1NFFA

Crystal structure of rv2002 gene product from mycobacterium tuberculosis
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
244
structure length
244
Chain Sequence
SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAELADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVAGLAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase Rv2002
total genus 91
structure length 244
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.1.1.53: 3-alpha(or 20-beta)-hydroxysteroid dehydrogenase.
pdb deposition date 2002-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nffA00
1B3BA 1NHGA 2Z1NA 3I9OA 1LI4A 4P4LA 4CM8A 1ZO8A 4ZRMA 2Y1GA 4BKUA 4RORA 3C7AA 4GL4A 5DBFA 2PZKA 1Z75A 1ZK4A 1LQTA 4PG7A 4E5KA 1UZLA 2P4QA 3KEQA 5T67A 3DZGA 1P1IA 2Y66A 2PK3A 4FD3A 4JK3A 5L7WA 1ZW1A 4JXKA 4D41A 1LEHA 3U3XA 2Q50A 2PH3A 2VRBA 1FDSA 2CMDA 3NGXA 3PJFA 4YJGB 4DRYA 4N7RA 4WCFC 3WBFA 1FDWA 1DC3A 1ONOA 2GN6A 2P9CA 1E77A 1TT5B 4YJHB 2Y1DA 2DBQA 4CM1A 2PD3A 1EFLA 2CZCA 3ZWBA 3LVFO 3L77A 2OXIA 4NPCA 1EVJA 5G4KB 2Y67A 1EVIA 1ZK3A 4JBGA 5U4QA 5CDUA 5L9AA 1Z7EA 4BKOA 4ALIA 3FNEA 1EVYA 3S55A 4XQGA 1QYVA 4WNIA 1YBAA 3DBHB 1ML3A 3PFWO 2P9EA 3LC1O 4YDRA 2UYYA 3UOGA 1KEUA 2JHFA 3SLGA 1E7SA 1Z74A 2WTBA 1KVTA 1OZAA 2CY0A 4AJIA 2OMEA 4J16A 5JPIA 3OSUA 4OL9A 3T4EA 4XQEA 2Y05A 4AJEA 4I9HA 2ZYDA 3QHAA 2WJPA 3FI9A 1QP8A 3LT2A 5JFOA 2X23A 3RUDA 1GZ6A 1ISFA 3GK3A 2C29D 5DP2A 1NVMB 3F6YA 1N1EA 4H15A 3VH3A 1XELA 4RO0A 4LRSB 3H3JA 4DA9A 4XYMA 1Z73A 4ZN6A 1MX3A 1JA9A 3I83A 2HDHA 1DHRA 5JYEA 4P8RA 4Z9FA 4RV9A 4ND2A 3ZH2A 4CM6A 3P2OA 3DXFA 4KP7A 5DCUA 1HE2A 3MJTA 4P4GA 1KEVA 5DCWA 1XQ1A 2GPTA 1A7AA 3QVXA 4RDIA 4R69A 1HE4A 3W4IA 3QV1A 1ZXBA 1ZVMA 4U8GA 3UCFA 4DLBA 2I5PO 2AMFA 3AY3A 3R6DA 5L4LA 1PGQA 4FFOA 4R3WA 1PL6A 2PKQO 1WMBA 2NU6A 1BXZA 4AG3A 3PHIA 2VQ3A 4HFMA 4I8XA 1T1SA 1VL6A 2NTVA 5JCJD 3PIIA 4RZHA 4WLEA 1PEDA 3ENKA 4IJUA 3NGLA 1Z45A 1VL8A 2C2XA 5A5FA 2PD6A 2AA3A 2BGMA 1GU7A 4ZQHA 4RCVA 4DREA 2YV3A 4N5MA 1AUPA 4R5HA 5EN4A 4A7PA 1YGYA 4NFYA 4PLFA 5B4VA 2EW8A 1Y5RA 3QLJA 4ITUA 4J4TA 3O03A 4BGVA 1YONA 1C1DA 3PHLA 4CPDA 1X1EA 4F6CA 2CVZA 4QX6A 4IQGA 1R0KA 1WW8A 1XLTA 2I9PA 2YHIB 4QEDA 5JXWA 3UHAA 4NFHA 3AK4A 4NU6A 4N18A 5IXSA 5B1YA 4JN6B 3KYDB 1DXYA 3P2YA 2E37A 5A04A 1I3KA 3OJEA 4G81A 3C24A 1Y8QB 2YV1A 2CFCA 4NBTA 4CM4B 4CM5A 4EUEA 4HY3A 1ZCJA 5A02A 2F1KA 3HSKA 2ZIZA 4FGWA 1ISIA 3LU1A 3TOZA 3F1KA 6LDHA 4PLPA 4CM9A 3EC7A 2OP0A 4KWHA 2C5AA 4XDZA 3P7MA 4FJ1A 3JQ8B 3INGA 4HFNA 5G2OA 1BW9B 5CDSA 4BNJA 2V7PA 3LYLA 1C0LA 3CPSA 5EL0A 4S1VA 3GN2A 1JLLA 3Q3CA 4CMGA 4OSPA 3AOEC 4FIZA 4YWJA 1CQIA 5F1PA 4J4HA 3A9WA 3GPIA 1R16A 2VYVD 4Z0HO 1UXGA 3CUKA 2O3UA 3GDOA 2B5VA 4RVHA 3R3SA 2X0RA 4LMPA 2O4UX 1JWAB 4FFNA 5KKAA 3FTPA 3RUFA 3ZHBA 4B3IA 3NT2A 1IL0A 3E8XA 2GD1O 1LTHR 3FBTA 1E1NA 5JDIC 4D0SA 1K89A 1EK6A 3MWDB 1R0SA 1VKOA 5IDXA 1DIHA 1U5AA 3TN7A 3D5QA 3OIGA 3RJ5A 5L7YA 5CG2A 3ZHZA 1SB9A 1B8PA 1BSVA 1T24A 2WE8A 1P9LA 1A9YA 3L6DA 3O26A 4J1QA 4L75A 3ANNA 3NRCA 3U4DA 4CUKA 2YFQA 5KJCA 4U0JA 2AE1A 2PGDA 3UCEA 2HQ1A 5CHEA 4R3NA 2GYYA 2UV8A 3SC6A 2HCTA 4FOOA 4RVUA 4BO6A 4BO5A 4BOYA 2D0IA 2O7QA 4ZGWA 3C8MA 3UGKA 4CMAA 3HB5X 1XU9A 3KM0A 3DB2A 4XA8A 4XIYA 1V6AA 2Y1FA 1H6DA 5EQFA 1F8GA 2Q4EA 1YB5A 4J49A 2XAAA 1BDMA 4IZHA 3CSDA 3Q1LA 3VZQA 3KZVA 3I52A 5I8ZA 2Y0DA 2BGKA 1G1AA 2IYPA 3PXXA 3DBRB 4DQUA 4UVDA 3DMTC 1ISGA 3DZBA 2I6TA 2WYWA 1LDGA 4DQVA 1R6DA 1EDOA 1LXCA 4W99A 4CMBA 1PJ2A 3IIEA 1JQBA 4IUYA 2O3RA 1U8FO 4GPD1 3U49A 4PLTA 3FNGA 3C1TA 1D1TA 1HKUA 4LISA 3BTUA 3CKYA 1XCBA 1BVUA 2PZJA 1PU2A 2FZWA 3K73O 2X1HA 1O0SA 5F5LA 3VH4A 2XXBA 4P38A 4PLCA 1W8DA 3SXPA 3EYWA 3H5AA 2JAHA 1HDRA 3RU7A 2WSBA 1TA4A 4GX2A 1ADCA 1KC3A 3VC7A 5KJEA 1I2BA 4YRAA 3PDJA 3I9NA 2PD4A 3KHUA 2DBRA 4ZJUA 3L0DA 4ALJA 3BMQB 4FW8A 4WOJA 3EMKA 3WBBA 3KLMX 2AQ8A 4J0FA 1H94A 4BNKA 1XGKA 4GAEA 4W6ZA 1IPEA 1M66A 3IC5A 4Q3BA 4L76A 5HS4A 3HFSA 4IINA 4F3YA 4K6CA 2E82A 2W2LD 3MTGA 4DXHA 3K2EA 1CWUA 1EFKA 2EJWA 1UXIA 3B6ZA 2QRKA 3ST7A 1EUZA 1NPTO 1R37A 3VAZA 4XYBA 2J3JA 2Y68A 4ZQGA 4AJNA 1RM5A 3SBOA 1VKNA 2HAEA 2QQ5A 3AU9A 4IDBA 4ZICA 2DAPA 4IS2A 4W9NA 2NVUA 3ZN2A 3GUCA 4OXYA 3WLFA 3NJ8A 3ABIA 1DEHA 3VH2A 1HYHA 1BHSA 2A92A 1UP6A 4UVIA 5A3JA 2BGLA 1ISMA 2I3GA 1FDUA 1HZJA 1LLCA 4WLNA 4ZA2A 1S6YA 2HLPA 3JV7A 3K31A 3ZW8A 5C7IO 3NUGA 4TRJA 4UULA 2GUGA 4BGUA 1HXHA 8LDHA 3MZ0A 2PY6A 1LDYA 3Q0EA 2Z5LA 4D43A 2E48A 2FPIA 4HNHA 1LC0A 3R3JA 5EPOA 3DAPA 3WR5A 4EUHA 1Y7TA 3LSYA 4K6FA 1MXFA 2YFHA 3DDNA 1B14A 3FD8A 4OKIA 1YB4A 2YQ5A 2R00C 1H2HA 3MCVA 3G3EA 3QVSA 4K28A 1PTJA 1XU7A 3F1LA 4Q3CA 4YJFB 2VTDA 3HDYA 4L4SA 1LDMA 5KTKA 4B4WA 4OMUA 2VCYA 5GMOA 4BUCA 5DT9A 1SAYA 1LRLA 3F4LA 3VDRA 5JMWA 2POQX 1O6ZA 1PS0A 2ZB7A 1H6AA 1U8XX 2NU9A 3G49A 2G1UA 4CUZA 1HDXA 4BNVA 3TZCA 5JAQA 2QX7A 5ES3A 5COQA 2PKRA 5ITWA 5T57A 4IY1A 3RUHA 2X6TA 4MVJA 2J8ZA 4N54A 4TQGA 3L4BC 4WCFB 1Q7CA 2YZ7A 2EG9A 4UREA 1EQUA 5CEEA 1ORRA 2VHYA 3ON5A 2P2SA 3GMDA 1OBFO 1RYEA 2H63A 4BHTA 3L6EA 3WQRA 4GMGA 4CLRB 1PZEA 4YT5A 4CM7A 1TVEA 2C0CA 5FFFA 3H6KA 3STHA 5C7OO 5U1PA 1BDBA 5JC1A 4PLWA 1GY8A 