1NFPA

Structural refinement of the non-fluorescent flavoprotein from photobacterium leiognathi at 1.60 angstroms resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
228
structure length
228
Chain Sequence
MTKWNYGVFFLNFYHVGQQEPSLTMSNALETLRIIDEDTSIYDVVAFSEHHIDKSYNDETKLAPFVSLGKQIHVLATSPETVVKAAKYGMPLLFKWDDSQQKRIELLNHYQAAAAKFNVDIANVRHRLMLFVNVNDNPTQAKAELSIYLEDYLSYTQAETSIDEIINSNAAGNFDTCLHHVAEMAQGLNNKVDFLFCFESMKDQENKKSLMINFDKRVINYRKEHNLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural refinement of the non-fluorescent flavoprotein from Photobacterium leiognathi at 1.60 A resolution.
pubmed doi rcsb
source organism Photobacterium leiognathi
molecule tags Flavoprotein
molecule keywords LUXF GENE PRODUCT
total genus 90
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 1995-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00296 Bac_luciferase Luciferase-like monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.30 Alpha Beta Alpha-Beta Barrel TIM Barrel Luciferase-like domain 1nfpA00
3FGCB 1FVPA 1TVLA 1F07A 1EZWA 4UWMA 1NQKA 3FGCA 1NFPA 3C8NA 1LUCB 1BRLB 1Z69A 2I7GA 3B4YA 5AECA 1BRLA 1LUCA 1M41A 1YW1A 4J2PA 4US5A 4US5D 5LXEA 1BSLA 2B81A 3B9NA 1XKJA 1RHCA 3SDOA 3RAOA 3B9OA 5DQPA
chains in the Genus database with same CATH superfamily
1EJTC 2DFAA 1V3JA 2O9OA 5HPCA 1EA9C 1YTKA 1JDCA 3AICA 3W7PA 3QV9A 3QPYA 5XIMA 3GFZA 3RLVA 3G8EA 5JBEA 1LLWA 2PD9A 3BH4A 6REQB 1V3IA 4HKPA 3H26A 2QJHA 4DUWA 4LUTB 4ZFCA 3QPZA 3H7RA 1U22A 3QZ6A 4ROQA 1GKPA 4QDMA 3LCLA 3WMCA 3HIJA 4J5NA 3BPWA 1T8QA 2V5CA 5E5CA 1BXCA 4M8UA 2GK1A 1HXJA 3CT2A 1FWBC 4W7WA 2CLKA 3W1AA 3DGBA 4S3KA 2FVMA 3MBDA 3D6NA 3KUMA 1VBRA 4I6KA 2BASA 2BY2A 2XINA 3IV8A 2PI6A 2GVGA 4JTDA 1F3EA 1VIWA 4G7EB 4H2HA 3P82A 1XLIA 3N2TA 1HJSA 3U0HA 2ZZ2A 1T99A 1ALDA 4ERIA 2Y8KA 2PD5A 1QDSA 2V38A 3SM0A 1QWKA 4H8NA 2VT0A 4LNYA 3WFZA 2DSVA 1C91A 3DKLA 2FTPA 5I23A 1MEWA 5T9CE 2QR6A 1GQLA 2J79A 2QMJA 2Y0FA 5I79A 2Y7EA 2CLMA 1XINA 3NSMA 2DZTA 3M6DA 2BV9A 3FY1A 2Q8ZA 3TZNA 1ELSA 3ANUA 4MWAE 3LBMA 4DYKA 5LHFA 3MSYA 5ABFB 1HGWA 1V02E 2PSNA 2KX9A 1FWAC 2VX4A 1RBLA 3W70A 1WOAA 5JUVA 3GXIA 3WL1A 2FHBA 2FJKA 1C8VA 3WY1A 1W1A1 4QJ1A 2WJZA 3M0JA 3QR1A 2WNZA 1TJ1A 3EDJA 3ITXA 1PIIA 4H4IA 3M5ZA 1QW7A 3HB9A 1J5TA 4GO9A 4PMUA 4LUSB 4PB3A 3PBWA 4FPSA 5FOOA 1JUKA 5HR7A 5C71A 4POCA 1W6TA 4W5UA 4GK8A 3TIMA 4QAIA 4PGLA 3N2XA 4O18A 1AD4A 4W86A 4L5ZA 2PGFA 1DWIM 4C1NB 5D05A 3M46A 1GVIA 3U9IA 4J35A 1P43A 4ZOBA 3WDQA 4DF0A 3LCFA 1V3MA 1YX1A 3H24A 2W0UA 3CZ8A 1VBUA 3I3EA 4IHCA 1KR0A 1XRSA 2GJPA 4J2PA 2EPLX 4NRRA 3W27A 2V8ZA 3CLMA 1SUXA 4LX4A 4Y9OA 4ADUA 4K68A 1TVLA 5REQB 3OGVA 4U5IA 3GD6A 1GW9A 4I9TA 1RK5A 1G9HA 3H23A 1D3HA 1J0YA 3PZVA 4O15A 4RXGA 4KEZA 5AYBA 1FWCC 2PGWA 1N8FA 4FOJA 1QK2A 5DXYA 4GZIA 4LYRA 3MI6A 3NDOA 4F66A 1EIBA 4RNFA 2E1DA 3NFUA 4EP8C 3GR8A 1HGYA 3BMWA 4MZ8A 3W7MA 3U3HA 4AU0A 1JZ3A 2OSWA 4U28A 3N73A 3GU9A 3GR4A 4Y8FA 2ACRA 1SSDA 2BHUA 2W5FA 5A8OA 3BAXA 4UTTC 3CBWA 4U4MA 4JTTA 3VE9A 1GOIA 5C9WA 1JF6A 1OYAA 3GHSA 2PRMA 1JRCA 3S9ZA 4W7UA 2AL2B 4GFIA 1LQ0A 4WCJA 4LRTA 4P7LA 3NQDA 3G1DA 1PYFA 3UVAA 1W1YA 1TUXA 1C7TA 7XIMA 4DZIA 1I8JA 3NVTA 1I2NA 4H7ZA 5DO8A 3G22A 1RJRA 3E38A 2WCSA 1TVPA 3PPCA 3BG5A 3GTIA 4WIWA 2G4JA 4S38A 4IL0A 4GJIA 1GW1A 4H83A 2I14A 1EJWC 4JTGA 2NXGA 4IFOA 4YL2A 3WQPA 4L4OA 4OWGA 4FNTA 4GNKB 1OX4A 1OFEA 5HUOA 3GVVA 4IUGA 3WD1A 2WXDM 5FF3A 9XIMA 3VD7A 5DRCA 3UZYA 5PTDA 5AHFA 1UOKA 3T55A 1M04A 3DG6A 3PZMA 4DX3A 3HGJA 4K8HA 3TWBA 2ODOA 4WR3A 1OCBA 4TUFA 1HFBA 2YL9A 3KEHA 1ECQA 3WK1A 5FEPA 4YNGA 3FOKA 3LTYA 3W24A 2A1YA 5CPMA 4QDWA 2VYOA 5LSMA 2CWNA 3UXDA 4QQ3A 3FJ4A 3WO8A 1E9LA 3C0JA 3MV11 5KZEA 1A3WA 2CETA 1HP5A 3NQ8A 4IQDA 1UD2A 3SCVA 4GQQA 5BXTA 2WSQA 4ZR8A 3WLLA 4UMBA 1MXDA 1S46A 2DU2A 2FH6A 5FKYA 1MRQA 1UHVA 1XIFA 3DESA 5E0KA 4YCPA 4FLRA 4Z2LA 5HWMA 4CN1A 1ZAIA 4JNMA 4LV4A 3PG9A 2Z7KA 2QCNA 2J13A 1XBXA 4M6UA 1ISWA 2QGYA 5G4WA 2G3IA 3NURA 3RRXA 3ZT7A 2PZNA 3CUGA 4BF9A 5JH1A 5JBDA 1F3TA 1MUWA 2D1ZA 2YDQA 2V3GA 4DZAA 4C6JA 4NJIA 5H8UA 4AY1A 4O28A 3FYPA 2DVUA 1LORA 3C56A 1H49A 5HQMA 1BYAA 3PB2A 3TK7A 1JPIA 4MHBA 2CCRA 1O5XA 1DJIA 2HISA 3TMLA 1T96A 1WE5A 4M6VA 3THDA 3V5OA 1XYZA 4YYCA 1KXTA 3GH7A 4DWSD 3E96A 2YGYA 3LXAA 4IPNB 2FPVA 3BLFA 2ESCA 3NZQA 3AU6A 1QBAA 1ME8A 2V3DA 5AYXA 2YXOA 3VGFA 2PTYA 3DENA 4WOQA 5LNSA 4X60A 4EXAA 2GQ9A 1LROA 3B97A 1SM9A 3EOLA 1RBOB 3RLUA 3A4JA 2PDGA 1XICA 1SMAA 4HK5A 1TUFA 2PU0A 1W9BM 2ALDA 4JTCA 1EHNA 4PN2A 2VD8A 3HN3A 3SCOA 1HJXA 3RMEA 2DEPA 3V5FA 4GVFA 4IX2A 3UZ5A 1OCNA 5REQA 3SUWA 1I0BA 1CENA 4MMWA 2V82A 3JZEA 4OUIA 3R13A 1L6FA 3DHUA 4OGZA 2VGFA 1K70A 1D7KA 1UWIA 1UKSA 1WKFA 4QS5A 2QV4A 1J6OA 2JKEA 2ZRYA 5HANA 6A3HA 1YPXA 2Y7GA 4PTMA 1W56A 5B80A 1FXQA 1KC7A 4JIEA 1IXOA 1XW8A 3RO6A 2EQDA 3OG2A 2H9AA 2X1SA 5I78A 4Z17A 3STCA 1XUZA 3FHQA 4UFIA 1G7UA 4NZFA 1BHGA 1W1IE 1MW3A 1MI3A 4O11A 4ML9A 3EKZA 3VMNA 4H04A 4PC8A 1EX1A 5C5YA 4FX7A 2C0HA 1Q2SA 5IFTA 3PTDA 5BXSA 1HX0A 2GOUA 2Z2BA 4HBKA 1JCMP 1LBLA 1E9ZB 2CITA 2B4GA 3BSHA 4ERGA 4DVOA 3UCCA 1SW7A 1VFUA 5EMYA 4S2CA 4EVZA 1S1PA 1VHNA 2GSEA 2FPTA 1KCZA 1ZFJA 2EG6A 1D8WA 