1NFRA

Rv2002 gene product from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAELADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVAGLAHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase Rv2002
publication title Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.53: 3-alpha(or 20-beta)-hydroxysteroid dehydrogenase.
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nfrA00
1ZNQO 3DBRA 3PZBA 3ZDFA 4J9UE 1D1SA 3ZWOA 1DRWA 1E3SA 4F46A 4IIUA 1TT5B 1UDAA 4II3A 4AJ2A 4HX5A 4D7AA 3QWIA 1HETA 2Q1SA 1YWGO 4E5MA 1RM0A 3IL2A 1MUUA 3NTQA 3GY0A 1KC1A 1LDEA 3GRPA 3PYMA 3KSDO 5DZSA 3WR5A 4BMSA 4E4YA 2D2IA 3N74A 3A9WA 1I10A 1YH3A 5BNTA 1V9LA 1ENZA 1E7MA 3TN7A 3Q11A 1RJWA 4KUEA 1ISFA 1UZLA 1NM5A 4NBWA 3S2IA 1VJ0A 3DXFA 3V8BA 1JA9A 2NU6A 4MVJI 2HRBA 3RC2A 2YW9A 3COSA 4UULA 4NBVA 3ZWWA 5FI5A 1QKIA 3C3XA 1CETA 2ZCVA 4XQEA 4ZGWA 4LSWA 2X0JA 3TFQA 2X5OA 1MB4A 3D4NA 4CMAA 4R9RA 5A3VA 4DIOA 2QRLA 2ZCUA 4MVJM 4HKTA 3T4XA 4NK4A 1MGOA 4CLHA 4IS3A 2WYWA 2OUIA 3DMTC 1IPEA 1VJTA 4UEOA 3W8DA 3KTDA 4KDEA 2YV1A 3D0OA 3DOJA 1ISMA 1IPFA 1YL7A 1GYQA 3PHLA 2HMSA 2G17A 1E3WA 3DBHB 2Q4BA 1PJSA 2P5UA 4Y6SA 1BMDA 4WLVA 5C37A 2G5CA 4PG6A 1C0LA 1PGNA 3ADOA 2EJVA 3KRTA 4HBGA 4R69A 4WCDA 4BO1A 4FB5A 4AG3A 4WLFA 3RBZA 5IDWA 3Q9NA 5TT0A 3RUIA 2WD8A 1BRMA 2W2KB 5JMPA 1I01A 3RUAA 1GAEO 4L4SA 4E5NA 1ENPA 1B8VA 3WBBA 3LVFO 5I7SA 3WX0A 4BO2A 5THQA 4M89A 4PLZA 3F1LA 1P1KA 3WNQA 1A4IA 3WXBA 5THKA 3GEGA 4A5OA 1XEAA 4NIMA 4TRRA 3PXXA 1ENOA 2WM3A 2NVWA 1DIGA 2VZ0A 4JP2A 1SOWA 2D1YA 4IDEA 3L9XA 1T2AA 4J2HA 4DC0A 1PZFA 3I1JA 1Y7TA 2BLLA 3OQ1A 3QWHA 4II2A 3Q2KA 3TL2A 4UUPA 1HDYA 1LI4A 3WTBA 4BMVA 1N8KA 3WQQA 1I2CA 2RCYA 3DO5A 3JCZA 4GL4A 1D3AA 3MCVA 1E1LA 4FN4A 5ER9A 3JQDA 1BDMA 3BTVA 1EK6A 4RF2A 4I5EA 4XYMA 4J3FA 3VH2A 2V6FA 2FMUA 1H9BA 4Q9NA 4EI2A 1CEQA 2J6IA 1J49A 5DBIA 3IKTA 3I9JA 2O23A 4CMHA 3KXDA 2AA3A 3PJDA 1KIFA 2QZZA 3AK4A 3BMQA 2EGHA 4CV2A 2IYOA 1MC4A 1GQQA 4M1QA 1GY8A 4ZRMA 1DSSG 1QLJA 4ALMA 1HXHA 1EE2A 3I9OA 4BB5A 5B1YA 4CLDA 3VTFA 3OJOA 1I8TA 1K6IA 2BFOA 2GCGA 3ZWMA 4GX1A 4TVOA 2Z95A 4AL4A 1F17A 2WYUA 1KETA 2EEZA 3MEQA 1K6JA 3WB9A 1HDXA 1ISGA 3MWEB 1LC0A 3GT0A 1UXKA 4U0JA 4U8GA 1NFRA 3C7AA 3JQ8B 4RVGA 2GERA 4ILKA 1MC5A 1NHWA 4RLHA 4XQCA 5ER6A 2UUPA 3OJ0A 5A9RA 2NQ8A 4LVCA 2EGGA 4WCFB 5I9LA 1GL3A 2Y68A 2Y99A 3P7MA 4Z3KA 8LDHA 1YS4A 2X6TA 1LX6A 3E8XA 3PIDA 4N54A 1BHSA 1DC4A 4ZHSA 3NKLA 2WD7B 2HO5A 3P2YA 4WLUA 4XYEA 4HUJA 2DFVA 1SCUA 4AVYA 2P91A 3EMKA 3GHYA 5IDXA 2GYYA 3K92A 4Z9YA 4M87A 2X5JO 2Y0EA 1KVSA 4CMEA 4WE3A 1MV8A 5A3JA 4FJ2A 4L9RA 1EZ4A 4OOFA 4IQ8A 3HFSA 4NI5A 5T5QA 5T64A 3PPIA 1CF2O 4Q3NA 1JAXA 4AFNA 1HL3A 2PH5A 3GNSA 1HYEA 4IDDA 2W90A 3OETA 3LT1A 2PWZA 2Q49A 4K6CA 3JQ6A 1GCUA 1ZSNA 2W8ZA 3ROPA 5C3MA 1LDNA 3E5RA 3OECA 3MJSA 5IN4A 3QHAA 3VZSA 1FDTA 1P45A 3G3EA 1Z6ZA 2GLXA 4OM8A 3ITKA 2X9NA 2C07A 3JQ7B 2GGSA 1ENYA 3ASUA 1VL0A 1E6EA 1NQOA 1Q1NA 1ZMTA 2P5YA 3B20A 1P44A 1WPQA 3FN4A 4JXKA 4KZPA 2R00A 3UCFA 3L77A 5G0VA 4DA9A 4EW6A 1TLTA 4MVJD 4FFPA 4PLCA 1YOVB 4QO8A 4OAQA 2NLOA 2B4QA 2DFDA 1IZ9A 1DXYA 1EVZA 3PYLA 1N9GA 2I3GA 2PV7A 3L0DA 4HNGA 4E6PA 2LDXA 1MLDA 4CPDA 1XWFA 2DT5A 2D0IA 4JP3A 4FDAA 4E2XA 4QEDA 4B7XA 3WSVA 2J3KA 2Q50A 1O9BA 4XRGA 4MIYA 1KVRA 4YYZA 3ADPA 2O7SA 1U7HA 1PJ2A 4PZDA 3A4VA 4UVDA 4CUZA 3H6KA 3N58A 4UVEA 2PR2A 3EDMA 3QJ5A 1JWAB 1R4NB 4U5QA 4DYDA 1FXSA 2O3TA 4R4JA 4CMIA 4QTZA 1PWZA 3OICA 1ISJA 2PD3A 1VL6A 2I66A 2XOXA 5DOZA 1GR0A 4MIEA 4BKRA 3JQBA 1OMOA 2W2KA 2Y1EA 4YBZA 5B12A 4A27A 1R0LA 4YVFA 4ZD6A 2FPPA 2AQKA 4ZU3A 5K6AA 4G2NA 1ZZEA 2ZQZA 4RPHA 1HWYA 4OIMA 1R4MB 1PGJA 1PGOA 1Y5RA 2ZJ1A 3RQSA 3TFOA 1QV6A 3JQAA 3UCEA 4ZQEA 2Q46A 3NEPX 4GBJA 4JBHA 1YKFA 4FC7A 3GUYA 3WGIA 3D7LA 3ULKA 1CWUA 1U8FO 3ZWNA 3ZHZA 3FNEA 3JQ9A 4CM4A 4R51A 3I9MA 3EVTA 3ZW8A 4S1VA 2J8ZA 1ZK2A 4NFYA 3R3SA 1CERA 1X14A 2JL1A 3PIIA 5DBGA 2HMVA 2B4RO 2NNLD 2G76A 2ZTUA 1EUDA 4QO7A 3DFUA 2VHVA 3F46A 3T7CA 2QG4A 3WQSB 5DULA 1AXEA 5F1KA 2Z5LA 3ZHBA 1R0SA 1R37A 3D5QA 4PRKA 1P74A 3ROMA 4B7CA 3GQVA 2W2LD 4W7IA 4XYGA 5A1TA 2V7PA 3FF4A 4I5GA 4E2ZA 3GFGA 4CR8A 5JDCA 4FFMA 4Y67A 3S8MA 1DDOA 4L4RA 4TSKA 1PWXA 4EYEA 3BYZA 4GKBA 4NBRA 2HLPA 1XA0A 3FBGA 3D1LA 3AI1A 4J4HA 4OXYA 4W7HA 2BF7A 2HMUA 1E7RA 3BZUA 4RPJA 4GMFA 3PI7A 4GVLA 2DTEA 1LLUA 1U5AA 2X58A 1GZ6A 2DPHA 3DWFA 2JCXA 4IDAA 3ZWXA 3FBTA 4EGFA 3DAFA 2O3QA 2DU8A 1NTOA 5BSEA 2BELA 2Y1OA 4YRAA 3JQCA 1T1RA 1LLQA 3MZ0A 3OIDA 4FBGA 5L4NA 3W4IA 4BNVA 4INAA 3QA9A 4N7RA 4GWGA 4LSMA 3ZWBA 4R1UA 5I9NA 1PJLA 2FR8A 1HE2A 4PLFA 5IF3A 1OBFO 5KVSA 1DC5A 2GO1A 2HKIA 2YFQA 3JQ8A 5G0WA 3GF4A 5G0UA 3GVHA 5F3RA 2OBNA 2CVZA 3NAQA 3RSHA 5U9CA 1UXHA 4MPDA 3ZHYA 4AJPA 4CM9A 4DPLA 3VH1A 2PK3A 2O48X 3JTMA 4WCFA 1X7DA 1SNYA 1E6WA 2I76A 5DNAA 4IY1A 2X23A 4CMJA 4BGVA 4NFHA 3TZHA 2PZJA 3HN2A 3OMLA 3E6AA 4J4TA 1LSSA 2YFHA 4OJNA 3L6DA 1BW9A 1RYEA 2RAFA 5ICMA 2JD0A 1XLTA 1EQ2A 1YXMA 1K5HA 3BTOA 2EKPA 3GUCA 4OL9A 3W6UA 3BA1A 5GZ1A 4H7PA 2CNBA 2PTGA 2Q2QA 5CG1A 1ZJYA 3AWDA 2D59A 1NP3A 4CUKA 3MJVA 1M76A 4WGGA 2C2YA 1W0CA 1N1EA 3LDHA 3LU1A 