2VZ8A 3Q11A 2Q4BA 4IJKA 4ZQFA 1E3LA 2AE2A 7ADHA 4UVHA 2O3JA 1AHHA 1A5ZA 3B1JA 4UVEA 3PHGA 3VPFA 3IUSA 3DHEA 2PGJA 1CDOA 4E2WA 2VWGA 1ZJZA 1DJNA 2VWPA 3U9LA 4CQMA 2OHXA 1NAIA 2Q45A 4CM9D 4IGEA 1K6JA 4WKGA 3SJUA 4GMFA 2GERA 3DMTA 4XKJA 2VHXA 3ORFA 3A14A 3V8BA 1E3IA 3N7UA 5IN4A 1N5DA 1YOVB 3DOCA 2QG4A 3JQ7B 4NFSA 4LSMA 4GH5A 4Z0PA 5L45A 5A5EA 1A71A 3U62A 3WWYA 3TL2A 4HP8A 3WYBA 4ONEA 5DNAA 4B7UA 3BMOB 5A4DA 1A4UA 3S2GA 4E31A 3RFVA 4A5OA 3VZSA 1P74A 4CMEC 4JIGA 2DBVO 4BO7A 3ONEA 2FPGA 3OQBA 1GEEA 1HDYA 4MVJG 1J49A 4EGFA 2YUTA 1ZSVA 1GAEO 1LSSA 3KSZO 3L07A 1Y9AA 5KWEA 1EEHA 1H0KA 5A9SB 1I5RA 1VJTA 3WSWA 4FS3A 2YQ4A 4HWKA 3GVHA 3OFSA 1M67A 3IQDB 3KLPX 3O4RA 4YAJA 2H9IA 4CODB 2UDPA 1Q0HA 3JQ9A 3QA9A 4I1IA 3JQ9C 3QP9A 1X7DA 2VYVA 3BAZA 1EUCA 1DJQA 1ID1A 2ZB8A 3CZMA 3ROKA 4EEZA 3WYEA 1JVSA 1RWBA 1EE9A 4I5GA 3JYQA 4BO3A 3SVTA 1OI7A 4IPTA 1LDNA 5CDTA 3D3WB 1PJQA 1NQOA 5DP1A 1O5IA 1YJ8A 4FC7A 4II2A 1VSVA 1U1IA 3I9LA 1CF2O 5EESA 1PSDA 1N1GA 3JD0A 1GQQA 5TLSA 4NDNE 3SC4A 1G6KA 1NM5A 1NWCA 1UXKA 2FR0A 3EW7A 2GLXA 3LZ6A 4TVBA 4B8ZA 3ETDA 3ZNQA 1Y9EA 1J6UA 4MP8A 4CMIB 4MVJP 2B4TO 4WOKA 1WPQA 4BKQA 2FZEA 1P31A 3S8MA 3SEFA 1WDMA 2NSDA 2HMSA 3OHSX 3PJDA 1YO6A 2P9GA 1FDVA 4RGBA 4AJOA 3IUPA 3HDQA 4RVFA 1LDBA 4F45A 1ZK1A 1NXQA 3INTA 3NT5A 1CETA 3QWHA 4KUEA 3T4XA 4WLVA 3GZNA 1IUKA 2CVQA 4R1UA 5HTOA 3KTDA 5CEJA 1F0YA 3MJCA 2JD1A 2XF8A 1PWXA 4NR0A 3JQGB 2JCXA 4TZTA 4D7AA 1UJMA 2C20A 1EZ4A 1Q2XA 2RHRA 3HHPA 3BA1A 2CSUA 2V6MA 4IDGA 4IM7A 1KVQA 1EMDA 2RH4A 1HL3A 1YL5A 1N9GB 4KZPA 3VVBA 1YS4A 3H2ZA 3OEYA 3IJRA 3T7EA 2G76A 4XQ9A 4M89A 4GX5A 1ISHA 3GG9A 1EVZA 1IZ0A 3JD1A 3I6IA 3RCBA 2WE7A 2NADA 1VLLA 1NX6A 1P1FA 2RCYA 3PGJA 3WQSB 2JFGA 4NBWA 4RL6A 3RROA 1V9LA 4JGBA 1E5QA 2DTEA 1Y81A 4I5EA 4JCOA 5IDYA 4DQXA 3BTOA 3D7LA 2AEMA 3OJFA 1NPDA 1I2CA 5GZ1A 9LDTA 2DUWA 4H3VA 5BNFA 3ZU4A 1XHLA 4CM8B 2P4HX 4QXMA 1NHWA 4EITA 3IDSA 2PR2A 4BNWA 2D1YA 4Y6RA 4A0SA 3DL2A 2Q2WA 3VVCA 1G0NA 1UDAA 5AYVA 1QMGA 1SNYA 3HFGA 4BL5A 5T5QA 3H5RA 1TT7A 2X5OA 4FJ2A 4YB8A 2P91A 4XCVA 1S7CA 2O4CA 4OH1A 1NP3A 3LC2O 3PYMA 3UKOA 4BS9A 3DBLA 2DBZA 3FPLA 1VE9A 1F8FA 2DFVA 2OP1A 3ICPA 2V6GA 3PZBA 4XJSA 4YJGA 3AY7A 4OAQA 2W2KA 2HO5A 1UDBA 3KYCA 2XPCA 1HRDA 1PJLA 1TT5A 4BO9A 3PPIA 1DFHA 1D7OA 1J5PA 3H5NA 4O1MA 2JCYA 4BMVA 4MPDA 5K6AA 4QQRA 5EERA 4PN3A 4OYRA 3AJRA 4ROSA 1JW9B 3CINA 3DONA 3G0OA 3ZWPA 3ZWCA 5LDHA 4BGEA 2I65A 3QJ5A 2IZZA 2UUPA 1YJQA 1NAHA 1PJSA 1GYPA 4AVYA 1I3MA 4N5LA 2B36A 5TIIA 2AXQA 3TZ6A 4YYZA 4J7UA 2RAFA 4BNHA 2GSDA 3AUUA 4IQ8A 5AXDA 1C14A 5F5NA 3UW3A 3NDRA 4RDHA 4M1QA 4E5MA 3ZWYA 5JNLA 3M2TA 4D45A 2NNLD 4J43A 5FYDA 1ZXLA 1ENPA 3HDHA 4NK4A 4JJIA 1WMAA 2Y0CA 5GY7A 4Y8VA 3GEGA 5FWNA 2OBNA 3AFNA 4DBVO 2J3HA 2PZLA 2Z95A 3ONDA 4PVCA 5H81A 4YT4A 3RD5A 1HYGA 4CLOB 5KVCA 5I9MA 2O7SA 4PLHA 4XYGA 3ZV4A 3TSCA 1U3WA 3WWZA 2B4RO 1HSZA 2J3KA 5K9ZA 5DN9A 1ZZEA 5DBGA 3GVXA 1VPDA 4CQMD 4PLZA 3RQSA 2AQKA 2OORA 2B35A 3WDSA 1RM0A 4PG8A 4CMHA 1BXGA 4DVJA 1XA0A 5AQ1A 4BNMA 3BMCA 4WUVA 2OGUA 3WLEA 1BVRA 2Q1TA 4MO2A 4IJWA 5T6BA 3RIHA 1ZSYA 4H16A 4AJLA 4E21A 1HETA 4FOSA 1LRKA 1SEVA 3F46A 4E5NA 1DSSG 4Q39A 1WZEA 3QVOA 3IAHA 5AXBA 1D4FA 1V3VA 2BLLA 4A2CA 4CQLB 4JP2A 2IXAA 4LCJA 4RLSA 4AJHA 4B3JA 2B69A 3JYOA 3DQPA 4IDAA 4DIOA 4XX0A 5KCZA 2ZTUA 2O23A 5U9CA 4UEJA 1NFFA 1UP7A 1QYCA 1GUYA 3LT0A 3MOGA 4OQYA 4PCVA 3RAJA 4GX0A 1DC6A 2Q3EA 4IIVA 3LQFA 3CMCO 4CUJA 4RPKA 4BNFA 5K0ZA 2GN9A 5LC1A 4CL8A 1ULSA 1TEHA 2ZCUA 4WK6A 1V35A 2IEDA 4JLWA 4RF3A 1T2CA 4GVLA 1DDOA 4YVFA 5TX7A 1M6WA 1WNTA 3RUEA 3TFQA 5KNLA 3LT4A 4UUMA 2X8LA 1PGOA 3K30A 4YA6A 2WYVA 5JC8A 3ASUA 4BO2A 1YRLA 4FGSA 3KXDA 1B7GO 5L7TA 3DAGA 4DC0A 2DPHA 4DLLA 4YQZA 2GCGA 3K8ZA 3CE6A 3HJAA 2EIHA 1DLJA 1GPJA 3HADA 4AICA 4JROA 1E3WA 1HYEA 1WP4A 3ZGYA 3O8QB 3D5TA 2VT2A 1JU9A 4KOAA 3M6IA 4NZ9A 3QSGA 3SX2A 4U6QA 4OXNA 3ENNA 4XIJA 3LLSA 3ZNNA 3IS3A 3H9QA 3FR7A 1NPYA 2NQTA 1E7WA 1Y8RB 2WD7A 4PZEA 3RFXA 2HMTA 1P1HA 4Z6KA 2DUUA 4E4YA 2FN7A 3WGOA 1L7DA 2FMUA 1LLUA 1QYDA 4J1TA 4Q3NA 2AG8A 3ZV5A 1LC3A 3MJSA 1Z6ZA 2OL4A 2VWHA 1E1MA 4I08A 2QRLA 1LNQA 4J2OA 4W4TA 1SC6A 2X58A 5ADHA 2HUNA 4HKTA 1DLIA 4Y67A 1M2WA 1QV7A 2O3QA 3E6AA 4M49A 4RF2A 4MOWA 4XYLA 4JNKA 3FBGA 1ZH8A 3PRJA 2BH9A 4M87A 3WSVA 2A35A 2YYYA 1A4IA 4BNUA 4ND4A 2O2SA 3TRIA 1PZHA 4WLOA 1R4MB 1DOHA 4B4VA 1PR3A 5G4KA 4CR7A 2VOJA 3WICA 3NYWA 1B8UA 1KC1A 3RU9A 1ISJA 2I66A 2TMDA 4PZCA 3AUTA 3JCZA 2BFMA 4F46A 4OJNA 2WEKA 1NFQA 3JYLA 5H82A 1ZSNA 5IJZA 1E7RA 3D0OA 1I2ZA 3RUAA 4PVDA 3RC7A 1GYQA 1Q7BA 4AFNA 2BHLA 5ICSA 3M1LA 4AJPA 4B3HA 1EE2A 3LT1A 1X7HA 2HMWA 4QO7A 1JDJA 3GT0A 4B8WA 1MV8A 2QYSA 4GKVA 4YPOA 4R16A 2C59A 3DBRA 4E32A 3JQFA 1P45A 4C7KA 3GHHA 1GUZA 2EKLA 1GQYA 2C82A 1QLJA 4R54A 3TZKA 4MP6A 4E5YA 1VJ1A 2DFDA 3DWFA 1MXHA 2PV7A 4CR6A 4FQ8A 2G0TA 4JBIA 3VPGA 3W4KA 3FNHA 5TJ9A 3F4BA 1KIFA 1YDEA 4FFRA 5A9TA 3W4JA 2HKIA 2GRAA 5I7SA 4O5OA 1CQJA 1GZ3A 3HQ4O 5TF4A 3GHYA 2VZ9A 3EVTA 5BNTA 3JQ7A 4J9UE 4RF4A 1DAOA 2X9NA 3NTQA 4MVJI 4CL3A 2HMUA 5THKA 2B83A 2NQ8A 4IDFA 4LGVA 1Q1NA 4B4OA 4J1SA 3EUWA 2A94A 3JQAD 3LF2A 3PQEA 2VHZA 