4YJ5A 3K8LA 2BODX 3SAZA 5F2LA 2VEMA 1G67A 3LMYA 2WANA 1R3TA 3OGRA 4F8XA 3CWOX 2XN1A 4RUBA 2REQA 3CQ0A 4LBUA 3DC8A 1GJUA 1KBKA 3OIHA 3E74A 2V2CA 4NL1A 4AZCB 2VGIA 1VJZA 5TIMA 1QATA 3DI0A 3IJ9A 1U1JA 3T4CA 2QYGA 3N2OA 3A3WA 3MHGA 2FHFA 4FSAA 1ZTVA 3M0KA 3CUHA 3WMLA 1ZUAX 3C52A 3OLIA 1LLZA 3YPIA 3LBOA 2P0IA 1H5VA 3NM1A 1YXCA 3AXIA 5CKSA 4LUTA 3VNMA 1Z7AA 2YJQA 4JFVA 4KCWA 2YPIA 4D8ZA 3MC5A 1R87A 3WDJA 5I09A 4GIRA 3ITCA 4AW7A 1XIGA 4IP5A 3QXBA 4WLCA 2PP3A 4FZIA 2ZZ6A 3BMXA 2BY1A 2BGQA 3WENA 3VAVA 3RM8A 2NQZA 2QJIA 3GC2A 2FHCA 3RITA 1P4CA 4CUCA 5C6MA 4E2OA 2C7FA 4Q4PA 2UV8G 1JNEA 2J7CA 3BE7A 4GH3A 2FTYA 4MWAC 1EP3A 4Y6GA 4DWSB 4GACA 1D8CA 3CL6A 5BU6A 5K9DA 3JW7A 4Q8UA 2NV9A 3TXVA 1QPQA 1BSIA 3H7VA 1ITUA 2Y63A 2ZADA 5JMUA 3V75A 2R91A 4B5TA 1RJPA 1JG9A 1V5XA 3P61A 2WVSA 3SCTA 3CM4A 1E43A 1H41A 4H6EA 3EGJA 2X41A 2QVNA 4NZJA 3UU0A 3UWUA 3GLCA 1JUEA 1XCWA 1PKYA 4TX8A 3V4BA 3UERA 1OCJA 1H0GA 4G1NA 1DJYA 2RUSA 3H7UA 2XFFA 2ZDSA 4QX4A 1QW9A 4GMEA 3BJTA 3HGOA 2Z4GA 1OX5A 3P0XA 1XF0A 3C61A 4I9MA 4MAZA 1RPKA 2WC3A 4X2PA 4M1BA 1THFD 1I1WA 1P1XA 4KWSA 3KZPA 5HUPA 5G2IA 3V7PA 4G5DA 3W2NA 1Z3NA 3USBA 5DBTA 3MS8A 3VD3A 5XIAA 3BG3A 4GYFA 4JHOA 3M7SA 4H00A 3EWBX 3G3MA 3AALA 3QGVA 1JYVA 3B8DA 1KRMA 3CQKA 3WUBA 1NVMA 3QF0A 3NQGA 1KM0A 3MSRA 2J9XA 1AJ2A 3TN3A 3H2NA 4ZCWA 4HOWA 4ACYA 3URAA 2A3EA 3UT0A 3KBVA 3N17A 3WD3A 4RZBA 4JTSA 1XSJA 2F61A 3ZJ6A 5A2BA 4LT9A 4EAMA 2DZWA 4INFA 1RVKA 3WLRA 2CBJA 1M7PA 4RW5A 1KGXA 3GG8A 3EMQA 4DUXA 4NJGA 5JQ9A 5U4NA 1BYCA 1FWGC 3MSGA 4C1KA 4UIOA 3CHCA 1K9EA 4F2TA 3TW9A 1D7FA 3QGKC 2OMAA 4NX5A 2X1TA 4YIWA 2P3ZA 3GC5A 3B40A 4JQ4A 4DPPA 1H62A 3STFA 2GYIA 1PAMA 1HJUA 1MNZA 3WD2A 4NNCA 1VJSA 4DO5A 4PTVA 3BDKA 1FHLA 3MI3A 4NZ5A 8A3HA 4O1FA 3WH5A 5TD4A 4F48A 4NP7A 1UD4A 4HTBA 3T0CA 1IT7A 1EPVA 1DTUA 3CZLA 5FL0A 1YTEA 4HA0A 1YNPA 3NQEA 3TQVA 3I6EA 4PUEA 4H7VA 4QEHA 3K8KA 1IZJA 3OHMB 4ZTYA 2O7QA 4UWMA 1ZAJA 3UA4A 1UG6A 2WSKA 1JZ4A 3LSBA 3I6RA 4P8WA 1HW6A 3RJXA 3WYZA 1RZMA 1XYLA 3FGCB 1UR2A 1HKIA 1WUFA 3MMUA 1UWTA 1J18A 4HOXA 4O1BA 4B5VA 4OQVA 5BYWA 3CC1A 4WY0B 3TROA 3UQNA 3B0YA 4FF7A 4HMNA 2BZNA 2E68A 3OU8A 4KMQA 3THAA 4DZ5A 1RCQA 3HZ3A 4GGHA 4E38A 1O66A 2R6OA 4ZOEA 1J11A 1UCWA 5DY3A 1DJXA 1Z6KA 4OKDA 1BYBA 3KXQA 3D5HA 2DV0A 3FNDA 3EWXA 3MBFA 2YIHA 3IIZA 3PBMA 4XZBA 3UJEA 3ALGA 4JYEA 1PVNA 1XYFA 2PFHA 4CQBA 1UKPA 1JD9A 2PC4A 2DH2A 1LCOA 1GKRA 3B9NA 2A6NA 1GVEA 1F61A 4R53A 1HNYA 4UR9A 2HDJA 5D37A 2IXVA 1LF1A 3AMDA 3OZMA 1TMLA 1ZHAA 1AW2A 4FAMA 4E4UA 1W32A 1E73M 3TLQA 2NZLA 2WZHA 3GG0A 6XIMA 1CB2A 2VEGA 5FD0A 1I45A 3GBDA 3W25A 1FWNA 3LCGA 4JX4A 1US0A 4B3KA 2WCAA 1O4UA 3UWVA 2QCMA 1YBQA 4KWWA 1A0DA 3LPFA 4IMEA 5KTLA 3IVTA 4U10A 2BGSA 3A4WA 3TQ0A 5FAGA 4AVFA 3KRUA 2GWGA 2PUZA 3BARA 4IPIA 1JCJA 3OBEA 5AY7A 2QPSA 4YTSA 4LSBA 4LBSA 1OJXA 3A13A 4L6OA 1UD6A 3G1HA 3ABRA 3GH4A 3LI1A 2ZUWA 3PZTA 4CD7A 4HK6A 1ECEA 2QNEA 3W1TA 4D72A 2VX7A 5M2FX 4WUIA 3VNIA 1XH1A 5MKGB 1NEYA 1NWTA 2GJRA 2FH8A 2XH2A 3ZR6A 4GYKA 1ME7A 4FXRA 3Q37A 1E5JA 4B5NA 1QVBA 2NXIA 5C8BB 4RNIA 4XZNX 4UTTA 3CWNA 4WY0F 1QO2A 2ZUUA 3NAVA 1V3KA 1SPQA 3P6LA 2O9PA 2PTDA 4G1KA 4AB4A 4H8HA 3HPAA 2D2JA 4DPQA 4KT2A 1L0PA 1JPDX 3W23A 1E6RA 4DWSC 3TTEA 4DXXA 5D2TA 4DYEA 3BUVA 1OG0A 2XVGA 2FPYA 2BTMA 2XH0A 4FOUA 3NOYA 4ZVJA 4RE4A 4URIA 2A79A 1H3GA 1NQ6A 4GI8A 5A6BA 3GKFA 4G56A 1JUBA 2PS2A 2AQWA 1VENA 1R7OA 3FV9A 4FXSA 2OLAA 1JI2A 3AO0A 3GNPA 4AZHA 1BSLA 1AD1A 3FA3A 1OCQA 3WLQA 3V0SA 5HQEA 1A5AA 1CXHA 4GZ7A 1SU5A 3MB9A 4L1XA 3T07A 1Q6LA 1LTDA 3BQ5A 1AK5A 1EJXC 4PMQA 1PTAA 1KFCA 1MQPA 3RR4A 1OFOA 4LC6A 3IRSA 2DZVA 1FWFC 4PMXA 4V2XA 3TEVA 2YR1A 2I56A 3AHTA 4U31A 3WBWA 3ZR5A 3O16A 1AW1A 3VU2A 3VNZA 1JAEA 4GUJA 3FVMA 3S42A 3T2PA 5DCBA 3BSMA 3RHGA 3TNOA 4NZ3A 3LHVA 3SRDA 1M6JA 4HSNA 1LL7A 1WXZA 6PTDA 4R9XA 4XBJA 1S2VA 2Z1WA 2ZIDA 3G6MA 2SFPA 3EOOA 2G50A 1FWDC 1UKTA 3O7UA 1VFOA 4OOUA 3EB3A 4IMGA 3QY7A 4GXWA 3MMWA 1DJZA 3TYDA 3D3FA 5MF5A 3WBYA 3PFRA 1PXGA 4XG1A 4CD5A 2ZZ1A 3VM7A 2ZTJA 4I3GA 3CMFA 2FKPA 1NWRA 2PDJA 4JQ1A 4Y90A 3IAPA 3KBMA 3L2LA 2Y7DA 1TE1A 4K36A 1R3VA 1KNWA 1Q6QA 3STEA 2OQYA 2Q09A 2YDAA 3RU8X 1VS1A 3G1XA 1B31A 2IKIA 2Y5EA 3VGEA 1CECA 3WZ0E 1R9XA 5BWAA 1KFEA 4X2RA 3H55A 3W22A 4LVAA 2CW6A 2PDLA 3QOKA 2W61A 5ABFA 1P0KA 3WEMA 2ZE0A 2FMNA 4AY7A 4KRUA 1QI0A 1MEIA 2WLYA 1HO1A 2FZ9A 1JZ6A 3W85A 4CN4A 4BA0A 1X98A 4Y8EA 4HZ8A 2VZSA 4QCFA 3N4FA 3KZSA 1IEVA 3N9RA 1GHRA 2QCDB 3AHXA 1PJ9A 4HHPA 1TWZA 2PRLA 1A5MC 2F9RA 3ATZA 2I9UA 1XIJA 3EZ4A 3WLOA 1OBAA 5IFPA 3AIRA 3VKAA 4GUIA 4R7JA 1U5JA 3WLMA 2PDKA 2E6DA 3HO8A 1R9YA 4FLSA 5TNVA 1DYSA 4OBSA 2NUWA 4UB9A 4PEEA 1VH7A 5E70A 4R9OA 1GPWA 3B8UA 2VD9A 4KCTA 4DB7A 7REQB 4G7FA 3T8LA 5C9XA 1FP9A 2WM1A 2ALRA 1FCVA 2BOEX 1ZL1A 2R9RA 1GORA 4UR8A 1XLEA 3P60A 4P5UA 4PMRA 5CC3A 1E0UA 4Q7IA 2YBVA 4MIMA 5AZ0A 4KETA 4O19A 1A53A 4DBSA 5BZAA 2G41A 3WEOA 4Q6XA 1J0JA 1R2RA 2EPNA 3W1XA 3JS3A 1BTCA 1TJPA 1LRQA 3T81A 1OFPA 4DWDA 4UFKA 2FVKA 1XGDA 3LV5A 2D3NA 1OVDA 5FF0A 2RFGA 3R5EA 2HVMA 4H9XA 1GGOA 3T9PA 2PURA 4IISA 1KD0A 1MXGA 3N1AA 1GG0A 4LPCA 1E3ZA 1QCWA 2DPEA 2PPGA 2ZUVA 4RR4A 1A50A 4ZE5A 2F6XA 3R2GA 1WB0A 3UYCA 3FCPA 1YPIA 