 4MS8C 2CJUL 1OAYH 3L95A 4HF5L 1JF1A 5B38A 3S4SB 4QT5B 1VADA 3CU1A 2PN5A 1UXSB 4GW5A 2Y4SA 2X89D 2BNUB 4Y16A 3B3IA 3DNKA 3FQUA 5A2IH 2VQ1A 1A7RH 1KC5H 4GBXC 1U41A 4KKNA 4WWKD 4AM0B 3MXWL 4JM2D 5CJ5A 3VA6A 4H88H 5I66A 3SPVA 4IDLA 1OGAE 3WE6B 1NL0H 3VDAA 3PWUB 3PHSA 4UQ3A 2B1HH 1FAIH 2OR9L 3VW3H 1IZKA 1YDPB 1CFNA 4QWWC 5JQ6H 1I8KA 5HHNB 2E7LC 4NUGH 3REWB 4MJ5B 4UV7L 4PYGA 1TZHA 4XVJL 1I4FA 3CFEA 2HJKB 3QEGH 4XCCL 1IARB 5D96C 4X83A 5ESQA 3RWIB 1HINH 1JWSB 1DBML 3EHBD 1HQRB 5IESL 2Y72A 2DQDL 5IW1B 3QNYB 4NRYA 4OB5H 2VJXA 5D70L 1QLFB 1VEPA 4PGBB 1ZLVH 3ARDA 1DN0B 1G9NH 2FB4H 5MERB 4MDJB 3QFDA 2VL5B 3RPIB 4JFDD 3V79C 4HKXB 1ZE3C 3QFJA 4KUZL 3SDAD 5CWSB 1OSZB 4M6AA 2ZSWA 4QO1A 1F58L 5D1XA 1SJHB 1KIQA 4A6YL 5AUMB 1HSBA 3QIUC 4JY4B 5ILTH 2RFXA 3MJGX 2DTML 3WXVL 1Z9MA 1Q72H 4R97B 4LLUA 4ZOCA 5DJDB 4XP5H 2DQIH 5DJ0A 3N0PB 1CU4L 2EKJA 4PUBL 2GTWB 2NY2D 1KEMH 2Z93A 4HBCH 1CICB 4E5XA 5ADOL 1YJDL 3HMXA 3VU2A 1HH6B 3MOBL 3HE6C 4Y4KA 3VFRA 4XZUA 1RVFL 3EOTH 5DJXA 3ZTJG 3MRQA 4CN6A 1ZA3A 1JNNL 1VPOL 4P2OC 4PRPE 3VCLB 1KJ3L 3SKOA 1PY4A 2BY3A 1VGEL 3LN5A 2O5YL 1WAAA 3NFNB 3O3BB 5K93A 4FQ2H 1I8LC 4P23B 4KKLD 2XTLA 4JM4H 1FFPA 1YEFL 1KCSL 5C0RL 2HFEA 2AEQH 4JFQA 3D18B 4IOIA 5DD3L 4PY8J 1BGXL 4G9DB 5K33A 1FYHB 1YYMH 5C07A 5FUOH 1R5IA 5FA3A 2VE6B 3A6OA 3ARFB 4JFPB 1YNKH 3T77A 4KZEL 3O9WC 1UZ8A 4YNYA 3UO1L 1NBYA 1K3IA 4U1MA 4OZIB 1CI5A 1F90L 3HAEH 3MLYL 4JZJB 5CEYA 4ZTPL 5CEZD 5GIRA 3X3GL 3HZVB 3WN5C 3STLB 3P9WB 5I8CA 4PTTA 1Q9OA 3CFDB 2C3VA 1YEHL 4OLUH 1MREH 1BREA 2QSCH 4KV5E 2B20A 4PG9B 1T5XA 1NDGA 5TQ2L 3TESA 1ODAA 4J3UA 1E4KA 4FZEL 4WTWA 4MMXC 5GZND 1AR2A 2V2XA 1W8OA 3CAFA 1V3KA 3V5HA 4BSVB 4NZUH 3TNMA 3LEXB 4G8FB 5FM5M 3GHEL 5MEOB 3F7YB 4YHZH 3H8NA 3K2MC 4X7EC 2OK0L 4ZUVA 1FO0H 1U8JA 4S1QL 1GZQA 3QUKA 4WNQB 4L4TA 4JFFA 5D7LB 4F8TA 4OZHA 1CYGA 1R24A 3TO4D 4HJJH 1WIUA 4GAJL 3KPLA 3IU4L 4NQXB 1KIPB 3GMQA 4LPTA 5L0QC 3JWOH 4MCZA 1AGFB 4ZSOA 3QR2A 