1ADBA 3PI7A 3ROMA 2G5CA 1RKXA 3I1JA 4L9RA 2EHDA 1SEPA 3PK0A 3GR6A 4IBOA 1R4NB 4RVGA 1P0CA 2NTNA 4NH4A 1X7GA 3QWIA 1ZUD1 2ZJ0A 1ZNQO 3EY4A 4OOEA 5EINA 3ICCA 3L9WA 5B37A 5A05A 2VHWA 3TWOA 1CERA 3DZHA 2YV2A 4E2ZA 4Z3DA 3RKRA 1Y5MA 2YW9A 1WDLA 2JL1A 3FWNA 4R41A 3D3EA 2CF6A 2Y93A 3I9KA 3OECA 4EUFA 5JDCC 1LUAA 1H93A 3GC6A 4L4RA 4YRDA 2GZ3A 4GWGA 4EBFA 5L40A 2YHIA 3GF4A 1P0FA 4MIYA 2ZK7A 1QKIA 3ANLA 3JQAB 5HRUA 5FI3A 1F12A 2GNAA 4BNNA 4D3SA 2C7GA 3E5MA 3PFFA 2GN4A 1E7QA 1IB6A 1NVTA 2Q2QA 4OGWA 4PG5A 4CMJA 2XXJA 1ENZA 3DTYA 4C7JA 1PS8A 2CUKA 4KTTE 1CEQA 1YWGO 2UVDA 5KVQA 5ILGA 2H6EA 1I10A 1P44A 2IDZA 3KB6A 5L4SA 3RI3A 1K3TA 5JCXA 1MG0A 4LCEA 3INRA 4DPKA 1MC4A 4P22A 3E9QA 4RPLA 2Y0EA 3AWDA 1PL8A 3GMSA 4MIEA 2FR1A 2Y99A 3FSRA 4ILKA 3AM3A 3AUAA 5BSGA 3TFOA 1SMKA 2Q99A 1IPFA 4NBRA 5BSHA 3ITDA 3JYNA 3TJRA 1DIAA 3A4VA 3BXXA 4I5DA 1N7HA 4CLEA 5JY6A 1UDCA 4PRLA 1H9AA 3R0IA 4AJ2A 3E18A 3JQGA 4TROA 1ZK0A 2J3IA 4WASA 4AJ4A 5FEUA 1XDWA 4NBVA 4HFRA 4CV3A 2IXBA 1F17A 5TRTA 2A4KA 5JDCA 1GZ4A 1OFGA 4GX1A 5GZ6A 4MINA 2WDZA 3W6ZA 5I7EA 4YAGA 3TDKA 3QRWA 4IZIA 4ESOA 5G0SA 3PDUA 4DIBA 5L51A 3H9UA 1QYXA 2B0JA 5EJ2A 2A9FA 2BELA 5CEFA 1PJTA 4DLAA 3ROQA 1VSUA 1A72A 4YTEA 3O38A 5F1OA 1ENOA 3OIDA 1EDZA 3WMWA 4AJKA 5CAEA 3FHLA 4XWYA 3X2FA 5JAMA 1Q0LA 4D3FA 4IDEA 3UXYA 2ZJ1A 3WB9A 4R68A 4WEOA 3ZZNA 4E33A 1X0XA 1SBYA 3JD3A 3RASA 4S3MA 5G0VA 5TC4A 3NJ4A 5ENDA 1UP4A 3WGYA 2ZCVA 3UH1A 3P5SA 3VTFA 5G0UA 4BB6A 1PX0A 1T4DA 3WGTA 4BKPA 2X9VA 3DMYA 1P77A 1LSUA 1DRWA 2Q49A 1KBZA 2HU2A 1PJCA 2QHXA 4MP3A 4NK5A 3PHHA 3U5TA 4DBZA 5JAZA 4FR5A 1YBVA 2C7VA 1NWHA 4FB5A 5AXCA 2BMAA 4IS3A 5HA5A 3KYCB 4JQCA 2IE0A 4LVCA 2PGLA 3JQCA 1G0OA 4BNXA 5JDIA 2WYUA 3WIEA 4XB1A 3ZDFA 3VKUA 4R1TA 4E3ZA 4OQZA 3OJOA 1NQAO 5L3ZA 1TLTA 4TKMA 4UAGA 1DRUA 3I9JA 4A03A 3G1UA 3Q2IA 1J4AA 4NHEA 3UF0A 2YJZA 1T2AA 3G1TA 1OC4A 1N7GA 3B20A 2G17A 1Y6JA 4I9UA 4IDDA 4W7HA 1IHYA 2QZZA 2LDBA 1E92A 1I30A 5I9LA 4OO3A 2VWQA 1LJ8A 1DFGA 2HJRA 4K26A 1ARZA 3HDJA 5KOIA 2P5YA 2I76A 4FPXA 1BTOA 1QYWA 5ENVA 5EIOA 3PJGA 4XJTA 1PQPA 2JCVA 5CPFA 3C1OA 2Y1CA 3S2FA 1CRWG 3U09A 2VOEA 4UUPA 1GV1A 3PWZA 2D4AA 1C0PA 2O50A 2J5QA 1VJ0A 3RC1A 4CLXA 3N58A 4CLOA 4L73A 2DQ4A 2JHGA 3GDFA 4U0KA 2CVOA 1DIBA 1PGPA 1YDWA 2VRCD 3F3SA 3GZ4A 3ZWXA 2NLOA 3AI1A 1UXHA 3WFIA 5CPBA 2OO5A 2WWRA 4BQRA 4LK3A 4EDFA 2HJSA 2EERA 1BWSA 1DHTA 1RPNA 1GCOA 1YXMA 1B16A 2DPGA 2ZTVA 4YCAA 3A28A 3PYLA 3OJLA 3M1AA 5L4NA 3BMCB 1XR3A 1UXJA 2Y1OA 1A7KA 7MDHA 3LF1A 4IDCA 4CM4A 5KJFA 3JQ8A 1E3JA 2GASA 4OOFA 3BHJA 1RM3A 2WM3A 3ASVA 4ND1A 3DHYA 4CMKA 4CR8A 4L0QA 3GNTA 1LLDA 3JSAA 5IZ4A 2ZTLA 4A27A 1FF9A 1HTBA 4G65A 1JVBA 4DPLA 2I67A 5KVSA 2IZ0A 3CIFA 3PYXA 1BW9A 3WJAA 5JW6A 3E5RA 1LU9A 2I3AA 1P3DA 2BKAA 1RYDA 2EJVA 2YDYA 4E12A 1PR9A 4GGOA 1Y1PA 1HDOA 3Q9NA 4D42A 3PP8A 3PVZA 1SB8A 3ZHYA 4KUGA 2EP7A 5T8KC 1B3RA 3K6JA 3GNSA 3GVCA 5JY1A 4HADA 4R5MA 4LVUA 3FNFA 2B4QA 4J2HA 1YVEI 1V3UA 1MP0A 3ZWMA 4DYDA 3UICA 1C1XA 3HG7A 3DZJA 4R9SA 4XGIA 5JCJA 1GQ2A 4KUHA 1U2GA 3S1LA 3AOEA 3H8VA 3PHJA 1HEUA 3KSUA 2X0NA 4XD2A 3KRTA 5G0WA 2D3TA 4GBJA 5JAIA 1NASA 5MGBA 1PJ3A 2IRWA 2TMGA 4KWIA 3WOHA 3GAZA 3G79A 1ZIDA 1O94A 3WNVA 4K1LA 4RPGA 4PIVA 1GYRA 4DYVA 1XG5A 3KYBA 1O9BA 3D64A 3GAFA 3LLVA 2FWMX 3UUWA 2J5RA 2RIRA 2IZ1A 2O3TA 1O8CA 3AW9A 1WLYA 3ZI0A 1PIWA 5A1TA 4CM3A 3H3FA 4NIMA 1AE1A 3EGOA 3E9NA 4PRKA 4R51A 3E1KA 1PJBA 5TJHA 1X15A 1MG5A 1X14A 2UAGA 3HWRA 4LMRA 4NI5A 2GO1A 3WXBA 2EGGA 3JQ6A 3LC7O 1PGJA 4XB2A 1V3TA 4Y9DA 1DIRA 2CDAA 2W90A 3DBLB 1E1LA 4E30A 3OP4A 1W0CA 4FC6A 5IAAA 5MDHA 1YH3A 3JQFC 1ZK2A 3EK2A 1DPGA 2CNBA 3PTZA 1LSOA 3GGOA 2IEBA 3V2GA 2ZB3A 3IJPA 3OIFA 4RF5A 5TT0A 1NQTA 2ZYAA 5C7LO 2YDXA 4KMSA 3IMFA 1YOVA 3W6UA 5C5IA 3DHNA 4M54A 1M75A 5ER6A 1E3SA 1BXKA 1WZIA 4K9DA 3K92A 2DT5A 1B15A 4PLYA 1U5CA 3BZUA 5L53A 1K2WA 4ZVVA 5HS6A 2HRBA 1QLHA 1SPXA 1A9ZA 2EEZA 4HXYA 4Y6SA 1ADGA 3WFJA 3VDQA 4CV2A 1P1RA 4G2NA 5F3RA 3DTTA 4HBGA 2AHRA 2ZQZA 1Q7GA 3E03A 1H6BA 1ENYA 3PLRA 4PLVA 3IKTA 1U7TA 3CH6A 3VHRA 3OH8A 4Z9YA 1UZNA 2NU8A 1U28A 3BMQA 3HN7A 2GZ2A 2RBEA 1P33A 4TRRA 4ZRNA 4PG6A 1OOEA 3TZQA 3EVNA 4B79A 1QORA 4ZHSA 1IY8A 3VH1A 1GDHA 1GUFA 1H2BA 1YL6A 1SCUA 1CIVA 2EKQA 4X54A 4J90A 3D3WA 2EP5A 1AXEA 3DO5A 1YL7A 3K96A 4QFCA 4XGNA 5AOVA 1M6HA 4WE3A 4CMEA 2X7HA 1U4SA 2DU8A 4JX8A 3QQPA 5JS6A 1E6EA 2Y1EA 3VPSA 3ETGA 3I23A 5HBRA 1B8VA 2B5WA 1GTMA 2FP4A 5DZSA 5BT9A 4DPMA 1WVGA 1U9JA 1VC2A 2PKQP 2X22A 3GVIA 2AQHA 4IIUA 4WJZA 4QUKA 3JQDA 2OZPA 1KY5A 3RVDA 2ET6A 4EJMA 4CMIA 4J9VA 3RWBA 3H9EO 1I8TA 2JD0A 1SOWA 1NQ5A 2NUAA 3F9IA 2Q1WA 1B0AA 2QIOA 2CDCA 4MVJH 5JSFA 4R4JA 4KDEA 1YQGA 4CLHA 2G82A 5FI5A 3WS7A 5EMHA 4FCCA 4IXTA 4YT8A 4XYEA 1J0XO 1MFZA 3OJ0A 4JJGA 3L6OO 4E13A 1AN9A 1M76A 2DTXA 1R66A 1MLDA 3NX4A 2BI7A 1HWYA 2V6FA 1Q0QA 3F47A 5BSFA 4M8SA 4INAA 3VZPA 1EBFA 4YAEA 1JAYA 3QIVA 1L1FA 2PH5A 2V6BA 4BNYA 3I4CA 3UCXA 4R1NA 1R12A 3D4NA 2OUIA 3PQDA 1OC2A 4TVOA 3ADOA 2WMDA 3AOGA 3GNQA 3BMNA 4W82A 1K6IA 3WGHA 1GPDG 1JTVA 1LA2A 1N8KA 3PIDA 4AJ1A 1NR1A 3JYPA 3ZU2A 2R2GA 4NNJA 4J0EA 3AFMA 2B37A 4YQYA 1HDGO 5I7FA 1T1RA 1YE3A 