4AEOA 4GCAA 1UR8A 1HN1A 3PULA 2D69A 2J77A 1OWQA 1OYBA 1S5VA 3BOFA 1KM3A 5ECUA 1FQ0A 4QTGA 2H8ZA 2R1MA 1FY6A 1CW2A 1RH9A 1DBTA 2Z27A 3AYSA 1Q4NX 3F1QA 3AU2A 1HKMA 3GQYA 4V1XA 4J3TA 4KCVA 3ONCA 4MADA 4LFYA 1G69A 5CBJA 2BY0A 4IIGA 1UQZA 4HZ6A 1EXBA 3WQVA 2V5KA 2C14A 3HPFA 3UZJA 2MANA 4H19A 1N82A 5JVLA 1FUYA 2J9YA 3U4FA 1GPFA 4ZQCA 5KMYA 2HTMA 2CFFA 1PZ1A 1QW8A 4M56A 5JIPA 3C0SA 3KM8A 3M43A 2WC7A 1DWGM 3WNMA 1G94A 2PDMA 4CQAA 2BFGA 3HJEA 1B3VA 3GS6A 4UZSA 1X7IA 3S3GA 5CLWA 3NO5A 3SCRA 2VC7A 3EWYA 3APTA 5JXQA 3COTA 1CDGA 3SI9A 3W7JA 4PL1A 3QZEA 3QSRA 4J3VA 2YW3A 2Q8XA 5EBAA 3BL3A 3CO4A 5CXPA 2CLHA 4HGXA 3QY8A 1I4NA 4XAZA 4HA4A 2ZBTA 1E0VA 3DU0A 4MNMA 2W67A 1W31A 3AMKA 1TKKA 3MV01 1WKDA 2DJLA 3W83A 3EX4A 2OXNA 3AMLA 4D8LA 1LZOA 2WZTA 2TMDA 4MAVA 2X8RA 4LUJA 2ZQ0A 4DM2A 1VP5A 4IGNA 1K3UA 2Q71A 1QXLA 3LPGA 3CZEA 4JIRA 3GSMA 3HA1A 4JEJA 4WSJA 3WQCA 3UJRA 3PN8A 3R89A 1NOUA 1JZ7A 1B9ZA 1W1PA 4C65A 2FGLA 3PANA 4HMCA 1XUUA 4PODA 3LERA 2BXVA 4TO8A 2YDSA 1NDZA 5FI8A 5D30A 4LC8A 2J8GA 4DN1A 1ZCOA 3UVIA 3L4WA 4DO6A 2PAJA 1IIGA 3LHUA 3WMSA 1TMHA 3M0XA 1I75A 2Y89A 4H9TA 1H7WA 1WKEA 3OW1A 4LF2A 2X0SA 3PAJA 2WW5A 4Z1CA 5CZTA 1B2YA 1ITCA 4ONVA 3S6DA 1V0MA 6XIAA 1DQWA 1S39A 3G0UA 3RX2A 2XGIA 3TONA 1SZNA 4AZ5A 5BNKA 2ZFAA 4JD4A 3TCEA 3L9CA 2WMJA 2VC9A 1FWSA 4LS1A 1GK8A 1QOQA 3B4YA 1VCGA 3L4XA 3PG8A 4Q6JA 1T41A 3PJTA 2HBXA 4KQNA 1XQLA 3T42A 4BF7A 5C2XA 2PBOA 3B9AA 1VFFA 4CNPA 2X2GA 4TX6A 3MUAA 4FOKA 4H6RA 1L6SA 5DANA 4CQ8A 1UH3A 2VQUA 3TTYA 2AMGA 3S9YA 1E6SM 2D2GA 3LZ3A 1FA2A 1TTPA 3OVRA 3LLFA 1M5WA 2GJLA 1K77A 3IARA 1CGWA 4LVBA 5HK4A 3NPVA 4GX9A 4EACA 2G97A 4NKCA 1UPMB 3OJGA 4GINA 4IMFA 1GNXA 3TU9A 3AFBA 4QG8A 2ZA2A 4EAYA 4I5RA 3VTRA 1JULA 4RE2A 3GIQA 3P2VA 6ALDA 4QR6A 1XRFA 3IIVA 3HPSA 1QNOA 4FI4A 5G1MA 2E40A 1TPH1 2P5NA 3GIPA 1F5ZA 3DG3A 1U1UA 1Q65A 3AMCA 8XIAA 3P3BA 2CLEA 3OIXA 1ICPA 4FXFA 3S1XA 1PKMA 2PDNA 3SCQA 1FWWA 1QNVA 1TJ0A 3TSBA 4BS0A 1OGGA 4QSHA 3B8IA 3UWWA 4MSSA 1REQB 2DSZA 2XWDA 4O8AA 1C7SA 3ZZ1A 4Z08A 1S5MA 4JDBA 1S5NA 2OPJA 5D9NA 4GVHA 4LWWA 5EA9A 3TN6A 5A6BD 1HKKA 3PSVA 1N8IA 3BGAA 5J5RA 1YADA 3CPGA 2EEXA 2HPMA 1W3LA 5GNZA 3W9ZA 1RUSA 2HNHA 3DERA 4JTIA 5DCEA 3T09A 1UUQA 3H53A 4AHQA 3ZLGA 3LI0A 1FX6A 4BK9A 3QQWA 2NSOA 4XBSA 5HATA 4US5A 4PTXA 3ZSTA 4Q8VA 3QQ0A 4AMCA 5A8NA 4DLFA 3GWQA 3EXRA 3N12A 1L2UA 4CVUA 2YL5A 1BWVA 1Z48A 3PPFA 4NXKA 3VCCA 3TJXA 2XYLA 5FJRA 4BQ2A 2FZDA 2QV5A 3RM4A 3SY8A 1VEMA 1ZP4A 4JGDA 5A6SA 2KAUC 4XD6A 1SZGA 1YEYA 2CERA 1UA3A 4Y2WA 2AKZA 3EKLA 1XC4A 3KHDA 2WHMA 4PCFA 1AA1B 5A1AA 1E56A 3B9OA 1UP3A 4I5UA 5A6LA 3SUTA 5I3HA 5XINA 2BX7A 3O8AA 1V79A 1CEOA 1FCQA 1J6PA 3NZPA 1CPUA 4GX8A 3A23A 1K8YA 1KFBA 3H4XA 3HQOA 2RHGA 3NDYA 4FNPA 4DELA 2DP3A 5FIPA 3CK5A 5DMMA 2XVPA 1IEQA 2XJ7A 2C0AA 1VZWA 5LNRA 4HA3A 2XISA 3IGHX 3MZNA 4JHZA 4CU7A 1BEUA 3LCWA 4CN6A 1JQXA 1KCXA 3TC6A 1UKOA 1N2VA 2G5WA 3UNTA 5TQLA 4LV9A 1WXYA 2Z24A 1UWAA 3NO1A 4XZMX 4GUFA 1K8XA 2ABAA 4LU0A 2Z1XA 1SR9A 3N6JA 1VGAA 1PL9A 1AQHA 3AZSA 2AGTA 2CXEA 4GQRA 2GL5A 1Z9AA 2A3HA 3LLDA 1W5OA 3U57A 5HQLA 2QJJA 3E6EA 1PWMA 1RQEA 1GTHA 5BMWA 3PFMA 1B3ZA 2XN2A 3OZOA 3BLPX 1NDVA 1VRDA 1DE5A 4Y9MA 2VRQA 3TJ4A 2PWVA 2XDFA 3S1WA 4JBRA 1OC7A 5U7SA 2WNWA 1H7NA 2OELA 3ZM8A 2J88A 3VNKA 3VIKA 4J3SA 1UWUA 2PF0A 2C1IA 1D2KA 3C6CA 4NYUA 4A35A 4D6GA 2XM2A 3ARQA 3LRLA 4NNBA 4A3UA 4N9CA 4ICMA 4PUJA 3LM3A 2H8XA 3PM6A 3M64A 1OINA 4HPXA 1YXYA 3GX9A 3R11A 4JYFA 3CH0A 4ZTXA 3GXDA 3S5YA 1TG7A 4ILSA 3UCQA 2Y1HA 3SJNA 3WX7A 3S4TA 1Y7VA 3TFCA 4FP1A 1M03A 4PUDA 3VDCA 2OZTA 4I7WA 3UR5A 3TR2A 1EC7A 4US5D 3GG7A 4HN8A 3OVGA 4FR1A 4N9DA 1V03A 2GZXA 4A4AA 1ZJBA 4C6EA 4Q32A 3TSDA 1WBHA 3VX0A 4P8UA 2YA2A 5L9FA 1UQYA 1A5BA 1Q66A 3UXIA 1FWTA 2I1OA 3B06A 3UZZA 3K30A 2GGHA 2CKRA 3P7YA 3M9YA 3PC0A 3VOJA 3DI1A 3DG7A 4ZQRA 1OF8A 1MUCA 3LHTA 5D2XA 1RSCA 3D0CA 3SQMA 1BVZA 3UR2A 1Z69A 2J6XA 2PLCA 3QW3A 2IPJA 3HQPA 4L9XA 2ADAA 3ERPA 1P1MA 2DIKA 3INPA 3MQTA 4L9YA 3VABA 2HROA 4GYPA 3SSZA 1U1HA 2QJNA 4Y9PA 4O16A 4AC1X 2WSPA 4NILA 2ACSA 4A3QA 5DN1A 2MUCA 3NYZA 1QAPA 2BVDA 3IV3A 2R14A 3PTMA 4O1AA 4EPEC 1RK6A 4HT3A 4C1LA 3A64A 3EMCA 2CYGA 3C0QA 1BWLA 3FFSA 4ORIA 2A3BA 4DZHA 1YDNA 1TV8A 1C8YA 1QT1A 3C0LA 4C7DA 3GXTA 1TELA 3HV9A 4CLMA 1JCYA 3L21A 2L5HA 4LB3A 3VD9A 2VHLA 3UF9A 1J12A 4UNIA 5A2AA 3MSDA 4Q33A 4EPKA 1JZ5A 3N34A 3SGGA 1FFQA 4H8VA 4NASA 3NJ3A 1KCLA 4GC4A 1ITXA 4AIEA 2ZUTA 1KB3A 1QPKA 1YLVA 4JEQA 1R5YA 1F05A 3MCNA 2QAPA 3BW3A 5B7YA 1LRNA 1HT6A 3GVRA 4FNSA 1I6NA 3KW3A 3R0UA 1HUVA 1OM0A 3L5LA 4XO6A 3LZ5A 1V6XA 1V0NA 2QW5A 4F2UA 5E0FA 2GVEA 4HPNA 4J2MA 3BLOA 5K4ZA 1YIXA 1R3QA 3WLPA 5EMJA 2WJDA 1ZS2A 4N4PA 1NDYA 2WOQA 1KTBA 1GZGA 5LIYX 2F2KA 4L1GA 3I68A 3GDKA 3LG3A 1XIIA 4YYFA 3TW7A 2OGYA 2V67A 3QLDA 5F1UA 3ITGA 2F84A 4X9YA 3TCSA 1P6WA 2X16A 4S3CA 4DUVA 3RX4A 4PMZA 4MNKA 2CXGA 1EOKA 2WZIA 1LBMA 1SJAA 3B0UX 1MDRA 1B3YA 2VRKA 1I2QA 2D23A 4HTYA 1Q85A 1S2WA 1E9YB 1K8ZA 4CD6A 3BLEA 3G0XA 4QRNA 4PYSA 2XSBA 1C3FA 2ZVIA 3AZTA 3R79A 1W5MA 1W9UA 3KTSA 3P67A 4MKVA 4XSLA 1G1YA 2YLLA 4QNEA 2QHAA 1ZPTA 2QDHA 2PCQA 2R1NA 3EMZA 5GNYA 2JQXA 3KL0A 3KOYA 3ZJ7A 3KCLA 1Z32X 3QSTA 4RZ5A 3G1AA 2ZRUA 