4RVFA 1VM6A 3T4EA 1C1DA 1ULUA 1V3TA 2QRKA 3WGOA 3ZN2A 4WLNA 2OHXA 1Y81A 2O3JA 2YDXA 3DZFA 3WGQA 1N5DA 4D0SA 1Q2XA 3TZQA 5COAA 4OKIA 1VSVA 1B3RA 1U2DA 4EITA 4B4OA 1SBYA 3DFZA 3IIEA 1ZCJA 5KVVA 1LLCA 3F9IA 1CQJA 1P1IA 2Q4EA 3A28A 3CE6A 4XCVA 1N7HA 2E82A 1NPDA 3H5AA 3INTA 3NDRA 4YAGA 3ON5A 3NDJA 3EHEA 1KVTA 2FRDA 1I2ZA 4GAEA 4HNHA 4HV4A 4KOAA 1EDOA 4OGWA 2GR9A 2DTXA 3GVXA 4IQGA 1QYWA 4Z6KA 2J5QA 1JAYA 3KLMX 1CRWG 1GFSA 4OHUA 5TLSA 2B0JA 1A4UA 3A1NA 4FC6A 3I23A 5AXBA 2CUKA 1F06A 3KEQA 2P2SA 2Y1GA 4FFOA 1WZIA 3JV7A 5KJ1A 1KERA 3VZQA 1X7GA 1I32A 1HDZA 4OXNA 3FPCA 1IUKA 2OL4A 3AM5A 3ZU3A 5LC1A 3HZZA 1E5QA 4QQRA 5I7FA 3LK7A 4DBZA 3GMSA 3UF0A 5TRTA 2Y05A 4P4GA 1D4FA 1PS9A 4XA8A 2WWRA 2FSSA 4XX0A 3WIEA 4ZQFA 1R4NA 4MO2A 1VI2A 3ANNA 3RJ5A 1YL5A 5F21A 1J5PA 1PU2A 2D5AA 7ADHA 1PSDA 5A9SB 2FOIA 4J0EA 3ONDA 4YA6A 3KYBA 4Y98A 2A35A 1NASA 4PFJA 2FPIA 3ZHXA 3ZV4A 1T2FA 2CSUA 5KIAA 3IKVA 1T25A 4I9NA 1LNQA 3QQPA 4FQ8A 4BQRA 2WJPA 4JJIA 3WQRA 3HDJA 1U9JA 4BNWA 4A10A 3R3JA 1QV7A 5DF1A 1NYTA 3O8QB 4JJFA 5C7IO 4GLOA 2HU2A 3I4CA 4J16A 3SC6A 4WPGA 3R1IA 5B4UA 3ST7A 3S2EA 1CDOA 3TZ6A 3I6QA 1FDWA 1PJ3A 3VPSA 1BGVA 4D46A 2POQX 3GRKA 2X4GA 5T67A 2HMWA 3CIFA 4IM7A 5HBRA 1Q7GA 3DZJA 4C7KA 3SC4A 2I6TA 2PGDA 5KJ6A 5A5FA 3WIDA 1HKUA 3K73O 4H15A 4ND1A 1LRLA 3UCXA 1V8BA 1DAOA 2F00A 3ANLA 1EMDA 1QXSA 4RDIA 3C1OA 1LBEA 4XJSA 4BKUA 3TF5A 2B5WA 4OH1A 2DBVO 1XHLA 4MJLA 3B1JA 5CDTA 3KYDA 1AXGA 3PZRA 4PLHA 2NM0A 4RV9A 3U49A 1S7CA 1UZNA 4E5YA 3K30A 1WZEA 3Q3CA 2AHRA 3DZKA 4R01A 4WK6A 3VPHA 3WLFA 1AN9A 1JKJA 1A27A 4YQYA 3OBBA 1HE3A 3KEOA 2VHYA 1F14A 1ZO8A 3VAZA 1B14A 3DBLA 1LXCA 4B8WA 1XQ1A 1GUFA 2NU8A 4ND4A 3H9GA 3O4RA 5FI3A 2GZ3A 2E49A 2AXQA 5GMOA 4H16A 5L7YA 4DTIA 1YJQA 3RFVA 2BGLA 2VT2A 4DREA 2CF5A 4H3VA 2IEDA 4BMNA 1ONNA 4TZTA 3AFNA 4J7XA 2OXIA 4MKRA 1OZAA 2FZWA 5AXCA 3VC7A 1N1GA 3FI9A 1WDLA 3EUWA 1HZZA 3PHGA 1AE1A 3L4BC 3RROA 4GSLA 4XIJA 5C7LO 6ADHA 2FHSA 3F5QA 3GDFA 4N5MA 1X0VA 1U3VA 4HFRA 3RASA 4AJKA 4PRLA 2V6BA 2QIOA 3LF1A 1H94A 3NTOA 4B79A 5GZ3A 1QMGA 3G1TA 2VHWA 3RFXA 2Q3EA 1Q7BA 5IDYA 3CXRA 3WSWA 2A9FA 2XPCA 5IJZA 5JO0A 3HJAA 4TVBA 4WCFC 2OORA 4IZIA 3D3WB 3V2GA 4BV8A 3ZNNA 3UUWA 2FSVA 1DC6A 1ULSA 1WLYA 1EBFA 1RKXA 2XAAA 3H2ZA 4J9VA 1QYCA 1SPXA 3I4FA 1RPNA 4XD2A 1B8PA 3G1UA 4PLWA 3PDUA 1ONOA 4NMHA 4MINA 3LT0A 2UYYA 3H3FA 4Q3EA 1KEUA 2Y0CA 2O4CA 4PVCA 3P19A 1B7GO 3TZCA 1GCOA 4YT8A 1P3DA 1SB8A 4E13A 1TVEA 1U4SA 1Z7BA 3U0BA 4A26A 3TNLA 3PLNA 4K26A 1BXGB 4FJ0A 1Q7CA 3DZGA 3TOXA 3E9QA 1RM5A 4ALNA 3AU8A 1SO8A 4CM6A 4YT2A 5CPFA 3VVCA 1NXQA 5KKAA 3KO8A 4A7PA 3PWSA 4FGSA 1CYDA 2BFMA 1OAAA 1U28A 1KEVA 1KVQA 3BMNB 3S1LA 5EN4A 3W8FA 4EUHA 2GDZA 2IYPA 4DPKA 4IMPA 4YEDA 1T4BA 3IMFA 4RPKA 2QHXA 1H0KA 3QWAA 4Y6PA 3GHHA 5HTOA 3W6ZA 2O2YA 2O2SA 2ZATA 1HDCA 3AM4A 3AOGA 4W9NC 3CSDA 4XIYA 3AUSA 4Z0TA 2E37A 3PP8A 5H82A 3DB2A 5LCXA 2DM6A 4FFRA 4D42A 5JC1A 3SLGA 1EFLA 4XZ3A 1XSEA 2I99A 5JDIC 1BVRA 4UUMA 4RZIA 4BNMA 3E9NA 3WGTA 5L7WA 1NHGA 3VPXA 1PIWA 1W73A 4BGIA 3JQGB 1GEGA 2VZ9A 1YO6A 3U62A 3DDNA 1LC3A 1ZSVA 3H5RA 3SEFA 3ZNQA 4BV9A 1ZK3A 1B8UA 1P0FA 1LDMA 1GPDG 3WWZA 3DEYX 4B4WA 1WMAA 1PJTA 1LQUA 1T1SA 4LMPA 1PX0A 2BHLA 3I5MA 4U6QA 3ETDA 3UW3A 4NQZA 4FD3A 5A9SA 2HRZA 4CUJA 2VWGA 1BDBA 3WJAA 4LRSB 5IFLA 3FTPA 5L3ZA 3KYCB 2EW8A 3Q9UA 3VHRA 5G4KB 3V1TC 1Y8RA 3EAGA 1E6UA 2O3SA 1Z73A 4RGBA 3TWOA 5C7OO 3CMMA 5EL0A 4J7CA 3O8QA 3DTTA 2Y1DA 4I1IA 1T24A 1I2BA 4GX5A 2C20A 4N18A 3C1AA 5TC4A 1C0PA 1VC2A 1PTJA 4J90A 2HDHA 4FOOA 1DFGA 3DQPA 4CM8B 2UVDA 4R1TA 4WLOA 3QE3A 4L0QA 3IJPA 3W1VA 4NH4A 4RVHA 3H9JA 2X0IA 4UEJA 3QWBA 1W4ZA 2GUGA 3FTNA 4BNNA 3RVDA 4B7UA 2EJWA 3DMYA 4NU6A 4DPMA 5A9TA 4P38A 1ADGA 1J0XO 3C1TA 4HY3A 4W82A 4BNLA 2YHUA 3DTYA 4WLEA 3K2BA 3DZIA 4BQPA 2AE2A 5ILGA 1WDKA 4WECA 5EESA 2ZK7A 2VHZA 3BMOB 3V2HA 5JLAA 4ZVVA 3FCOA 4FOSA 1MG5A 3RC9A 3UGKA 1E1NA 4KWIA 3ICPA 4ITUA 2NU7A 1PZHA 2PH3A 4IQ0A 5I7VA 4GX0A 1UXGA 3D4OA 2D8AA 4RF4A 1PR9A 1M66A 1VSUA 2QYSA 3HQ4O 5JCJA 4M8SA 3OQ6A 2BRUA 1AGNA 1L7EA 1Z75A 2IE0A 4I9HA 2P4QA 1I0ZA 2CVQA 3H9QA 2C5AA 5DCYA 1P1HA 4OKNA 3GMDA 1B3BA 3NV9A 1LA2A 2VT3A 4ZRNA 3NT2A 1WXDA 1AHHA 3AOEC 2QYTA 4YAJA 3HSKA 3RKUA 2HAEA 1E3JA 4J91A 2IXAA 4IJKA 3JYQA 1PL8A 2GZ1A 3NTRA 4J43A 4R3WA 2PKQP 4DBVO 5TNXA 1HSZA 5JBIA 1DIAA 2P9EA 3ANMA 1J6UA 3WYCA 1ZUD1 3A06A 4OOEA 1ZK0A 4RO0A 1VKOA 3RUDA 3PLRA 3OP4A 2OP1A 3D3WA 4IIVA 3QIVA 5JY6A 1DOHA 3V5NA 1KY5A 2CVOA 2GN4A 4R68A 4YJHB 4Q39A 2VYND 1Y6JA 5A5EA 1D7OA 5DOVA 4Z0HO 1U7TA 2VOEA 3MWDB 3KBOA 4I08A 1EE9A 3NYWA 4AJEA 3IP3A 1TT5A 1UDCA 5KCZA 5A03A 3DZBA 3FR8A 3UVEA 1ZKMA 1CQIA 4DQVA 1NQTA 1X13A 3PDJA 4O63O 4YPOA 2QZ9A 2WTBA 1ISHA 3U4DA 2H63A 1V0JA 4KMSA 1HDGO 1LU9A 2H6EA 4YJFB 3IUSA 1ZEJA 1DC3A 1IOLA 5B4VA 1XU9A 1I33A 2OGUA 4DL9A 2Q2WA 3GLQA 4D3DA 3PJEA 3AY6A 1QG6A 1MP0A 5FEUA 4BB6A 1E0DA 3T7EA 2EV9A 2NWQA 1ZK1A 1G1AA 1GADO 4TMFA 4MKXA 2P68A 3JD1A 3C7DB 5B4TA 4NJMB 4PZEA 4N5NA 5L9AA 2Q1WA 4BNZA 1ARZA 2X86A 4GVXA 2YHIB 2RH8A 5FF9A 2V6GA 2NVUB 5AQ1A 3GAFA 4BHTA 1UP7A 4EUEA 3RUEA 2JHFA 4YB8A 3PK0A 3BHMA 1UH5A 3GA0A 