2X86A 2X4GA 1DAPA 2PZMA 2EWMA 1PGNA 2F00A 3O8QA 4FFPA 5COBA 5LDGA 3WQQA 3VTZA 2BFAA 4YJHA 2R6JA 4BO8A 4RVSA 4LRTB 5IG2A 2BF7A 2H5LA 4DL9A 3U0BA 2NTJA 3PGXA 5H83A 4EEXA 3ZW9A 4HFJA 2W2LA 3V2HA 5C37A 3CTMA 1JKFA 3UN1A 4CLRA 3KETA 1ULUA 5IZCC 4TRNA 4XR4A 5JYDA 2OFPA 2X0JA 4PGFA 2VHVA 4GKBA 4QECA 4Y98A 4DGSA 4JJFA 5FF9A 3UFXA 4EJ0A 4OHUA 3MJVA 1T2DA 3OF2A 3GRKA 1MC5A 4NMHA 2NWQA 1X13A 1QSGA 1KS9A 2VNAA 1JWBB 2Q1UA 1RM4A 3DBVO 2W2KB 4TZKA 4LW8A 2D5AA 1N2SA 4BNZA 2HK8A 3IP3A 2HK9A 3I3OA 2VYND 5BR7A 1NVGA 1U3UA 3GQVA 4CV0A 4UEOA 4Z0TA 2VT3A 1IULA 3FR8A 3MJ4A 3E9MA 3BMOA 1H6CA 1HDCA 1W6UA 2H1SA 3TPCA 3PWSA 4AJJA 1GV0A 3HB4X 3PLNA 4Y6PA 1KY4A 3Q9UA 2Q46A 3C7CB 1K0UA 8ADHA 5DDIP 1TB4A 1ONNA 3WMXA 3S2IA 4MKXA 4AL4A 1KVSA 3ZNPA 1HSOA 1I01A 1E7MA 3NTRA 4EYEA 4D46A 3ZU3A 3FWZA 1D1SA 3EDMA 4BO4A 5B12A 1HLPA 3JD2A 1HF3A 2IYOA 3R1IA 1FJHA 2BI8A 2PWZA 6ADHA 1JN0A 3W8DA 4EW6A 4NJMA 4UVGA 3FF4A 3FN4A 2WD8A 3ZWOA 1E6WA 1YKFA 3C3XA 1SOVA 3TZHA 5EQDA 3F5SA 4PG4A 3AUSA 1C1DB 2W4QA 4E5PA 4GSKA 4ALKA 4D0RA 3V1YA 1KEWA 1NFRA 2DLDA 2VTEA 3NAQA 3Q6IA 4MDHA 4FFMA 4WCDA 5TGDA 4U5QA 4A73A 3OETA 3I6QA 4BMSA 1JKIA 4YT2A 1VL0A 5JE8A 3QY9A 4TKLA 3RKUA 3DFUA 1IZ9A 2GZ1A 3H2SA 3TNLA 1BXGB 1NR7A 2HK7A 3VPXA 3WYCA 4BVAA 1O95A 3OQ1A 3KYDA 5ILOA 3ONFA 4L4XA 3DOOA 4BO0A 3B70A 1PJ4A 1Z82A 1R15A 4J91A 5K6AC 1OMOA 3IL2A 1AGNA 4DC1A 1B26A 1R4NA 1LLQA 3C85A 5IFLA 1KYQA 1DO8A 2EF1A 3OA2A 3V1TC 4A10A 3RSHA 3E48A 4ZQBA 2Q2VA 4ALNA 4CQLA 2VN8A 2X5JO 4TSKA 4E2XA 2ZYGA 4J7XA 3U4IA 4GVXA 3FPCA 2X0IA 1ZEMA 5DOVA 2ZQYA 5THQA 4O59O 2CD9A 1XWFA 4GSLA 4RZIA 1I32A 1C0KA 3QW2A 1K5HA 4ID9A 4OSOA 5A03A 1YBMA 4L74A 1UR5A 4DTIA 3GG2A 4KQWA 4BGIA 1PQWA 3ZWWA 3JQAA 3N74A 4J4BA 3TL3A 3DC2A 2HMVA 2ZTMA 3GUYA 4Q3EA 2W98A 2FPPA 2AEFA 3FTNA 3NT4A 5JO9A 1XKQA 1N9GA 2JJYA 3GFGA 1I3LA 5G0TA 2EXXA 4FJ0A 2OBYA 3GVPA 5IZCA 5G4LA 2CF5A 4UUNA 1UAGA 5F21A 5TNXA 4YBZA 3NKLA 1KERA 3K2BA 1UUFA 1D8AA 2Q1SA 4BB5A 1WDKA 3DEYX 3MEQA 1W4ZA 2ILTA 2NVWA 3H65A 3HN2A 3OBBA 3OM9A 4WCFA 3WIDA 1R0LA 2EKPA 3A1NA 5ER9A 3ZNOA 3CXRA 4R1SA 3VZRA 1DBVO 3ZU5A 5KVVA 4OM8A 2DC1A 1FXSA 4KQXA 3NV9A 4O6VA 3AI2A 5HM8A 2WD7B 1DIGA 2D2IA 3ZWAA 3MJEA 1GD1O 1U2DA 4IQ0A 3GFBA 5TS3A 2ZATA 1V8BA 3DBHA 2FSVA 1GCUA 1Z7BA 4RJTA 3WGIA 2NVBA 5AXAA 5F1KA 2J6IA 3MWEB 5ITVA 3B1FA 4I5FA 1IHXA 2FOIA 1BG6A 3OICA 1ZMTA 3QVWA 4ZQEA 4N5NA 3W8FA 1PS9A 1BGVA 1MUUA 5COAA 4CLDA 1ONPA 4LN1A 2E49A 3SJ7A 1LQUA 2QZ9A 3ANMA 4F6LA 3JQEA 5BNIA 4CQMB 3HE3A 1E1KA 4MIOA 1EUDA 1IE3A 1KVUA 1RJWA 2J5KA 5JLAA 4HUJA 3RBZA 4WGGA 2FRDA 5GZ3A 1ADFA 3F5QA 5DF1A 3EZYA 3ROPA 3H4VA 2PFGA 1XSEA 3CMMA 4YRBA 3QVTA 3LK7A 1UH5A 3G17A 1HZZA 5T8KA 3C1AA 4UEKA 1XIVA 5A9RA 4NU5A 4E0BA 3GH3A 1ZKMA 1WAMA 4BMNA 3AI3A 5ICMA 3ZWVA 3ZHXA 4W9NC 4CV1A 1NBOA 4W7IA 3KOUA 3BTVA 3COSA 3VKVA 3E82A 1ZBQA 1QRRA 4J3FA 1I36A 4NBUA 4BNIA 3FCOA 5A9SA 3DAFA 3KEOA 4D79A 4MVJE 4BV9A 4Z3KA 5LCXA 5IDWA 1GADO 4J7CA 2D8AA 3DOJA 2PNFA 2ZB4A 3V5NA 3W8EA 5CDGA 3Q2KA 4GI2A 5JMPA 3D1LA 2HSDA 4XR9A 5KKCA 4NG5A 3DFZA 2X5KO 3DZIA 2Z1MA 4FSHA 4BQPA 4BKRA 4GWKA 1E3EA 2VUTA 4DUPA 2NVUB 5KJ1A 2AG5A 2GR9A 4YXFA 2NM0A 4JBHA 3TOXA 3U4HA 3H9JA 5CFZA 1KOLA 3ITKA 4NJOA 4XQCA 3X2EA 4KTVE 1BMDA 4RVDA 1Y8QA 1XEAA 2NU7A 1L7EA 4GQAA 1E7YA 4YR9A 1DRVA 4A26A 4E2YA 3K5PA 4H7PA 1HE3A 1ZEJA 3JQBA 3OQ6A 3GEDA 5L95A 1VRWA 4TRMA 3HNPA 4IMPA 4G5HA 1CYDA 4HX5A 3RBVA 3GY0A 1JAXA 3FRJA 1MFPA 4YAKA 3WNQA 4FDAA 2R00A 4XDYA 1OAAA 1IOLA 5BSEA 1WWKA 3VPHA 1T25A 1LDEA 5IN5A 4MKZA 1V0JA 2D59A 3WTBA 1HLDA 1TXGA 3L4SO 3H9GA 2XOXA 1U3TA 1PWZA 2GN8A 2RHCA 2P68A 3WGZA 2JFHA 3ADPA 4GLLA 2BFOA 3BIOA 3GLQA 1UAYA 1ZFNA 3C7DB 2DTDA 3GZNB 4NQZA 1X1TA 3AY6A 4GLOA 4XEHA 4B7XA 4DWVA 1AHIA 4Q9NA 4RQTA 3GA0A 4GGPA 4ND3A 3DZKA 5IDQA 1E6UA 1I0ZA 4WECA 2FHSA 2JD2A 4FFLA 2D5CA 1A27A 4BNLA 1YQXA 4RPHA 4P4NA 3KSDO 4CMCA 1XYGA 2O2YA 2VYNA 3L4BA 4IGFA 1VI2A 3U4CA 1LRJA 3NDJA 4OKNA 1GEGA 4QTZA 3D4OA 1NTOA 5DOZA 2FR8A 1C3VA 1X0VA 4ZD6A 1SO8A 1DFIA 4Z9XA 4Q3AA 5A3VA 1I33A 5IXYA 3T7CA 2PA3A 2BRUA 3GGPA 3V2UA 5IF3A 3D4PA 3I9MA 1FK8A 1EBUA 3PJEA 2X9GA 3ZV6A 9LDBA 3JTMA 4MVJM 3HZZA 2OOSA 3LDHA 4M55A 3I5MA 4J1NA 3GGGA 4YAIA 2RH8A 3NDIA 1QV6A 3RC9A 5B4UA 1UZMA 4HNGA 5DBIA 1KEPA 1Y8RA 3RBXA 3AU8A 3M2PA 4D44A 4HV4A 3DZFA 2AW5A 3VOSA 3PZRA 4OXKA 4J6FA 3L9XA 1P1JA 1PZFA 2YY7A 2IODA 5TT1A 1C1XB 5JO0A 3BMNB 3WGQA 4EZBA 3WTCA 1T2EA 1O89A 2EW2A 5I8WA 4WLFA 3KBOA 1PL7A 1DC4A 1R4MA 4RPJA 5I7VA 4FN4A 2SCUA 4QO8A 2E4AA 4MVJD 3UAGA 4PZDA 1I3NA 2O48X 3JQBC 3TQHA 3WJ7A 5B4TA 1GFSA 1U4OA 1LX6A 1SZJG 2FSSA 5BQFA 1JKJA 4IMRA 4BV8A 4L8VA 1K6XA 3B1KA 1QR6A 1U7HA 3KVOA 4RLHA 3KUXA 2UUOA 3IKVA 2LDXA 5I9NA 3ULKA 2JKVA 3RJ9A 5C3MA 1TI7A 2VRCA 3ETEA 2DM6A 3BTSA 1AXGA 1EQ2A 1T2FA 4UUOA 2C5EA 2NACA 1FDTA 3RC2A 1HT0A 4EJ6A 3IOYA 4IXWA 3A06A 2E6UX 1KVRA 1CJCA 3GPDG 3RFTA 2JFFA 4B7CA 1F14A 4LSWA 3MTJA 1YQDA 2VZ0A 3WG9A 3PWKA 4XZ3A 1LBEA 1PQUA 1WXDA 4ND5A 3SLKA 5JBIA 4YJDA 3OEWA 1I24A 2VUUA 3TF5A 3MOIA 4YACA 1GR0A 4R9RA 4WPGA 4DIFA 1YB1A 5J23A 1VM6A 3OMLA 1C0IA 1KETA 2CDBA 2EV9A 1EK5A 4RQUA 4WNCA 3ZWNA 2NV6A 5TSDA 4OIMA 3P19A 