1NFRA

Rv2002 gene product from mycobacterium tuberculosis
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
244
structure length
244
Chain Sequence
b'SGRLTGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAMAAELADAARYVHLDVTQPAQWKAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGIRAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNSIHPGLVKTPMTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVAGLAHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase Rv2002
publication title Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 84
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.53: 3-alpha(or 20-beta)-hydroxysteroid dehydrogenase.
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nfrA00
4J9VA 2X9VA 1I32A 1B16A 4OMUA 3ZWOA 1GPDG 3RSHA 5HA5A 2HU2A 2YY7A 3AI1A 4RVSA 2XOXA 1AE1A 2Y1GA 3LVFO 1LDEA 4KTVE 2X5KO 2X0IA 4MP3A 3WNVA 3WIEA 3RUFA 1P77A 2VRCA 3T7EA 5C7IO 2FR0A 3D64A 1Z74A 3TJRA 1K6IA 1IB6A 1P1KA 4E6PA 1LC3A 1J0XO 2HSDA 4Y9DA 4B4VA 1ARZA 4E2ZA 5IDQA 3PP8A 4YR9A 2AXQA 4WUVA 1RYEA 4MOWA 4L9RA 4C7JA 1YBVA 2GN8A 2PD4A 1U8FO 2VRCD 1DC3A 5G0UA 3W8FA 4IINA 4ZU3A 3QW2A 4B4WA 1Z73A 1Y5RA 2NNLD 2BHLA 4CM4A 1SMKA 3L6DA 2DU8A 2HMVA 4CR6A 2GPTA 3IDSA 1DB3A 4CQLA 1LLDA 1DRUA 4J1SA 1HKUA 1PGNA 3NGXA 4JIGA 1GR0A 2O2YA 4H7PA 2Q99A 4YJFA 1CEQA 4CLOA 1IZ0A 3QWBA 3WBBA 3PQDA 3PHLA 3WFIA 2C07A 1R4NA 3E1KA 3IUSA 2XXJA 1BXZA 4NJOA 3WR5A 4M8SA 3A28A 2DBZA 3GAZA 4Q9NA 4OM8A 4R1SA 1LTHR 5A06A 1MXFA 2DLDA 2PZMA 4YJDA 3UFXA 3H6KA 1W73A 5C5IA 3A4VA 1TEHA 4QO8A 4UUMA 3PHGA 1PTJA 2NTNA 4MVJE 3AFNA 3JTMA 2O3RA 3VZRA 3MWDB 3UAGA 4ONEA 1HZZA 2LDBA 1O89A 1UP4A 1GV1A 3PWKA 2VNAA 4A03A 4Z3KA 4HKTA 5I9NA 5L45A 5KVSA 4EBFA 3DTTA 3GA0A 1A4IA 3RUAA 2AQKA 5JS6A 2H1SA 3NGLA 3VH4A 1C0KA 1Q0QA 1RJWA 5C37A 1ZK3A 5H82A 3IKTA 1CJCA 1FK8A 4E12A 2X4GA 3AFMA 4PFJA 4TKLA 1IY8A 4BO5A 4PVDA 4OAQA 3JQCA 3GHHA 4J4BA 1O0SA 2AG5A 2NACA 3EAGA 4PCVA 1GTMA 4RLSA 5EPOA 4GGPA 2IZZA 4IBOA 3DL2A 1FDTA 1A9YA 3VZSA 1ZNQO 3ZU3A 4B8ZA 4MIYA 4EYEA 3NV9A 3ENNA 2ZK7A 3PK0A 4PIVA 3WGYA 3E18A 4NBRA 2TMDA 2NM0A 1EK6A 3MJEA 1ZJYA 2YYYA 4URFA 3B20A 5L3ZA 4CM4B 5JDCC 3KB6A 2IYOA 3PJFA 3RFVA 4R3WA 4CQLB 3JYLA 4ZN6A 3U5TA 2PY6A 3GY0A 3ZHBA 4CLOB 4NK5A 2IDZA 4YJFB 3H65A 1Z6ZA 4MO2A 4TRNA 4ALNA 5JCXA 4A73A 1V0JA 4ZQGA 4A5OA 4YBZA 4CMGA 2UV8A 2IODA 3BMCA 1U7HA 3COSA 4IMPA 3L9WA 1LLQA 1EK5A 3PQFA 1C3VA 4BO1A 4L0QA 1HT0A 1YO6A 2B0JA 3RJ9A 3GR6A 4M89A 1PJBA 4HWKA 5EMHA 3QV1A 3I9KA 1XWFA 1UAGA 1LDBA 1H2BA 3DOJA 1KVUA 2ILTA 4M87A 1EVYA 1M6HA 5LC1A 5EJ2A 1T26A 3FD8A 1EEHA 3RC2A 2FY8A 3I9MA 5DBIA 4BGIA 1ZFNA 4IJWA 3EK2A 3GZNB 3DZJA 4GVXA 1EQ2A 5IZCC 4GAEA 3AOGA 4ZRMA 1YL6A 3ZWAA 4D46A 4J91A 3WBFA 4S1VA 1KOLA 2JFHA 2EHDA 1OFGA 2YQ5A 4UEKA 3U09A 1FDWA 1NR7A 2VYNA 4FPXA 1MC4A 1ZEJA 1HDYA 5KKCA 2EW2A 3FPCA 1WMBA 4P4GA 4IMRA 2PKQO 4IJVA 2G5CA 4XYLA 3JCZA 3GOHA 2D8AA 2VYND 5IF3A 3WGOA 3I5MA 4GH5A 4QT0A 3N7UA 4CLXA 2EP7A 5BQFA 1CDOA 1XGKA 1YGYA 3BMOA 1CIVA 4WNIA 5HS4A 1E3JA 4JROA 1GL3A 1Z7BA 3H2SA 3JQFC 3EYWA 4Y98A 3TOZA 5BSHA 3CUKA 2HDHA 3OA2A 1GU7A 1WZIA 4FGWA 1VM6A 1VSUA 3HB4X 3BMCB 3R6DA 4YRAA 1F8GA 1FXSA 3RKRA 1JLLA 4D3SA 2JCYA 5B37A 4GWGA 5I7SA 5JXWA 1SEPA 1DC6A 2D1YA 2D4AA 1E7QA 3LC2O 3DZKA 5T5QA 1H6CA 3ULKA 3AW9A 2G76A 3PIDA 5G0VA 1A5ZA 3OHSX 1WLYA 4MVJF 4PLVA 4DPMA 2W4QA 5JDCA 1WDMA 4OXYA 2P68A 4TKMA 4AJHA 2VOEA 2B35A 2D2IA 3BTSA 3C7AA 3C8MA 2RH4A 4I5DA 4NPCA 2BI7A 4PLHA 2GSDA 2OMEA 3NT4A 5LDHA 4LSWA 3KO8A 3WX0A 3V2HA 1U1IA 2NVUA 1NYTA 3UCXA 4B7XA 1CQIA 1E1NA 1M6WA 1LQTA 4DREA 1NXQA 1XEAA 4HFJA 5IXSA 1AN9A 3GK3A 3I9NA 4WLUA 1I30A 2VWHA 4JBGA 2E82A 2OP0A 2X23A 3HSKA 1UXGA 4HFRA 1BWSA 3ENKA 2GZ2A 2Y0CA 3VVCA 1VL0A 4BVAA 1A71A 1GYPA 2YV1A 3JYNA 3E8XA 3ZHZA 4AJ4A 4FDAA 1N1EA 4PVCA 2VHVA 3B1JA 1SO8A 1E5LA 1MLDA 2UYYA 