2P8MA 3QHZL 3L3GB 4LPUA 4MQTB 3QDGE 4NQDE 3L95B 4GG6F 3U83A 3P0GB 5B38B 2MQ3A 2B4CC 3OTTA 4Y4HC 1UWXH 3AGVA 3WLWC 5KVEH 3MR9A 4MJIA 3BQUD 3B3IB 3KWWB 4HXAL 5J1TC 1AR1D 4NO3A 4ENED 3R4DA 1AO7A 1U92A 4X99A 5I66B 3OB8A 2ATPB 5KVGL 3SPVB 3CLFL 1R3IH 3ZDZE 2EDQA 3E3QE 2VN4A 3HFMH 3HUJF 2VDPH 5JXEA 1LDPL 1MAKA 3T0DA 3GMPA 5DSCB 1YA5A 1KCRH 1I8KB 2VZOA 1LE5B 5CUSL 1WZ1L 1A7QL 1UADC 1BEYL 2HVJB 4J3XA 3N50A 1E28A 1TZHB 3W11D 4U6XA 1I4FB 5IF0B 4LCWB 2EE3A 2LVEA 4JZNA 4MD5B 1TVBB 4HIJA 3SDYL 1FN4B 1AHWB 3SCMD 4UT7L 5ESQB 3RVWD 4XP4L 5D5MA 2OR8A 5HYJD 1U91A 2DM2A 5TF0A 5I8KL 1RUKH 4I3SL 3RWCA 1HZHH 1X5FA 3ARGC 3ZKND 5IVNA 4NRYB 3RA7L 2E27L 2XZZA 5C2BL 4FZ8L 2WWMC 3ARDB 1EFXA 2J6EH 4LNVA 1EAJA 3O4LE 4IOFD 4D0BB 3QFDB 5C0EA 5ACLA 4RA0C 4V1DE 5BS0A 1CIDA 4U0RB 5DMKA 5ICZA 4ZOEA 1LO3H 5HBBA 2D4FA 2IH1B 3V0WH 3OKNA 3I9GL 4JGJA 4P46C 1KIQB 2WLYA 4BQCA 4PB0H 2RFXB 5E24E 5D71H 1RIUH 3MOAH 2VXQL 4LLUB 4FS0A 3C60D 2EDKA 2XXMB 4L8SC 4YWGH 4YDJA 2F54A 3E2HB 4H1LH 3VXSE 5AWNL 4OAWB 4MQ7B 4E5XB 2DQHL 4HFUL 5DFTA 3Q2CA 3VFRB 3MRQB 1ZA3B 4JFZH 3OJVC 4RISL 4X7DC 4GBXA 5F7UA 1EEQA 4ZXBD 2VLKA 3V4UL 3LN5B 4M7LL 4EI5C 3X11A 5JLZA 4IIQB 4ODXA 4KROC 4L9LA 1QRNB 4HS6A 4XMPH 1QBBA 1T1YA 3ZMRA 5E7BA 4KKBD 2CGRL 1EJOL 2C3XA 5FA3B 2F8OA 3BP7B 5KSBF 2FEDD 3FO0L 5FM8A 1IM9A 1MQKL 3AB0C 1UZ8B 1WV7T 4YNYB 1HN1A 1WVZA 3N06B 4WUUD 4RGMC 5EORH 1U2CA 3IDYB 4FTVB 5CEYB 2JF1A 2GAZA 3FO1A 1YEEH 3PDGA 4RGNB 4PJGE 4HXBL 5F1KC 5T3XL 2IMNA 4NC2B 3V9FA 3RDTD 1VSCA 1IGJB 1FHGA 5I8CB 4PTTB 5K59F 1Q9OB 2NXZD 3WKMH 2C3VB 2H26A 4JHBA 4WV1C 2OR7A 1T5XB 2YA2A 1NDGB 1RFDL 3ET9F 4IRJC 3T4YA 3BPNB 4FABL 4M7ZC 5ERWB 4NP4H 1INDL 4DEPB 2WNGA 4QRSA 1SEBA 2V2XB 3BPCA 3OGCA 1U8NB 1S7RB 3NAAL 2HN7B 3WUWA 1JWMA 1WGOA 4B41A 4M6OH 2RHEA 4ZUVB 1U8JB 5F9DC 5GGTL 5LG1A 5L2KD 2GJ6D 4L4TB 4XI5D 4JFFB 2FECI 4ODHH 4OZHB 1R24B 4XWGL 3THML 1MLCA 1CVSC 3OAZH 3BX7C 3HE6A 3GMQB 3OMZA 5FECB 3QSKB 3ESUF 5CD5D 1QZ1A 