1N92A 3QWAA 3V1UA 1T26A 2GGSA 3EZLA 3WX0A 4BNGA 1NNUA 4DMMA 1ZJYA 4MJLA 4JP3A 4D3DA 2HRZA 4URFA 1MGOA 3WGGA 1FMCA 1NYTA 2C2YA 4DMLA 1DB3A 3QE3A 4U7WA 5T64A 4ALMA 2PLAA 2BD0A 2PTGA 3GEMA 1E5LA 3GRPA 3K9QO 1E0DA 2AEJA 4O63O 5CG1A 1DC5A 2JAPA 3GN1A 3KV3O 3KO8A 2QRJA 5KJ6A 4NJMB 4BIIA 2VNSA 4QSMA 3OA0A 4R01A 3DR3A 1QXSA 2VUSA 3EAGA 4PLGA 2YHUA 3NTOA 4YJFA 5DCYA 4MVJF 4Q3DA 4U6SA 4XGKA 3W1VA 2V65A 2I99A 3QWBA 1MA0A 1BRMA 1GL3A 3PQFA 1D3AA 5A06A 2C54A 2DKNA 2ZKLA 3GDGA 4II3A 1W73A 1ZMOA 4PFJA 1PZGA 2EGHA 3CZRA 3BHMA 2QW8A 4ZU3A 3UVEA 5KIAA 3S2EA 3RUCA 4BO1A 4B4UA 2W8ZA 4IJVA 1QG6A 4E6PA 1IYZA 2BFPA 3CEAA 4QFDA 1HE5A 2P5UA 3H7AA 3ZCXA 1LSJA 3PEFA 4YEDA 3QWFA 4KDFA 1MB4A 3O9ZA 1F06A 3IP1A 4MKRA 5TQVA 2GF2A 4QT0A 4XRRA 3RUIA 2DVMA 2FY8A 1HDZA 3NEPX 4WEQA 5CDYA 4I9NA 1E3WB 4O0LA 3BYZA 3AM4A 4ALLA 1H9BA 4EI2A 3I4FA 2QYTA 1U3VA 4XRGA 2AQIA 3JD4A 3ZV3A 4BNTA 2O3SA 4FBGA 3BHIA 1XQ6A 5CP8A 5DULA 4C4OA 3AM5A 4WLUA 1T4BA 3EHEA 5AVOA 4TMFA 3HUDA 4TWRA 1H5QA 4M86A 2C07A 1B2LA 5HWSA 2GDZA 4CJXA 3GOHA 1P1KA
chains in the Genus database with same CATH superfamily
3L7KA 1NHGA 2ZIWB 4QARA 2QRVB 3PRHA 2Y1GA 2ODTX 3N75A 3FOCA 5KVAA 3C7AA 2QTZA 1Z75A 3ZI4A 4BJ6A 4FM9A 1KWKA 2OFXA 3F9CA 1EM8A 2VQ6A 3OLWA 4G97A 4O4LA 5GJCA 2P4QA 5HIMA 5FPHA 5T67A 2Y66A 5ECDA 5E9QA 1HYBA 2HA7A 3MBOA 1U8CB 1UDXA 4JK3A 5L7WA 5JBQA 1X80A 3RG2A 3L8FA 2Q50A 5FORA 3UATA 3PJFA 1Q14A 1MQAA 4YRKA 1MRZA 4HQNA 3TLGA 1RVDA 1J39A 1M0SA 1U6KA 2PV0A 3N8DA 2V3VA 2AIRA 2ODNA 3IAM1 4IIXA 4QU9A 2F48A 4L7VA 6YASA 3IBTA 1IOVA 2RGRA 4AI6A 4UDXX 4FDLA 4NYJQ 2BJVA 3IQZA 4H1HA 3K0FB 3OZGA 4UBIA 3INYA 2NO5A 4RTOA 3BEDA 3ZLTA 3LECA 4B45A 2CZCA 3NYIA 3KU4A 3L77A 2OXIA 5CDUA 1EDBA 2ZPUA 3FUVA 2QXTA 3ZWKA 5IWAB 1EVYA 2Z57A 5C5CA 4MTLA 5CURA 1R6XA 3DC7A 5FL7D 3Q6MA 3VI4B 3W9UA 3UOGA 1VHLA 3A36A 1ZD3A 2I1LA 4UMDA 1BEEA 1E7SA 5C9ZA 1Z74A 1EGHA 2WG0A 3EIWA 2H4YA 3L0YA 1HM5A 4HDKA 4L4ZA 4L9AA 5KI6A 2QX6A 3TK1A 2IOQA 3X1ZA 4A15A 7MHTA 3JALB 3A6JA 2NSYA 4AJIA 2OMEA 3NC4A 3OSUA 3T4EA 1WSBA 5GIOE 4AC9A 4E1VA 3U61B 1KQGA 2VDPB 3KVYA 2BBTA 2ZJ3A 2QORA 2ZYDA 4URYR 3M6VA 4JJAA 2X3FA 2X23A 1VPLA 1JR6A 1ISFA 3GK3A 4H27A 2ZAIA 1N1EA 1AQUA 1WCIB 1WCV1 1KK1A 1K1EA 1XELA 1UBRS 3U13A 3C70A 3KDSE 5JATA 1OTXA 2BUAA 2JAXA 1U28C 4P92A 5JYEA 2PZAA 4P8RA 2JF0A 4ND2A 5K0JA 3ZH2A 4CM6A 3OJXA 2WLTA 3DXFA 1UKCA 3P2OA 4KPGA 1IN7A 1PFGA 3GGSA 4X8MA 1XMSA 1SVKA 3FDZB 1L3IA 2GMWA 4P4GA 1KEVA 1N25A 1S2GA 1XQ1A 2GPTA 1W5SA 4R69A 3QV1A 1QOQB 4GI3A 2R9VA 1ZXBA 4MLCA 4U8GA 5EGNA 3V55A 3WLQA 5BV2P 4MRSA 2I5PO 4KQCA 4ZYZA 1OH5A 3AY3A 3R6DA 4K9SA 4OM7A 3V7UA 2ZJOA 5LB2A 3KQLA 2I7DA 4V0LA 3I2JA 3HBMA 3HGMA 1BXZA 4LOAA 3PHIA 4AG3A 1R6UA 3WL8A 1Z3IX 3GA7A 3PIIA 3VX4A 5KTPA 1PEDA 3ENKA 2QWXA 3NHPA 4IJUA 3NGLA 4QOFA 2VIIA 4DJDC 1VL8A 2C2XA 2G4LA 5A5FA 5IJ0B 3ZJTA 2I8CA 3R0VA 4XVUA 1RYMA 3L0PA 4HJRA 4FW9A 1SQ0A 5M29A 1B6TA 1YGYA 2O1WA 1C3EA 3ETLA 3N2GB 3QEKA 4NFYA 5EE1A 5FD8A 3WV4A 5AM2A 3QLJA 5LU8A 1UOEA 3B82A 3E9ZA 3O03A 3N59A 1YONA 2FA9A 4KGXA 4DCCA 1H9CA 1QYRA 1KIMA 3HZHA 1DEKA 3SQNA 2B1GA 1ZGBA 4O2BB 4IQGA 1R0KA 2BOVA 3CCFA 2GHTA 4I1UA 4MLDA 2YHIB 4PQRA 4QEDA 5HGJA 1P80A 4AECA 1L7MA 1NLZA 2Q2NA 1L7QA 3EISA 4N18A 5IXSA 3U56A 1QYIA 4IH4A 3KYDB 1F7UA 2R0QC 1XD2A 1W9MA 1JX6A 3HCBA 5LMUB 4FYMA 1UT6A 3OJEA 4G81A 2FSIA 1Y8QB 2YXBA 1QKKA 1XDZA 2YV1A 1TAQA 4CM4B 5HJ7A 2XF2A 4M0KA 4HY3A 1FU7A 1ZCJA 2JH9A 4FHEA 3H99A 3QBTA 1GGFA 1PHPA 2IUSA 2QN1A 3LU1A 3N2KB 3QV2A 1ILEA 3WL4A 4AO8A 2WTUA 1OVGA 1EBBA 1UFVA 2ZU6A 3B5JA 1E9FA 1QCCA 1A4XA 2OP0A 1BJTA 1GPWB 1DOAA 1QPGA 2JHPA 2PR7A 4XDZA 3FWPA 3VOAA 1QNLA 3GT7A 3JQ8B 2VHEA 4HWOA 3DE7X 2V7PA 4LBVA 5CIYA 1PG2A 3CPSA 1JAZA 4S1VA 4CMGA 3VNAA 2MOKA 3AOEC 4FIZA 4XWOA 3MQ2A 4QU8A 2IF0A 4J4HA 4PZ0A 2V5AA 1QIHA 2RD2A 1POWA 3GPIA 3SHTA 3ZKWA 5DK4A 1UBJS 4OREX 2YNMD 1P72A 3G6WA 3HKEB 3BQ9A 4D3YA 1SOMA 4HNAB 3CUKA 2GBLA 2C31A 2G4CA 1KAHA 1Z2OX 2H1FA 2OGZA 2ZWAA 3D3KA 3M6LA 4FR0A 2FFAA 4ZVQA 3BH0A 3R3SA 5AVUA 1TJ4A 1JWAB 3EZXA 3SQOA 2QAIA 1E0KA 3FTPA 3RUFA 3ZHBA 4B3IA 5CITA 4UPEA 4D4IA 2XJ9A 3LY7A 3CIOA 4TTQA 3VC2A 4QJ3A 1FSZA 1E3TA 3TX2A 4BZZA 1EZZA 2Z1DA 4TSFD 1GPKA 4NRDA 3Q7SA 4UXIA 3CLHA 3DMFA 4OHPA 3EDRA 4YC7A 3MWDB 1CR4A 5J2TF 1R0SA 4E5VA 2ZBEA 1VKHA 4HC4A 3UYKA 3H2KA 1JSRA 3PHBE 3QPUA 5IDXA 5KYXB 1GSOA 1UBGA 3ML1A 4TMWA 3UK7A 2FLWA 4QDOA 3RJ5A 4WXMA 5L7YA 3ACDA 1SB9A 1H1TA 3FGPA 4ETMA 1Z07A 5FEMA 3DOIA 4C6TB 3NRCA 3O5AA 4U0JA 3OKAA 1UBUS 3RABA 2QP4A 2CNLA 4FDMA 4R3NA 1THTA 4WD3A 4ZZ1A 3B5EA 5A6VA 4RVUA 1WS6A 4BO5A 4BOYA 4J0CA 4DWOA 1L7BA 2D0IA 4ZYWA 2O7QA 3HXKA 1M34B 2VJQA 3NFRA 2FAXA 1BU8A 1CJKC 1NNI1 4P98A 4CMAA 1H1LA 3FYTA 4G4SP 2UXDB 1EX6A 1WHTA 4XIYA 3JAWB 2VTBB 3SIRA 3I1FA 5LQUA 1X2EA 5D5QA 4J76A 5LBIA 3NHYA 3O4VA 4R9UC 3QZUA 5CT6A 2GTPA 3GJ4A 2VKTA 1G63A 4OX9Y 1MOSA 3HVUA 5B7GA 3VZQA 4WN9B 4I1YA 2BGKA 3OOEA 1PKEA 1PO7A 1RFGE 4PM4A 4R8VA 4HSEA 2J9GA 2KW5A 1LDGA 5MN4A 1ULZA 2ZW9A 1EDOA 1LXCA 1ZA1A 2A5DA 2IIQA 4R1PA 3PUVA 4W99A 1LD3A 4BUZA 2IHJA 4CMBA 1JQBA 1NXPA 1EAMA 2XZOA 4XJVA 3FTEA 4PLTA 3FNGA 4Q0MA 4DDMA 3WZ2A 