2E48A 5EPOA 2A94A 2Y1CA 3UICA 1FDVA 5BSHA 2BFAA 4L4XA 1HE5A 4OO3A 4NHEA 4TRJA 1O0SA 1H6DA 3DBHA 1HRDA 4JJGA 4DQXA 4IINA 1E3EA 1KOLA 3HB4X 1WMBA 5EERA 4FR5A 4NU5A 4XQ9A 4CMGA 1NWCA 3KETA 3D4PA 2BI8A 4Q3CA 4CQLB 1E7QA 3F6YA 4YJGB 1ZEMA 4R16A 4X54A 2ZJ0A 4TQGA 4PG7A 3ABIA 3AI3A 4MKZA 3ETGA 2FY8A 2NTJA 4Y8VA 1DIHA 4YDRA 3RBVA 1PJQA 2J5KA 3DONA 2DQ4A 4RVSA 1M67A 2JD1A 2B5VA 1EDZA 3CMCO 3WFJA 3HUDA 1Y5MA 3OEYA 3E03A 4IUYA 3GK3A 4E0BA 1U3UA 1HTBA 3VTZA 1A72A 4R9SA 1YJ8A 2WDZA 1PL6A 2ZB3A 4RORA 4XGIA 3OIGA 3AU9A 1DB3A 1A7KA 1ID1A 3RI3A 3OJEA 4LK3A 3I52A 3GVIA 1JLLA 2ZYGA 4A73A 4BS9A 4ZICA 1XDWA 4AJ1A 1ADFA 4JCOA 5BNFA 3FNFA 2ZB7A 5ITVA 4CLOB 1PQUA 1MFPA 2WE8A 3BAZA 5BSFA 5ICSA 4J2OA 5KVQA 4IDBA 3RU9A 4Q3DA 1YQGA 1WP4A 1ZXLA 3ZWCA 3QRWA 2AMFA 2VNAA 5DCUA 3BMOA 3P5SA 1DIRA 4DIFA 3MJCA 4J1SA 5BNIA 1DLIA 3KVOA 3JD4A 2EXXA 1UP6A 3K6JA 3F4BA 3VDRA 3SXPA 3MJEA 1LSUA 1LUAA 5DP2A 1D1TA 3NJ8A 1X0XA 1I36A 2IODA 3CKYA 1M6WA 3K96A 5JYEA 4D43A 3GEMA 2C2XA 4CMCA 1ZSYA 5FFFA 4ALLA 4F3YA 4K9DA 1WDMA 2H9IA 3AM3A 3ITDA 5COQA 4GSKA 4LN1A 3L4BA 2G1UA 4YRBA 1QSGA 1E1KA 4UVGA 3G17A 4MP3A 2UUOA 3U3XA 1Z82A 1LLDA 2X0NA 5DP1A 1SOVA 1GYPA 5KWEA 1D8AA 4FGWA 1NR7A 1K3TA 5I8WA 1LSOA 5EQFA 2H1SA 2C7VA 3F4LA 2J3JA 2EG9A 3OJLA 2X9GA 4IXTA 4DLLA 2DC1A 4P22A 4CLRB 1OC2A 2VTDA 4HFMA 4U0KA 1Q0HA 3PFFA 1GV1A 1H2HA 1YBVA 3DOOA 1CIVA 2WD7A 3AY3A 5DT9A 1J4AA 4J49A 4CM1A 2B83A 1JN0A 4YJHA 3E18A 1ML3A 5U1PA 4BNFA 3WNVA 1NQ5A 1EUZA 3PHHA 1O6ZA 3B1FA 1T2EA 3LC7O 4LGVA 1A71A 1U2GA 4EJ0A 3AY7A 4D3SA 2IZ0A 1XU7A 1BVUA 5I8ZA 1B15A 4MVJH 2PGLA 3WWYA 4B8ZA 3ZWAA 5TT1A 4L73A 4K6FA 3HFGA 4PLVA 2CD9A 3M6IA 4ND5A 2TMGA 4D44A 1NWHA 1ZFNA 4CLEA 5JFOA 5T6BA 3OA0A 3EZLA 1QORA 2BKAA 3MOGA 3NJ4A 3IDSA 1P1JA 5TJ9A 3FRJA 3X2FA 4CM7A 2B4TO 3BIOA 4JLWA 1P1RA 3JQ7A 5COBA 3E48A 4IDGA 2IEBA 2DBQA 5EJ2A 4W9NA 2XXBA 4BNIA 3JYLA 4OSPA 4LRTB 4EEXA 1YOVA 4JX8A 5EINA 2HK9A 5F1OA 3RC1A 4NJMA 3O38A 4YAIA 2X5KO 5JDIA 1R6DA 3CZMA 2YHIA 3W4KA 4GGPA 2FP4A 1LTHR 2Y1FA 5T57A 1W8DA 1Y1PA 2P4HX 1PS0A 3L6EA 5G0SA 4XB2A 2VTEA 3AFMA 6LDHA 4BOYA 2HCTA 3PQEA 1PJ4A 3U5TA 2Q1TA 2OBYA 4GMGA 2OOSA 4D0RA 2RIRA 3PWZA 3I9NA 1A9YA 3F3SA 3L4SO 1ZMOA 1LSJA 3JYOA 2VOJA 3I9KA 1FDSA 3RBXA 2Y67A 4IMRA 1DLJA 4AJHA 1FK8A 2YZ7A 4YTEA 2V6MA 2Z1NA 5JPIA 4YJGA 2ZIZA 3GC6A 3UFXA 1O89A 4BO3A 2VYNA 4HFJA 2AEFA 2HQ1A 1C0KA 1E3WB 2JHGA 1XKQA 5H81A 3NUGA 5CEJA 1I3MA 3DHNA 4Q3BA 3RU7A 3ZU4A 1NQAO 1R4MA 1GZ3A 3I83A 4JGBA 3KOUA 5L40A 4QECA 4BIIA 3NGLA 3NX4A 4E32A 1R12A 2DBZA 4DYVA 5IG2A 2NSDA 4R3NA 2FN7A 1LQTA 4NNJA 3CPSA 3WYBA 2JFHA 1EK5A 3BTUA 2BFPA 3B6ZA 4ZA2A 1GYRA 1V6AA 2PKRA 4R1NA 3ZI0A 3M1AA 4R5HA 3W8EA 4Z0PA 4KWHA 4A2CA 2UAGA 4CM3A 3KLPX 5DDIP 2B69A 4CLOA 3VOSA 5TGDA 2RH4A 1HF3A 1HLDA 1JW9B 2AW5A 4RPLA 1B2LA 4N5LA 2R6JA 3DR3A 3VZPA 2VUTA 3ZWYA 2IZZA 4YQZA 3FWZA 4MVJA 2I67A 3ROKA 1SMKA 4C7JA 4DVJA 1OI7A 2D4AA 3U4CA 4E30A 1N7GA 4B4UA 2VYVD 1GTMA 5JAZA 3AI2A 2AQHA 1IHXA 1X1TA 3QY9A 1HYHA 4I5FA 4MVJE 4W6ZA 4TKLA 4YRDA 1YVEI 1X15A 3I6IA 3ASVA 4Y9DA 4XGNA 4MVJP 3LF2A 5JNLA 3QVWA 1NFQA 4UAGA 4EEZA 2JCYA 1FMCA 2YV2A 4P8RA 1RM4A 5ADHA 4OMUA 4QX6A 3ICCA 4LISA 3ONFA 4CJXA 3AOEA 5J23A 1QP8A 3CINA 1A7AA 2W98A 3GDGA 3IAHA 4E21A 2IZ1A 2QX7A 2AG8A 1UDBA 1NVTA 3FD8A 4MIOA 4TZKA 3RC7A 3TRIA 2CDBA 1BWSA 4XRRA 1OOEA 4CQMD 3GNQA 3L07A 2JCVA 1O5IA 4J1TA 1DJQA 3AUUA 5A4DA 1L1FA 1H6CA 4EBFA 4EDFA 2Q1UA 3C85A 4NZ9A 4TKMA 1MG0A 4CLRA 1H2BA 1ONPA 2HK7A 1Q0QA 2B36A 2PD4A 2VRCD 3RCBA 4RVDA 3QV1A 2Q2VA 2G0TA 3QVXA 4HFNA 4L76A 4R1SA 3STHA 1KC3A 4B3IA 1NVMB 1YL6A 2A92A 3UHAA 3HG7A 3JSAA 4O5OA 3TJRA 4NJOA 3SX2A 5F1PA 4FPXA 4PCVA 3DHYA 3H65A 3A14A 1C1XB 1UR5A 1NBOA 4JN6B 3INRA 4DC1A 1NAIA 2O50A 2PD6A 2R2GA 4R54A 4AJ4A 4M54A 4B4VA 4ND3A 1VL8A 1S6YA 4ZN6A 2O4UX 4NK5A 3KHUA 1FDUA 3S55A 2JAPA 1YGYA 2NQTA 3WGGA 5L51A 4YAKA 2W2LA 1UXIA 3PJFA 5G2OA 3V1UA 3FWNA 3E1KA 3CZRA 3ZU2A 3JQFC 2VN8A 3H2SA 3G49A 1GQYA 4PG4A 2JAHA 3NRCA 1PJBA 2C82A 3AUTA 3K31A 2BGMA 3OHSX 5IZCC 3R6DA 3JQAD 3TOZA 3WFIA 4PVDA 1W6UA 3QWFA 4R5MA 5HS4A 2WSBA 2ZTVA 5IAAA 4KQXA 2GD1O 1Q0LA 3Q6IA 4HWKA 3JD0A 4G81A 4OSOA 4WOJA 4XDZA 1PQWA 1XELA 3LLSA 2JFGA 1XGKA 5JS6A 2EP7A 3PVZA 4NPCA 2EKQA 4AJLA 4IZHA 1KEWA 2I9PA 1UAGA 5CP8A 1AHIA 4RZHA 1HSOA 3RKRA 3K9QO 3EC7A 2VHXA 2QRJA 1EBUA 1JQBA 2HMTA 1EFKA 2OFPA 1H6BA 1T4DA 3U9LA 4XWYA 1R16A 5FYDA 4YT4A 1Y9EA 2CZCA 3DC2A 1M75A 4BNUA 4BKOA 1KBZA 3MJTA 1UXJA 4CQMB 2Y93A 1NX6A 5A06A 2DBRA 4MP8A 4UUOA 3FHLA 3Q1LA 2X9VA 5CEEA 9LDBA 2WEKA 1N9GB 1G0NA 3K8ZA 3RUHA 2UDPA 1I3KA 4BL5A 3QVSA 4OQYA 3CTMA 1FJHA 1VKNA 1NR1A 1HYGA 1XG5A 2FR1A 3WMXA 4E31A 4BO6A 1ZJZA 2GN6A 4DXHA 4D41A 2ZKLA 2ILTA 2VQ3A 4CLXA 4XJTA 4RQUA 4O1MA 3JD2A 1B0AA 3VH4A 3M2PA 4IGEA 1MX3A 4J1QA 4QT0A 4BNKA 4TRMA 3RUCA 4J6FA 3ZH2A 3TDKA 3M1LA 1X7HA 1Z45A 1P33A 4CMIB 2X22A 1GPJA 4J7UA 2PKQO 1IHYA 4RPGA 2C54A 3QVOA 3KB6A 1YBAA 2DLDA 3TPCA 4PGFA 4DLAA 3ZZNA 4L8VA 2W4QA 4CM9D 2Z1MA 1QR6A 4M49A 1IB6A 1OFGA 2DVMA 3AUAA 2DUUA 4BNXA 4RF5A 2JJYA 3N7UA 2AQIA 2OP0A 3O26A 2X1HA 2YJZA 3L6OO 1U8XX 5ILOA 5I9MA 3JQAB 