2NQTA 2PGDA 3M2TA 5TJ9A 5IZCA 2FPGA 4HUJA 2OBNA 4BKPA 4BO0A 3BMOB 5T64A 2EXXA 2WE8A 2NU6A 4FFOA 4DWVA 1VJTA 4JNKA 5A1TA 5CG2A 4E3ZA 4YB8A 2YDYA 3AU9A 1PS0A 3KBOA 2DVMA 2YHIA 4LN1A 1HE4A 3KYCA 5HTOA 2HMUA 2Y67A 5F21A 4QECA 4RV9A 2D5AA 2CMDA 1XG5A 1E6WA 1QLJA 1VRWA 1DIGA 1H9AA 4FBGA 3PIIA 3WTCA 3HFSA 1B7GO 3NT5A 5BT9A 1I0ZA 5JO9A 3QVTA 4BL5A 3H7AA 3WSVA 3RASA 5L95A 1O94A 4ZHSA 2HJSA 5A9RA 3V5NA 2I65A 1YBAA 2GDZA 2RH8A 3JD2A 3M6IA 5JMPA 5BSFA 1GQQA 1B26A 1U5AA 3UHAA 1C1DA 4A26A 4Q3NA 3D4PA 4WCFC 2NVUB 1NAIA 4MVJI 3PFFA 1EBFA 3Q9NA 4II3A 4CMIA 3PPIA 1BGVA 4N5LA 5EESA 1OBFO 1T1RA 2GR9A 5KJEA 1GUYA 4R1UA 4J7CA 4CM9A 3ONFA 4EDFA 1MFPA 5ICMA 2CNBA 5A9SA 2O7QA 2EIHA 4NU6A 3A1NA 2J3IA 4JP3A 2YHUA 3PJDA 3BA1A 1JU9A 4J90A 2DFDA 3S8MA 1NPDA 4BMSA 4CJXA 1GZ6A 1IOLA 1NVTA 1UDBA 3AUAA 2O23A 4BNLA 1F06A 4CM9D 1WW8A 4Y6PA 1EFKA 3DHYA 1MX3A 1UH5A 3NTRA 3PHJA 1KVRA 3UCEA 5BNIA 4TZTA 3ZV5A 5KVCA 4Q3DA 2P5YA 2OGUA 4IDEA 1T2AA 3FBGA 4N5MA 4WLNA 4ZQHA 4BHTA 2DTEA 1XCBA 3D3WB 3JQEA 3RBXA 4IS3A 3BTOA 4PLGA 4R68A 4UVGA 4CV1A 1XR3A 1RWBA 2YHIB 3KYCB 5L7WA 4J4HA 4CLRA 1A7AA 2AEMA 1TT5A 2P9GA 5TSDA 2ZCUA 2Q1TA 3RU7A 2Q3EA 3CTMA 3S2EA 4JBIA 1ISGA 4ESOA 4OOEA 1TB4A 5B12A 4B8WA 1PZHA 1HLDA 3DTYA 2NADA 2Y0DA 1LXCA 1PL8A 2HJRA 2JHGA 4RF2A 1PWXA 3IOYA 3O38A 1YQGA 5HWSA 4E5NA 1WDLA 5AQ1A 4YT4A 4ILKA 3QSGA 4EUEA 2WDZA 4KTTE 5DOZA 1W0CA 1C1DB 3R3SA 1CETA 5IN5A 1FDUA 2YW9A 2BFMA 1NAHA 3F5SA 4EUFA 3ZNQA 4MKXA 4CMIB 3JSAA 4RVFA 1ZK1A 3GN1A 4IDCA 2VOJA 4CV3A 2F00A 3ROMA 2VWGA 5JLAA 1E1MA 3WLEA 4HP8A 5DOVA 1GUFA 3FTPA 3I6IA 3SJUA 3LLSA 5DNAA 1EBUA 1GYRA 1BSVA 4F46A 3E9QA 3SBOA 2H5LA 2I3GA 3B6ZA 3RKUA 4WCFA 3HB5X 4EJ6A 5CEFA 1IPEA 1ADCA 3IP1A 5JYEA 3FF4A 4PRLA 4RF4A 2HQ1A 4YT5A 1ZCJA 2YZ7A 5K9ZA 2QHXA 4F6CA 3PGXA 5EQDA 1E7WA 5IN4A 3JD1A 3PDUA 4IDDA 4DQXA 1PWZA 3KYDA 4XJSA 4BO7A 1BMDA 1H9BA 1TT5B 4CMKA 5L4LA 1P0CA 4TVBA 5ER9A 2ZKLA 2EW8A 3TPCA 3PYLA 1QYVA 2GASA 4QX6A 3FPLA 3RUDA 3JV7A 4FB5A 1GQ2A 5EIOA 4RVDA 1C0LA 1E0DA 3LC1O 1NWCA 1U4OA 3CINA 1D1TA 1PJTA 2GRAA 1I24A 2HO5A 4J0EA 3DONA 3T7CA 2CVZA 3I9LA 3D3EA 2D5CA 1PJLA 2RAFA 3I9JA 3PLNA 4MKZA 1ZXBA 2Q1SA 4DLAA 4CUKA 4IIUA 2FSSA 3EGOA 1QKIA 3HQ4O 5AXDA 4OSOA 2OO5A 3RQSA 2E48A 2BF7A 4ROSA 4E2XA 4KP7A 2VT3A 3IS3A 4ALJA 1HDGO 2QYTA 5T8KC 3DOOA 4FOOA 4DGSA 1N1GA 2YDXA 5JYDA 1DC4A 1CYDA 2PA3A 4MJLA 4MP6A 1WWKA 3LQFA 1DIRA 1EMDA 1PGQA 1T2DA 4YT8A 4XRRA 5U9CA 3DMTC 5DDIP 1PS8A 3H9GA 4AJPA 2B36A 4MVJG 3RCBA 4RLHA 5DT9A 1HDZA 4YQZA 3QWHA 4ZA2A 1VE9A 4L74A 4LGVA 4OIMA 3Q11A 4I5EA 5I9LA 1Q1NA 4WCFB 4BNJA 5B1YA 2ZTUA 1PSDA 2C7GA 1ZUD1 3UCFA 3L6EA 3VPGA 3P19A 5COBA 3ZHYA 4LMRA 1XDWA 3HDYA 2AQIA 3D4OA 2P91A 1JVSA 4HXYA 2O2SA 1GYQA 4CODB 5COQA 1DLIA 3AWDA 4FC7A 1YJ8A 3L77A 3ZWMA 3LK7A 1DLJA 1KEWA 1CRWG 3QJ5A 4CLEA 4FFMA 5G0TA 2JL1A 3GUYA 4BNZA 1IL0A 1UXIA 5CG1A 2V7PA 1GCOA 2DT5A 3LDHA 2FZEA 3E48A 3V2UA 4I08A 1PZGA 4NIMA 4NMHA 5TNXA 1ZSVA 3H4VA 2GD1O 4FC6A 4I9NA 3MWEB 2CFCA 4O1MA 3VH3A 4BNTA 2A9FA 5K0ZA 2FHSA 2ZCVA 3VVBA 4OYRA 1PZEA 2I3AA 1QLHA 4LCJA 3KEQA 1D4FA 1WAMA 4F6LA 3G1TA 1Y1PA 1ONOA 1P1HA 4LVCA 5BSGA 3NEPX 1U8XX 3TFOA 2J6IA 1RPNA 5KWEA 1Y7TA 2QZ9A 4JX8A 1LC0A 5DCYA 4YJGB 1PGPA 1E7RA 4U6QA 4FW8A 1AXEA 3DZFA 3IJRA 5KJ1A 3FCOA 2YJZA 4D0RA 4I5FA 4PG6A 4Q3CA 4P4LA 4U0KA 5T8KA 3T4XA 2Q50A 2B4QA 2GZ1A 3EUWA 3OA0A 4A27A 2C5EA 5DP1A 2IE0A 2DUWA 1SZJG 4UULA 3DMTA 2PWZA 1YRLA 5JFOA 1KEUA 1W6UA 3KZVA 3PGJA 3WXBA 2JFFA 3ST7A 3P2YA 2PLAA 3JQ9A 1UAYA 2EKQA 9LDTA 1J6UA 4DYVA 3TZQA 3OP4A 3DBVO 2FN7A 2NTVA 3FSRA 1F0YA 2Q45A 2I67A 3I3OA 5COAA 2GN6A 4RDIA 1NWHA 3WGQA 5B4VA 4IZHA 4P22A 5TX7A 2V6FA 3KLPX 2Q4EA 2PK3A 3KTDA 1WPQA 1MC5A 3IKVA 3DEYX 1HZJA 4QUKA 3WYBA 1MG5A 2AW5A 1I2ZA 2C2YA 2FR8A 4YACA 5H83A 2RIRA 3I52A 3OICA 1P9LA 5JMWA 4PN3A 1J5PA 4KZPA 4WOKA 1U3TA 4HFMA 4OO3A 1LI4A 