4PCAA 3OX2A 4LISA 2XVMA 4KQJA 4O2AB 1N2BA 4HQRA 2Q0XA 1FFXA 1CQJB 2FRVA 3O6VA 1U0JA 3C8ZA 3ZBPA 1PU2A 1Z26A 3FRHA 4HTFB 1JKJB 2ORIA 2X1HA 2I1VB 1B73A 1BRTA 4I2NA 3V8MA 2JAHA 2NO0A 1HDRA 3T7RA 3FOEC 4NBSA 2WSBA 1YUNA 2KYRA 4PPGA 2QUBA 5CTJA 3OIVA 2CJWB 2X2PA 4IIDA 4Q9HA 3IX7A 4HYQA 4ISCA 1WXQA 1X1SA 2WU8A 1R0ZA 5AICA 4L57A 1SIBE 3I9NA 3P0JA 1RXWA 2R5NA 3VOBA 2OCBA 1JQLB 1W88A 2DBRA 3KHUA 3QX3A 1N0IA 1PR6A 1NW4A 3PSAA 1EUQA 2VL7A 4FW8A 4DCSA 4QGSA 5I3ZA 3EMKA 3KLMX 2PQMA 4J0FA 1F6DA 1Y9DA 3RADC 3CRW1 5LXTF 2OQIA 5KDDA 1RS0A 4FGZA 2AZMA 3T5TA 4UD6A 1FJXA 4TYMA 3R7NA 4YP7A 3CB2A 5HVNA 2JGRA 2V5VA 2XDAA 3MTGA 1FUIA 5WRFA 3UMVA 2C3YA 2EJWA 3TG2A 1U1DA 2PCLA 4DC9A 1DELA 2OV3A 5EWMA 5NLLA 3NEJA 3BMXA 1ZZGA 3WGLA 4TXLA 4GLBA 4UZFA 2WF8A 2Z8XA 4XYBA 3ZH9B 2Y68A 4ZQGA 1JE0A 3DSRA 4AG5A 3ECCA 3SBOA 3SHVA 3T4PA 4I55F 3I6YA 1JHUA 3D8TA 5D8DA 3BGVA 1OHHD 2NVUA 2O2HA 2YN2A 4TXMA 3GUCA 1ZBDA 5JMTA 4D4MA 5C1BA 3NUZA 2I62A 3ABIA 1XMXA 3AJEA 4HSGA 1Z6PA 1VPTA 1SIOA 5BQPA 1PJ8A 2ZR7A 4KKVA 5IH3A 2VLBA 3KJXA 4WDRA 5IJXA 5REQB 5A3JA 1DJLA 4WLNA 5B7QA 1LNZA 2ABWA 5AKLA 1VYTA 4P7KA 2HLPA 4ARCA 2XYGA 3UH0A 4UHJA 1ZL2A 3WRYA 2O7NA 1IXZA 4A8PA 5C7IO 2I4IA 3NUGA 4UD2A 5EE0A 4BGUA 5KHLB 2Z9DA 3S0JA 8LDHA 3E7XA 5C4MA 1WSDA 1G291 1KFBB 3TX6A 4D43A 4D81A 2FPIA 1VIMA 4XM1A 4KNVA 5JALA 4LF5B 1PJRA 2OILA 1NQXA 4EUHA 4IH9A 4LJSA 2GK6A 2HC9A 4BP9A 4CFYA 3KPVA 2FDRA 1CRQA 2R00C 2LNDA 1H2HA 3MCVA 4AG6A 1JEAA 5LZ2A 5B2EA 2ZJAA 2PVSA 3ZOKA 1NBMD 4ZYUA 5J58A 1FVHA 4Q3CA 4QNRA 4ZMRA 1ZH2A 5FNVB 5IBCA 1KP2A 4S1NA 2Z56A 2VTDA 5GJVC 4F4FA 1LDMA 4DXAA 3L6RA 4B4WA 1K66A 3O3CA 4OMUA 2YYZA 3ILVA 2ZI9A 1SAYA 1A97A 4U6NA 1H0SA 1ND6A 3ZDAA 2Z4TA 2X8JA 2NU9A 2R7NA 3R4CA 2W70A 2B2CA 4AP6A 4BFXA 3MVEA 1IMOA 1XYYA 5ICFA 2EJUA 2C3PA 2O7VA 4LYEA 5GV8A 2V03A 5KSZA 5JAQA 1RAFA 2A59A 1CUJA 4AUEA 3N53A 3SOZA 2DY1A 2GSWA 2LE0A 4IVNA 4C05A 4S1WA 3A26A 3VPAA 5TMBA 1XNJA 1L5MA 4N54A 4KN8A 3BCHA 4Q24A 3IHLA 4TQGA 3UUGA 4C3UA 3DF7A 3QBVA 6AT1A 3L4BC 1L7VC 1NVDA 3MLAA 3MFYA 1TDJA 4L4YA 4Q7LA 1G5HA 2R3SA 3FCXA 3QLVA 4ZZ2A 3C45A 3MGBA 4JODA 3IEMA 4J3NA 2XZTA 3BDIA 5ALEA 1C7FA 2VHYA 2YJTD 5AKJA 1ECPA 3ON5A 3P26A 4DWWA 4KO4S 2A30A 5GONF 5AVWA 4B33A 1OBFO 1Q11A 3BWVA 4OSEA 4Y2UA 1CE8B 1PFYA 1Z7WA 2VHUA 4OIFA 4QHTA 3SF8B 4CLRB 1BKYA 2RGWA 4R8KA 2FW8A 3STHA 1ABEA 2A0YA 1N2HA 2YZNA 3NIFB 5E3JA 5AI0A 1BDBA 4WN3A 5CFMA 2OOKA 2XJ4A 3E84A 4KFSA 1YZKA 1WG8A 2BT4A 3K9LA 1XXHB 3EDQA 2BEKA 2F67A 4QUBA 4UHBA 2IXTA 3EWIA 3B1JA 3PNMA 3PHGA 5KPJA 2P6NA 3N76A 4NOJA 3IUSA 1OILA 1AGPA 4LOKA 2PGJA 2N46A 3HUFA 3GX1A 3MIZA 3WSTA 4E2WA 1Z6AA 2PANA 1ZJZA 3KTOA 1DJNA 3IERA 2OHXA 4DV1B 1YVPA 4GZ5A 1L2TA 4CM9D 5AW3A 2GBFA 3EEBA 5E6SB 3CZ5A 3D1VA 4IGEA 4WKGA 1U2SA 4OXQA 4B5LA 3SJUA 1QS0B 1ZH4A 1TF2A 2GERA 3FKJA 5MN5A 2LIVA 2OESA 2V3WA 1G17A 1A1SA 3Q7QA 1Z8NA 5F5XA 3HI6A 4Q48A 1FP2A 2VDNB 2WJ4A 3DOCA 3DO6A 3IALA 4DCOA 2BYTA 4NFSA 4DA4A 1XAGA 5CLQA 4LSMA 2BFDB 4GH5A 4RAQA 2GKSA 5A5EA 3FMOB 5L45A 2APJA 1YRAA 1UPXA 3O4JA 5IM4F 4OGGA 4B7UA 4ARZA 4PYNA 1BD3A 1JYSA 2VP3A 3CLSC 3VZSA 1AURA 1PP4A 3LYHA 4JIGA 4KNWA 4MKFA 3UJBA 1E66A 2EF0A 1DQRA 4EGFA 2YUTA 5HZGA 1MNAA 4L22A 4M46A 1XZGA 3FBWA 3STVA 4W1QA 3H1EA 5JNWA 2HJHA 4UBNA 3RRNA 2QU7A 2YQ4A 1PQ4A 3K09C 1JVNA 3HY3A 2IHUA 3MCAA 2BFFB 3GFTA 4X6UA 3TXAA 1LPPA 2UDPA 5EKDA 3KOMA 4YWHA 5DIFA 3LUDA 3QA9A 4ND6A 4BB0A 1X7DA 3PF8A 4YQEA 3VYSB 4I4IA 1CY2A 1J06A 1P0QA 4C08A 4Z54A 4RSMA 3QE0A 3CZMA 2I4RA 4K2HA 5M3BA 4EEZA 1CUSA 2GD0A 1L5OA 1D2GA 1G3IA 1RZVA 3HMQA 1NR5A 3JYQA 4G25A 1Z6GA 4N7MA 3R8CA 4A6DA 2O5EA 4KZKA 5D2CA 1M2NA 4IPTA 4B6PA 1ND5A 3OCYA 5FA6A 1DXQA 2FB9A 2ADOA 5LMCA 1N2CB 3HUTA 4HR7A 1G64A 1ZHHA 3NEAA 5JZMA 2IV7A 1U3FA 1N5MA 4FC7A 2TRSB 4II2A 5E3IA 1OXKB 4DJTA 3J7AC 3I9LA 1W34A 3WLSA 1SKYB 1H8HD 4DHWA 1DUSA 1G19A 2BFWA 2WDPA 1NGSA 1QE3A 3K8QA 3V3KA 1I7QB 1QRTA 3LZ6A 1D03A 3DEAA 2FPOA 5EJ6A 2C4KA 4KKXB 3LLCA 2AFHA 2OM2A 1BAPA 1J6UA 1TCUA 1OI3A 1NVXQ 2H0QA 3AKCA 4JLSA 3SSNA 5AW2A 4ZO9A 1A5AB 2DUJA 5E2AA 1BMQA 4NAUA 4OJTA 3IUPA 4BAZA 1IQ0A 3DVRX 4JBYA 2O8FB 2GXUA 2HMAA 4BQQA 2QTBA 3UWOA 5CBPB 4BTEA 1NXQA 2G5GX 3HLYA 4JQZA 5IARA 4HLNA 1FDOA 4QPPA 3ELWA 4YMUA 3TIGA 1R3DA 1IUKA 1CIJA 5CEJA 3MJCA 1YBHA 4NZNA 2PKWA 2PXCA 4GIBA 3B89A 3B51X 4RJJA 3HPQA 1GPUA 3BFVA 4RIFA 2ZG6A 3ZXSA 4D5GA 4GOXA 5LN1A 3C8HA 2G36A 4LQ4A 4H4EA 2VJAA 1XZQA 4OK3A 1GZHB 3LBYA 1QO0A 2GETA 3N87A 1IZYA 1EZ4A 1P5RA 4M9SA 4IDGA 4TWBA 1U7DA 2CSUA 3L8MA 3V80A 4JCCA 2RH4A 1VE6A 1ZUNB 3CNOA 1DCMA 1GUDA 1GLVA 3E23A 3IDOA 3DP9A 2P2CA 3C1UA 1QH9A 1EINA 3T7EA 1N6HA 2JJ1A 3B12A 3E05A 3PE6A 4XQ9A 2TMKA 1GL6A 4HDQB 2VP2A 1IZ0A 4LJAA 3N6RA 1DI0A 3QPVA 3JD1A 1PEYA 9GPBA 2WE7A 2G83A 3PGJA 1P1FA 1ST2A 2JFGA 2WU3A 2ZRLA 4BCDA 3SFVA 2YBDA 5DHPA 3U7QA 4YCNA 4NBWA 1PHRA 3F5MA 3QLVC 4JGBA 4YMWA 1VL1A 5DNWA 5K0NA 2Q2OA 3CX4A 2PS1A 4AB1A 1OZGA 4HB3A 4XH9B 2ZBFA 1V9CA 2ZR8A 3HYNA 4I5EA 3L3BA 4ILEA 2VDQB 1OTHA 2AKAB 4JCOA 5EHGA 2PL1A 4TYYA 5CLGA 2QI9C 4OYYA 4UUQA 2P6RA 1E1DA 5F12A 4ZV7A 1H2EA 1TOAA 1RRVA 1Y7PA 4PHFA 4QXMA 4EITA 5FA5A 1E1RD 3LFTA 5EP1A 