4Y6RA 4ZQBA 1C14A 2C29D 1WNTA 3LT4A 4ZJUA 1DAPA 1DO8A 1L7DA 4F6LA 1YQDA 5JO9A 2BD0A 4CM4B 4DIBA 4XYLA 2GNAA 3EW7A 1H9AA 3WG9A 2I65A 4CV1A 3GPIA 5IXSA 1DRUA 5IXYA 4IDFA 3IJRA 2RBEA 4RJTA 4C4OA 4BUCA 4PLGA 2OZPA 4BKQA 3L9WA 3R0IA 4NR0A 5ITWA 5JE8A 3PFWO 4HP8A 3RIHA 5CAEA 3KM0A 5KJEA 1XYGA 2BMAA 1GU7A 1TEHA 1U3WA 3IQDB 4HXYA 3ETEA 3RJ9A 2BH9A 4CR7A 5CG2A 3ZU5A 1JWBB 3MTGA 2JKVA 1RWBA 9LDTA 4PLYA 4YWJA 2P9CA 2SCUA 1MA0A 3F1KA 5JYDA 2DUWA 4PIVA 1HT0A 1R0KA 1ZK4A 4UVIA 2EW2A 5CDSA 1PS8A 5HWSA 4CR6A 2J5RA 5A04A 5ES3A 1O94A 4B3HA 1JKIA 2RHCA 5A02A 3PTZA 1O95A 1KS9A 1M2WA 2NTNA 2WYVA 5CDYA 1BXZA 3GGGA 4FIZA 4NBUA 4TWRA 3ZNPA 4XDYA 2GZ2A 3LQFA 1E3IA 4GI2A 1O8CA 1PGPA 4A03A 1P9LA 2NUAA 5BQFA 3VZRA 3MJ4A 1JDJA 1XCBA 4E5KA 2WMDA 5H83A 3VKVA 2PZLA 4I8XA 2VNSA 1ZW1A 3NT4A 1VPDA 4MOWA 3K5PA 3E9MA 2NU9A 2FR0A 5TX7A 3GAZA 3IOYA 1LRKA 4GQAA 3UKOA 5IZ4A 1SAYA 2OO5A 3ORFA 2WE7A 2VWQA 4FJ1A 1GZ4A 1F8FA 1PGQA 3EZYA 1C1XA 3PRJA 1YDWA 4WNIA 5CHEA 1WVGA 1HDOA 2BI7A 3ENNA 1PQPA 2YV3A 3LLVA 5EMHA 2CFCA 3JYPA 3GEDA 3WTCA 3WICA 4U7WA 2GASA 1BW9B 3GG2A 2VUUA 4Q3AA 3I9LA 1T2CA 3U4HA 4E12A 2PLAA 3SJ7A 4JBGA 3GZNB 4BO5A 4BO4A 4CODB 4QUKA 5IN5A 5TF4A 3ZCXA 4R41A 1BXGA 4WNCA 2GN9A 4RQTA 1E77A 3FSRA 4FFLA 4JNKA 5B37A 4YJDA 2EP5A 1XR3A 4JBIA 5AXDA 4E3ZA 5BSGA 3ZNOA 3PQDA 1EVYA 3P2OA 4WOKA 2VYVA 3OH8A 3B1KA 5C5IA 2I3AA 3BMNA 2GSDA 1C1DB 3PJGA 2Q45A 3UXYA 3CUKA 3OQBA 4CM5A 1E5LA 3WOHA 2O3RA 2HUNA 3CEAA 3GNTA 1E7YA 2ZTMA 4CL8A 1JVBA 1F8GA 1TT7A 3QSGA 3H4VA 5AXAA 1PR3A 3E82A 3GG9A 2I5PO 4PLTA 1LJ8A 4YXFA 1SB9A 1M6HA 1ADCA 2EHDA 3U4IA 5JAQA 3RUFA 1E1MA 1GD1O 1H5QA 3F47A 3OSUA 3PHJA 4P4NA 2IDZA 4W4TA 5AOVA 3WS7A 4M86A 3O9ZA 3G79A 3JQGA 4FCCA 5G4LA 2PZKA 4CQMA 2C0CA 1GQ2A 3UOGA 1AUPA 3GZ4A 3WMWA 1QYVA 4ZQHA 3GVCA 3VKUA 1RM3A 2FZEA 3JD3A 4DWVA 5L53A 1I3LA 4LCEA 1T2DA 2IRWA 1HEUA 2X0RA 4MVJG 3HNPA 4UUNA 3ZV6A 5JSFA 1PJCA 4Z9XA 5A05A 3HDQA 4BNTA 2VRCA 3LZ6A 1YB1A 2J3IA 5KKCA 3UN1A 5K9ZA 3BMCB 4J1NA 4RDHA 1WAMA 3TL3A 3KYCA 3WLEA 3W4JA 1QYDA 3HADA 4WUVA 5G4KA 3H5NA 3HDHA 4IS2A 4OXKA 1IYZA 2NACA 3SVTA 1X1EA 1SEPA 2B35A 3LC2O 2J3HA 2C5EA 1GV0A 2XXJA 2LDBA 2D3TA 3OA2A 1JVSA 4MVJF 1PL7A 3OFSA 1RYDA 1NPTO 2H5LA 1E92A 4DRYA 4I5DA 3X2EA 3GGPA 4UVHA 5L4LA 4UREA 2E6UX 1BG6A 4YCAA 2GRAA 3B70A 4CM8A 5KJFA 4IGFA 1LDYA 1HZJA 1UJMA 1B26A 2ZYAA 1YQXA 4KTVE 3ZW9A 5KJCA 4G65A 5CFZA 4F45A 3VDQA 4YACA 7MDHA 1EQUA 3QP9A 3RFTA 2VWPA 2Q99A 3RAJA 4ROSA 4Z9FA 4Z3DA 4ALIA 5TSDA 5AYVA 2G82A 1GEEA 4XR9A 4URFA 3WDSA 3IC5A 3EVNA 1BXKA 5JXWA 4L75A 1V35A 4QXMA 5K0ZA 1Z7EA 3S2GA 1PEDA 5ENDA 3V1YA 3GR6A 1DHRA 2YQ5A 2CDAA 4IPTA 4NFSA 4NG5A 1LEHA 1LDGA 4JROA 3CH6A 4XKJA 3NT5A 3INGA 4TROA 4E33A 5JAMA 2GN8A 4D3FA 4U6SA 1XQ6A 5F5NA 3DL2A 1NPYA 3VPFA 4NBTA 1IL0A 4K28A 2F1KA 1I5RA 1N92A 2EWMA 4E5PA 2GPTA 3ZWVA 2ZB8A 1P0CA 1ZXBA 3FNGA 3KYDB 4I9UA 1YB4A 1GUYA 1HDRA 3FPLA 4IJWA 3F5SA 1KY4A 4UEKA 5DCWA 1YBMA 3KZVA 3NDIA 3FR7A 1P77A 1FF9A 1H6AA 3PQFA 4XR4A 4M55A 2HJSA 1QLHA 4BO0A 5G0TA 1KYQA 1U4OA 3DBLB 2ZTLA 3EGOA 1E3LA 1F0YA 2XF8A 2AEMA 3O03A 3H3JA 4XGKA 1V3UA 2VRBA 4FS3A 4AJNA 1HLPA 2Y66A 5L95A 3HDYA 3OF2A 3ZWPA 3AJRA 1EEHA 2JFFA 3E5MA 4BO9A 4KUGA 1C3VA 1PZGA 5GZ6A 1Z74A 3OIFA 4CMBA 3HHPA 4EJMA 5IDQA 4YAEA 1OC4A 4RL6A 2IXBA 3QVTA 2YQ4A 2Y0DA 5KOIA 3D3EA 1JKFA 1G0OA 3KSUA 5CPBA 1H93A 4IJUA 2D5CA 3C24A 4D79A 5T8KA 5DN9A 1YDEA 2VCYA 3DZHA 3QLJA 1LRJA 3PGJA 3DOCA 1NNUA 1Y8QB 1N2SA 4OQZA 1NAHA 5DBFA 3LSYA 1ZVMA 4W99A 5F5LA 5BR7A 3NGXA 4CL3A 5KTKA 3JQFA 1CJCA 1SC6A 4PG5A 4PZCA 3JYNA 1SEVA 4O59O 5IZCA 5AVOA 4CV3A 3WYEA 4YJFA 5U4QA 3C8MA 4RVUA 4EZBA 3GZNA 2ZQYA 3JQEA 4FFNA 4J0FA 5LDHA 1KEPA 3RWBA 1PZEA 2QW8A 3DBRB 1YE3A 3GN1A 1TB4A 1I24A 3K2EA 1EVJA 3VH3A 5L45A 4ALJA 3D64A 2RHRA 1UAYA 3HB5X 3UAGA 2ZYDA 5KVCA 4XEHA 2JD2A 4WJZA 4CMEC 3GFBA 5CEFA 4WEOA 1MFZA 4KQWA 1IULA 3PWKA 1DFIA 1YONA 4BNJA 1JTVA 2AE1A 5CDGA 3ONEA 2QQ5A 5EQDA 4JK3A 5JMWA 2A4KA 2AEJA 2HK8A 4IDCA 4BNHA 4AICA 4L74A 3KSZO 1DRVA 8ADHA 1LDBA 1QYXA 3G0OA 4WKGA 4PLPA 4XB1A 2B37A 2NVUA 2X8LA 3BXXA 4AJOA 2DTDA 1KVUA 1VE9A 2HJRA 5MDHA 4E2YA 4ONEA 1I3NA 2E4AA 3SJUA 4B3JA 1G6KA 4CV0A 2TMDA 2X7HA 2O3UA 2NTVA 4KUHA 5HS6A 5L7TA 3GH3A 4WASA 4RF3A 4BGEA 1A5ZA 4XQGA 2CDCA 4IJVA 5JCXA 1VJ1A 2R00C 3DMTA 3PHIA 2PA3A 1I30A 2YUTA 4BKPA 5I7EA 3ENKA 4D45A 1U5CA 1U1IA 2C7GA 1A9ZA 5L4SA 2PFGA 4RLSA 4FSHA 4CQLA 3VPGA 2EIHA 3BMCA 5GY7A 1DEHA 5JCJD 2CF6A 1IE3A 1E7SA 1XIVA 1NVGA 2ZB4A 4DQUA 5MGBA 4GKVA 4AJIA 3GN2A 1P31A 1ZIDA 3H7AA 4RCVA 4EUFA 2GF2A 4DUPA 1K2WA 3S2FA 1E7WA 1IZ0A 3I3OA 3MOIA 1TXGA 5TQVA 3LT2A 1DHTA 2PNFA 3EK2A 4IBOA 5EIOA 5JW6A 3AW9A 3BHIA 5LDGA 3Q2IA 2PGJA 3WGHA 2CY0A 2DAPA 1Y8RB 4BO8A 3JQBC 2EERA 4DGSA 3BHJA 5CDUA 4DMLA 1WW8A 4TRNA 1K0UA 3TQHA 2VZ8A 3UH1A 4F6CA 2VWHA 1VLLA 5K6AC 3GPDG 3DBVO 5HA5A 1NFFA 3U09A 3GDOA 1UUFA 2YYYA 4GH5A 3WJ7A 4P4LA 1P1FA 4KTTE 2UV8A 5KNLA 5JC8A 4BVAA 4ZQGA 1BTOA 1GUZA 1MXHA 1YB5A 2DPGA 4GWKA 1DBVO 4JIGA 3JQ9C 4KP7A 1QRRA 4FW8A 2C59A 3PEFA 4LVUA 5TS3A 3WGYA 1ORRA 1UP4A 1ZH8A 4GGOA 4JQCA 3SBOA 4BNYA 1K6XA 2DKNA 3EYWA 3MTJA 4OYRA 