4GNVA 4YU1A 2NX1A 1EGZA 1ZBVA 1ZJIA 1Z44A 1VLIA 1TX0A 1XGEA 1PIFA 1C90A 2HS8A 3H2AA 3MUIA 1PZ2A 1J0KA 2HSAA 3W76A 1A4MA 2Y8UA 1BAGA 1CLVA 1U30A 3DFOA 3QH2A 4KESA 2Y4SA 3VVGA 1FWIC 1KFWA 3WD4A 2ISVA 3WEZA 2V69A 3LEPA 3KP1A 2ZA3A 1X38A 3UETA 3M5XA 3E1F1 4CD4A 3BG9A 1LOSA 1HJVA 3O07A 1N55A 5G1YA 3WQOA 2X7VA 4LVDA 1PZ3A 2GDUA 3BOLA 5DMYA 5EBUA 2QDDA 4HU4A 4C6DA 1G6CA 4UQAA 4NVTA 2E8ZA 4K37A 1RAKA 1K4GA 3CHEA 1EUNA 2NXHA 4JCMA 4ICNA 1W2VA 2BHYA 1QI5A 2C79A 2D0FA 2V2DA 1AMKA 1JZ2A 3K8MA 3BLIA 4JIIX 3UGVA 4AY8A 3EDFA 1KGUA 1NWSA 4MY1A 3NVDA 2WWDA 3CU2A 4ZQPA 3IJ7A 2E8YA 4P7NA 3XISA 4WF7A 2WWCA 1EJ7L 4DEFA 1GVOA 1ADDA 1LWJA 5AC6A 2D2HA 5CC6A 2FFIA 3MTWA 1X6NA 3VNYA 1QNRA 3P5ZA 3WF1A 4AISA 3TN5A 1YTDA 3W75A 3WQ6A 5IBXC 2Z28A 2BVYA 3H21A 3V18A 2AL1A 3TSMA 1KW1A 2AOSA 4I9JA 4LAKA 4O14A 1JGMA 3KOXA 1W1TA 4F0LA 1UR0A 4B5SA 3S1GA 4U2YA 4Q7BA 1SO5A 4QJ5B 1TZZA 1EJRC 4PA8A 3N19B 4X61A 2WLZA 3T2OA 3HQ1A 5AHNA 3THCA 4YS1A 3QC3A 2PDHA 3S1UA 2XN0A 4DJDD 4LYPA 3VNDA 1KRAC 1VCFA 4NX0A 2WMFA 1OABA 5GJMA 1NIUA 2ACQA 4FO4A 4QIUA 1AJ0A 2ZRWA 3EX3A 1GOOA 4WGHA 1UC5A 3UFYA 3IJQA 3BURA 4HN4A 1X97A 1CT5A 1Y5WA 1E1EA 4PL2A 1U2YA 1OT2A 3LU2A 1CCWB 4CVWA 1L8PA 3R8RA 4IWWA 3PTKA 2XFRA 3SN1A 3EX1A 4L80A 4REQA 1PKNA 3L67A 4AEFA 1GOQA 1DV7A 1E0WA 4XKMA 4JPGA 2ZICA 4XVEA 1F2JA 3UW6A 3THQA 2W63A 5CZJA 4LEQA 4YWSA 3B3DA 4FX6M 4PTDA 5MKGA 2QUTA 1BG4A 3W87A 1K8CA 1ISZA 3CLWA 4GY7A 3WF0A 3F2DA 1RR2A 2BDQA 3P93A 3UWYA 5DBUA 3WQEA 4LAUA 1U5HA 1B54A 2B7NA 6ENLA 2WZEA 4S3BA 3KOZA 2W9MA 1RY0A 3FEQA 1TPFA 4GISA 3S1VA 1TZ7A 1Z42A 2WK2A 1A5UA 3OLGA 2VFHA 4PUMA 4M80A 2XH4A 2DZXA 1PKLA 1Q8AA 4Q3MA 5D2WA 4DIAA 3M0HA 5HDRA 3VKKA 3V1HA 3ABZA 3TV8A 2AQVA 2WHLA 1R47A 3OA5A 2Z25A 2VURA 2OSYA 3A3HA 1IWBA 4XD4A 2VX5A 5HNRA 3BW2A 1E40A 2YBTA 4UFJA 3ABXA 4F0KA 3C3NA 4QJ3B 3URNA 3FX4A 2QJMA 2P88A 3FA5A 3NQVA 1O1ZA 4HVXA 2QULA 8CGTA 4PSRA 5CJ5A 3GKAA 3N14A 4XK2A 1FDZA 4MDPA 3GYEA 4QROA 4Z2HA 1WZAA 1WOBA 1W9VA 3CUXA 4QE1A 2BGNE 2YCJA 4KWOA 4HNLA 3THUA 2CLIA 3P8JA 4FK9A 1A4LA 2X05A 4CCEA 3PB0A 3QMSA 3MUY1 5AN7A 4GJJA 1W5NA 4OV4A 3OEXA 3V5CA 5EFDA 3VKBA 3IPWA 2FGZA 4C90A 5IHRA 3N6QA 2EG7A 3BV7A 4XV0A 3UGRA 4W84A 1RBAA 5JH2A 2X1RA 1U83A 1F76A 4UCGA 4ORMA 1R30A 2QT3A 2O55A 1JCTA 3EPOA 1FWJC 1KV8A 3B8SA 3QMTA 3WQ4A 3NXLA 3SBFA 4EE9A 1PEZA 3S9IA 4QG9A 2GDQA 3FHAA 1P0DA 3N18A 4YHEA 3H2MA 3J7HA 4NF7A 3W88A 5E0CA 4X9SA 1TO3A 4BF5A 1BWKA 3I4KA 1W3HA 3NZRA 5HNNA 3TJLA 2FGBA 3DYPA 1LOLA 1MXSA 3T0TA 4D6HA 3OLDA 3TYCA 4J3XA 4AVOA 2ZXQA 2VVNA 4AXNA 4HNVA 1W5QA 1YDVA 5K9CA 4MPKA 4N9BA 2CC0A 3WBEA 1XCFA 4O52A 1GZ1A 4OV9A 4AC7C 4TQTA 4WSHA 2V5JA 1KRCC 2CBIA 1CXIA 5AZ1A 1H2JA 2V63A 1H09A 3EXTA 3PPHA 3DX5A 1C8XA 4GHRA 4L61A 3IGUA 3VGDA 2YYUA 3IUIA 5HWNA 2ISSA 2VOMA 3N4EA 1AH3A 1EBHA 3HJZA 4BEUA 1XDJA 2I16A 3E0FA 1SJDA 3MJYA 2FZMA 4MWAD 4M82A 4HOZA 2ON3A 9XIAA 1ADOA 2DUAA 1W0MA 1SO4A 3S8HA 5AC5A 2HBVA 1M53A 4WHBA 4BQ4A 3GG1A 4KS0A 3JVAA 4C60A 1K4HA 3OYZA 1JPKA 3LNMA 3SFWA 1G4EA 4D9PA 2OTDA 5CQ1A 2QIIA 3MCOA 1XLKA 2NQ9A 4IGSA 1GT8A 1CZ1A 3DKJA 3UG8A 4LH8A 4F9JA 1JPHA 3O9NA 3CTLA 1GCYA 4S3JA 1MFUA 3EXSA 1BKSA 2QCDA 1KM1A 1TQXA 3LCXA 3BLKA 4BJHA 4G7EA 4Z2GA 1KQZA 1WZLA 3L66A 3W1QA 2VNCA 3H8AA 2WYSA 1PYMA 4V15A 2DGAA 1ODZA 3N2MA 4ZBCA 2ANUA 2WVVA 3PWGA 4KERA 4W88A 2EBNA 3ELFA 3CTTA 2XFYA 2Z6IA 3M47A 4KGLA 4DJDC 1E71M 3T1GA 2YCEA 1L9WA 3VX1A 3KWXA 1IEIA 4LF1A 1BRLA 2F6KA 2VDGA 3CEPA 3TQKA 1QPOA 2A3CA 3TYUA 2UY2A 2ISFA 3F4WA 4RNHA 1QBBA 3NQMA 4GC3A 4O1EA 4H8UA 4K38A 3VKCA 4UTHA 4PUNA 1US2A 1Q8JA 4AIOA 2PB1A 3AYTA 1HL8A 1PPIA 4N42A 1FHDA 3NQ7A 3PUDA 2C19A 3LM7A 1SJCA 4JL1A 3QC0A 2VZUA 2O7SA 2H6RA 4GUGA 2VI0A 1UC4A 1BGAA 3MW7A 4S39A 4WJ8A 3MKCA 1SFLA 3O2LA 4DJFC 4YTTA 1TV5A 2J8FA 1PV8A 3XINA 1XJBA 4B5UA 1WDQA 2YA0A 1F3WA 4IH3A 5CSRA 2OQLA 3KDNA 2DIEA 2XWEA 4B92A 1NFPA 2Y7FA 3ZT5A 4D6EA 3EA1A 3EPMA 3C2FA 4E8GA 4GNJA 3BLDA 5LGZA 2E77A 4C6IA 4O1DA 3BAYA 2A85A 2NLYA 5CPNA 3CYVA 1J0IA 3DFTA 1H0IA 1C9WA 4NI3A 3NQ2A 5FSDC 3R0DA 3VMPA 1V08A 2FYMA 2Y24A 4MYAA 3UJSA 1GQJA 2HEJA 1FCUA 3WJSA 2Y85A 1OFQA 4MWAA 3LMZA 1X1OA 1W9XA 1TE6A 3SIZA 3SEPA 4Z1DA 2FIQA 3LGEA 1W91A 4KRTA 3KLLA 3CV7A 2HS6A 2HK0A 3QHOA 2ZDRA 2A6LA 5H8PA 5AOUA 3PNZA 1DQXA 2EKGA 3OB8A 4GUHA 4S1FA 3WL0A 1HJWA 5I2UA 2PODA 4RK8A 1KBLA 3ZJKA 1P7TA 3V0UA 4AG0A 3KBSA 4HA1A 2J27A 4H01A 4IQJA 1EB3A 1WAUA 1AQ0A 4G2DA 1VEPA 1B9BA 2HE8A 1CXKA 4LB4A 4LCRA 3BO9A 3QYQA 3IJIA 4IJCA 4D6IA 2OU4A 5LKYA 1H5YA 3U2CA 4H6QA 5HJYA 3W82A 4A8IA 5A8GA 2NUYA 4ZB2A 1SMDA 5AVHA 2ABBA 3WQFA 5LIXX 1W1B1 2EHHA 1GOKA 4PCNA 5DQPA 1ODUA 1CXLA 1XWYA 1ONWA 5M3WA 5DY2A 2YW4A 3L65A 1BXBA 1L6WA 1KFLA 2PLKA 3E2RA 3PJUA 1SFTA 3EWUA 2A7NA 3OBAA 4D2JA 4KGJA 1RD6A 2BMBA 2J9ZA 2IPWA 3JU2A 4IQLA 2VRJA 2HPIA 3L0KA 3PWAA 5EMKA 4YTRA 3EX6A 1OFAA 1R3SA 3IUDA 5BRPA 4R88A 1BPLB 3KS5A 1JRBA 3H2OA 5HPOA 2PDCA 4LTSA 3M5VA 5H91A 3POCA 4UQBA 4ZQMA 2VDIA 2OO6A 2XZ7A 3VDGA 1WAWA 4W8LA 1WDRA 1DVJA 4AZ7A 2H90A 3I3BA 3WKZA 4F4RA 3BGJA 1OD0A 1M68A 2QDGA 1A5NC 4UTLA 4FNUA 2Y5SA 1R9ZA 3Q58A 2MNRA 5D2VA 3JUGA 2QS8A 3WDHA 3VFLA 2QQ6A 5FF4A 2YBUA 2PGEA 3NNTA 1B3WA 5C54A 1EJUC 2IXUA 1XGZA 1G4SA 