4BIIA 2ZTMA 4FR5A 2FOIA 4WJZA 3OEYA 3OQ6A 4IDAA 2VQ3A 4LRTB 1ML3A 3SLGA 4R5HA 5KTKA 4G2NA 4PG4A 3QY9A 3HWRA 2D0IA 3P7MA 5JE8A 5TIIA 2X86A 1T2FA 5U1PA 1E1LA 1PL7A 3GVXA 4AG3A 1XLTA 5CDGA 3DAPA 4Q3EA 1T2CA 3GRPA 1DPGA 3ZWVA 3UXYA 3LT0A 4OXNA 1PJQA 1EVZA 3VAZA 1N9GA 1NFFA 3QVSA 2WJPA 3PYXA 3QVXA 5DF1A 4L8VA 2W90A 4HNGA 4LISA 1Y6JA 4IDFA 1YH3A 3MOIA 1KVTA 2B5VA 2DQ4A 4MVJH 4RVGA 3QQPA 2RHCA 2B37A 4XQEA 2C59A 4I8XA 2DBVO 2CF5A 1N92A 1U28A 4GPD1 1EDOA 1OAAA 4RQUA 2J3HA 1YJQA 4BKRA 3ABIA 4JQCA 4KWHA 4ND4A 2DPHA 3PXXA 4OGWA 4FGSA 4R9RA 4RQTA 1R6DA 4XJTA 4QXMA 2DC1A 3ZH2A 1D1SA 1NQTA 4N18A 1ZEMA 4R54A 4XR9A 3K30A 1NR1A 4NG5A 3OJLA 4U6SA 5IG2A 4WE3A 4CM7A 4B7UA 3D0OA 3MEQA 1M75A 4WK6A 4JJFA 2QW8A 3OSUA 4KQXA 2BELA 4WCDA 1XU7A 1E3IA 2VZ8A 4PZCA 3ICCA 1H6BA 1KETA 1QP8A 4L4SA 4U0JA 1LX6A 3I23A 4L73A 1T4BA 3F9IA 3E82A 3RJ5A 2WD7A 3IAHA 2QX7A 3ROKA 4MIOA 2PD6A 4J6FA 2J8ZA 3DAFA 3WJ7A 2H9IA 1R4MA 2BGMA 3JYQA 1YQDA 4Q3BA 1EVJA 4MPDA 5JNLA 5TF4A 2DKNA 4XYEA 2BKAA 4LMPA 5A03A 1IPFA 5I8ZA 1H94A 4XQ9A 5A5EA 2QZZA 4UUOA 4D79A 1TVEA 2I5PO 3KSUA 3GLQA 3JD4A 3P2OA 2WMDA 3U4IA 1N9GB 4OKIA 4IGFA 4DMMA 5AXBA 4DRYA 3U0BA 2E37A 3PJGA 1C0IA 4BNHA 1R4NB 2EERA 3A9WA 2X0RA 5ILGA 1QV6A 4H15A 4Z6KA 1YS4A 1YE3A 1H6AA 4CUZA 2BLLA 1YBMA 1YVEI 4O0LA 1OMOA 5THKA 1PR3A 1ZK2A 4NFYA 2DPGA 3RUEA 1TLTA 4XDYA 3W1VA 3W4IA 1WVGA 5G4LA 1XSEA 4BQRA 2JKVA 1UDCA 3EW7A 3GHYA 3LSYA 2X5OA 4FFRA 4RVHA 1ZSNA 4BNWA 3K2BA 4DL9A 4XB2A 2W2LA 1MG0A 4GX0A 2ZTLA 3VZQA 3DZHA 4LVUA 4TMFA 1ZJZA 4QSMA 2ZB4A 3F47A 1OOEA 2DUUA 1O5IA 4IDGA 4AJOA 2W2LD 1X1EA 4W6ZA 1PJSA 4RGBA 4IXWA 3B1FA 3C24A 3NUGA 1KEVA 1K6JA 2WD7B 3HDJA 1B0AA 5LDGA 1GV0A 1R12A 4CPDA 4Z9XA 1PGJA 3KSDO 1HE3A 3AM3A 1R4MB 1R37A 1HXHA 4GWKA 1GQYA 2Y0EA 4PLTA 1N8KA 3F1KA 4ITUA 4HFNA 5L4SA 3D4NA 4TROA 5KKAA 4OXKA 1UXHA 2AEFA 3OJEA 3RROA 3B1KA 4TQGA 3M2PA 1VL8A 3U3XA 2DAPA 2BD0A 3GAFA 4YYZA 4O6VA 4EEZA 3ON5A 5L40A 3O8QA 5JAMA 3EMKA 4CQMA 2HK8A 4JN6B 1UXKA 3RVDA 2Y93A 4W9NC 2BGKA 1J4AA 3EHEA 1K6XA 4U8GA 1T24A 1MUUA 1YB1A 3DZBA 2EP5A 1Q7GA 2VRBA 1HSOA 3DZGA 3E6AA 3PWZA 4Z0TA 2GUGA 4YJHA 1ORRA 5F5LA 3V2GA 5CDUA 4CM1A 2C0CA 4CQMD 1U5CA 5EERA 4ZQBA 1DEHA 1HYEA 2VWQA 2WSBA 3BTVA 2QYSA 3TOXA 1PZFA 3DC2A 1CQJA 2VZ0A 1YDWA 4E33A 3X2EA 3ETEA 5DZSA 3W4JA 4QFCA 1EQUA 1NNUA 4A0SA 1DFIA 3HN7A 3GPIA 2VHYA 4XA8A 2O48X 5JY6A 1JN0A 4Y67A 2F1KA 5I7VA 3K92A 4R5MA 1KS9A 2C29D 2Q4BA 5TT1A 2X0JA 5TRTA 1YOVA 4HADA 3ZZNA 1PGOA 2XAAA 2YV3A 4NHEA 3ZWCA 1SCUA 3ZHXA 5B4TA 1AHIA 4DQUA 2C2XA 3DOCA 3JYPA 3NDIA 1GZ3A 4BNIA 4E31A 4OHUA 3GFBA 3KV3O 4OKNA 4WNCA 4PRKA 4GBJA 1QXSA 2CSUA 1GCUA 1ZIDA 2YV2A 1GPJA 2H63A 3PDJA 3RC9A 1JKJA 4PG7A 4RPLA 4L75A 4YDRA 3ZWPA 1Q0LA 1SB9A 3G79A 2I99A 3G1UA 1LRJA 3WDSA 4EZBA 1T1SA 2DM6A 1Z45A 2C7VA 4GLOA 5TS3A 2I6TA 1XHLA 2IXAA 4AICA 3DWFA 3O8QB 2J5KA 2J5QA 1EE9A 2W8ZA 3GEDA 3KETA 2EKLA 3DBLA 1HLPA 4J3FA 3OIFA 5T67A 3PHHA 5ENDA 4AJ2A 2C5AA 1VJ1A 5C3MA 3D7LA 3GDFA 5CPFA 4YWJA 3RU9A 4XCVA 2HRBA 3AOEC 2W2KA 3FR8A 2HK9A 1SNYA 5FF9A 3H3FA 3H8VA 1B14A 1V6AA 5KJ6A 2EF1A 1CERA 1LQUA 4RZHA 1DIHA 1X7GA 3AUUA 4Z9YA 3VPHA 1WMAA 1G6KA 3QWAA 3VTFA 3AM5A 4A7PA 1M66A 1F12A 2X0NA 3H5RA 2CVOA 3WNQA 2I66A 4GLLA 3SJ7A 5GZ1A 4DC0A 1HDXA 4ZVVA 5HBRA 4YA6A 3TFQA 4W9NA 4GKVA 3M1LA 4KMSA 1Q7BA 4IY1A 3TL2A 4HNHA 1NX6A 3PJEA 3W8EA 4MDHA 4KOAA 2V6MA 3VKVA 4II2A 3GGOA 1EUZA 4YTEA 1VPDA 4FSHA 4INAA 1YOVB 2QQ5A 1B3RA 3T4EA 3GT0A 4FS3A 4XR4A 1HDCA 3WG9A 3PYMA 4XQCA 4TWRA 4DPLA 4XQGA 5JBIA 3DXFA 4J2HA 1HYHA 2X9GA 4BNXA 4I5GA 2X6TA 4UVDA 1N5DA 4E2WA 3WGTA 2ZIZA 1ZMTA 3VPFA 3AK4A 2EGGA 5L4NA 3TZ6A 4JK3A 5IAAA 1QR6A 1JA9A 1FMCA 4MIEA 4XIJA 3F1LA 1DBVO 2PH3A 3ZV6A 4EITA 2IEDA 4BMVA 1HDOA 3OBBA 4XEHA 4J1NA 1QYXA 1LDNA 5U4QA 3GVCA 3CZMA 1ULSA 1PJCA 3DBLB 1JQBA 4IPTA 1UUFA 2PTGA 3Q2IA 1XIVA 1ZVMA 1JTVA 1L1FA 