5JY1A 1Y9AA 1B16A 2OMEA 4DLBA 2V65A 4GLLA 3GOHA 1DIBA 4AJJA 3ROQA 4PG8A 4MDHA 4EJ6A 2O7QA 4IXWA 2NVBA 1U3TA 4ESOA 3HWRA 2P9GA 1TA4A 1DJNA 2YY7A 4KDFA 4ND2A 2HSDA 3ZV3A 2FPGA 3WBFA 4BNGA 3IS3A 1R15A 3RD5A 3C7CB 4K1LA 3BMQB 5JDCC 5TJHA 4A0SA 1ZBQA 5FWNA 5ENVA 3QW2A 1TI7A 4WEQA 4LCJA 1EVIA 2NV6A 3DHEA 2AQ8A 2NADA 4CMKA 3LYLA 1ADBA 4QFCA 1IY8A 3D5TA 3VVBA 4BO7A 3M2TA 1F12A 4LMRA 1V3VA 3EY4A 4MP6A 3WGZA 5BT9A 1YRLA 3H9EO 4S3MA 4O6VA 1SZJG 4BGUA 4XYBA 3PGXA 4G5HA 1BSVA 1WWKA 3GVPA 4QSMA 1DFHA 3KUXA 3GGOA 2FWMX 3LC1O 2PY6A 3OM9A 1EUCA 3OEWA 5TIIA 4ALKA 1JU9A 3TSCA 3DAGA 3IUPA 1MXFA 3BTSA 2EF1A 3H8VA 1DPGA 1ISIA 1K89A 3TZKA 2YDYA 3ZGYA 3HN7A 3KV3O 3OJFA 1HE4A 2VUSA 3FNHA 3Q0EA 4GPD1 5HM8A 5JAIA 3H9UA 2CMDA 1R66A 1C0IA 4E2WA 2EKLA 4NDNE 4YR9A 4LW8A 4O0LA 3ZV5A 2PZMA 1Y8QA 2ET6A 3DAPA 3PYXA 5T8KC 2BGKA 5HRUA 4J4BA 1T26A 1UZMA 4QFDA 4PN3A 3IP1A 1GDHA 2AG5A 4GX2A 4HADA 4ID9A 4YT5A 1VRWA 3HE3A 3SLKA 4DMMA 3V2UA
chains in the Genus database with same CATH superfamily
1ZNQO 4DV6B 3SIWA 3E61A 4R0NA 4XASA 5ALNA 5CFRA 3ZWOA 1DRWA 1MAHA 1ZQ9A 2Q3HA 4IIUA 3CR7A 3E8MA 1TT5B 2J7PD 1UDAA 4GM1A 4GW3A 1EFHA 2WTUA 5HGJA 3Q85A 1CQIB 3RQIA 3AP2A 1GGVA 1RDFA 3QWIA 3JAKA 4QPDA 1BGXT 2JDIA 1HETA 2JK0A 5ERGB 5F3DA 5I9TA 3ETNA 1Z4OA 3K09C 3KJXA 4FYPA 5C4GB 1DZ3A 1KJQA 3SK0A 4HGNA 2EQAA 2G5TA 5BO5A 3VNBA 2BSAA 3GY0A 1XZAA 5IS2A 3KQSA 1LDEA 2OYCA 2CV2A 4W5JA 3MG9A 4ODIA 3U3RA 1DU4A 5B30A 1JDBB 1BMFD 3A9WA 1KH1A 2Z1DA 3C1UA 1V9LA 3R77A 4G0NA 5FFMA 3ZIUA 3I9V6 1RJWA 3PNOA 4KUEA 1UZLA 4O4JA 5KMGA 1KZGB 1QM5A 3OU6A 4NBWA 4NICA 1R64A 2H11A 3ENWA 5IM5A 3P2MA 1R3DA 1JA9A 2NU6A 3FDFA 3QPBA 4P9NA 1KRWA 3RC2A 2R79A 4TSFA 2YW9A 4EG1A 4ZU6X 3EHDA 1VCOA 3QBEA 2HBYA 2FOXA 5AW3A 3G2OA 1XCPA 2W8BA 5CHYA 1N36B 4I1PA 3H11A 4N3AA 3PDHA 1YKSA 1XRNA 3CZCA 2FRDC 3JZIA 3OFND 4JCCA 3D4NA 4HDSB 1KWKA 2PSHA 1RXSA 4QZVA 1TKCA 1XWIA 2QRLA 3G8DA 4HKTA 2WMNB 2X41A 3MT0A 4CLHA 4UTRA 3C74A 4QLBA 3EXHA 4ZCSA 2OUIA 3RKSA 3G5UA 2AK3A 4UEOA 1BCSA 3TI9A 3KTDA 3W8DA 1QGZA 4FQ7A 4HZUA 2Q6KA 4MMZB 4UMFA 2XHEA 3DOJA 2AOVA 1FFEA 1ISMA 3LHFA 3N86A 4MS1A 3ZVLA 4Q1BA 4NPHA 1Z4QA 2A33A 1QZ3A 1E3WA 1TJNA 3DBHB 4HDNB 2Q4BA 4YRRA 4KK3A 2P5UA 3UG6A 5HCNA 5TB5A 2IPOA 3RVNA 4EIWA 2Q41A 2H85A 2IT1A 1JLSA 3D7KA 1C0LA 3ADOA 3C8UA 3T35A 3AR6A 3BRSA 4IJQA 2EJVA 4UD6A 4JUBA 2VXCA 4RHXA 3GL9A 3DB1A 3IDFA 5TR9A 4WCDA 3BDAA 4WKNA 5FB3A 5EMKA 4AG3A 3EQ9A 5AM2A 4WLFA 4X6LA 3IAM6 2DWQA 1F5SA 1T0UA 3HM9A 2FDRA 5JTUA 2AVDA 1P0MA 1GAEO 2ZXEA 1V5IA 1YRQA 4FHFA 3PQ3A 3VU0A 1AGYA 4RD6A 3NHSA 5FL7A 2Y71A 5KREA 1XA4A 3LVFO 1V9SA 2IOHA 2QUZA 5DO9A 3WX0A 4PLZA 3F1LA 2J9YB 721PA 5THKA 1UJCA 2B78A 3IAUA 4TRRA 1TYEB 3TTWA 1BYUA 1PJZA 4QHYA 5ITZB 1DIGA 1GXSB 4N8EA 1T5DX 4G1EB 5DYGA 1Q19A 2JFOA 2VF8A 1F6BA 1M8GA 1VLMA 2B7CA 3EGEA 4X9XA 4J3NA 3V8NA 3ASYA 4GMKA 1L8XA 4POOA 1NDQA 3D54D 4UASA 2J3MA 3Q2KA 3WB1A 3RIMA 3R44A 2A4MA 3VKFA 4PNEA 1LI4A 1EUDB 1F38A 2A5GA 3WTBA 1E3MA 2R68A 1CUEA 2XWPA 3LW8A 1JS1X 5ALKA 3RT9A 3WQQA 3BMXA 4HYEA 3DO5A 4WXHA 3GP8A 2PH7A 1X1CA 1E63A 2LW7A 1N3BA 1SHUX 2C31A 1T5IA 4GZ6A 1P17A 2FEPA 3MCVA 1CR6A 1NF2A 3IPLA 2Q3LA 1ZNYA 2WDPA 3LG2A 3T3EA 4RF2A 1EZZA 1UXOA 3C7TA 3N6XA 2FMUA 5CLGA 5SZKB 4Q9NA 2BFBA 4RH3A 2ACVA 4C22A 4D6XA 4EHIA 2F1OA 3OWOA 4BAUA 5B7GA 1Q20A 3RYCA 4FS8A 1SUBA 3PNLA 5FOVA 1B43A 1A9PA 2A0UA 2YVKA 2XW6A 1KIFA 2FVYA 2GAOA 3PG5A 1IMJA 1JFFA 1DUIA 4QUIA 1YUNA 3BMQA 4S0ZA 4TUYF 1NJ2A 3T6KA 4M0FA 1LZLA 3CJTA 3SDBA 1DQZA 1GQQA 1MC4A 4TLMB 2ZPTX 3EOAI 4ZRMA 1RHJA 4QYSA 5HIIA 4CDGA 1JDPA 1NUPA 4BB5A 3DVAA 4IGKA 5B1YA 1CRZA 1FDOA 5FOWA 4CLDA 3K6SB 2H65A 1Q83A 1I8TA 4WIAA 2WJIA 1DTEA 4NENA 1RQGA 2AFIA 2ESRA 4URWR 1NY5A 4LRXA 1F17A 2G4VA 3LD9A 1GZHB 2WFZA 3F4KA 3P8ZA 4R8SA 2DOKA 5DXFA 5AKZA 3B9BA 1ISGA 3AJDA 3WB9A 1DIOB 1YR1A 4ES6A 5BUCA 1KO4A 2JFNA 1K5DA 1UXKA 2MU1A 1QPZA 3TDMA 2XXAB 4WY5A 3O94A 4I46A 5AW5A 2VJMB 1USKA 3TNFA 2VPXA 3D2LA 3HGTA 3UMVA 5I7OA 4BVLA 2BL4A 3DOUA 3LTEA 2EKDA 1R1DA 4GLJA 2K6GA 3SXUA 4NESA 1Z5WA 3NHKA 4DAEA 3PXEA 4Y2XA 5FQOA 5CXXA 1U0HC 1XE3A 3QPUA 4RCZA 4NU8X 3I92A 3SZ3A 2ZAMA 1LX6A 1U7UA 1UMCA 1YQ9A 1AK1A 3WRXA 1BHSA 1DC4A 2NO1A 2B2CA 1T8UA 2WD7B 2O2CA 3QELB 1T8RA 4IVPA 4KLNA 4XYEA 5HQ3A 3QHPA 3GHYA 5IDXA 4N0DA 3WKDA 3HDGA 5EZYF 3K92A 2EZ8A 4M87A 1BA3A 3HSSA 2YC4C 2WICA 4WE3A 3RO7A 5LZ9A 3O8OB 5D5PA 1XC7A 3VU9A 4OOFA 3VPDA 2QY9A 3LMKA 2JAUA 3B5IA 4IRXA 1P73A 4NI5A 4P83A 5T5QA 3CNOA 4AYXA 3PPIA 4Q3NA 1KSHA 2FJUA 4ANFA 3QNUA 4C2UA 3EYAA 4O2AF 2J48A 1H0HA 4RD2A 5IABA 4NARA 9ABPA 2OM2A 2FSHA 4JJ7A 4H77A 3ROPA 4K6CA 1TJ3A 1ZSNA 2G8NA 5I47A 1T5BA 4DS3A 3UMGA 4DCVA 5BN4A 2H4XA 3HVRA 2QMEA 1ZINA 3JSXA 4MCJA 2GJKA 2YZNA 2OZLB 3ZWKA 2H5JA 4ZARA 3VU1A 3AINA 4N8SA 3KKEA 1P45A 3H16A 4UHCA 2PJRA 3HCDA 4EF6A 5J2UB 3ITKA 2ZS8A 3E7DA 4BWYA 1GSIA 1S8AA 3JQ7B 5JG7A 2MINB 1Q1NA 1ZMTA 2BWJA 2P5YA 1YTUA 1WPQA 1YHZA 4H0NA 4LOKA 5B3LA 1RMTA 1FRQA 2GEUA 4O4LA 4DNPA 7MHTA 3QEKA 4DR7B 5JRZA 3BHNA 4QO8A 2B2NA 4JP1A 3GCXA 3KC2A 1IZ9A 2FKAA 4ZOLB 5H1YA 3IXLA 2PV7A 5B1DA 3SEZA 1EWRA 4DA0A 1GTRA 