3H2FA 1QI2A 5I24A 4FLQA 3PAOA 1TRIA 1W17A 4GA8A 3AXXA 4DRSA 2DORA 5EL1A 3QOMA 3QV8A 3UJFA 4XTIA 1TX2A 5LZLA 1DJGA 4ZO9A 1B5TA 5D9PA 1LM1A 4CNOA 5M1TA 1ZB5A 4V28A 2OX1A 4C6MA 1LLOA 1CGVA 3O3RA 1XBVA 3R94A 3UJ2A 3FDGA 3M4HA 2FQIA 1XQKA 2Z6JA 4TU1A 2VKZG 3SSJA 4ZMGA 1HL9A 3TZFA 3OG3A 1MVYA 2VFDA 4JX5A 4P7OA 3BK0A 4AHPA 5FEXA 3QGAC 4LY8A 2JKAA 2F38A 1HVQA 4TR9A 5IRPA 4XAPA 3DBPA 4M7SA 4DJEA 3AYVA 2GPTA 4JN8A 1TA3A 2AL2A 2P76A 3LPOA 3UYIA 1QHZA 4C6OA 4X3ZA 4RDWA 4EKJA 3VCRA 1IGWA 3CQJA 1ML1A 1KM4A 2A0NA 3IJ8A 5T26A 1XLJA 4RE3A 1VPYA 2A7PA 2DUZA 1TR1A 3SECA 4WXZA 4W8BA 4I5XA 4MPQA 3KX6A 3NDZA 2DZSA 2J78A 1K02A 7ODCA 1QRQA 1WP6A 4XBKA 5AKQA 5BCAA 1W5PA 3LGGA 1J4EA 5F4XA 4Z1AA 4YTQA 4HNNA 1EDGA 1S5TA 2OCZA 3WJYA 4I8DA 1UWRA 3RO8A 1O1HA 4AH7A 3SO7A 4RE0A 1E15A 5FA5A 5CJMA 3I10A 3DBNA 2PDPA 1PSCA 3NSNA 2ZYFA 2V9DA 1DXIA 1UR1A 4Q8OA 2AMXA 1MMFA 3GW0A 3QBUA 3GNDA 3M1ZA 1UW9A 3P62A 4IJBA 4AD3A 2DZPA 3URBA 3BSGA 4ROPA 4GZEA 3CIWA 1Q6CA 1I1XA 3EOEA 1XKYA 4OECA 3LRMA 1DWHM 4EK7A 4QQUA 1GVFA 4DLMA 1IWAA 3K2GA 3VD5A 2IKHA 3PUOA 4GQBA 4AIUA 4CGTA 4JTAA 3LY0A 4YLWA 2PDFA 4GI6A 4KPLA 3CAVA 3TMQA 2CLFA 2J75A 3ECQA 1LBFA 2DQXA 3NXFA 3O15A 1PIGA 2C71A 2OR2A 4O1CA 4QBXA 3FSUA 5CH9A 1Q6OA 5FF2A 3KDOA 1LG1A 4FIQA 1K9FA 2RH9A 1W1ZA 4BWLC 1PDYA 3GTFA 3H4GA 4AF0A 1F6YA 1FKWA 3GRIA 3K13A 3IK2A 4XAFA 1CIUA 2GVJA 5D4YA 2W92A 5LA1A 4FNRA 3W71A 1WQ5A 3QFEA 1P7TB 3RLHA 3H12A 1POJA 3MO4A 1E72M 2WSYA 1Q7MA 3VC6A 4XZWA 3MA8A 1W3IA 4MB1A 1LL6A 1Y5VA 2A3AA 3DAQA 3VE7A 4ZOCA 4DJFA 2OZ0A 3AIQA 1PX4A 2VC6A 3ZWSA 4AD4A 2GDVA 1T5AA 2C8NA 3Q67A 3W7OA 2X0YA 4HNCA 4UFMA 1HL2A 1AZ2A 4HMEA 1JGIA 1OK4A 3AS0A 3STPA 2UWFA 3NQAA 4N4QA 1IT8A 1VAHA 2I5QA 1XP3A 3L4ZA 2BVTA 4JXCA 5HJLA 3MO7A 1SO6A 1ZY9A 1JJKA 4PMJA 3VIHA 5KZDA 2F6UA 4W85A 2W62A 1ZAHA 1EC8A 6TIMA 2E5DA 3DIPA 1ZQ5A 5T91A 1NF7A 2VEIA 1W3KA 4IG2A 1UD8A 4BCEA 4GIAA 2XGBA 4W8AA 1PO9A 3LX9A 4WD0A 4OFCA 1TSIA 5K7JA 2ZVRA 1CTNA 3MHUA 3LQGA 1EJSC 3OQEA 1FP8A 3VUPA 4O0ZA 3WLSA 2FZNA 3WLTA 4BQ3A 1YDOA 3MP5A 1X6UA 3RCYA 4US6A 1TPDA 1ZENA 3S46A 3K46A 3MP4A 1NELA 5G1TA 2CZDA 4NAEB 4M51A 5CBIA 2C3ZA 1TVNA 3ES7A 4XAGA 1IT0A 4ATLA 4LBRA 3PP7A 4G9PA 4WX2A 3TAOA 3QR3A 1KKOA 4K3ZA 4AWUA 1VJIA 3M6YA 4MFEA 4HJFA 1GQKA 3C2OA 5C7VA 1NH6A 5LYRA 5FJJA 1Q45A 5K4XA 2J66A 4Z2KA 3W73A 1F7BA 4J9JA 1B0IA 5DELA 4KCUA 4CNTA 1E6NA 2DVTA 4YN5A 4B91A 1JYNA 2J8TA 4G8TA 4A05A 1HKJA 2PGRA 3W7DA 1XFBA 3M0VA 2AQOA 4OUEA 3E3HA 1M3UA 4Q4OA 7A3HA 1Y5XA 3C4UA 3F4NA 3RN6A 3WNKA 5C70A 1H7RA 2E7FA 3RPMA 3V16A 5I5RA 3UCDA 3AXKA 4ATWA 4J4KA 4PMNA 4M0XA 3AWOA 2XSXA 3QKEA 2NQJA 1UJPA 1V6UA 5DXXA 3H2CA 3TYZA 3Q4DA 5A94A 4DBDA 4D6JA 4M3PA 3GFXA 3Q94A 1VYPX 3BMVA 2ONEA 3AJXA 3QM3A 5DT7A 5EMLA 4Z2JA 2G96A 2VC5A 4AYSA 2XU2A 3GC4A 2KZHA 4GYPC 4QFUA 5CAKA 4GWEA 4PCTA 4AXKA 1UR4A 2ZUNA 1E1FA 1OZMA 3SCNA 4AD1A 3KRSA 3GNRA 1VYRA 3EB2A 5FJOA 4A6GA 4R27A 1Q3NA 3HURA 1AJZA 1OFBA 2PP1A 3GXNA 4IX0A 2IKGA 3ABOA 4JDYA 5C9UA 2J7EA 2HK1A 3M41A 3S5NA 2OQHA 2Y5JA 4MFDA 1EZ2A 1SR0A 1W54A 2OJPA 1V6WA 3K4DA 4ZB0A 1K03A 4RNJA 3SGZA 5J8LA 2PWDA 4RCXA 3WN6A 1XLMA 4PBEA 4W5ZA 1GEQA 2OT0A 3G24A 2ZWYA 2O4MA 1OIMA 3EB4A 1QPRA 1V3LA 4LOCA 3VI2A 4EWND 2GWNA 5GQBA 3QYSA 2NVDA 4HSHA 5KETA 2XIBA 4EF9A 1OGSA 3W86A 2WQDA 3FN9A 4GY1A 1HF6A 3GXFA 2DW6A 5IXEA 5HMSA 3U2OA 1A5KC 1S2AA 2GGEA 3H6OA 5ABTA 4D8AA 5BOFA 3HG2A 4XB3A 1C93A 4O50A 1TV3A 3GZ3A 3M0LA 1K6WA 4C7GA 1R2SA 3KRZA 3HG4A 1MW1A 4MJZA 4NJHA 4PTNA 2E6AA 1TYGA 3TNBA 2WCGA 3GB6A 3F5JA 1Q6FA 1OFRA 1F9CA 1E4IA 1EFZA 3FVDA 1BD0A 1ICSA 4AIBA 2VP8A 1LQ2A 3TC7A 1QNSA 1PCKA 4I7UA 4PUWA 4NT0A 3F2CA 2HMCA 1QPNA 1TPVA 1OG6A 2R1PA 2ISWA 4UZUA 2G3JA 2WHJA 1ZP3A 2XIQA 4NUWA 1A80A 1A49A 1AVAA 5SWUA 1GVSA 2PWGA 2CZ5A 2VR4A 3M0ZA 2BS9A 3ARUA 4A22A 3ENLA 3FYOA 1J96A 5DCDA 3UZXA 1KXHA 1MRAA 1IE7C 4AYGA 2Z2UA 3NWRA 4IGMA 4MGGA 4IOTA 1N8WA 1SGJA 1RALA 4PMYA 2ZZ4A 3W72A 4HIBA 4EF8A 2OEKA 1ZJHA 1IHIA 3CZJA 1J10A 3HG5A 2VGBA 2PC8A 4LCSA 4N6FA 3TKFA 3M0MA 4O0QA 1MQRA 4AVNA 1J01A 5HA7A 4WJEA 4DM1A 4MUZA 1KV5A 4WDWA 1T7LA 1PHWA 2ZX8A 1FKXA 3PJWA 3W1UA 5KEZA 5B7ZA 2YOCA 3EWZA 4Y9NA 3FAXA 1Y8BA 3N11A 1XG4A 1O6IA 3KE0A 2UY4A 2AAAA 1VR6A 1T0OA 3SRFA 2DT3A 3WQGA 2NV2A 3OLEA 1J0HA 4B4HA 3EPNA 1TIMA 3LENA 3LCHA 1IWPA 2C1GA 2CZVA 1EJVC 4M6PA 3NPWA 3SUVA 1QI3A 4A3HA 3URQA 1RQHA 2ZUMA 1YKWA 4ICCX 3STGA 3MU7A 4AD0A 3H54A 4CQCA 4NRSA 4H9YA 3S5SA 2C6QA 2YB1A 3KFTA 3VOGA 3VXGA 1KKRA 1GQNA 2W79A 2QIWA 2WB5A 2VCAA 1UZHA 3CHDA 1MZHA 2V6AA 2DSWA 2W91A 3GVWA 4MTVA 2ZX9A 4R85A 2PE4A 2J25A 4FXJA 1DPMA 3ZS4A 1NDWA 2EPMX 4I9AA 5E9XA 3RXZA 4GYJA 1ESWA 3XIMA 3PZGA 5A6MA 4GKLA 2ATMA 3L4YA 3OVPA 3WQ5A 5HAOA 3LQLA 3NG3A 4IIHA 1MEHA 2JIEA 1KLYA 3WUFA 4JTJA 3SZ8A 4YTUA 2VWSA 3Q65A 4XD3A 1O68A 3UD6A 3IEBA 1JL8A 1JAKA 1H1YA 3B8VA 3S6TA 2I57A 3FJNA 1DXFA 3IJDA 1VFHA 4UQCA 3F4DA 1P0NA 3JZUA 3CGTA 1AFSA 4WKHA 5I0DA 3U2ZA 5D9OA 3TX9A 3WMBA 4KWVA 4S23A 4E6MA 2QAFA 4JIQA 3AXMA 5HMEA 2YXGA 5JIWA 1H61A 4ZA0A 1DORA 3MP3A 2P3EA 1ZNNA 2XVKA 5G5IA 3AMGA 4JIHA 1XH2A 3RUBL 3SURA 5CCZA 3HOJA 1FWEC 1ZSXA 1NY1A 1ICQA 1OX6A 4JL2A 2I17A 2JF7A 2E9LA 1L8NA 5K2ZA 2YKKA 4FF5A 1RP9A 4JTFA 4CU6A 2NT1A 