5IDXA 4IIVA 4R1TA 2EG9A 4AJEA 4XRGA 2TMGA 3N74A 2W2KB 2R6JA 2XXBA 5CDSA 1E3EA 2Q46A 4R4JA 1LEHA 1K3TA 3VC7A 4NQZA 5IDYA 4XX0A 4E5MA 1IHYA 4LRSB 3GG2A 4P8RA 4J7UA 1YDEA 2ET6A 2Y1CA 1G0OA 2JD1A 4WKGA 4BNYA 3SC4A 3OH8A 4UVEA 1P74A 1HL3A 2W98A 3D1LA 3JQDA 3UICA 4WGGA 4FIZA 4H16A 3VH1A 5JSFA 3WS7A 1LBEA 2A92A 1VL6A 3K9QO 3ETGA 4IS2A 2JD2A 5A3VA 4RPJA 5F1KA 3GQVA 2J5RA 2I76A 3QVWA 3ZWXA 3AOEA 4J2OA 5A9SB 1MA0A 2ZATA 2J3JA 1KC1A 4PLCA 4O59O 3E03A 3S2IA 1YXMA 1A9ZA 1GDHA 3ORFA 2PGLA 3RC7A 4BGVA 2A94A 1QYWA 1OI7A 1SEVA 3LYLA 1YB4A 4R41A 4J1TA 1Y9EA 3JQ8A 1R66A 1X1TA 1HWYA 4IXTA 2Y99A 3LC7O 5JAZA 3EVTA 4YAEA 4NZ9A 2HMWA 2O4CA 1QSGA 5L51A 1RM0A 4QTZA 3HJAA 1I36A 4PLFA 3C85A 3TDKA 3HDQA 3NDJA 3OEWA 2PZJA 4PLYA 4R69A 3Q3CA 5HM8A 1I2CA 4YQYA 4CV2A 3O03A 1XU9A 3B70A 1P1FA 4CLRB 5TC4A 4I9UA 3GVIA 2QRKA 1YB5A 3AY3A 3CKYA 5BNFA 3PQEA 1VC2A 3HFGA 4E32A 3ADOA 3RC1A 3HUDA 3MJ4A 2DFVA 4A10A 1V3UA 2AE1A 2R00C 4NFHA 3ZGYA 4J9UE 3H9JA 3O26A 3GDOA 2JAHA 1I3LA 3C3XA 5A5FA 2JHFA 2CZCA 3DR3A 4NNJA 3ZWWA 2Q2QA 4ALKA 1N2SA 3KYBA 1GEGA 1UXJA 1BRMA 4JJGA 4G5HA 4UVHA 2NWQA 5T57A 1AXGA 3ROQA 3SC6A 4WLFA 5I7FA 1LSUA 5DCUA 1BDBA 4KUGA 5A4DA 1NP3A 2CY0A 3UH1A 2PGJA 3PVZA 4Y6SA 3LLVA 6ADHA 1YONA 1MGOA 2O50A 1ISIA 1BHSA 1BVRA 1R16A 2BH9A 3G17A 3G3EA 3KXDA 3QWIA 4NH4A 4RF5A 1PX0A 1VJ0A 1KERA 2Y05A 3Q9UA 4OOFA 3WWZA 3ZWNA 5TLSA 1E5QA 5ITWA 3IC5A 3GGPA 2J3KA 2FR1A 3CSDA 1BXKA 4K26A 4LSMA 5ITVA 3S1LA 5CAEA 4GMFA 3GZ4A 4FN4A 3ZW8A 1DIBA 4M49A 3RWBA 1QYDA 3F4BA 3U49A 4NDNE 3RI3A 4YAKA 2WYWA 3FI9A 1SOWA 1DIAA 2VNSA 5C7LO 1KY5A 3JQ9C 2I9PA 3CXRA 4AJLA 2X9NA 3NJ4A 3VTZA 3JQ8B 3R1IA 1SBYA 4L76A 1E6UA 3BHMA 3OIDA 4X54A 4E13A 3LU1A 3I83A 3BMNA 1ISJA 2Z1NA 2WTBA 3BHJA 1NFQA 2V65A 3DBRA 3AI3A 2VHWA 3EVNA 4R9SA 4PLWA 1LRKA 3O4RA 3RIHA 3S55A 3NRCA 1O95A 4JGBA 3WICA 3TZCA 3KYDB 3PZRA 5G0WA 4TRJA 3IQDB 4WLVA 3AUSA 4ND3A 1TT7A 2HRZA 4LK3A 1PQWA 2RHRA 3CEAA 3HZZA 1DC5A 1H2HA 4WEQA 4XWYA 3OFSA 3H2ZA 4W7HA 1JVBA 4W99A 2NU9A 1E92A 1B15A 1LDGA 1EE2A 2G1UA 3K2EA 4H3VA 4WLEA 4YRBA 4BO9A 2JAPA 3I1JA 1BW9A 3LF2A 4R3NA 5FFFA 2BMAA 1IULA 5AXAA 3JD0A 2POQX 4QEDA 4RZIA 2O3QA 2HMTA 4DYDA 1UDAA 4AJIA 2GLXA 4BNUA 1WNTA 4FJ0A 1VSVA 1ZMOA 4DUPA 3INGA 1V3TA 5GZ3A 2GN9A 4ND1A 4YXFA 2EGHA 1H6DA 1K2WA 4UEOA 4E2YA 2CDAA 1LSJA 3C7CB 2R00A 4MVJP 1LSOA 1C14A 2GYYA 5TT0A 3C1TA 3RBVA 1N7GA 4FD3A 1PS9A 4CV0A 3UOGA 1XQ1A 2OXIA 4DA9A 5CFZA 3DAGA 3S2GA 2OFPA 3ITKA 3BMQA 5EQFA 4EI2A 4ND5A 3AJRA 4L4RA 2HUNA 5DBGA 1QMGA 4KQWA 1AHHA 3MJCA 1HRDA 1E7YA 2Y1EA 2OZPA 3F46A 1N7HA 1CWUA 1HTBA 4PGFA 3ZWYA 3VPSA 4HBGA 5TGDA 3H9UA 2Y1FA 1UZLA 3BMNB 3VH2A 4B3IA 2SCUA 1V3VA 1P44A 3TRIA 4CMBA 3DBRB 3IIEA 1HE2A 2GN4A 5JY1A 3IL2A 1PL6A 2B69A 5FWNA 3UW3A 4W4TA 2NU7A 1HDRA 1I01A 1WP4A 1Z7EA 4PG5A 2B83A 1TA4A 3FN4A 2BRUA 4OQZA 1DHRA 1UJMA 1KVSA 3JD3A 1E77A 2ZQYA 3GNSA 3W6ZA 1HYGA 4CM3A 2X1HA 4DQVA 3WGIA 1QG6A 4PLPA 2D59A 2ZYGA 3K8ZA 4U7WA 1ADBA 4AJJA 4RF3A 4D41A 4OH1A 2NU8A 1DHTA 1PR9A 4DIOA 1X0VA 3CIFA 1GD1O 1R15A 1E7SA 4ZICA 1S6YA 2FP4A 1PIWA 3OM9A 3KUXA 4M55A 1NASA 1NBOA 5G4KA 3NX4A 4I9HA 3UUWA 2Y66A 3SX2A 2VCYA 3K31A 2GO1A 4YEDA 3W8DA 2IZ1A 2WWRA 4CMEC 3INTA 5A04A 1LU9A 5JW6A 4BOYA 4BKUA 3RAJA 4BNMA 4HY3A 5JPIA 3CMMA 3BMQB 4UUPA 5DULA 5F1PA 3FWNA 1HF3A 1EUCA 4XYMA 1A7KA 3QE3A 5JDIC 3V1TC 4DBVO 4GQAA 4E4YA 1KC3A 1DJQA 1DRVA 2IRWA 2V6BA 3ADPA 3OQBA 7ADHA 1E3WA 5GY7A 4TVOA 3RFTA 1ENYA 1PU2A 1DO8A 2OHXA 3WQSB 4MKRA 3RBZA 3SEFA 3W4KA 4M54A 1NFRA 3U9LA 3UF0A 3L6OO 2FRDA 2DBRA 4NJMA 2IYPA 1V9LA 5A9TA 1BDMA 3GN2A 1Q7CA 4E5PA 3WMWA 2JD0A 4KUEA 9LDBA 1ENOA 4FQ8A 2CDBA 2Z5LA 3M1AA 4MVJM 5CDYA 1F8FA 1I3NA 4GGOA 3IJPA 1I3KA 2OL4A 1KY4A 3K96A 1HE5A 4B79A 1UZMA 4QO7A 4D7AA 4CLDA 1ID1A 2RCYA 5KCZA 3ITDA 1C1XA 4W82A 5JCJA 1CF2O 2P5UA 3GUCA 5TQVA 2WYUA 3MTGA 2DTDA 3K5PA 1E7MA 1XELA 4GX1A 