1EFVA 1TM7E 2FP4B 3WOVA 3FF1A 1MLDA 4R2KA 4UMEA 1XL1A 4CPDA 2D7JA 5AW2A 4GLFA 1VJCA 4FX5A 2D0IA 2I2CA 1L5YA 2I54A 3HVHA 4KQEA 4B7XA 5AVZA 1E2HA 4FGLA 1WE2A 4GRIA 3WSVA 4AP6A 2B3TA 1Z29A 4GG1A 2J3KA 4ZO6A 4PSUA 4XRGA 1QH0A 4MIYA 1GRRA 4YYZA 1QRDA 3REGA 1M72A 1P2SA 4EJ2A 2BFCA 1CVLA 4B83A 3ADPA 1DKPA 1H05A 4E09A 2IFTA 1VJGA 1GP2A 2V7BA 2P27A 2CKMA 5BSKA 4UVEA 2OHIA 3A37A 3IT1A 1G21E 4HS9A 4L6AA 2PR2A 1R0BA 4U7GA 3IR6A 4N6OA 4U5QA 4DYDA 5DN6D 3KQTA 4FYXA 4CMIA 1OBCA 1PWZA 2X9QA 2VLIA 1DO2A 1BZYA 1IHUA 2AN3A 3ILVA 2PD3A 2XOXA 2A14A 3JQBA 4RESA 4TS1A 5DSTA 3O75A 2W2KA 3HI6A 4QG3A 1TM5E 2CXHA 4INPA 4G8JA 5BVGA 4YBZA 5B12A 3G9UA 4AZSA 3I04M 3CLSD 1U7ZA 4OMFG 3RRNA 3FLEA 2ZQZA 4CEHA 3G8BA 4KN9S 1EK0A 1OFIA 1UADA 1HWYA 1WD7A 3TFOA 1CU1A 5FWYB 1QV6A 2Y6UA 3DKVA 1TJ4A 1CV2A 4DZRA 3RODA 4TTQA 2O1SA 1DBIA 2BY4A 3D7LA 1SUEA 2ZIWB 1CWUA 1LBHA 2C9OA 4GKAA 4Z7OB 1GG8A 4IIXA 1N7IA 3FNEA 4CM4A 4C06A 2P90A 3I9MA 3EVTA 4K6GA 4DCOA 3K70B 3KJGA 2J8ZA 3EA5A 1AZLA 2IOFK 3D3NA 1B0PA 4NFYA 4ZEWA 3T5DA 2FJPA 4DR5B 3UJBA 2P2DA 4ZHQF 1MEJA 5EE1A 3E9RA 2AWOA 2MTBA 3PIIA 5ELLA 1I4WA 3GLGA 2NNLD 2ZTUA 3OQIA 4U9HS 2R66A 3LPDA 1A88A 1D4OA 3DFUA 3T7CA 1WF3A 4D92A 3IEPA 4F5YA 2R7MA 1BMFA 2X3FA 2Z2JA 4LQDA 1J2JA 1ONSA 3WL4A 1QHEA 3M81A 1AXEA 1LVUA 1KIMA 2PMEA 1JP7A 1N5IA 5AI8A 5IC6A 3WQHA 5AW4A 1R37A 1OHHD 3BB4A 4WD3A 4MCAA 3IDAA 5EIAA 3QE9Y 1YS1X 2Q8NA 3FF4A 1SC1A 3GCWA 1V4NA 2PAAA 3C8ZA 3PA8A 4HPJB 3T06B 4CR8A 2NXWA 1RC8A 3OLVA 1UEIA 2GD2A 1PJRA 4TSKA 1NQWA 2D6FA 4NBRA 4PF1A 3UAVA 1UODA 1GDDA 3AI1A 4A9AA 3AKCA 3OFNA 1ZN8A 2BF7A 3GJ8A 4HXFB 4ZVSA 2YXNA 4OGLA 2OVFA 3BZUA 4OLHA 3SXJA 4KPGA 4TV8F 5HEKA 3I30X 4RPJA 2WTAA 4RWZA 5EUQB 2RI0A 1AN0A 1C7ZA 1LLUA 4IDAA 2G3YA 5LBIA 3CZ4A 1TZMA 3M6MD 1JECA 3UOAB 5C35A 3V1KA 4D4MA 3RG8A 2VPQA 2WBLC 2QVGA 1C30A 3R0ZA 3EEOA 1AQNA 4P4TA 3W4IA 3DW1X 2EJBA 5FULA 3ZV7A 1B4DA 1RRMA 4W9MC 1NOKA 2X5NA 4B6OA 4Q9HA 4GWGA 1H9CA 4B84A 1E8DA 3LLMA 1F2VA 4R1UA 5I9NA 2FR8A 2OR3A 1HE2A 2F64A 1S2LA 2QP3A 1TTQB 2JBAB 1VCNA 1OBFO 4NRDA 2VHEA 5IAGA 2ZT5A 2WABA 1S2NA 2QGZA 4YP0A 5DM0A 3W2GA 2HKIA 4MV1A 3J80A 3OHPA 3TW0A 5F3RA 4NXMB 4X45A 3C98A 4DPLA 5KINB 2DY0A 2VBGA 2PK3A 2BVNA 3QBVA 1O87A 5CA0B 4NE7A 3KSRA 4IJ6A 4P92A 4PS0A 1OA1A 1E9VA 4CKBA 5DNAA 2Q5IA 3U4QB 2B3DA 3NAGA 1NQXA 3PNQA 3TVTA 4NFHA 2Y6VA 2PA0A 2PZJA 3SD7A 2QBYB 4NE9A 2QIPA 1LSSA 4OJNA 3ZJ5A 4L51A 1FFBA 1L7AA 2JFQA 4IOJA 2RAFA 5ICMA 2JD0A 3MUOA 4B34A 4O4JF 4TTSA 4FI3F 2C9YA 3BKXA 2I4TA 1JG3A 2WTXA 3DDCA 1KDZA 2EKPA 2NZUG 2YIMA 1OFTA 3GUCA 4FLMA 4BWVA 4ARIA 1Q44A 3F6SA 5AJHA 5CG1A 4NLLA 2D59A 3HO8A 3QFSA 3BQ9A 5FPSA 1RLOA 1KAMA 2C2YA 4ZEXA 2PPVA 3LU1A 1VM6A 2W83A 2HI0A 1M10A 3S2YA 3T4EA 1ULUA 1F6DA 3WGOA 2OHXA 3IV9A 2OUKA 1KRHA 3DZFA 2GVDC 2YW2A 1CUBA 3KUKA 5DI3B 5CA1F 3KQQA 4I1SA 4OHCA 4D0SA 5EJMA 2D7DA 4V38A 5GWXA 5AVRA 2G9UA 2Y1LA 2WQ7A 1WMSA 5IKEA 1JMYA 4D3ZA 4EITA 1AY0A 1ZCJA 3F9IA 2RGNC 1QIHA 3AIKA 2ROQA 1P1IA 3ISJA 5FOTA 4BDSA 4CWAA 1RXWA 1NPDA 2VAMA 4ZHSA 1T2NA 3HLKA 4GAEA 1KVTA 2QN3A 3RRJA 3AEXA 3N0XA 3F8TA 1WDWB 3T7JA 2BCJQ 4IQGA 4Z6KA 1C0EA 1BX3A 3MPOA 1VKZA 3VBEA 3LYUA 2CGEA 5BW5A 4ENWA 4TMVA 1U9IA 3I23A 4NV1A 4DKJA 3NS7A 3U80A 4Q7QA 2P2SA 2Y1GA 2ZJ5A 5A71A 4AB1A 3SX4A 2O06A 1SIWA 3IGFA 4MRSA 5EIWA 3KDSE 3ZX4A 1TMKA 3MLBA 3IVRA 1Q0TA 4Y7DA 4ZDJA 1X7GA 1WHSB 3TI7A 5CFMA 3L8ZA 1G8SA 1PLKA 1HDZA 5HCUA 1K4MA 4OP2A 3FPCA 3ZU3A 3S68A 2GYUA 1E5QA 3CLKA 5K2MA 1U80A 4HGRA 6GPBA 5I7FA 3AF5A 3LK7A 4M8KA 3PNVA 3X1JA 4AMYA 3RHFA 2HLNA 3EC1A 3QVUA 4TLCA 3TJMA 1D4FA 5G3YA 3RTBA 1Q16A 1AT1A 3BWMA 2GM4A 1ADJA 4C3UA 2OCLA 2QTCA 3QPDA 5L3SA 4G5QA 1YL5A 4ZVOA 5ICFA 4WA7A 2YL2A 3A7EA 3N7TA 7ADHA 3DVSX 3GFTA 3QBJA 1J8VA 4LC9A 4MI9A 4YA6A 3R7SA 5JZVA 2H16A 4Y98A 2A35A 2DLCX 2P5TB 3DXXA 4IKEA 3NDBB 4OJKA 3ZYCA 1P9RA 1UZUA 1LNQA 2GPYA 4LKRA 4L5AA 3QQPA 1M2EA 2C9DA 3ZU6A 1J09A 4FQ8A 3K0SA 2TMKA 1N2CE 3Q7QA 4BNWA 2IH5A 3DP9A 3U7FB 1EXWA 1K0FA 3R3JA 2ZJBA 3NFYA 1R6XA 3TGWA 1A9RA 1ZJ5A 4G84A 1W34A 4GLOA 1GN9A 5C7IO 2ECQA 4J16A 3K15A 1AIPA 1V8ZA 2PX6A 4HX9A 3E22B 5HFJA 4EY7A 3R1IA 3ITEA 3HDVA 3ST7A 3S2EA 4EB6B 1CDOA 4QOJA 4M46A 1O9HA 1W8IA 2ZPAA 1RYZA 4HAWA 1FDWA 3A32A 1E0JA 5DWQA 3KFVA 3BD8A 3IT2A 3HBLA 3V4OA 3WGMA 2AJLI 4D46A 3GRKA 2X4GA 3OFVA 4F4IA 3B3QA 4I3FA 2N0SA 1YZKA 4H3SA 1V16B 1V8OA 2HSEA 2AEEA 4ER3A 4KAJA 1Y3IA 4Y1EA 1NMYA 2ZUTA 1KMNA 1QWOA 2GFQA 2HH9A 1IWOA 3I32A 3ILYA 1HKUA 2BMVA 4ND1A 2P3LA 3WIDA 2DPMA 4DQ0A 5I01A 2WKQA 3SQOA 2VG8A 4ND6A 4WKCA 1L1EA 3IQGX 5DNDA 3TLGA 5B1EA 1L8QA 4L5IA 2J0SA 1XHLA 3NB0A 4EL0A 2RHLA 3KYDA 3LCCA 4Q3OA 3TD6A 1AXGA 1E5DA 4G3XA 1OIWA 3FAZA 1RTTA 5JH7A 2P0EA 3UK2A 5K0EA 4UPDA 2AHRA 3RGGA 4YMVA 3KR9A 2YHSA 2IS6A 3Q4GA 1W5TA 1L5SA 2DQKA 3UHPA 3OBBA 4F5DA 5E1BA 1HE3A 3W5CA 3KEOA 3VSAA 1F14A 5B6IA 1JPNA 5ALLA 1FP4A 2ODNA 2HADA 4LDAA 2HF2A 2BBOA 2HF9A 1RZVA 3O4RA 4HQ0A 2E49A 1FL9A 1GNRA 4GXTA 1ZGGA 2P7IA 4H16A 4M0MA 1YJQA 2OBFA 3IR5A 1RXIA 2BGLA 2Z04A 4DTIA 1V48A 2XUFA 3FVVA 3HJUA 4JT9A 4B76A 2VT2A 3ES9A 4O3MA 1KEZA 4H3VA 2IEDA 2H06A 1NU6A 5PNTA 1E20A 