3GVQA 3C8NA 1ONEA 4WY0A 3DDMA 3S83A 1W1VA 1LJYA 3GHUA 2DZUA 4GGBA 5JU6A 3G18A 5A5WA 3WSUA 4HYWA 2Z00A 4MUPA 2X30A 4BR1A 4DHGA 3CHFA 1R86A 2DZAA 1VFMA 3GDRA 3FXGA 4B3LA 3W1MA 4IFRA 4JY9A 4HP5A 4UXDA 4DJFD 4L65A 3I7RA 2ZXDA 1W2PA 3QMRA 4ASTA 5C55A 1TJRA 4ZO7A 3VGGA 3WFAA 2DJXA 4FA3A 3ARYA 4BHYA 4GABA 4YVVA 4I6VA 3UXKA 4UNKA 4JN7A 3QTPA 3AIEA 2DVXA 1XKJA 2G3MA 2WBGA 4H9UA 4L6HA 1WDPA 1MW2A 2OKOA 2QZRA 4LUIA 2VFEA 3MHFA 3R6IA 4BI7A 1EUAA 3RF9A 4GFSA 1HQTA 4HHMA 5FESA 4QITA 3SRKA 3L7RA 2TYSA 2NSXA 3RFAA 1AUSL 3EOSA 2DUXA 3AJ7A 3VIMA 1E0TA 1XXXA 3WD0A 1PTGA 4AZCA 4AHOA 4DQWA 4EX4A 1MFVA 1DWFM 2Y62A 4OOZA 3F5LA 4HNOA 4OJYA 3TWAA 5ABEA 4WSKA 2Z1VA 3FS2A 3H4WA 1W9DM 1X96A 1AH0A 3W6LA 1DHKA 1EBGA 1PCWA 3DHDA 2X2YA 3GO2A 3S5ZA 3SCPA 1X8CA 1DJQA 4HYVA 2JGYA 1O60A 4LY4A 4DO4A 1GOXA 3N25A 4LALA 3NO3A 3WBXA 3WH9A 2I9EA 3PY2A 3VCNA 2OGJA 1H51A 1EDQA 2FLIA 3A3XA 2C15A 4DBWA 5EKYA 3SW6A 3WFLA 3LSCA 2VMFA 3BCDA 3BTNA 5RUBA 4PRWA 4M29A 3IWPA 3PHAA 2DT2A 3NPXA 3MDWA 4LAOA 4RZ4A 1ZJAA 1QNPA 3I7SA 3P0WA 3IAQA 1R8LA 4ACZA 4S3FA 2NVAA 3C2RA 1T6MA 2XIJA 3OZPA 1AZ1A 4E3TA 3ZLHA 3A22A 2D20A 2RDWA 1XDMA 2J7DA 2WV8A 4IM4A 1J79A 1S5WA 1ISVA 3FJLA 3P84A 5DRIA 1KBIA 4H9MA 8TIMA 5DT5A 2VXNA 2XUCA 1BXNA 3W7CA 1VPQA 2QUVA 1CI1A 1WZKA 2HXTA 2NQHA 4P2VA 2CBVA 3RYSA 3UNDA 1BTMA 3GW3A 1CGTA 5BMXA 2G3NA 3CS2A 1PDZA 1P0EA 3ZO9A 4LW7A 1UMLA 3CQIA 3F7JA 1HO4A 4JAWA 1WA3A 4RW3A 4B2DD 1KBJA 4HCHA 1WPCA 2CKSA 3AS1A 2PRHA 1V93A 4E4PA 3VKJA 1TMQA 4Q8TA 3S5OA 2QCEA 2HRWA 4BWLA 1SQ7A 4JQ2A 5D8ZA 5FCZA 1KR1A 3O06A 1M7OA 3FDKA 6TAAA 2ZC8A 1UJQA 3QR0A 1HTIA 1H7XA 5D33A 3N13A 1E55A 4AD5A 1RLCL 4ML4A 4PE8A 3PZQA 3T78A 2JALA 5LA2A 5HJXA 1QOXA 5CPTA 1Q4WA 3ID7A 2FB3A 3DUGA 3GYCA 1OYCA 1DEDA 1V02A 4IG2B 5FEZA 1F4AA 3AS2A 2PDWA 1FDYA 4UOJA 4KIRA 2WVVB 4MY9A 5G4EA 4IIBA 5C9RA 3S47A 4N6EA 3TOYA 3IIXA 3UR7A 1GUVA 5D09A 3CZKA 3VILA 5CC5A 2NWRA 4IF2A 1JXJA 4IMCA 3UPMA 4YCOA 5A69A 1FRBA 3KAOA 4OU1A 4UFHA 2Z2AA 3SGUA 3N2BA 4J3WA 1TPC1 1D3CA 4L64A 5A8PA 3OODA 3KBJA 2OYLA 1GWJA 2QUUA 4PFMA 3OYXA 3HGSA 5BOEA 3QW4B 1JYWA 3RGTA 2BSLA 4KRZA 1H63A 2OYKA 3IACA 1XIHA 1JEZA 3WF2A 7TAAA 5FJTA 1P6CA 4MJ2A 3A5FA 4IP7A 4AWEA 1ZRQA 3ZOAA 3AHZA 3S2JA 5EB8A 3U2EA 7REQA 4IPJA 3WJWA 5CPLA 3A12A 3O63A 2VELA 4PMVA 4K1GA 1VLWA 4UTFA 1SW0A 2XTKA 4WGXA 3PUEA 1UZ4A 1X39A 2EG8A 2CESA 3EEGA 3VIOA 1XLBA 5AYIA 2IQ0A 1YMYA 3ABQA 3PWIA 4XZIA 2E5CA 4IGHA 4B15A 1AW5A 4IL2A 2VFIA 2EAWA 3EDKA 3C8FA 5LXEA 1G0CA 1LOQA 4BI6A 3R0KA 4NU7A 1BFNA 4OBRA 3CV6A 3UY8A 4V1YA 2BG5A 3EDEA 3GM8A 2RKXA 2OWWA 1KM5A 3WF3A 3UESA 3CO8A 1V6TA 2FDMA 4BKNA 1PZ0A 5I07A 1JNDA 5DX7A 4BI5A 4JS3A 1TPWA 3VIPA 3VIGA 2E6FA 4GVIA 2CLLA 3CIVA 3NIYA 3ARWA 4LEFA 3VK5A 1Q6EA 3MWCA 4XZLX 3B8WA 1ZCCA 3NZGA 3PUGA 3W00A 1QJWA 3O1NA 1M41A 4Q4QA 1XIDA 4GI9A 4PB5A 3GH5A 1TWSA 4XISA 4R3UA 4WKFA 2QLYA 4AAJA 2EPHA 4PRRA 4UQ9A 1V7AA 1NJJA 5LIWX 3QJAA 2VUNA 4AZGA 5LNUA 3NGFA 2JBMA 1YNQA 5KZ6A 3VOHA 2A5HA 2GVYA 4C6FA 2E6YA 2PDIA 4JKKA 4B9YA 3TLLA 3N9SA 4TTUA 4HYRA 2HE5A 4D1JA 4XUYA 4PTWA 1GOMA 5I77A 4QHRA 2DT1A 3MUCA 2CIPA 1WUEA 2J7BA 3SUUA 3SJ3A 2GSJA 2AAMA 3ITVA 2ZRVA 1TA3B 4WRHA 3G77A 4A8LA 1DIDA 2I5GA 3W2MA 5A6KA 4RV8A 2PWEA 4Z2IA 4MB4A 5HULA 3LA4A 1TPUA 4Z1YA 3AUJA 4CEXC 2JEPA 3SY1A 3ZQ9A 1QHOA 2LLEA 3REQB 4AX6A 2VENA 4QLJA 5D04C 3BLLA 5CBBA 4P8XA 2OVLA 1CX9A 5HMDA 4KEVA 4X22A 3QPEA 3AWNA 5AYZA 3ZMRA 4PH6A 2B0MA 4EANA 5H2ZA 4OE7A 2PDUA 3W28A 4BEQA 5AC4A 1SYTA 1P5BA 1XIMA 5H8MA 2RJGA 3ZYZA 1OY0A 3LXCA 4IPPA 3PSWA 3EEZA 3IGXA 2YZ5A 3B4UA 1LYXA 2JKPA 4RPQA 1V8EA 4GBDA 2ZX7A 3CV1A 3TN4A 4IXHA 4Q4RA 5E1QA 1MQQA 1AODA 3SUSA 1SFSA 1DXEA 3L12A 3K1DA 3O6AA 2UY3A 4GXPA 2HV5A 4IFKA 4J3ZA 3BCJA 1F6PA 3W6MA 4O10A 2OT1A 4ZENA 4LCQA 3T0DA 2J74A 3FJ6A 4KWUA 1L2QA 3WLJA 2O0TA 3WH7A 1TWWA 3M44A 2H9AB 1I2RA 4X0VA 1R2TA 4DY1A 1SVDA 4H7CA 5A8QA 1GJWA 3WQ8A 4EOUA 1PUDA 3N04A 4JKMA 2ZA1A 2G4FA 3NL2A 4YVXA 1IF2A 2FZ8A 4O13A 1A3XA 1Y0EA 4DNMA 4LAZA 3A4XA 4QS6A 4WDTA 2PZ0A 1M7JA 4OTKA 3VZZA 3ARRA 1R3RA 1RP8A 1BF6A 3GHTA 3DZ1A 5E6ZA 4R5EA 4ZEPA 3RX3A 1Q7QA 2W66A 3S2NA 5LIKX 1Z41A 1MSSA 2DSUA 1RV8A 2JE8A 4E3VA 2E9MA 3C86A 3WK3A 4LUYA 1ZBCA 3KL3A 1JDEA 3H70A 3N3MA 5E09A 3E02A 4GBUA 1R3WA 3P74A 2R82A 1LL4A 1HIZA 4TV6A 2IKJA 4HCDA 3BWWA 1S2UA 2G95A 4PUKA 1LG2A 3UEQA 3MDUA 1AQMA 1EH9A 1W3JA 1F8IA 4H9VA 4AMAA 3CB3A 2WSRA 3RRAA 4YVPA 2NT0A 1EYWA 3HM7A 1WO2A 4A21A 1GYLA 1EGMA 1KM6A 2W4XA 5LGXA 2WMKA 1HVXA 1GONA 3BVJA 1XLLA 5LNWA 1GHSA 4YHGA 4UQDA 1B4KA 2GUUA 3CUZA 4NYYA 1O7AA 2YYTA 4B16A 3GK0A 3EBVA 4MNLA 1E51A 1YHTA 2ZC1A 3RPDA 4DF1A 4QAWA 1V3HA 3NM3A 4ZQOA 3AI0A 2YCIX 3BQ6A 3GVGA 4IXXA 2OOFA 4DXKA 2QJGA 4A3YA 3E0WA 4Q8QA 3IS4A 3ZSSA 4FNQA 4C6PA 2XFWA 1BGGA 3A9IA 5H1WA 3GDBA 3ITLA 1KXVA 3LCIA 3MYOA 5CGMA 5M17A 1S2CA 4XZ9A 4HZ7A 4GVGA 1FHVA 2J4GA 2FTWA 2CPUA 3HTWA 1A0EA 3GAYA 4FB7A 2PDQA 1CGXA 1G5AA 1PX8A 2VM8A 4WEVX 2O56A 3KOFA 5IDIA 4DJEC 3I65A 3S6OA 1H60A 1LT7A 4E2DA 3AC0A 1IGSA 2BWGA 2RGMA 4JFUA 1KTCA 2EPOA 3ISIX 4S3DA 4TTGA 5EMUA 1OF6A 1UROA 3W2KA 4MLJA 1KTNA 3T4WA 1HP4A 4UTUA 1EHAA 1UBSA 1OX4B 3N4AA 2E67A 4UQEA 3VPLA 1A5LC 1H50A 1QO5A 3UZWA 3LYEA 1EGVA 4GE8A 