4O2FB 5FEBA 1WZKA 3OX8A 3NZHH 3PHQB 3M8OL 4YLQT 4UTAL 5I1KL 1KNOA 2ZG2A 1M7IA 5SWZE 5B39G 3V6FB 3OV6A 1N5YL 3EJYC 4NHCH 4PRHD 5E5UB 3MR9B 2J12B 4XBGB 4XMKL 1OAUH 1F11A 1T4KA 1K8DB 3UDWC 1AO7B 2VZTA 1P7QD 1U92B 3H3BC 3CH1A 1YMMD 1ZLSH 1Q0XH 3NA9H 3M1BA 2FHBA 4WTZG 3TZVC 3O9WA 4U1SB 3U4BL 3FRUB 5E6IA 4MYWB 5F6IC 3GMPB 4PJ7A 2XG4A 3VXNB 6FABL 2F58H 3VFTA 1ZVYA 2NLJB 2ENSA 1TQCC 2AK1L 1K8IB 2CUMA 3S6CA 1JPSL 4JZNB 1PBYA 4HIJB 4I9WD 1L0XA 2ADGA 2H2SC 1ZLWK 3CDYA 1ZVHA 1CXHA 3FFCE 1U91B 5IHUL 4F37F 3EDFA 4G8GD 4JRYA 1WWCA 4K71B 1XAUA 4LHQB 1T20B 3MCG1 4KHTH 3OB0H 2APWA 4X6DA 5I75B 1C1EH 4DVRH 3BGAA 4XB8A 3CC5A 3MRMA 3ULUD 5F7WC 3VWKD 1MI5D 4HWBL 4DW2H 5DMKB 2I9TA 2J8UF 2B1AH 3T3ME 3DHJA 3OKNB 1D5BB 1S78C 3PWVA 2R0KH 2XRAL 3WLBB 3IFOB 1ACYL 4FQXC 4DQOL 3DX9A 4Y8AA 4XWOD 3N85H 2MCG1 2F54B 3QULA 1NAMH 4PY8I 4TUKH 1JGUL 4FFYL 5CSZA 4NYLA 4YHIA 4XBPA 2XWTA 2W92A 4MNHB 1IC5H 1HHIA 4WU7A 1SY6H 3N9GH 1OAQL 4YFLF 1MHCB 2VLKB 3S88H 4K94L 5T3XE 2X9YA 4P9HL 1J87A 3QIWC 1CFQB 5GGUA 4L9LB 3CPLB 3SDCD 3QAZC 5FYKH 4R4BA 2BC4A 2BY0A 2AJUH 3C8HA 1FV1B 3KPOA 1WUNT 1EGJL 4GKOA 2AEWA 3ZL4H 1U8HB 2DS4A 4KTEH 4X80L 3ES6A 4KJPC 4P2RD 4RQQA 4ODBD 2EDJA 5JW4R 1NCBL 1ADQH 1E4XI 1FC1A 3MXVH 1S9YA 5AD0B 1LVEA 4XNZB 3FO1B 1LEKA 1U95A 2Q7NA 5GRZA 2IBGA 2ATKB 2QHRH 2DIJA 1T2XA 4DAGH 4XCEB 5EUOB 1MCKA 3ARGA 4HUWB 4WWKC 5I0ZA 3F7QA 3BDYH 1OTTD 4JM2C 4OFKA 5ITBL 4OLVL 1AC0A 5ADPH 1RIVL 2MCPH 2XN9D 2W65A 2VLLA 5FA4B 3GMNB 3T8XB 4QRSB 1SEBB 4FQLH 3JVGA 2IANB 3SGJA 1AGEA 3GBMH 3LQAH 4P46A 2A2QT 1HI6B 2CKBL 4NFCA 3MODL 2I07A 1JWMB 4QTHB 1QBAA 1OGTA 2XACC 1EFQA 2PNDA 1W0WA 4P4KD 2X1XR 3MBEA 3MFFA 1EX0A 5IM7B 2GCYB 1K6QL 4L8SA 1WQVT 2EDXA 3ARZA 5DEFA 5J9PA 1Q0YL 4YBLC 4JCLA 2VH5H 2EIEA 4MQXD 4TPRH 1M71A 3EHBC 1J1PH 2Z4QA 1GGYA 1CS6A 5A43C 1HYRC 2HFFA 1QTYT 1I1RA 1CGTA 5HHVH 3GRWL 4OGXH 3IS0X 3OL2A 2IQ9L 5GJSL 1D5ZB 5C0BB 1FE8L 5CEZE 4EI5A 1KNOB 1M7IB 4PJHE 4ODSL 1MJJA 