1U1GA 2XYQA 5GM2A 4BMNA 5HOQA 1XMQB 1N77A 1N6IA 3FTFA 2JKZA 5DXJA 4NYMR 5KWSA 2Q5HA 3EUWA 3EY9A 3U7HB 4HAIA 1HZZA 5CDHA 2H3EA 1N34B 2UZ4A 1AE1A 3L4BC 2VTBB 2AF3C 4XIJA 5C7LO 1ZC3A 4ID3A 3OOHA 5AJVB 6ADHA 4XD7D 3F5QA 1BD4A 3HU5A 1CTQA 1X0VA 2XF2A 4HFRA 1Z3CA 4NZNA 3STTA 4AULA 3KQHA 4R9NA 2K5UA 1WHTA 1CYEA 2V6BA 3IUJA 2CN1A 1T91A 2AMJA 2FRXA 2GS9A 5EQJB 1ZUNB 2PWBA 4B79A 4KIGA 1QMGA 1LW7A 3F5DA 3G1TA 4L8LA 2QGFA 2QX4A 2H4HA 4BQSA 3SQWA 1Q7BA 1EQAA 3K32A 1YNSA 2KSQA 2NIPA 2XPCA 2OFFA 3WSWA 2OB1A 5IJZA 3HJAA 2Z43A 4G0UA 4P0PB 2I0FA 4WCFC 9MHTA 4BV8A 2BSQA 1TPZA 1WUYA 3HLYA 4DZTA 3UUWA 5DYWA 4R1OA 1DBPA 2FSVA 1FTNA 3HNOA 3U40A 2H59A 1Y6ZA 2EARA 1EBFA 1KAHA 2GILA 4C0SA 3KQKA 4B8WA 1KR2A 4J9VA 4KEAA 2XUPA 4IHQA 1E6KA 2BM9A 4C4XA 1RPNA 2IHZA 3L01A 1B8PA 3G1UA 4PLWA 4XD2A 3U3MA 4TX1A 3P2IA 4IDQA 4RKEA 4C1NA 1TA0A 1EESA 1MQSA 2A84A 4XIIA 1C7FA 2O5CA 2JGMA 3H3FA 2DEUA 3QPCA 2Y0CA 4RTMA 2R1TA 4W63A 3NVDA 1PSZA 1P3DA 1N2IA 1OHHA 4Z99A 3NBXX 1U2GC 2PR7A 3DDHA 2FDXA 2OHGA 2H1WA 1PG0A 1QH1A 3E58A 3IV6A 4MB0A 2AV6A 3PLNA 4MZDA 3VHXA 4ETIA 2QRUA 4F84A 3DZGA 4OMCA 5I51A 1SO8A 3BXEA 4ZOAA 5AWFC 2WQ6A 1DINA 3E0XA 3HY3A 4Q19A 4A7PA 3ZTYA 2IF2A 3PWSA 4KXYA 1CYDA 5HUHA 3LIIA 1KEVA 4GPIB 3V7WA 4E4RA 1U2DC 3CUYA 4ZI7B 3TPZA 4EUHA 2GDZA 4DPKA 4ZJYA 5G41A 4JELA 1T4BA 2I7DA 4YEDA 5KBYA 5KPJA 1F8XA 3QFHA 2XNSA 2N1MA 4B3GA 2Q7XA 3H9BA 3FMOB 3QWAA 1Y7LA 2YRWA 3GEPA 4UHHA 5DBHX 5HG0A 2IBMA 3W6ZA 4FWTA 4AS1A 1JEOA 3ER9A 3AM4A 4W9NC 1UOPA 2QN1A 4XIYA 1TD9A 4G9EA 3ADDA 2Q3BA 1ZZGA 2HRCA 4KSYA 4G56A 4U7FA 3DB2A 2GYWA 4CL0A 4TKVA 4HVTA 1WABA 1P2FA 3SLGA 3T7KA 1XSEA 2ATIA 3FJYA 4UTOA 3A4IA 4RQAA 3KKPA 3E9NA 3WGTA 4AZTA 1AG9A 4BRUA 1W73A 3O2JA 2BP7B 1XLVA 3TZLA 4L8YA 1ZSVA 3ZNQA 2YXEA 5CYOA 3MIZA 3ZBTA 4F0JA 1S02A 5DMHA 3F3YA 5DBEX 5DWVA 4I4CA 4DE5A 3EIXA 4HAZA 4JP8A 1HRKA 5FTLA 3IA7A 2P2GA 5A9SA 4NQZA 1W6RA 1SQFA 3QM1A 2C5BA 3G1WA 2HRZA 4WRRA 2VWGA 3KJZA 3WJAA 3ADCA 1ICEA 1CBUA 4LRSB 2A1TS 2XKAA 2GK7A 2ZRDA 3FZNA 4EI7A 1M2OA 5L3ZA 1P4AA 1JT2A 2NZYA 4YR7A 5F35A 2JLXA 1NJ8A 5G4KB 3ICOA 4QFBA 3HUEA 3OJXA 3DPSA 1Y8RA 3GJ5A 4I6GA 4KE9A 1DUVG 4L8GA 3EIFA 4XM1A 4AP5A 4D5EA 2VDUE 2Z6AA 4Q1VA 4Z8XA 4AF6A 4J7CA 3MHPA 3ODPA 2G1JA 3DTTA 3EGDA 1Q12A 3LECA 2Y8EA 1RVV1 3BRWA 4Q15A 1SPBS 4J90A 4FZVA 4JNCA 1U90A 3PVCA 1Q14A 1FYFA 4F9FA 4HYTA 3ZTTA 2JFVA 4I1VA 5E2AA 3AM1A 5DT2A 3A9RA 1ZD3A 1NW8A 3JZFA 4RE6A 2I4OA 4LZLA 2CLSA 4UUBA 4ZO4A 3G2HA 5FUYA 1PWYE 3PFGA 5J43A 1THTA 2JH9A 3HJTA 4L0QA 3IOBA 3EDYA 4DSOA 3LL4A 3IJPA 4LY0A 1IN1A 1VYVA 2Q5OA 4NH4A 4RVHA 2JLYA 2VDNB 2IOFA 1XTKA 3H9JA 2BJVA 2IPLA 3KDAA 3OZWA 4ND8B 4L9WA 4P93A 4UEJA 2EIXA 2CHGA 2P35A 2PIDA 4GR5A 4WJKB 1D0VA 2V7QD 1LF0A 2R0QC 5SY4A 3JATB 1DKOA 2FWNA 4NU6A 4L9AA 4DPMA 1KQFA 4REMA 3GU3A 4PAWA 3GIWA 5A9TA 4A2WA 4HTFB 4HY3A 4BNLA 4C3ZA 4MUHA 2DR2A 1UMBB 2AG1A 2G08A 3QVGA 2G8LA 2D1FA 3G13A 5JAHA 2A59A 3LQQA 1XEXB 1PHPA 1WDKA 4J2TA 1J99A 1D4ZA 1DG1G 3P9CA 3UJPA 2WF7A 3A36A 7GPBA 4FE4A 5JLAA 4CHGA 4PBTA 4WFJA 2FFAA 3RC9A 5CVTA 2XDQA 3GPCA 5JS8A 1YB2A 4IQ0A 1H5UA 1RJDA 4GX0A 4JLKA 5DK4A 2D8AA 4F4FA 2QSJA 1J1IA 4LDZA 3UZUA 5AESA 3M9LA 2G6BA 3OG9A 2ETXA 4Q21A 4M6WB 4UCQA 5AK5A 5CU7A 3CLTD 5KYTA 2DHEA 2EJTA 2IE0A 4I9HA 4GZ3A 4M7RA 1GG5A 1I0ZA 1QCZA 1USVA 2ZIUB 3ABOB 4AIIA 2C5AA 1H2RS 5LP6B 3KAQA 3JZDA 4X41A 2V7GA 4HK4A 3DCNA 1TO1E 4MRMB 1P1HA 4EFDA 1Q3TA 5TQ0B 1DG3A 3HS3A 1U99A 3NV9A 5DTQA 2VT3A 1Z62A 3B12A 4ZRNA 3NT2A 4J0CA 5BRNA 2QY6A 1PT9A 3AFIA 2YICA 5CVUA 5DYYA 3AOEC 2BH2A 1RHRA 3K20A 1R8QA 1F0NA 1C9YA 2VP6A 3OOEA 3WNBA 1CQXA 1K63A 3SC2B 4E88A 5FPKA 1XPUA 2JA2A 1ZGCA 4R3WA 4EHFA 5FJIA 3TK1A 1ZONA 4EA6A 4ZCRA 4QDTA 2P9EA 3ANMA 4MWOA 1J6UA 2HOQA 4KIFA 4YIHA 4FR2A 1KMHA 1AS0A 4X3CA 3ONNA 3P4UA 5KC8A 1ZUD1 3A06A 4DRZA 3OT5A 1DXOA 1H8HD 2WG2A 1ZK0A 2E3JA 3EH1A 3RUDA 2Y4OA 2IUEA 3D3WA 3OP4A 3PFHA 5LXTF 1WUHS 3IP6A 1Z0IA 1TYAE 4Y6OA 3KNZA 1KY5A 2GN4A 2IYAA 4FHCA 3V5NA 3VR6H 4Q39A 2XVYA 2JGRA 2VYND 2Z83A 3U6BA 2ZSFA 5A5EA 3MCWA 4U2KA 4Z0HO 3ND9A 4NEQA 4YECA 5JARA 3NWOA 2XRFA 3MWDB 4I08A 4YAOA 3HSYA 1Y1QA 1DKQA 3KWFA 1NW5A 3L6BA 1TT5A 2R6HA 2HV9A 3PVSA 3FR8A 1QK4A 4KO1S 4OQQA 1ZKMA 2PT9A 5A03A 1E18A 1CQIA 3P45A 5C4IA 4CF7A 3B7GA 2V7VA 3PDJA 1XVLA 1X7XB 4YPOA 3EN0A 1CK4A 1TADA 4ZANA 2HA7A 3U4DA 2C0QA 1F2TA 2I2WA 3K70D 1ZJJA 3IA2A 1HDGO 3P9XA 4QYMA 4PQGA 4DSAA 1QBKC 3H17A 3DKKA 2ATVA 3ICVA 5EPUA 3NBQA 4C4AA 2RAVA 1EDBA 2H1OA 1DC3A 3LUKA 1FUYB 2X2OA 1QGYA 1A7UA 2AI2A 2COKA 2BW0A 1W4AA 2I6UA 3BC1A 1FLAA 4XGRA 4ZO9A 2JEZA 4WN3A 2D54A 1N0HA 2VJQA 4H35A 3NJRA 2ZVQX 4Z4CA 1QVAA 2A9PA 1JHQA 3ANYB 1N2JA 3I64A 3WGVA 3KU1A 1VXOA 3HRHA 1Q92A 1FVOA 1ECJA 1HNWB 3A1TA 3F7TA 1A9QA 1ZK1A 4NCAA 1G1AA 4TMFA 1QOZA 4MKXA 3IEKA 4JKOA 4BATA 621PA 3T0GA 3PXUA 4KYTA 3HVKA 2XVXA 2XBUA 4N5NA 5BQ3A 4URXR 5L9AA 3SY8A 1UOQA 2CLKB 3BBLA 4D4LA 3ZGZA 4HDSA 1Y1KE 1XTVA 2LGJA 2PMWB 4UW9A 5GOZA 5HK9A 4BHTA 5E6SA 1GZDA 1LKZA 2J9RA 1WDTA 2B4KA 5CCDA 1QF6A 1VB5A 3DHWC 3KEGA 3PK0A 4EKYA 1J8YF 1R18A 3MSCA 1FTWA 4A5SA 2Q07A 2A88A 1GAJA 1J07A 5JJIA 5BSHA 