1DWJM 3NPUA 3C5QA 3E9AA 1YE4A 4XQ6A 2ZRXA 1MZRA 3WNLA 1Q6GA 3E12A 7ENLA 3GTXA 4A2RA 3CB8A 2VGGA 1ENUA 2OFJA 2NUXA 5F2GA 5AHLA 3PK7A 4FHAA 4ATDA 1IV8A 4JHMA 5D02A 4RDYA 1WDDA 4XIMA 1B3XA 1TFVA 1PTDA 2GGGA 2QMKA 1AL7A 3DFQA 3DECA 3NQCA 3CASA 4XKYA 3MYPA 4IUOA 5HR6A 5BRBA 5D8WA 3GE7A 4N02A 2GVLA 2V2HA 1BVWA 1JCLA 1XISA 2OLSA 3OBKA 4J40A 4TMBA 1IZKA 1E5NA 1VIZA 3SB0A 1XPGA 5AFDA 2QCLA 1H11A 3TC3A 1BG9A 5CAHA 1FXPA 1XPYA 2G0WA 1YNYA 2VEKA 3GXPA 2CLOA 3WLNA 1UIPA 3FK4A 5BWFA 5AHEA 4QXIA 4KEMA 3G1FA 3USZA 5CLTA 5GVJA 3T2QA 3L23A 1ISXA 1GQIA 1YE6A 1GVYA 2YA1A 1UD3A 4JICA 2WBKA 1I2OA 1TPB1 4IP4A 2QGHA 3V3WA 3VC5A 3WELA 3LBCA 2OWXA 3BC9A 3QTGA 2RDUA 1F8MA 3LXBA 4FR6A 3SY5A 3L0NA 5GJNA 3CV2A 1DIEA 2WAGA 3C3UA 2GJNA 1R7AA 4TV5A 4JTQA 2ZX6A 3GDLA 2V5DA 1YW1A 2HXUA 5I3DA 4WJXA 1GZJA 5DMNA 1V51A 3W7GA 1TTQA 4NG3A 3M7WA 4UOZA 1RHCA 1DIKA 1XRTA 3ARVA 1C9DA 1H1ZA 5F2IA 1XIEA 2INEA 1BF2A 1KGWA 4HPHA 2VUYA 1UWQA 5DFAA 4CNSA 3HGRA 3DFHA 1RPXA 3BGGA 4KFPA 2XH7A 3GAKA 3W81A 3TYAA 1UZDA 1EXPA 3WLKX 1F74A 2BBFA 3ES8A 2VQTA 4ADTA 5HBFA 1JI1A 4C6CA 2QDEA 3DCPA 4P7QA 3VIFA 3W6YA 3WNPA 3W29A 8RUCA 3WDRA 3L4UA 3F2BA 3I4EA 3NOEA 2QCFA 3A47A 4RDZA 1TJ2A 1WNOA 3VFCA 1QHPA 1LRTA 4UTMA 1O5QA 5LXXA 2WMHA 2ZX5A 2XIOA 3RPTA 1IEWA 2C1HA 4O54A 1UIOA 3HQNA 1XHGA 3ZFHA 3U8GA 4C6KA 5K9XA 5LIUX 2CLPA 1TV2A 4JFWA 3NSXA 1AQFA 4M19A 4RX0A 3T08A 2QPUA 3KHJA 3IJ6A 3R4IA 4TVDA 1EL3A 2Y6ZA 4HNTA 1IXQA 5I02A 4O12A 3CUFA 4UOQA 1IXNA 1TPEA 2GUBA 1DJNA 1UP2A 4IPLA 5D03A 5I3IA 4MZYA 3SCUA 3N15A 4C91A 4AF0B 4R34A 5FL1A 1EO7A 5CGQA 1EEXA 2X42A 1NQKA 3L5AA 4E0CA 4OHQA 3PJXA 1UZ1A 2RDTA 1K9DA 3OTRA 2O9TA 1EYEA 2TRSA 3E0LA 2W3ZA 4PBGA 2DSKA 2V3FA 1WKYA 4QGCA 5A2CA 5ECVA 3W84A 3GNOA 3BJSA 4CD8A 3C2VA 5BROA 4ZSUA 5E93A 1TV4A 3CT7A 5T9BG 1VKFA 3PZIA 4FMVA 2IUZA 1BKHA 2C91A 3LD5A 1TREA 2NQ5A 4DI8A 3HPXA 3TOPA 4FX8A 2Y88A 4N2YA 3VM5A 4KFOA 1MWOA 1RA0A 2DT0A 2ZXBA 3U5YA 3G1YA 2Q01A 1WZMA 4U3CA 3CWHA 2OWCA 4RV3A 3ITYA 4JTEA 3R8HA 5FJUA 5DLCA 1UBPC 3P81A 3NEVA 4F0SA 4P7RA 1UR3M 3LV6A 1ONRA 2HCVA 3FSTA 5F4SA 3L4VA 4ZXOA 2JEQA 3G8RA 1J9YA 1EF3A 3AHVA 1ZGDA 1OC5A 4NXSA 3BW4A 5EMMA 3G1SA 4HCLA 3LGDA 2VJXA 4IIFA 4Q4SA 2J62A 3QHNA 1JF5A 3BAJA 1F6KA 3JRKA 3KL5A 1MNSA 4ADSA 7PTDA 1JCXA 4DAFA 4AWTA 2X1UA 2HJPA 2Q6ZA 1KRBC 2PP0A 1TIWA 3I7QA 4A3RA 3KRBA 4GIYA 4HPGA 4PCSA 2YL8A 4Q7NA 4R7OA 3UWEA 3KTXA 5CG7A 2B31A 1A5SA 5AHMA 4LS0A 3E2VA 1FH7A 3EDDA 2PWFA 4BZYA 1R3YA 4WK9A 2VWTA 4OBTA 1UUOA 1XFCA 3TP4A 4DWSA 1BQGA 2I7GA 1W8GA 3CPUA 3R1ZA 5CZSA 1AG1O 1SFJA 4IICA 1C8QA 2VDHA 1ZZMA 3LB0A 3T0BA 5IBXA 4JTRA 4W87A 5AHIA 3O6CA 3UA3A 2D24A 2Y2WA 1JXKA 3MVIA 1ZLPA 5A6AA 4NY2A 4KFNA 3ZIZA 1J2WA 4Q4KA 3TA6A 5I3FA 5C2CA 4WQ6A 1UYQA 3F5KA 1C92A 1MUMA 2OYMA 3WQWA 1OHLA 1A3HA 1JIBA 4DO7A 1R0MA 4JR5A 1V77A 5DMLA 1HKVA 2NLIA 3VINA 3BJFA 4EPDC 1ISYA 2VO5A 2QPXA 3WG6A 1E4NA 5KITA 4P8VA 1L6GA 4GOAA 5E9AA 2ZWZA 3BZGA 3Q2DA 1IXPA 4LJ3A 3KVKA 1G01A 3LRKA 2JFEX 4CCZA 1FHUA 3HFYA 1HKWA 4DAIA 1GVRA 3ARSA 4Q8PA 3O0KA 4DJDA 3SQLA 2I5IA 3HMJG 1K9TA 5HINA 2E9BA 1VYSX 4JOMA 1FH8A 2WMIA 2YCLB 3MUZ1 1EC9A 4PSPA 5BXPA 4B3ZA 1SZRA 1S38A 4F40A 3CIXA 5TAOA 3RK8A 1QTWA 2BVWA 4UBPC 3MKVA 4A8NA 1J2BA 5DF0A 4MKNA 1H7OA 2QXWA 2VEPA 4MF4A 5F1VA 3O0FA 2XGZA 1S3HA 2E28A 1JCNA 3BAWA 4C1NA 2Y8VA 4C5YA 2Z0IA 1B30A 3W37A 4JZ5A 1EP2A 5T8GA 3CMGA 3E5BA 3W1LA 3GNXA 1PS9A 1LWHA 4H2CA 3GTNA 1X8FA 1DOSA 1TCDA 1RY8A 4C6LA 4CCDA 4LNCA 1BVNP 2OKTA 2QUNA 4NAEA 3CUIA 3MJMA 1H4PA 3NQBA 4XAYA 3EA3A 2E1WA 3PF3A 1S2TA 5G2WA 3R58A 2P8CA 2CBUA 3FAWA 3B0PA 2G3FA 2DY3A 1NTHA 4J27A 1LUCA 4GLEA 3ITOA 5BW6A 4IIDA 3FLUA 1MYRA 4UTWC 1TWDA 3SFKA 4KW2A 3W1PA 2GQ3A 5CGTA 3KCJA 4ZXLA 3MANA 3RMJA 1CGYA 3G2GA 3TTOA 3U7VA 2GJXA 4LANA 3OP2A 1WYIA 3V1PA 4L4MA 5IM51 4ZE4A 3MVTA 1I9CB 1SW3A 1W3NA 3M0IA 4AX7A 4H6KA 3DFNA 1JQVA 1LWIA 1UH2A 1JDDA 4HJWA 1F07A 1PHQA 4L4PA 4QDPA 1Q7ZA 3MCMA 4WZHA 1JR1A 3U7BA 4LQ1A 2BB0A 3PZUA 1XSKA 3DFYA 3PR2A 2EKCA 3IANA 2DZBA 3SIMA 2TSYA 4LXFA 4JTLA 4LGXA 2AGKA 1EX5A 3BXWA 5D9MA 4REQB 1A5OC 4EWJA 1VEOA 2QCCA 4RPPA 2WVUA 2E3ZA 3N29A 1BYDA 2OSXA 4I7VA 2J47A 2H3DA 2J7HA 2ISDA 3WNNA 1DHPA 4ZFMA 3ARTA 4E2BA 3MPGA 3LOTA 4RLIA 3T44A 2PLMA 3ANYA 2TPSA 4JKLA 3EKGA 2J7GA 3NL6A 2HZGA 4B5XA 2CHNA 3VGHA 1R38A 1EF2A 3W26A 4IMDA 4W93A 1Z8AA 3A9BA 3E0VA 3PZ9A 2INFA 2WKJA 5DEZA 2P0OA 2V5LA 3MWAA 4ZZ9A 1JPMA 3TA9A 1P6BA 3F4VA 2V68A 1NARA 5D2YA 2ZZ5A 1CBGA 4X63A 1JZ8A 2E25A 6REQA 5A6TC 3UWZA 4HZMA 3W02A 4A2SA 4H9ZA 5G4HC 3GU2A 5G2HA 1LP6A 1DTNA 4IZGA 4MZ1A 2H3BA 2WO5A 4A29A 3A21A 1IIHA 3B04A 3LK6A 1DL3A 3TR9A 3W2JA 4HNUA 5C0QA 1V0KA 2UZ9A 3MUXA 5I00A 1LUCB 3VNJA 4KEUA 5LA0A 3WUEA 2ZE3A 1XD1A 4G6CA 3OVQA 1TB3A 2P10A 4F9DA 3NQFA 4GZJA 4HU3A 2BY3A 2ZZ7A 1VC4A 1I2PA 1AL8A 4J28A 4M7TA 1FWHC 2C13A 3VOFA 1XR2A 4PR4A 2GQAA 3T05A 5HXMA 3DC0A 4OIFA 1LQAA 1X6LA 4WDUA 2WM0A 1XRVA 3AISA 3DN5A 3Q45A 3W3OA 4KH2A 5AB3A 1CB7B 5IHSA 1EPXA 4D1IA 5GJPA 1US3A 3W7NA 2FVLA 1TRDA 2OZ8A 3W74A 5GNXA 5AYYA 3BICA 3CHVA 3B0XA 3L2IA 1DWAM 4PRTA 4J1OA 4P61A 2O9RA 4I8YA 1OIFA 2Z26A 4BFAA 3AQUA 1ME9A 1XV8A 3ANVA 3VZXA 4IT1A 3VZYA 1TWIA 2A2IA 2QKFA 3PVFA 3RM9A 2GK1B 2OODA 