1XA0A 1J49A 1UZNA 5C7OO 1IZ9A 1LA2A 1EZ4A 2IXBA 3WGZA 3C7DB 5JCJD 4QFDA 1PJ4A 5G4KB 3R0IA 3MCVA 2P9CA 3FRJA 4UREA 3HE3A 1LUAA 1B8PA 3D5QA 5KVVA 1X14A 3GVPA 3OF2A 2GF2A 5CEJA 2AE2A 4KDEA 3ZNOA 4BO3A 3PLRA 3QHAA 5ICSA 1LJ8A 1ZZEA 1QV7A 4DLLA 2P9EA 3OMLA 3PWSA 2GGSA 1PQPA 4P38A 3G49A 2VUSA 4XYGA 3VPXA 4E21A 1ONNA 1Z82A 4K28A 3WB9A 3OQ1A 2UVDA 4B7CA 3AM4A 5CHEA 3GZNA 3EC7A 2H6EA 4N54A 3PEFA 4D3FA 1FJHA 1I5RA 1P1IA 2UUPA 4ALIA 3FBTA 3GH3A 1ENZA 2B4RO 1UP6A 1BVUA 1B2LA 1DSSG 1FDVA 4JCOA 4D44A 3KLMX 1K0UA 3KSZO 4BO8A 1M67A 2AQ8A 1E3WB 3CPSA 3IP3A 4CM6A 1HSZA 2ZQZA 4CMEA 3E5MA 3KHUA 4W7IA 3OETA 4FCCA 1PEDA 3BYZA 4YPOA 4AFNA 4CLHA 4TSKA 1NQOA 1X13A 4CMCA 4JJIA 4NJMB 1NQAO 2VN8A 3L9XA 4OJNA 5A02A 1JAXA 1NPTO 4DLBA 5AVOA 2IZ0A 3BXXA 5L7TA 5JDIA 2NTJA 4CL3A 3JQBC 4XD2A 1TI7A 2PNFA 5BNTA 2PZLA 3GMDA 2DBQA 3UGKA 5MGBA 4R16A 1NTOA 1S7CA 1SC6A 2Q1UA 1C1XB 4GSKA 4NU5A 5MDHA 3NTQA 2UDPA 3UVEA 4AJ1A 3L0DA 4IUYA 2VTDA 4YAJA 2O3UA 3PFWO 3ZV3A 4K9DA 1HETA 4IJKA 2JJYA 3MTJA 3CE6A 1JWAB 3NTOA 4CMHA 1QYCA 1U2GA 1I10A 5FI3A 3WYEA 1Y8RA 3ONEA 1ZKMA 3DZIA 3TWOA 1LLCA 4IQ0A 3LT1A 2E49A 2Y1OA 5JC8A 3GFGA 4GX5A 3ANMA 1YL5A 4B3HA 4BV8A 4K6FA 4DC1A 2BI8A 4R51A 2PD3A 1I2BA 1A72A 5IJZA 5L53A 3ZDFA 3BIOA 2G17A 3WSWA 1EDZA 1OC2A 3C1OA 4XGNA 1GY8A 7MDHA 1XYGA 3JQAA 4FOSA 4YRDA 5EN4A 4RO0A 2OUIA 2VZ9A 2DTXA 5BSEA 1YL7A 1DOHA 3OECA 4CM8A 4F3YA 5JC1A 4WEOA 4DBZA 4OQYA 3IUPA 4B3JA 4XGKA 2EV9A 2V6GA 3TQHA 3ZU4A 1LRLA 4I1IA 5ES3A 1MFZA 4ALLA 3BZUA 3CZRA 3JQAD 1GAEO 4BMNA 8LDHA 4C7KA 4J43A 2CF6A 2OBYA 3L4BC 4Z3DA 2VWPA 1ISMA 4NBUA 1B8VA 4DVJA 3VDQA 3ANLA 3E9NA 2JFGA 1DAPA 5F5NA 3ASUA 3TL3A 5TJHA 3WLFA 2NV6A 1ENPA 3I4CA 2Q2VA 4UAGA 3SVTA 3KRTA 2GZ3A 3F5QA 1NHWA 3V1UA 3TNLA 4NK4A 2E4AA 5KVQA 2OOSA 3DHEA 3WYCA 3DQPA 3HG7A 3DFZA 3JQGA 3HDHA 3H9QA 2FMUA 3DO5A 4KDFA 3H5AA 3GNTA 1Y8RB 1RYDA 2R2GA 3PRJA 2VHXA 1A4UA 4FJ1A 4XDZA 1VLLA 1Y5MA 4XYBA 3JQBA 4GX2A 2ZB8A 3KVOA 4UEJA 3U62A 3ZW9A 2G0TA 1U7TA 5I9MA 2VTEA 2NLOA 2JCXA 5JAQA 3H3JA 3ZCXA 2A4KA 1PQUA 8ADHA 4BNVA 3QLJA 2ZTVA 4AVYA 4TZKA 1FF9A 3AI2A 3JQAB 4WOJA 4QQRA 4GKBA 1RM4A 2C54A 2A35A 2FPIA 4CM8B 1IUKA 1D3AA 3NDRA 5T6BA 4DIBA 4UUNA 4MINA 3WJAA 3EDMA 1ISFA 3TN7A 1VI2A 5HS6A 5F3RA 1NQ5A 5G2OA 4ZJUA 3L4SO 2VUTA 1ZBQA 1NVMB 4YT2A 1K89A 5I7EA 5I8WA 3X2FA 1P3DA 3K73O 5GMOA 2NVBA 4CQMB 2PR2A 3A06A 3TSCA 1L7EA 3RUHA 3DMYA 4IQ8A 1R0LA 4BB5A 3KM0A 4J16A 1XKQA 1X15A 4EGFA 4YJHB 2CD9A 3D3WA 3DB2A 4NR0A 2YUTA 3NJ8A 3CH6A 3UN1A 4BO4A 5LCXA 3L4BA 1E3SA 3FR7A 2O4UX 3JQGB 2O7SA 1JWBB 3PZBA 2OORA 5A3JA 4WASA 5G0SA 2RBEA 3NT2A 1NHGA 1U3UA 2AHRA 4IZIA 4DXHA 2Q1WA 1JW9B 3NAQA 1U3WA 2D3TA 3GDGA 1EFLA 1P31A 4EJMA 3U4DA 3VHRA 2OP1A 4CM5A 2PKRA 1ZO8A 1GADO 1T2EA 3JQFA 4N7RA 1Q0HA 2NVWA 4IQGA 3ZWBA 3HADA 4BQPA 4D3DA 4RORA 3QP9A 3ZNNA 3AUTA 3FHLA 3U4HA 5ADHA 3H9EO 1P0FA 4RPGA 4BO6A 4WPGA 4ND2A 2Z95A 3WFJA 3ASVA 1T4DA 2YFHA 4NBVA 4RDHA 1I33A 3RUIA 4O63O 2FZWA 3GPDG 1JAYA 1IE3A 3WOHA 4O5OA 1M2WA 2WEKA 4RL6A 2P2SA 1O8CA 2IEBA 4XKJA 5AOVA 1PJ2A 3IMFA 3LF1A 5A05A 4GMGA 2PH5A 1MV8A 1H5QA 4NBTA 4WECA 3STHA 1O9BA 2EKPA 3EY4A 4D0SA 2CUKA 2B4TO 4HV4A 4AL4A 4RJTA 3FNGA 3FTNA 2HAEA 2ZJ1A 1MXHA 4M1QA 4NFSA 4UVIA 1HEUA 2FSVA 1DRWA 3GF4A 1W4ZA 3VKUA 4Y8VA 1U2DA 2GERA 3G0OA 3V1YA 2QIOA 4ZQEA 1X7DA 3ETDA 3HHPA 3LT4A 3PHIA 5ER6A 3VZPA 4RCVA 3TZKA 3JYOA 6LDHA 3MZ0A 3INRA 2Y1DA 1RM3A 4Q39A 2PV7A 5THQA 1B3BA 2CDCA 5BR7A 3RFXA 3P5SA 4GVLA 1W8DA 4FFNA 1RM5A 4J49A 5IFLA 4DTIA 2AEJA 3A14A 2HCTA 3KOUA 1ZH8A 1AGNA 3OIGA 4JP2A 4A2CA 4EEXA 3UKOA 4G65A 1WDKA 5K6AC 2GCGA 5KJCA 1H93A 4EJ0A 3GC6A 4ZD6A 3QRWA 1X7HA 1V8BA 4DMLA 1KEPA 2B5WA 4JLWA 1OC4A 4L4XA 3AU8A 1KBZA 4AJNA 1DAOA 3L07A 4IM7A 1JKFA 3DBHA 2ZYDA 4J0FA 1ZXLA 4FFLA 5KJFA 3KEOA 5J23A 1JKIA 3GG9A 3LT2A 1ADGA 1E6EA 2VYVA 1A27A 4K1LA 2YFQA 2CVQA 3U4CA 1ULUA 