1XPOA 4BNWA 1II9A 4QYSA 2RHBA 1EP3B 1L5RA 1G0NA 4MV5A 1DAHA 1WPXA 1E2EA 4FP9A 1UZAA 3HY4A 3L1HA 3IT0A 4N5HX 5G1NA 1S7CA 2O4CA 1KP9A 2XTAA 4KQ9A 2QRHA 3LC2O 4RIGA 2FK7A 5AUOB 5HOQA 5F3DA 4CKZA 4O08A 1YB2A 1WMFA 1VSTA 1JNYA 3DMRA 2WVHA 2HO4A 3VZBA 5HMMA 1IBKB 4I36A 3AY7A 3QOFA 2W2KA 2HO5A 4JYAB 3I58A 1FP7A 2ODPA 1QIJA 1EWTA 3NBYC 2KS6A 1KI6B 2QY6A 2WWYA 2GM4A 2LKCA 1HRDA 2BCEA 5DHTA 1SK9A 2WG1A 4OQLA 5L3SA 1TT5A 3W2GA 1RRCA 3PPIA 4ARAA 5H9WA 1DEAA 1J5PA 2R8OA 5K6AA 2JCYA 3RVPA 1F48A 1GILA 1JB1A 4QQRA 4P4SA 4EATA 3PPVA 3G0OA 2F9LA 4S1PA 4CWAA 4DZTA 1QGZA 4NARA 4NICA 1YJQA 3UPTA 4BN0A 4P31A 1GXSA 2G6BA 2J4DA 2OTCA 4NBKA 5AOAA 2EDAA 3OE7A 4D8VA 4MYHA 3WRVA 5EP3A 4ASUD 5AHOA 1Y6FA 3OM0A 4N5LA 4CN9A 2B36A 2AXQA 3T0FA 2IKSA 1B8OA 5EMKA 4P3PA 4EGQA 3SDSA 1J2YA 3G0GA 1QRSA 4H60A 4RIIA 4BNHA 2GSDA 3AUUA 3FX2A 3I8SA 1RD4A 4B82A 5F5NA 3ZHVA 1TMOA 2IOHA 2ATVA 1L5FA 1QAQA 2PMFA 3EXG2 4G86A 2NVOA 4KX3A 2I3DA 3RRXA 3EULA 2AFVA 4MYUA 3DVQX 4G63A 5DHRA 4YUYA 1ONBA 1ZXLA 3KQPA 2HT6A 1BU5A 2GPWA 5EP4A 2C5FA 1E99A 1X9GA 2PZFA 4FI3C 2Y0CA 4U00A 6CHYA 1ZR2A 3GEGA 4HF7A 1S96A 1ZU4A 5F77A 3U44A 1THZA 2J3HA 4YT4A 4CL2A 2XDQA 3ZV7A 2V58A 2YMMA 2V0GA 1C9NA 3QKTA 4F3TA 5K8IA 3L06A 1MNQA 3O84A 4PYIA 1VCNA 3HFJA 4TV8F 5I9MA 1JTFA 3ZV4A 1IUNA 1NURA 3EXEA 4NJEA 2LVBA 4XI9A 1ZHFA 4AUKA 3WADA 2J3KA 1LWOA 1MQSA 2MMGA 2OWEA 3RJMA 4NULA 4M7OA 1GNSA 3KYIB 3U48A 2DGDA 2ZXEA 4S0ZA 3B1ZA 3KXPA 3NGMA 1ZQ9A 4PLZA 3WWEA 1NMXA 2H1OA 4O4HF 4DNFA 2BEUA 3H17A 1TECE 1JEOA 1RM0A 1THGA 1SN7A 1TUEA 4R83A 4HH4A 4DVJA 2CYBA 1CS0B 3RRBA 5AQ1A 1QE5A 1JIJA 4MRMA 2J87A 4QBGB 1YVRA 3WLEA 5JEEA 3ZDDA 2Q1TA 4MO2A 5T6BA 2BM0A 1YU6A 1NJ2A 2PMWB 1YZQA 2XMQA 4RJ2A 1J9EA 1K8YB 4JOSA 4UM9D 4XASA 3CF2A 5CCEA 1I0LA 4JZYA 3F46A 1IJBA 3PC7A 1DSSG 2CB0A 1WZEA 2IYSA 2MDTA 3D6AA 4Q39A 1PNVA 4GPIB 3VHXA 3IAHA 1P2SA 1KH3A 4AAYA 1X1AA 1GKIA 3P9NA 4DIUA 3SSMA 4CQLB 1U8YA 4F5DA 4EI8A 2JC3A 4AZ3A 2WMNB 1DAKA 1GZDA 2ZTUA 3LVQE 1T9CA 1MV5A 2KBFA 5KUTA 2DEUA 2IH5A 5U9CA 4BMSA 2RARA 4OQEA 3MOGA 1E3MA 1GUYA 3A4TA 1QHHA 3W8RA 3R9IA 4YMGA 1YRQA 1DC6A 1YI0A 2Q3EA 3CG0A 3CMCO 1UJBA 3BOSA 4YRJA 3UANA 4E1BA 2Y27A 1FUKA 2GX6A 3PUJA 5E6RB 2B1RA 2IBMA 5DFAA 4RUKA 5K0ZA 4ROTA 5FTJA 3AEZA 3GLHA 3IE2A 3QF4B 1G9SA 3R5SA 4WK6A 1PLLA 4HWSA 1FYDA 2DJ5A 1IONA 2RHGB 5DMHA 3K30A 5FOSA 4B6JA 3MN1A 2C9MA 3DPSA 1A2OA 4FZ3A 2OCKA 3WGKA 5EE5B 3R8XA 5LXTA 1W36C 2HF7A 1G5PA 2BR4A 3UA4A 1XD8A 1YRLA 4MV1A 1UJ6A 5F64A 4DC0A 1YMUA 3K0KA 2WYHA 1HH4A 2GCGA 3MCTA 3KQSA 2O6LA 2FSUA 3CF4A 4DR5B 1NW7A 1VHWA 4C4XA 1XNRB 1DLJA 1XTRA 1YUMA 2FPMA 1E3WA 1HYEA 3FNQA 1GTL1 4JQYA 3ZGYA 4NZ9A 4C0JA 1JU9A 2PUJA 3IUNA 2WNIA 4RXUA 4U6QA 3MMXA 1V45E 1X86B 3G5AA 3IE1A 3UT0A 4BWVA 3MK31 5DI3B 3ENNA 3GGCA 3LLSA 1DJMA 2B30A 3AINA 1K97A 2A1TS 2G80A 3DOHA 5GGXA 3GH1A 3QU9A 4RD4A 4KLAA 2DHQA 1ZNYA 2ID7A 3F5FA 3WHKA 8GPBA 1UK9A 2XNCA 2D8MA 2QRVA 4Z6KA 2Q29A 4I81A 4DIEA 3WGOA 3I2YX 3SP1A 5B7PA 4GU5A 4LNHA 4YRCA 3Q1KA 2PEYA 5J5CA 3SJBA 1IM5A 5FBLB 2ZYUX 2BSQA 2ONYA 1LC3A 1XMOB 1C7RA 1EM8B 1T3TA 2XCOA 3NAGA 4O4LB 1ABBA 4N0DA 2EZ4A 1D2RA 2NNWB 3C43A 4GRAA 2OL4A 4I08A 3QXHA 3ZG6A 2AD1A 4NU0A 4ARBA 1XVIA 4DTCA 2GHQA 5JNSA 2F8TA 2CFIA 3W1EA 2Y6VA 4MV4A 3RK1A 1K06A 2BVNA 1MAHA 2X58A 3SAJA 5ADHA 3LUFA 3E8MA 4PNEA 1I94B 5AW4A 3SC2A 1GJRA 4ZJPA 4BP8A 5FBVB 1KJ9A 4HAVA 5C52B 4Y9UA 3ANYB 4I19A 3SICE 1ZH8A 5CUQA 3DBIA 1M1NB 2XITA 2P79A 5CB8A 3WSVA 2A35A 1A4IA 1RIFA 4LXTA 4CHGA 1K7YA 1JI0A 4RC9A 4ZDKA 4ND4A 2C61A 1YQ9A 4XSHA 2CXRA 1P4SA 3BB3A 1PR3A 1ZRHA 3TCKA 1CR0A 3L02A 4OMDA 2QTAA 2B7LA 1EWYA 2BCGY 1B8UA 1WQ1R 1KC1A 2SKCA 3OVMA 3ZXXA 3O93A 5CFQA 3VJMA 1R8XA 2TMDA 5B1DA 3BXOA 3AUTA 3JCZA 2BFMA 4I50B 1J8YF 1LFAA 1SD2A 3G59A 3U31A 1MH1A 3NS7A 1Z7YA 5BSUA 4DCTA 2P8SA 4OJNA 2WEKA 1NFQA 2V1XA 4X24A 5H82A 5IJZA 3D0OA 4H17A 1E6KA 2ECPA 1ILWA 2WINI 4AFNA 5BURA 5DIZA 3W5SA 5AI6A 4B3HA 1EE2A 4EY3A 3LT1A 2HMWA 1YAJA 2JGEA 3D6HA 1WUTA 4QOGA 4TS3A 5JAHA 1EGMB 4UAJA 3GT0A 2QYSA 1H5UA 2R68A 3I76A 4R16A 5THXA 3U2QA 2C59A 1QK5A 3DBRA 4C3OB 3JQFA 1P45A 2QNIA 4MAAA 1OYVA 1JDZA 3GHHA 2EKLA 3L7IA 4DY6A 4E5YA 5BNWA 5MF6A 2J59A 3CVXA 2VAVA 4UBOA 4NX2A 1DGQA 4LFBB 4DNQA 2PX4A 1TX4B 3C6ZA 4FEYA 4RFSB 3UAWA 3VPGA 4DS3A 5LWQA 5G3ZA 1OGJA 2HX1A 2XB6A 1RWOA 2JFNA 5E1OA 1OUMA 5A6SB 1CP3A 1YDEA 1CR1A 2QXYA 3MWKA 3GJQA 5H8WA 1Z6QA 3D2BA 5I7SA 2HK6A 4JLKA 4EO4A 5FLEX 2B4YA 4FXOA 4LSGA 2H0AA 3GHYA 1B0UA 1KARA 4EVIA 1O3YA 4J9UE 1SBTA 4RF4A 1DAOA 2M98A 5E6UB 1ZDMA 2XOEA 2QD3A 4TKVA 4LK2A 4WY5A 1NSFA 5THKA 4HVLA 2VF5X 3WK4A 4B4OA 4LGVA 2ZYSA 3D6UA 3ROZA 3LF2A 4D57A 3O83A 2VHZA 1ADBA 2CUTA 3PI7A 4LXXA 1YQUA 2NSJA 4ZT7A 5FR1A 2Z8YM 2M9MA 2TMYA 1S4QA 2W2MA 2EHDA 4L9RA 4P4UA 4FE3A 1T0HB 1VBNA 2DRIA 1EEXB 4GGMX 4POAA 3EVEA 4WVLA 4YECA 4RVGA 1Q22A 2NTNA 5D7BA 1T10A 1WZUA 3CG4A 2V1UA 2OKGA 4G09A 1T1JA 2XVYA 1NU8A 4FFBB 4OOEA 3ICCA 4U9UA 1JEQB 4F11A 2VHWA 5KC9A 1P7ZA 2R8PA 3V4PB 2YV2A 1LB1B 3O7MA 3W5DA 2BIFA 4X7MA 1RZ3A 3EPPA 4AQ7A 1NY5A 3NHWA 1V9SA 2I87A 3R23A 1NLYA 3FWNA 3DT6A 4R41A 1U3CA 3OECA 4MPPA 5JDCC 1LUAA 3EF0A 5B2FA 