1OVGA 3HU3A 2BFAA 2E87A 4IX1A 2IZ7A 1HE5A 3DA8A 4OO3A 3HA7A 2J45A 1O0SA 3DBHA 4TRJA 4XFDA 4BEVA 4QATA 1E2UA 7REQB 2RKOA 2HFJA 1Y80A 5KTPA 2H1VA 3IVCA 3V8RA 3FTQA 3R9WA 5IH3A 2CLFB 5K0LA 3PIRA 3V2IA 5EJ5A 3VKGA 2GEBA 2CL6X 4M7PA 3PPYA 2VDKB 3SOPA 3MLAA 4FR5A 1N1DA 1NWCA 1ZLYA 3HXMA 5AUNB 3TNDA 3N2YA 2BI8A 1Z4PX 3ZEAA 5A7GA 4CQLB 3COPA 3AEKB 1PUJA 3JVVA 4YNBA 4F8JA 3R8FA 5ANRB 4FONA 2I33A 4PG7A 3AI3A 3S44A 3ETGA 3TLCA 1E2PA 1DIHA 3RBVA 1PD1A 1UF9A 4EG8A 2DQ4A 1FRNA 2FW6A 1WBJB 2VBFA 1T3LA 3X43A 2R8BA 5K0SA 2BAGA 4KLRA 4U2EA 4X60A 4ADSG 2XMCA 4OJMX 1W9HA 1Y5MA 3OEYA 4M1TA 1SKYE 3GAMA 3MT8A 3WNZA 1IHOA 2PYDA 1NF9A 1TFUA 3AZPA 2ODWA 1GXSA 1Q74A 4R9SA 5JH7F 1P0QA 1TAQA 4DSUA 4XH9B 4LJ7A 3FCYA 3IOMA 1O77A 2IXGA 5DYTA 1JR3E 1HQYE 3AR3A 3SG0A 1A7KA 3RI3A 3S2UA 2XKJE 2OD7A 1BEUB 1NC3A 3I52A 4D56A 2UXBB 3NG1A 2ZYGA 1FYEA 4MRPA 4ZICA 3Q3VA 3AFOA 3CF4G 3CB4A 3L0IB 4XAQA 4JCOA 3RFFA 3JYHA 1NRWA 1K98A 2MMGA 5EXDA 2G72A 1ZRHA 5ITVA 2D4HA 1BYIA 3FHCB 1PQUA 1CY2A 1QC5A 1FMLA 4Y1RA 2XGJA 5FUBA 1VZ3A 1PFUA 1FE8A 1QTRA 3FOEC 5CW1A 2PZBA 4QL3A 4ZU1X 1O96A 1JG6A 3WIVA 5KVQA 5EHXA 4IDBA 2QZPA 3A3PA 4Q3DA 2X1MA 4NYJR 3ZWCA 5CTAA 1M0EA 1QJCA 1XJ5A 2ZIVB 5KUTA 2PKYX 4QU0A 4S04A 3JASB 4NONA 4EX6A 1UWVA 5BR4A 5KYNA 3OQOA 2WZBA 2KJQA 1DIRA 2QW1A 3BMOA 4FFDA 4N0EA 1S4QA 3P27A 1DLIA 3KVOA 3JD4A 2EXXA 4QREA 3HYLA 1CR2A 2R1VB 4JJAA 3S28A 1Z83A 2APJA 4B4DA 4D98A 4QT4A 3P9ZA 4R3UC 4QPNA 3I12A 3O0DA 1E2NA 2W4IA 3LVBA 4IQFA 1M6WA 5AOAA 5JYEA 3Q3GE 4QASA 5K45A 3JWPA 4QM7A 1L7OA 3Q8XB 3K6SA 1NP6A 3EA0A 3GEMA 4Q4JB 3IPXA 4CMCA 1VPWA 1DP4A 1AKMA 2FPGB 2R11A 3FA2A 3CWZA 4EO4A 4G5FA 1F3OA 1G8PA 1RRVA 3CBGA 3CUVA 3HY4A 1I0LA 5COQA 2WIFA 1MOPA 2UKDA 2XXAA 1PR6A 1SHZA 2VJMA 1JXAA 5FT9A 1F8UA 1ORHA 2UUOA 3MYRA 1TLFA 5DP1A 1THGA 5KWEA 4FGWA 5BOVA 1G8KA 2AWNA 2A9VA 5HPYB 1O95C 2CJPA 2J3JA 3QLUC 3CCCA 3V97A 2JW5A 3OJLA 4FGUA 4P5PA 1SU4A 4DNFA 5BYAA 3WMGA 5HNKA 2DC1A 1W581 1OC2A 4HFMA 5EIXA 4N7BA 1Q0HA 3W2IA 1A5BB 4ZT4A 4KYUA 1RACA 3DOOA 3V3KA 1PSWA 4I9GA 2WD7A 3J7AC 3VISA 3VYWA 1XDBA 2QK4A 2WOOA 3MRSA 1XVUA 3G2JA 2R6DA 4J49A 4LZJA 4MAFA 3QXXA 4DDTA 3S1AB 5FNVB 5EMJA 1VE6A 3M5WA 4OMDA 2BKEA 5U1PA 4JLOA 4PYLA 4RPCA 1ORTA 4FZJA 5CRIA 3KHTA 1NQ5A 3WNVA 1EUZA 2AZDA 3O8OA 2C4WA 1O6ZA 3AEYA 4P7FA 3WYFA 2CEKA 4JZYA 1XCJA 2LVBA 4GPTA 4Y30A 1A71A 1PG2A 2QG9A 5CH3A 4CIWA 4D3SA 2JGKA 1JDSA 2IZ0A 1BVUA 4ESVA 5ICGA 3N75A 2XYHA 4MVJH 4DCSA 4EX7A 3ZHUA 5FBHA 1NKVA 1TRKA 2EFEB 1BU8A 5TT1A 4QLOA 3T61A 1W0JD 3ZCPA 3HFGA 4ZAVA 4EA7A 3DLHA 1S2IA 2RGUA 1T8YA 1RCFA 5ALHA 2V5UA 4AWXA 5TV2A 5H8WA 3QUAA 1VBMA 1Z2EA 5T6BA 3SS8A 3U7IA 2WHQA 3TQQA 1BN6A 2I6FA 3VQTA 1HR0B 4G09A 1U1EA 3GUUA 4IO0A 4UOQA 1FYDA 1EA5A 3JQ7A 3TQRA 3UK1A 3FZGA 4OATA 4NDZA 4KNWA 2DBQA 3MRVA 2OV1A 3B85A 4EG5A 3T1QA 4YCSA 3JYLA 1PUXA 4Y2RA 1EGHA 4FWIB 1I2MA 2LUOA 3FHJA 2I03A 1POXA 2HK9A 3RC1A 3STWA 3KTOA 3O38A 1SVOA 2GVNA 5EWMB 5HILA 4Q1EA 1BWQA 3IVGA 4Z4QA 4ZOLA 2ZT8A 2YHIA 3EE6A 1JHAA 4MI6A 5DM1A 2D1SA 3K35A 2IV2X 2FP4A 5KCMA 2IP1A 3W4KA 1SCBA 3IVXA 4G0XA 5G0SA 2IHBA 1OPXA 5EZ6B 3V3TA 5K6TA 4XB2A 3AFMA 4ZOBA 1AS2A 3NP9A 4QYXA 2EG5A 2XE4A 3GFSA 1TU0A 4HN9A 4OB7A 4OQ4A 1HT1E 2HCTA 3TQFA 2MWMA 1NXXA 2GLTA 5EGNA 4WY8A 3FXAA 2Q1TA 2RGRA 3R40A 3HUTA 3I9NA 1O94D 3H4MA 4HB4A 3MB8A 4JJZA 1EFRD 3RFUA 1ZMOA 3T7IA 2WZCA 1ZVJA 4JP5A 2HU8A 1A82A 3A6EA 4IIYA 2VOJA 3CURA 3NHRA 3I5XA 1H8HA 1H0RA 1LI7A 2BEUB 3RBXA 2PJZA 3EODA 6NULA 5MFZA 1BC5A 2OAGA 1ZXXA 5JQGB 5ALEA 4YTEA 3QX3A 2J59A 1OILA 2VATA 2ZIZA 3DDZX 1QQ7A 1ACLA 2QR2A 2VYNA 3JWEA 1C0KA 3BB1A 4JENA 5JHHB 1L5RA 1XKQA 3NUGA 4QC2A 1S2DA 3I45A 3PXAA 1J2YA 3I83A 5FWYA 2MMCA 3ZS9A 2F8TA 2GYVA 5L40A 1AUVA 4BIIA 3NGLA 4MUNA 4OQXA 2IUYA 1R12A 1RQNA 4TWAA 5IAEA 1UJ4A 2H8KA 3C97A 5IG2A 4K9RA 1S0UA 3EPJA 1LQTA 3LL7A 3VBCA 2IHNA 1UWKA 4GI1A 3NDPA 2FN8A 2YINC 3UKJA 2WF8A 1JJBA 1G2IA 2VTVA 1AS3A 1H2EA 3DLPX 3LUCA 4K5QA 4YQEA 2IS1A 2PKRA 4QTXA 4R1NA 2QQ0A 3I09A 1GGFA 1DVRA 1H4TA 2E1PA 4YMGA 4KWHA 2UAGA 4LECA 4BKUA 4XJXA 4TYNA 1GPKA 2CMFA 3HJHA 1B73A 1KI2A 2QM8A 1HF3A 1HLDA 2RH4A 1ETUA 2TSYB 2R7KA 1H66A 4RPLA 1LGYA 4RVCA 4N5LA 3DR3A 5JEDA 4GC5A 4G6ZA 3OPYB 4JYCA 1VB3A 1JUDA 1NNSA 4RMHA 2QW0X 1N0VC 4AX4A 2VJOA 1M7GA 1BH6A 3QLTA 1T8PA 2FETA 2AR9A 2WB4A 1RLJA 2Y2UA 4O4IA 4RADA 3ZR4B 2JAXA 1ZJ4A 4QULA 2FN4A 1SXGA 4DIKA 4P4SB 4WBXC 4D9HA 4DVJA 1ESCA 4CN9A 1SQ5A 2D4AA 1EFCA 2DUJA 3TIGA 4E30A 1X86B 2ORYA 1SA0A 4LQLA 3TW8B 4FDLA 5F2OA 1XRJA 2NV2B 3JPYA 5HHTA 1GTMA 2Q8PA 5JAZA 1HYQA 1NW9B 4EY5A 1E94E 2AQHA 1X1TA 2DFTA 1UBHS 3FFWA 4I5FA 2IEYA 4MVJE 4W6ZA 4TKLA 1Z5OA 4NDAA 1NL3A 1YVEI 3CH4B 5K2OA 1UM8A 3CZ9A 4XGNA 3B9RA 2G0AA 4G07A 3EF3A 3L2OB 1NBAA 1NFQA 821PA 5JNLA 4MDEA 5MF6A 2YV2A 4P8RA 1RM4A 4YN3A 1J7KA 3DL4A 1LI5A 2GM9A 2R65A 1XTQA 4UZEA 3E8SA 4LNHA 2V03A 5F73A 5FCDA 1RP1A 4LISA 3ONFA 3UA4A 4EF5A 3A31A 5CK5A 2CC2A 3T34A 3OCJA 2HSJA 2P67A 2W98A 2YX1A 3DH0A 1N3YA 4ICIA 4E21A 2C3PA 1UDBA 2Q5CA 4CBVA 4RKRA 2DZDA 3KFLA 4AG5A 3RC7A 1IM8A 2JBAA 4ZVRA 3B6EA 1AQJA 4XRRA 4YV7A 2Q3JA 2PX3A 3ZD9A 1XK6A 4OGGA