4LCEA 4M86A 1BG6A 4IJUA 4Z0HO 5L9AA 4D42A 1KIFA 1VKNA 4RPHA 5JO0A 4PZDA 1Y81A 1P33A 2FWMX 1NPYA 3ROPA 3OJFA 4P4NA 4E0BA 2VYVD 1Q2XA 5KOIA 3HNPA 1LSSA 2HKIA 4Y6RA 2Y68A 4BB6A 1WXDA 3W6UA 4IDBA 1RKXA 2QRLA 4PG8A 4E5KA 4BV9A 4PZEA 2BFOA 3R3JA 1ZW1A 3QWFA 4G81A 3EZYA 3I4FA 3TZHA 3Q1LA 2X7HA 1XQ6A 5DP2A 5F1OA 3WQRA 2P4QA 4C4OA 4PLZA 3WWYA 4E30A 1Z75A 1ZK0A 1U3VA 5JAIA 1GZ4A 3AY7A 5KIAA 4RPKA 3BTUA 3I9OA 4XGIA 1DFHA 1KVQA 3TF5A 3QIVA 3GGGA 1Y8QA 1T25A 1SAYA 4YAIA 4HX5A 1GUZA 2BFAA 1V35A 3FNFA 1WZEA 4CR8A 4BNNA 3S2FA 1I8TA 4ID9A 3ZU5A 5CDTA 4RVUA 4J7XA 3VDRA 4GL4A 4FJ2A 4Z0PA 4XIYA 1JDJA 3GMSA 4K6CA 2P4HX 3WGGA 4BNFA 1I3MA 4MP8A 4R1NA 1D8AA 2C82A 1D7OA 2HMSA 2PKQP 4N5NA 4J4TA 4IGEA 3LZ6A 5EL0A 4ZGWA 1P1RA 3AY6A 4KWIA 1QRRA 1Y9AA 5FEUA 3DBHB 4CUJA 1PJ3A 1TXGA 3C1AA 3Q0EA 3SXPA 1IHXA 4JBHA 2NSDA 3DHNA 1VKOA 5AXCA 3ZNPA 1LLUA 1E1KA 1SOVA 3QA9A 1AUPA 2WM3A 3EZLA 3MJSA 5IXYA 1KYQA 3V8BA 5KNLA 1DDOA 4R01A 3WMXA 1DJNA 4GSLA 4S3MA 3HN2A 5K6AA 1GFSA 2EWMA 3ZN2A 4F45A 2AQHA 4U5QA 1YKFA 4BKOA 3MJVA 4KUHA 3WIDA 5GZ6A 4YJGA 2C20A 3F4LA 4EW6A 3E9MA 3GRKA 5HRUA 3QVOA 4B4UA 5EINA 4D43A 2G82A 1LNQA 3VOSA 1NM5A 4BGUA 1ZK4A 1BXGA 1GEEA 3FNHA 4DPKA 3BHIA 2O3SA 2YQ4A 4BO2A 3GEMA 1P1JA 2VT2A 2X8LA 3CMCO 4NBWA 4WLOA 1H0KA 1SB8A 1DXYA 3NKLA 4AJKA 1Y8QB 1M76A 3RD5A 1MB4A 1OZAA 3H5NA 4YCAA 3O9ZA 1K5HA 5H81A 2O3TA 2BFPA 1MP0A 3ANNA 1R0KA 2ZB3A 4DIFA 2WYVA 2Q2WA 4CR7A 1SPXA 1QORA 3WGHA 4NI5A 3ZI0A 2VUUA 1LDMA 1F14A 1IYZA 1X0XA 3JQ7A 1U4SA 4CMAA 1U9JA 1ISHA 5CP8A 4ALMA 2WD8A 1ZSYA 2UAGA 1LDYA 3JQ6A 2QG4A 3RUCA 3ZV4A 5IZ4A 4JXKA 2XPCA 4BNGA 2AA3A 1EVIA 2HLPA 5DCWA 4EUHA 1G0NA 2O3JA 4Q3AA 2FPPA 4E5YA 5CPBA 4Z9FA 3F3SA 4CMJA 5DN9A 4TRMA 3K6JA 4YAGA 2AG8A 3FWZA 1P45A 2ZYAA 2Q49A 2GNAA 3N58A 4OL9A 3PTZA 2E6UX 4BKQA 1DFGA 1F17A 4BNKA 2HK7A 4BS9A 1ADFA 2X22A 4B4OA 2ZB7A 5CEEA 4TRRA 2NUAA 4OSPA 1B8UA 3MJTA 3DDNA 4MVJA 3DFUA 2XF8A 2WE7A 1G1AA 1FDSA 1BXGB 2AMFA 3BAZA 1BTOA 2Z1MA 1YWGO 1EUDA 4YVFA 2QRJA 3GVHA 3WTBA 4BUCA 3NYWA 3FNEA 1YQXA 5FI5A 2BGLA 1BW9B 1UP7A 4CL8A 2VHZA 4ZRNA 3OJOA 3F6YA 4LW8A 1C0PA 3OJ0A 5FYDA 2EEZA 3MOGA 4MVJD 2JCVA 3GNQA 4ZQFA 3ZU2A 5IDWA 5AYVA 3GEGA 2PFGA 3Q2KA 1O6ZA 1R0SA 2PZKA 3ICPA 4FFPA 5DBFA 3WQQA 3D5TA 4XB1A 5ILOA 4BGEA 3SLKA 1ONPA 1UR5A 2EJVA 1E3LA 2ZJ0A 5B4UA 1L7DA 2UUOA 3E5RA 2X5JO 4J1QA 1NVGA 3ONDA 2NQ8A 3JQ7B 3PI7A 3Q6IA 2X58A 4GI2A 4XZ3A 3I6QA 5L7YA 4D45A 5ENVA 2EJWA 2LDXA
chains in the Genus database with same CATH superfamily
4J9VA 3MCAA 2YUIA 1WB9A 3ZWOA 4RHFA 4M46A 5HA5A 5AVXA 4LF8B 4LQLA 5L3QB 8AT1A 5IU6A 4HQFA 3BBPA 2XOXA 1AE1A 4FYIA 4OJTA 1LDEA 3LQQA 4GNRA 2HWUA 5CFPA 2OXEA 3R5KA 3N76A 2DMRA 4BFTA 5C7IO 3MN1A 4P93A 2VRCA 3T7EA 3AVTA 2FR0A 1BDJA 1K6MA 1TPYA 2QX9A 3D64A 1SOAA 1ZIYA 2GK4A 2HSDA 2OC9A 3KZKA 2C4NA 2ZRIA 3W3AD 3DD5A 3ZZMA 4PTZA 3PSHA 1NBEA 4Y18A 1Q16A 1TX4B 2A0FA 2GN8A 2PD4A 3IQFA 3P9KA 2IELA 4BZPA 1P39A 4HGRA 3OQMA 2JEYA 2PSEA 4ZU3A 1EX1A 3AKZA 1TAQA 4BJ6A 3B1ZA 4ZJYA 3H7IA 3DG9A 3QFTA 3ZDZB 3IODA 2J08A 2NNLD 3OOHA 3GAAA 4CM4A 5KAMA 3LFHA 4HAWA 4GHWA 4IG9A 4H08A 4OL0A 3RFFA 2E89A 2F2TA 1HKUA 1EUDB 1YR3A 1Q14A 3NGXA 4JIGA 4LDAA 2I2BA 3SM9A 1E4VA 4LZNA 4MVWA 4C87A 1JEYB 5LYJF 2XNSA 2INGX 2O1EA 1Z18A 5EP3A 1R4NA 4PO8A 1NX9A 5EWJA 4NJOA 4M8SA 1KQFA 1R5BA 2F1IA 2XQVA 2DFTA 2Z30A 5EXXA 4ND6A 1J0EA 1N5KA 2WP0A 3LJKA 3OURA 3FDFA 5TR9A 2IHBA 3FOCA 3NPMA 3ZXUB 4EQ6B 5A06A 1Y3IA 4YREA 4O33A 3H6KA 1W73A 2PRSA 3LBHA 5ALPA 5C5IA 3A4VA 4EDHA 3CT6A 1YQQA 4GZ6A 1YK1A 2NTNA 4MVJE 3ZCTA 2OHIA 4PXAA 3ZJYA 3MS2A 2ECPA 3K0AB 5DYTA 2LDBA 5HBGA 4BVKA 3I5YA 2CKMA 3PWKA 5TPWB 1W2WB 2BSXA 4FDMA 3EPHA 5DN6D 4Z3KA 3R0JA 1V5FA 4HCJA 2PGNA 2XE4A 4PANA 4UZSA 4HWPA 3AEUA 3H5WA 2FLWA 2IP1A 2NPFA 4AY3A 1A4IA 1M8PA 1EUCB 2AQKA 1X7XA 2HDNB 3NGLA 4OGKA 3VH4A 3VKFA 2PUGA 4H3SA 3MMXA 1M5RA 