1T8UA 3HDGA 3GC6A 4K1XA 3D9QX 3IEVA 1UBCA 2O1SA 3O8DA 4J0IA 2H85A 1EX7A 3HPRA 1FTNA 2QMHA 2XRMA 2WM9B 3HBAA 2IYTA 4NPHA 2YHIA 4IQFA 3OM8A 4CKXA 4YUZA 1QKIA 5HRUA 1MAUA 1UKZA 2QJFA 3H0KA 1FRFS 1GHTA 1R5JA 2GNAA 2WPDA 1E20A 4ZCLA 5HX7A 2WFLB 3KWLA 4PZUA 2BFBA 3L0IB 1XD2B 1E7QA 1IB6A 1NVTA 2N47A 2Q2QA 4P93A 1R1DA 3WYFA 1TA9A 2PG3A 4PG5A 4MS4A 1AQYA 1QH1B 4HYYA 3AYZB 4X92A 5KYWB 3ZCRA 5JCPA 2CUKA 4B3CA 4KTTE 5GPBA 4YAOA 1G98A 4YO8A 3IP5A 3ZX4A 3FWYA 3KPWA 1AKEA 3Q87B 2UZ1B 4KAFA 5HRCA 4IUBS 5ILGA 4ZVRA 4PQGA 4BN5A 4YCSA 3U3DA 2ZGVA 2XTZA 4IZOA 4U9HS 3FPAA 4F86A 2WP8J 3FAZA 2NTEA 5JCXA 1MG0A 2AFHB 4X00A 3UXHA 4DPKA 3W5AA 1MC4A 1PJAA 1GPLA 3NQ41 3AWDA 1N0UA 3GMSA 2FR1A 4V0QA 4UQPA 2ZUBA 1DRJA 2YOFA 4A6EA 3OMWA 2D62A 3TFOA 3D7MA 4FUTA 4BRZA 3T12A 3R41A 4NBRA 4UPVA 3QJGA 5C32A 5HQ3A 1Y9ZA 3CNLA 2JIQA 4MJ7A 1ONSA 3UPUA 1L3CA 3J7TA 4NECA 3PSHA 5EFOA 3UUFA 1VLZA 3H7IA 4KO8A 4M37A 3UBTA 3PNLA 3Q3JB 4FYPA 5JY6A 1SU7A 4WINA 4KGVA 1H9AA 4R1QA 3E18A 1DBRA 2F3TA 2J3IA 3UGQA 3M4NA 3DDWA 5SZKB 2G77B 4NDAA 1LZLA 2YVUA 3RPEA 4X66B 4CV3A 1F17A 1HMPA 4C0SA 3O4GA 4ZYLA 2R62A 1OFGA 1BCRA 2QN9A 1J0AA 4LWPA 1VLMA 4MINA 3TDKA 4ESOA 4DT1A 3PDUA 4UCQA 1AS3A 1QYXA 2R6CA 5DYTA 1QFYA 3AL3A 3OKCA 2A9FA 1MENA 2FW1A 1LW6E 3TW0A 3D1JA 5CEFA 3GJTA 4BRWA 1VKJA 3ROQA 3NATA 2B8EA 2WJ3A 3O38A 1XQYA 1E9SA 1ENOA 4NBNA 1M9NA 4LBYA 1B41A 2BL4A 5F73A 3K71B 1Q0LA 4N41A 1P9NA 3LDFA 3OQHA 4D3FA 4RWZA 3BVPA 4Z1MD 2NPOA 2RGYA 1KOJA 3QKUA 1JMVA 1ZUHA 3H2GA 3MJRA 4MV7A 1TLFA 2IP4A 5I9BA 1L5LA 3T7KA 3RASA 3ID6C 2DETA 3STWA 5G0VA 5TC4A 1M34E 1NQVA 1XCLA 3NJ4A 4C29A 2CLMB 1DXOA 3C3WA 1VJGA 5IEBA 4UMEA 2ZCVA 3WDKA 5DM0A 3P5SA 2WV7A 3D2CA 2ZIGA 3B2QA 4K87A 5K0TA 3UHPA 3P9YA 2O0HA 3WGTA 4BLPA 4OHZA 2X9VA 1NBHA 1O57A 3OZXA 4BKPA 5KTNA 1AUXA 4WZAA 1YIAA 3MUFA 1W7AA 3DL4A 3D7RA 1I7NA 3AIIA 4LA4A 4U2FA 3K4PA 3Q8MA 2QRGA 4NK5A 3VDXA 3PHHA 4L5YA 2EZUA 3FDFA 4CT5A 4R2IA 2EG5A 1SKUA 4DBZA 4P86A 1JWLA 3BWYA 4G0PA 1OXBB 5DGCA 3RREA 1YV9A 2HJGA 2YFKA 1YBVA 3GUHA 3NTVA 4P34A 4PY2A 1HE8B 3QENA 4URVR 2HDNB 3EUAA 5CBKA 1NT4A 5ENZA 4L07A 4PYQA 5HA5A 2ZUWA 4R7GA 3QKSB 5FQOA 1G8SA 1VB5A 4HI0E 4KMMA 4RLQA 2PGLA 1JI3A 3UJ8A 4BNXA 2IEGA 3DDUA 4LSZA 4WL0A 4YASA 4ALNA 4HVCA 3E4CA 5ALVA 1WCIA 1Y80A 2QTGA 1Y5IA 1NW3A 1F7VA 4GOJA 4XB1A 4Y18A 4AU1A 3H5IA 4E3ZA 4OQZA 2Q3JA 3DUFB 3B38A 4DSUA 3NXSA 4ZZ3A 1T0BA 4MUBA 3I9JA 4OD0A 4A03A 3G1UA 2VBGA 4LDQA 3SHFA 4L08A 4Y2JA 3Q2IA 4ZI2A 1XVTA 3ZTTA 3VV2A 3CKKA 3UF0A 5IJ9A 2IUEA 1T2AA 3G1TA 1OC4A 2ORVA 3GUVA 1G8YA 2RSLA 4D9JA 5FX2A 2HPZA 1O9HA 1ORHA 3SZOA 1MAWA 3WO1A 1QM5A 2Q3BA 1IHYA 3EXIB 5KINB 1ZNZA 3SHQA 2J46A 5I9LA 1CUAA 3C7KA 4OLFA 3I04A 3BWBA 2L19A 3RIMA 3D43A 2XUFA 3EFBA 2WBLC 1QYWA 5CDFE 5I7UA 4K9PA 3R24A 5DCLA 4UHKA 3C7TA 1CZRA 2OG1A 5EIOA 2J08A 3I9FA 4MQLA 4XJTA 1NM5C 1VFNA 1PQPA 1X74A 1XTUA 2VJMA 3SZ3A 4EMBA 1NW5A 4ZOBA 1E1CA 3BQMB 3ZBTA 3AVTA 1T8SA 3A11A 3HCDA 2F59A 4CTMA 2VOEA 2RJ3A 3O9MA 3U44B 3T0GA 2D4AA 1TYCA 2GFQA 3P2JA 3KDPA 3R5TA 4KQFA 3EIOA 4G56A 3IP9A 1BA2A 3GDFA 4JT8A 3BH6A 1YCGA 1T8PA 3DLAA 4OTZA 4KN9S 5P8WA 1DIBA 1PGPA 1C30B 1E0SA 3UAOA 3Q3EA 1UXHA 5EQTA 1G7CA 2XUAA 4WSOA 5DSTA 1XJWA 1Z12A 4G85A 4EDFA 2EERA 1EA5A 3Q2OA 2VJNA 1F8UA 2ZSFA 3THXA 1XTPA 1DHTA 1Y3HA 4PPFA 1GCOA 4ESHA 5BMOA 2DPGA 4YCAA 3A28A 4XIIA 3M1AA 4H0NA 2WUEA 2Q9BA 4U2EA 1EHYA 1QTRA 2QG6A 2ZRAA 3ICOA 2WVJA 4JVOA 3E0QA 3MGCA 4OK6A 2IXGA 4IDCA 5K0SA 1T35A 4N6NA 2HNKA 2ROQA 4CM4A 5KJFA 2J07A 1E3JA 1IDN1 2GASA 1O95D 3T1YB 3KE8A 2VEDA 9MHTA 1S5PA 4N0MA 3B3AA 3GNTA 3O95A 2HY7A 3FKSD 4LF8B 3JSAA 3CWZA 4A27A 1M2OA 1FF9A 4G65A 3K05A 5AJXA 5KVSA 3CIFA 5DXAA 3CXUA 3DVAA 1ZYUA 4J94A 1BW9A 5ANRB 3LXXA 3WJAA 4JBLA 4Q3KA 1P3Y1 5JW6A 2YUIA 2PSEA 3TTXA 5GIPE 4BU1A 5DX8A 1C4KA 3SBDA 1JJVA 2EJVA 2V59A 3Q88A 2ZIXB 2XMDA 4E12A 5JJCA 3AL0C 1RMYA 5E6RA 4ERXA 2MYTA 1X7WA 3NASA 4MWSA 4TTAA 2HOQA 3Q9NA 1M54A 1X6VA 1E98A 3CRVA 3C97A 3H86A 2FYTA 2DSNA 3Q7TA 5CCBA 5AM0A 3TOCA 2IHKA 5J43A 3E27A 1J21A 2IYLD 2W4MA 2Q5LA 3KTFA 4DJJA 3KZ1E 3FNFA 1W1WA 4JQOA 1KP3A 1V3UA 4C0KA 3ZWMA 5DWQA 5IUJC 3KFLA 3UICA 3U17A 3DZJA 1U2GA 3S1LA 3AOEA 2HLNA 2ZT7A 5JNVA 5ECYA 3MWDA 4XD2A 4KBYA 5IYZF 3KRTA 1CDEA 2GBGA 1PJ3A 3B9QA 4FEAA 2YXLA 1SUAA 1ZIDA 1A5TA 1MR3F 2FETA 1Y7LA 4GOKA 4IUCS 4PIVA 4RPGA 3ZHSA 4BJHB 4BLQA 3KEFA 5CLLA 3WWDA 1YR6A 3KYBA 5KQLA 3A9SA 3U81A 3PFIA 3AHDA 3I05A 5EGSA 3SF8A 4E03A 3D64A 1PYGA 1U9CA 4ZOAA 3W5VA 2FWMX 2RGCA 3NRJA 2AOWA 2O3TA 2E4ZA 3TD2A 3RG8A 3UAXA 4FZRA 3AW9A 4P3KA 4P5DA 2ZSBA 4NS4A 4XD7D 5CGQB 1ORTA 3ZXYA 2OV1A 3AP1A 3GCZA 3MPUA 3IKMB 1IAVA 2Q3CA 1XXHA 1XKTA 4GP6A 3E9NA 4P4TA 3E1KA 3WZMA 4PSAA 4PWZA 1QGDA 1U7WA 4HDCA 4LMRA 4NI5A 1F20A 5IYZA 3UJNA 1VQ1A 5CVDA 1KK2A 4DLSA 1LVHA 1PW7A 4L5AA 2Z2JA 1T4CA 1ZW6A 1E1LA 2GJAA 2I2BA 2J9YB 1B76A 3C41J 1YH3A 2WHPA 1JA1A 4LZOA 3JQFC 4Y6OA 3SC2B 1CK4A 1DPGA 2JGIA 3PTZA 3ENVA 1QP0A 4JT4A 1XPUA 2HYDA 2QNBA 3K94A 3LL7A 2HA2A 4I14A 1XZNA 3E3MA 4RF5A 1NQTA 4K9MA 2P9HA 3RDPA 1E4EB 1K5PA 3PICA 1ZS9A 4KO2S 3W2HA 3BFJA 2E55A 4E94A 3B3GA 1BXKA 1WZIA 2HN9A 1A95A 4CRWB 3DULA 4RHEA