3DVFA 1BLNA 3QO1B 1HEZB 1S7WA 4AT6A 2M1KA 2P49B 5IT2H 5J1AA 3CH1B 1ZT7A 4YFLI 5C08B 3ZYOA 2FD6H 4K3DL 5E6IB 5IOPA 4BM7A 4Y88A 2NY2C 3TVMD 2NY7H 3C87A 5KJRL 2MKLC 4PJFA 3O4LA 1WCQA 4FFZH 2YRPA 3P11H 4V1DA 3SKJH 1X4XA 3K46A 3AS3A 4WV1A 1MFAL 3TT3H 5SWSD 1YECL 3K1KC 5IVZB 1UCBH 4IRJA 4MJ6B 4JRYB 5EC2A 1PKOA 5J0BA 1ZEAH 5F7FA 2EDDA 3WS3A 1QYGH 2ENYA 4X6DB 3VXSA 4GQ9L 4DK3A 5LXGH 3WFEL 4MAYA 3CC5B 4UDUA 2JJVA 5JDSA 1FVCA 2I9TB 4ZAKA 3GNML 3NN8B 5IB3A 4HLZG 3MLSH 2GT9A 2IPUK 3MUHL 1KJMB 1G7MB 4DZBB 3PWVB 4EUPG 2FLRT 5EOTA 3FMGH 1KJ2L 1G7HA 4WFGE 3DX9B 4BZ2L 1KB9K 1RUPH 2NTSP 4KDTC 5C0ND 5TE4H 3ZDXE 4Z76B 4RAHA 2DM4A 1VACB 3WO4B 1GOFA 3G5ZA 1A9EA 4NYLB 2IQAB 2XWTB 2Y36H 1A4KA 4KQ4H 1HHIB 3EDJA 5GZNC 3EGSA 3WJLA 1FLRH 5HYJE 1TXKA 3MA9H 4LIQL 4I77H 3UDWA 5IKCA 3BKYL 4U6HA 1IMHC 2R1WA 4GRWB 5GGUB 4UBDD 3D0VA 2R4SL 4JPKH 4MXVE 1PAMA 5SV4A 1INEH 4U1GC 2JELH 2NXYB 3O4OB 1EDQA 2NNAB 3GJFH 3E6FA 1TITA 4PJBA 1CGWA 1H3WM 3KS0J 5E5RB 2FRGP 3VXRD 2D7MA 5I19L 4M43H 4PRDB 5FHBH 1J8HB 3ZYZA 4FA8A 1J1OL 1S9YB 1YY8A 2QQNH 4J23A 1LEKB 2C4FU 3UJJH 1FNGA 5CLTA 2ED9A 5HGDA 3BQUC 3DARA 4WJ5B 3T2PA 2FIRT 2Y1VA 5DJ8A 1AR1C 5HYFA 5FO7B 5E9DA 4ENEC 4B53A 4XAWL 3PABA 4KI1A 4RGOL 1FLTX 4F7MB 2VDNH 4LARL 3HNTH 5HGGS 2W65B 3L5HA 5TQ0H 2VLLB 3I2CH 1NCDH 3IFNH 4MXQD 5CIPH 2YWYA 1KTDA 1AGEB 2D9CA 5C6PB 4XNXH 2FZ3B 3OKEA 2V17H 2F53B 3W11C 2EDBA 2I07B 2X4SA 1KB5H 4FQXA 1RJYA 1CG9B 1W0WB 4YHPB 4CN4A 3MBEB 3Q5OA 4E0RA 1ZA6A 2AK4D 1XEDA 5J9PB 1DN2A 1BWWA 3SCMC 4ALAH 2A9ML 5DJCA 4JVWA 4D9LH 1YY9D 3H9YA 4DN3H 1G7QB 4WUUE 3KG5A 2PYEE 4HEPG 3ZKNC 4NQTA 1VFMA 1G9MC 2GIYA 4BQBA 4Z7VA 3QEQB 1EHLH 5D1ZB 4RX4A 1U3JA 2A73A 2M26A 4IOFC 2IADB 3QIWA 3OZ9L 4JCMA 5GRXG 1UENA 4JO1H 4MA8H 2QTEA 1A14H 1BLNB 2NY4D 3BGFB 3R8QA 3WSQH 1O7VA 2VKXA 2Y07H 5ETUB 1DUZB 4ONFL 2QQKL 4AT6B 3ETBF 4YHLL 1JCKA 2OP4L 1HKLH 2PYFB 1MFDH 3DBXA 3GHBH 2AAVA 3TJEL 1V5JA 4YO0A 2ICWB 3B9KD 5MP6L 1Q9KB 4HKJA 3SDDD