4LJ5A 4OX9Y 2ZRNA 3VR2D 5A62A 3QSYA 1ID8A 5T6MA 1CJCA 8OHMA 2X4GA 4DV2B 4PFJA 3QLVA 5CLLA 2FLVA 2XNDA 3UMRA 1IY8A 5C53B 3ZLTA 4PVDA 5HKOA 1RXEA 4FZJA 4OM7A 3GHHA 2AG5A 1VYHA 1QRUA 1JQJC 2MSLA 4RAQA 3ZQUA 4IBOA 3VZSA 1UEXC 3DBIA 1ZNQO 2CJPA 1C4KA 4D8XA 4HH0A 4Z86A 3PA8A 4MGHA 4MIYA 4EYEA 3V80A 3L7OA 2XA9A 3C6MA 3MXOA 4WY8A 1UFOA 5D87A 3WGYA 4B43A 4LWZA 5LDDC 1U7PA 2BLNA 5K99A 5EMLA 1YOBA 3SEFA 3RIGA 2GNPA 5TQ2A 4RNDB 5AJTA 5ECGC 5IXYA 5L3ZA 4CM4B 1XRSB 1F1JA 1RCFA 3JYLA 3FCAA 4OQPA 5LUBA 5FUQA 2X9LA 4RJ2A 2Y4OA 2IDZA 3D6FA 2I7TA 3H42B 1Z6ZA 3OIVA 2WY2D 4Y7DA 5JCXA 5JIBA 4HVTA 4A73A 1AUXA 1LQ2A 1V0JA 5H3HA 2BGWA 1BVHA 5FTNA 4CYMA 3J80A 3L3BA 1HFEL 2G1JA 2W43A 1U7HA 1ZG3A 2JS7A 5LZ7A 3CVWA 1XXHB 3GP3A 2NTYC 3NJRA 4KI0A 4L8YA 4OBBA 5LMZA 3QQ5A 1LLQA 4WRRA 1EK5A 1ZNWA 4FBLA 3PQFA 1ECGA 4BQEA 4PYMA 2XYVA 3BM5A 1YO6A 4MO9A 3GR6A 3RJ9A 4A27A 4UU0A 4HRVA 1CUCA 4MV4A 3G8AA 5EMHA 3QV1A 5KNDA 1AD2A 2OD9A 1EFTA 3N59A 5U4XA 4ABYA 2QTFA 1U8AA 4Y30A 3ZZTA 1IN1A 4QDTA 2C94A 3DOJA 5DEIA 1LPAB 2IBTA 1W46A 1EFPA 5LC1A 2AN1A 5EJ2A 3PUYA 4IEIA 3RC2A 5B7QA 2FY8A 2VEOA 2PE5A 4Q9KA 3EK2A 4M1YA 4DY4A 1X7XB 3AF2A 4DCTA 1A0OA 1IY1A 1X86B 2J4CA 1G5TA 3Q7TA 4GAEA 5DIFA 1V7ZA 3SZGA 3ZWAA 3E22B 3T1YB 4I0WB 1OSNA 4JL5A 4J91A 3HRIA 4CG0A 1RKQA 3NOVA 1FFWA 2HDWA 2UZ1B 1KOLA 3U09A 5ALOA 2NYUA 3D2BA 1NR7A 4FPXA 1JLMA 1PUJA 1GTZA 2AUTA 2QSUA 4IJ5A 5KQLA 2ZSBA 2WBLC 2PH7A 1WMBA 5G3ZA 4HZGA 4CWAA 3FLMA 4V1CI 3MFYA 5LQCA 1IEXA 2WSSD 5DI9A 2OD7A 1S89A 2Z4RA 3N2ZB 1SELA 1KARA 4UZFA 4OLHA 2AUMA 3PUZA 5BXYA 4GOND 4BE7B 3RFCA 1O03A 1T5IA 3QITA 1UK8A 5TQ2B 2B5OA 2PGIA 2WIKA 2HWYA 4JA2A 3N7UA 4O4IB 5TS2A 2YVQA 1ELOA 3IO5A 1CIVA 1LPSA 3O1LA 2OYCA 1OFUA 1XCGB 2PMCA 4YECA 1I6WA 4W9MC 1GL3A 1Z7BA 2CYAA 5GGXA 1WPXA 2FQWA 4S1PA 4TV9F 4WFKA 4QOEA 4WXRA 1Q57A 4F4HA 1GU7A 1WZIA 3HVJA 4RCZA 4O4LF 3ILSA 4GS5A 4OB7A 1VSUA 5AR1A 3T7IA 3WE7A 2H9YA 2GPNA 5CVUA 1VJCA 4YRAA 2C83A 4ZCLA 2D4AA 1E7QA 2QN8A 2WU8A 3AW9A 3DEZA 4N5IX 1A5ZA 2X0EA 4F4FA 2LE0A 4XXHA 4ZOBA 2W22A 2A1UA 5DYIA 1W0JD 4ZT2A 2W4QA 2X13A 3OCVA 3PD0A 4AKSA 4R7TA 1DIOB 1WV1A 2P68A 2JH3A 4AJHA 1IQUA 2F43A 2VOEA 3MBIA 4PQEA 2NUTA 3THSA 3C8MA 5JVDF 1OX5A 1J8FA 4QQKA 1YFZA 4Q9LA 2VCEA 1EFPB 4PZLA 5LDHA 2YMLA 1NRWA 5FCDA 2QS9A 3BPSA 4OD0A 4CKWA 2EP8A 2P6OA 3EQ7A 1Z15A 3V2HA 1JXAA 2ZRPA 4KLRA 4RGYA 1GG8A 4AUKA 5MFZA 4DEVA 2IOFA 2Q3CA 2QE6A 4LXIA 1E1NA 1MB2A 2H54A 5FOVA 1LQTA 4B7XA 2VP0A 3FJYA 2V1UA 1XEAA 3EZ2A 121PA 4HFJA 4RD3A 3GK3A 3PD7A 5IXSA 3KT8A 1P6UA 4MWCA 4DLPA 2FRVA 4JBGA 4MA5A 5DVZA 4AX8A 3H11A 2CMGA 1VPVA 1CR2A 3BGDA 1QIGA 1NUUA 3HSKA 4JC4A 3HR7A 1AUQA 3ZWKA 2Y0CA 3MRXA 4EY4A 4R84A 3K6RA 1EWVA 5TDHA 2GA9A 4UBLA 1O77A 4RABA 2V7QA 4I3HA 2Z0MA 3ZHZA 4AJ4A 1GTRA 1I2DA 1P17A 3NORA 4PVCA 2VHVA 4FFWA 3B1JA 5AI0A 2O19A 2UYYA 5AWFC 4NWIA 3H13A 5TJ9A 1JI3A 1SVWA 2C04A 2WG0A 2GX6A 5IAGA 1QCZA 4FDLA 2EFHB 5IVHA 4JR0A 4P36A 1P5HA 2ODEA 2WE8A 1UADA 2J33A 5A1TA 5CG2A 5J4VA 3PFNA 1XPJA 3ZJTA 3H2HA 4OUDA 4JVSB 5DYWA 2GKGA 1TADA 2YHIA 4EGCB 5JISA 1HE4A 2VAXA 5D8DA 1OR8A 4S1NA 2ZZKA 1KAOA 4OLAA 4G0XA 3HYCA 1E6WA 1J0CA 4P84A 4K7JA 1QUFA 1A82A 4PFQA 1YFLA 1VP9A 5ESXA 5ALLA 1XMXA 1Z16A 4RDCA 1H9AA 4FBGA 4KO8A 3V7WA 4X64B 4O25A 1M2EA 2FQYA 2RGXA 2ZKIA 4UXHA 2A1UB 3RT7A 3AJEA 5TPZD 4OGGA 4AIRA 4BASA 4BL5A 1XWWA 1JDVA 4A8PA 2F43B 2C5HA 2NUTB 4ZHSA 1PNOA 2FX2A 1JR3D 3TQTA 1JHPA 4TYPA 3V5NA 1K08A 1G5RA 5DYYA 3GU3A 3WLOA 3WDMA 1I51A 2Q4OA 3M6IA 2NP6A 4GI1A 4X1KA 4C78A 2IYZA 1TYAE 2FMFA 2ZBDA 4BXOA 1GQQA 2C3YA 1Z0ZA 1P3Y1 1NJ8A 4Q3NA 3D4PA 5LIPA 1ZBDA 3OF5A 2BR3A 3KTAA 4LSGA 1BOFA 1G8PA 3K5WA 3PFFA 3CCBA 3Q9NA 4MVXA 1VG0B 5J5VA 1KI1A 3JR3A 4N48A 4MVCA 1T1RA 4RKWA 2GR9A 1JJFA 2W37A 1PEAA 3HCRA 3KZXA 3WLIA 5ICMA 4U2CA 2QL9A 1U90A 2ODTX 2O7QA 2XZDA 3MFQA 1J9GA 3HU3A 4I1OA 4V0SA 3ND5A 