1KXQA 5BOOA 1M1BA 6CGTA 3KVJA 4J7RA 2VFFA 1EZWA 4UFLA 2VR5A 3NZ1A 3B03A 1IR1A 1VD6A 1V7YA 2J7FA 1XYMA 3BAIA 3LDVA 1XC6A 3WK0A 2EJAA 4F0RA 4IQEA 3RJYA 3KBNA 4YMZA 4Q8MA 3AXHA 3EX2A 4TIMA 4D6CA 4PZVA 1UASA 4ZO6A 3BV4A 4FS9A 5LNVA 2ICSA 3O6YX 2PWUA 4E5TA 3LNPA 3EWWA 1PWLA 1NF0A 5AC8A 5IOBA 1EQPA 1VQTA 1O94A 3K4AA 4JTKA 1M01A 1NAL1 3IK4A 1WDWA 4M6QA 5A95A 1W37A 3RG6A 2REQB 2RAGA 2PDXA 5HMFA 1UUMA 3M16A 1TV7A 4N0RA 3S2CA 3FEMA 3VA8A 1XH0A 1SJBA 3PBVA 1QI4A 5FEWA 1IQ8A 1HG3A 1IR2A 2Z1BA 1XYBA 1V0LA 1FBAA 4L7ZA 4MVAA 2RDXA 2OOGA 1FFRA 3DHFA 1M7XA 3HU7A 3L68A 3PS7A 1VBJA 3DHPA 1QNQA 4LAMA 4HMDA 3GXMA 1XLCA 3B0VC 5I3JA 1GKQA 7CGTA 1UP0A 3ZVHB 4A8RA 3K1GA 2CEQA 2DW7A 1H1NA 1NOWA 4B4FA 1V6YA 3U5UA 1ZU8A 3UP8A 4B90A 1ADSA 1QR7A 2D0HA 3W2UA 3QEZA 2X1IA 4GD0A 1GJPA 4PBFA 2J24A 4GQ0A 3T40A 4IJRA 4K8GA 5HNUA 2OG9A 2YB4A 4GG9A 3RILA 4K2SA 2R94A 4DYJA 1GG1A 1R85A 1IEXA 4DUOA 4UTJA 4NQ1A 4QLKA 2E4TA 3AIUA 4TMCA 3CMJA 4X0NA 4NZCA 2BNJA 3VOCA 3K4WA 4QLLA 3UWQA 1XCXA 3DFSA 3T0AA 3KVLA 4Z0JA 2NX3A 5TF0A 4DXVA 4HPJA 4QISA 2NQLA 1F73A 2VX6A 3OQ8A 2NWSA 1XLGA 3UXAA 2JF6A 1VHCA 1G4TA 1ONXA 1B1YA 4S3EA 4IMAA 2EGZA 4HB7A 4NHVA 1XIBA 1VPXA 4F2BA 1EP1A 3TYBA 1Q6DA 4JTUA 1UOZA 1W3TA 5KZMA 1WV2A 3E49A 1REQA 3EA2A 3I6TA 1CNVA 3OHIA 2PMQA 3T6CA 1XYCA 2W6RA 3RU6A 3G5EA 4GY0A 4H41A 4QCEA 4CQ9A 3POHA 1XM3A 3W7HA 2WMGA 1R46A 4O17A 1JFHA 1EOMA 1L6YA 1FVPA 3CPRA 1K7XA 3LS9A 1TQJA 2EPKX 4S2BA 2C16A 5CSSA 3NR0A 2CHOA 1T8XA 4Y9AA 3S2LA 3JR2A 3RNDA 3ZVIA 3M0YA 3PZNA 4Z42C 3MMDA 3SN0A 5CSUA 4XD5A 4GPNA 4NAFB 4Q8NA 1MW0A 3D3AA 1RQBA 3GTHA 3OGSA 2NVCA 5CZ0A 3FGCA 2DQWA 4W7VA 3QHMA 4B2DA 4XIAA 2WJEA 4UTWA 4K7YA 2IPFA 2XVLA 1TTJA 4OT7A 1A47A 1VRXA 2GGIA 3LTSA 3TYEA 4PB4A 2ZZ3A 3WDIA 1E4LA 4ES4A 2RJHA 3AS3A 3G1RA 4QP0A 3E2QA 2XSAA 3UR8A 2FB2A 3SDOA 1SZFA 1OFDA 4S3AA 3HPZA 3EWCA 4ACZB 2B7PA 3REQA 3CL7A 3ARXA 3RLGA 4PCPA 3OPSA 3LTPA 1NM9A 3ZJ8A 2HQAA 1WX0A 3FIGA 1XLDA 5TBOA 5E6YA 2IQDA 4UMAA 5CJNA 3WNOA 3KWSA 1V6VA 5EPDA 1NSJA 1QUMA 2GSHA 3IIOA 3W1RA 4RXFA 3S0CA 4L9ZA 2XZ9A 3HV8A 3WBAA 3ZLFA 3WDPP 3GU1A 1CLKA 3L0GA 5A3HA 3W7RA 4UMCA 2EXOA 2R8WA 1QWGA 3T7VA 1OK6A 1J0ZA 4PUUA 4UTKA 4MB5A 3UPBA 2PTZA 4E8DA 1E70M 3GDMA 5I6SA 2PLJA 3VIJA 2GQ8A 3GHRA 4CCCA 4HSOA 4L56A 4EPBC 3ZWTA 4MJ4A 3LHYA 5I7GA 3K5XA 4JQAA 5C9ZA 2XPKA 4RKAA 2X0HA 3W7LA 3FA4A 1GYNA 1OSEA 1PBGA 4M5PA 3R43A 4H3DA 1UR9A 1OD8A 4MM1A 3KP0A 3AIWA 3N2CA 3P5YA 3WH6A 2GOKA 4KBXA 1W8SA 4C5ZA 2IMRA 2CWXA 4QSFA 2ACUA 2YCKX 4U2ZA 3QY6A 1AMYA 4F0HA 3QN3A 4JY8A 4CKQA 4M81A 1XG3A 2WPBA 2ZUSA 1IZCA 3CAKA 1JD7A 3QV7A 1KQYA 1E4MM 4QE4A 1EDTA 3P80A 4IFKB 2NV1A 3V36A 4EIVA 2Q3OA 2Q8LA 5FAJA 2WQPA 4UTIA 3AUOA 4KKXA 4AD2A 3QVQA 4LVFA 3G0SA 4GRSA 1TTIA 3A6OA 4XZHA 2TODA 2O4QA 3ONBA 3ZR4A 1Q63A 2F8QA 4QEEA 4L1WA 2QF8A 3IVUA 3NCOA 3W7EA 4XTDA 2AKMA 2Q3RA 3GZAA 1H7PA 4QNWA 1A5CA 1DP0A 4NAFA 3UXLA 1Q13A 1RD5A 3CAQA 4ZGYA 3PNUA 3ME3A 3VMOA 3IVSA 3KBWA 1Z89A 2NX9A 3W7QA 2XHYA 3NA8A 3N3TA 1Q2RA 4AZIA 3SN4A 2A4AA 4LRSA 1XD0A 1JDFA 2X40A 2JK2A 1UA7A 1WCGA 4WOZA 2P8BA 3RR1A 2VZVA 3CZGA 4FLOA 3IIPA 5EGRA 4MJMA 2FZBA 1YRRA 3SCSA 1CGUA 1EKOA 3TJIA 2GFTA 1YPFA 2UBPC 1MDLA 4N9EA 3HBLA 1VFTA 3VDHA 1Q6RA 4D6DA 1S1RA 3AZRA 4NJJA 3VNLA 4DNHA 4NZ1A 3QFWA 3APGA 2D73A 4MLRA 5F4WA 3GY1A 3MKKA 3MT1A 3RIKA 2Q02A 2HVOA 4YWIA 4B5WA 2QVHA 4K39A 2QF7A 3WUGA 2B7QA 3PTQA 1QU4A 3B05A 4O53A 3I3DA 4JN6A 4OZOA 1E1CA 3IRDA 4RZ6A 3NUKA 3R10A 3QRHA 4LUSA 3BCFA 3V35A 3W7IA 4XSMA 3SADA 2UY5A 2VVSA 3B8TA 1UB3A 4V27A 2HWGA 2ZXAA 3RAOA 3GUWA 4XUGA 5FACA 1O5KA 4O8RA 3NTYA 3WLIA 1VFSA 3W2LA 4PULA 3BANA 3R12A 3AOFA 3FXYA 3NGJA 3VOIA 1JDAA 3TDFA 1NFGA 2VOTA 4OVXA 5FSEC 2P1FA 3VDBA 3G3DA 5ABGA 2VTFA 4ECLA 2VZOA 4UNLA 4M1RA 1QASA 3AIVA 3D47A 5ENLA 3IGSA 2XIMA 2E09A 2F2HA 4PMDA 2BHZA 3RCMA 1E6QM 1KFJA 3ARZA 1D3GA 4CU8A 1WDSA 4M24A 4MG4A 1DE6A 4GJ1A 2PU1A 1CWYA 1F4HA 4O0KA 2VR2A 3APYA 1HJQA 2R1LA 4U33A 1EWEA 4DBEA 1V4YA 3KVMA 3CXOA 3CEUA 4LYQA 1J8VA 1KM2A 1XLHA 1M9HA 4NSBA 1TZ9A 4I90A 1FH9A 4AZBA 5CG0A 2PA6A 2E5BA 4GKTA 2VCCA 1B3OA 4ZQNA 3WJXA 5BU9A 5J5DA 1LT8A 5M5DA 3U48A 1GOWA 4MOZA 2PTXA 3IUHA 1ZBWA 1U5VA 3D46A 3DOPA 2ZKMX 5EY5A 2HNEA 4AQLA 4HD5A 1E6XM 2OX4A 1C29A 3BAKA 5F7UA 2YLAA 5AVNA 3QQ1A 1RVGA 2FJUB 3EWDA 5EFFA 4KIEA 1NFBA 2BOFX 1KWKA 4HU8A 3MZ2A 1DJWA 3IJLA 4Q8WA 3SR7A 3MY9A 3QKZA 4J3UA 3DH7A 7TIMA 3UG3A 2V30A 3EYPA 4L6DA 3CQHA 1IYXA 2D22A 4U3AA 2WNNA 3II1A 2FMOA 3CJPA 2TAAA 2PF8A 4GI4A 4HU0A 1CLXA 4HK7A 5HOSA 1FCBA 3LHZA 5IDZA 4NI8A 4QM1A 4GIEA 2OZ3A 1DKWA 5C2GA 3CL8A 3HF3A 2CZFA 3E2SA 1G7VA 1OC6A 4E8CA 3A4AA 4XWUA 4XO7A 4TX9A 1RA5A 3GDTA 4O4VA 3LPPA 5L6UA 1JFXA 3GNNA 4ENLA 3U6WA 4DJED 2ZTKA 3AROA 4MKSA 2C18A 5FJIA 2Y70A 1MO0A 1Q5MA 1A0CA 2Y61A 4Q22A 4F79A 4C6NA 1KA9F 5I3GA 1I60A 2XG9A 2QEZA 4DI9A 3O05A 4K6AA 1PE1A 2ZOXA 4XVDA 2RGLA 3NL5A 1E6PA 1EEPA 2QCHA 1UWSA 5M03A 3KCOA 4TXEA 1W9PA 1VBHA 1X7FA 3GFYA 4R7WA 4FIRA 3TE9A 1EA0A 3W53A 3VD4A 1FTXA 2P50A 2Z7GA 1RCOB 3U4AA 1O5RA 1SSGA 3DYMA 2F7FA 5I06A 4AZ6A 4Y96A 1PB0A 2VZTA 1TR9A 3WLHA 1NU5A 4NIRA 1NWUA 4ZOAA 5JBFA 4U5KA 2YFNA 3H22A 3W01A 2PCEA 4E2VA 4YXGA 2WVTA 2D3LA 1KFKA 2YFOA 3GUGA 4ZB5A