1GNRA 5SY4A 2PQ2A 2MHCA 5FO0A 5BUQA 2YHUA 3PJDA 3S8MA 3GEPA 3T35A 1NPDA 2Q8NA 4OHPA 2PUJA 1YC2A 4EL5A 4PYJA 1WW8A 4YCMA 1ZVJA 3KWJA 4HJRA 4BX3A 2X2EA 1P2FA 1UH5A 3NTRA 4URWR 3VHLB 1KGSA 4QG3A 4K88A 3AYZB 1Z0DA 4IDEA 4BHTA 2JEZA 4ZQHA 1OI3A 1ZOPA 3MHTA 3KB2A 4MULA 2ZRDA 4ZYWA 4Y6LA 4K2AA 4OUDB 4UVGA 5K5EA 3O4FA 3FVVA 5LYYA 4D4KA 5HYVA 4I81A 1B6TA 1XR3A 1RWBA 2YHIB 3B85A 4EF5A 3QLUA 1I94B 1KI7A 3NAZA 2AEMA 3EXHA 3G13A 3HUFA 4IJMA 1TCAA 5DHQA 1A1SA 1NW4A 3DZ8A 2Z8YA 3SNHA 5K8VA 1X8LA 1XTIA 4JBYA 2FX3A 4JBIA 2EZTA 4Q48A 1P29A 3V8VA 1UPCA 2HA6A 4JHXA 1RP7A 1TJ3A 4B8WA 3BJIC 4G09A 2Q6LA 2OK8A 4TTJA 3RARA 4P3KA 5CVTA 1HY3A 1WBBA 1MVNA 1YCFA 2H8GA 4KACA 4RH3A 2VJOA 4LY0A 2CK3A 3RG8A 2C9BA 2EAUA 4NOJA 1IVYA 4NYJR 5HQTA 3TSYA 1ZN7A 5HWSA 3AL0C 1AS2A 1KYIA 4O8CA 4F9EA 2JAQA 1G5HA 2ZE5A 3ZXXA 4G6ZA 5A4JA 2G88A 5AQ1A 4X1KB 2PS9A 5IK2D 3U3ZA 3TR6A 4BXOB 4K0KB 4FYKA 4IHJB 5FBVB 4HEHA 2WDZA 4KTTE 4AWXA 3W1WA 3WNZA 1K9VF 2AZDA 5J63A 1U7ZA 2OCDA 3O4GA 3SDBA 4IDCA 4DCJA 3I2KA 4LBVA 4B73A 2PUDA 3JALA 3AHCA 3DPUA 1CUHA 2YY5A 1CW2B 3IIIA 3L06A 4MB0A 5I3ZA 5IARA 1LI7A 3B89A 2RB5A 1J07A 5DK4A 5ALSA 4A8JC 5LYJA 5LQUA 4XTRA 3GUHA 1N6HA 2JEOA 1RJFA 4HP8A 3ZXSA 4C0AC 1LWOA 3KQUA 5DOVA 1GUFA 4Y2QA 3TNFA 1KL7A 1UFQA 1C8VB 4ISCA 3ZD6A 2V59A 3L8DA 3U48A 2C92A 3SKXA 1MC1A 3GFSA 2E55A 1ZU5A 4EBBA 2H5LA 3JPYA 1FY2A 3QUCA 3B6ZA 1AUOA 2J7KA 4FINA 5ARDA 4DUGD 4YAUA 3EEOA 4QOFA 3PUIA 1TQ2A 2HA2A 4KREA 4ZDJA 1XNJA 1KRXA 1K9SA 3K1YA 3K70C 3MYRA 5JYEA 5D1HA 4ZCSA 4RF4A 2YZ7A 1T5DX 3EFHA 3U7FB 3KTFA 1W0KD 2CE7A 3JVUA 2IIQA 3I09A 4B75A 1TZKA 1L5QA 2CFTA 3F9CA 1YR1A 3N2LA 3DHWC 1H4VB 3H2JA 5JLJA 1P0CA 4AK9A 4X0EA 1T8RA 1Y9ZA 4PFKA 1ZD2P 3LOPA 4XTCS 3DAOA 2Q3LA 3PYLA 4U00A 4UBIA 1AJEA 1ULTA 3COVA 3FPLA 1VBMA 4MR8A 4FB5A 1QOPB 1YZGA 3KUUA 3NWJA 1C0LA 1W34A 1ZGCA 2XGOA 3LC1O 1NWCA 1P5RA 3MMSA 1JEAA 4K3UA 4CNBA 4CTKA 4M0KA 4GM4A 3HV0A 2GRAA 3U6BA 2F9LA 3FPGA 3DONA 2CVFA 2LPMA 2V03A 1BD4A 3A8TA 4D4MA 1I7DA 4G8BA 4GXQA 3D3EA 4L28A 5G3YA 2CV0A 5CW2A 5T7BA 4ZXFA 3WMRA 3I9JA 2ZSIA 4YP1A 4M53A 3X1YA 2WJYA 4D6XA 1Y5LA 2FSSA 5KNCA 1KZ1A 1QKIA 4Z2AA 4DT1A 5AXDA 4WNYA 2P78A 2WJVA 2AJLI 2BF7A 3QJGA 3REQA 3JALB 1HDGO 4KU4A 4TTVA 5T8KC 3KBBA 3PHBE 4GEKA 3RRBA 4JEHA 1OU4A 4QLOA 4KR0A 3S1SA 1JDZA 2Z9BA 3L8EA 3HGQA 3QM1A 4KHZA 4MP6A 5LYJB 5E4JA 3SWWA 4XRRA 4BFVA 4UDOA 3V4PB 1XUOA 3GEEA 3S70A 4RE6A 4AJPA 4QKQA 2QMZA 3NTUA 1K4MA 4X8HA 5DTEA 1KSFX 2B36A 4MVJG 3RCBA 3KK0A 4YQZA 1SOUA 2XA2A 1WM1A 3QWHA 4ZA2A 4L74A 4OIMA 3DLTA 1THMA 2EBHX 4I5EA 3ZE2B 4PNEA 4MV9A 3KG2A 1AKRA 1Q1NA 5T4EA 5B1YA 1AZWA 3DWGA 4YRZA 3UMVA 2JFUA 3UCFA 3DXZA 3LHIA 3VPGA 3BUSA 1IVNA 3MRTA 1T0HB 1S2MA 2QQFA 2E4ZA 3ZHYA 4LMRA 3GJXC 1M0SA 3DYIA 2AQIA 2P91A 4HXYA 2O2SA 3N05A 1GYQA 2R97A 5AVYA 1PZXA 2FR8C 2N0SA 4V1CB 1N2GA 1YJ8A 1ZQ9A 3LK7A 1I6MA 4MRAA 1ODIA 1DLJA 4EHAA 1R5JA 3LWZA 4TQAA 4IVPA 5IAOA 3NIGB 3BFKA 2EGUA 4CLEA 4BNZA 3HJBA 2CD7A 4M8KA 6GPBA 2OVFA 5CXSA 1APBA 2XT6A 4H0NA 1UXIA 1P2GA 4I5IA 5HKBA 4M76B 3SQOA 2WINI 1NZJA 1WCWA 2F9MA 4G97A 5JWOA 1KFBB 5KOJA 1GCOA 2FZEA 4F4CA 4DR1B 4YCCA 5JHGB 1PZGA 3B5EA 2VRNA 3EIQA 1ZSVA 1EK2A 4X1YA 4GBGA 5AM4A 3URMA 3PGKA 4TTQA 1C3OA 3VKHA 1PWHA 4JBNA 1B41A 1AQLA 3ZJVA 1FBNA 4O1MA 2EBUA 2GSWA 1MT0A 3A1DA 3EQ6A 4KGVA 1BHJA 1CR4A 3KQOA 2PZBA 4QXAA 3WRVA 4AECA 2XW6A 3F6EX 4DT1B 3VYWA 1QLHA 2AF3C 4OJKA 2I4NA 4QOGA 3REQB 1O6GA 1W88A 3F6CA 1L5SA 4IWXA 1NW6A 3OWXA 4JP5A 3ZD7A 4ZAXA 3WLTA 3JZIA 1ZH2A 4XASA 1R9MA 2V7XA 2Z83A 2J7PA 4LVCA 5BSGA 2G9QA 3GJ6A 4AO8A 3VZBA 4O4LA 1WXFA 3N2EA 4F5YA 1P0MA 1ZJWA 5F76A 1JRLA 1GA1A 3FI0A 5FO1A 1Y7TA 3QEBZ 2AL7A 4PZUA 3S28A 3U4QA 4UATA 3D7KA 4RD2A 3RFXA 2NMVA 4YJGB 3IB3A 1NE7A 1W1WA 2HQSA 3LP8A 3OWHA 3FSGA 4B35A 1ZC4A 2ASVA 3DZFA 2XUZA 2NO0A 2WHPB 3HWSA 3LV8A 1T0IA 5ALEA 4D0RA 3LCMA 4UE2A 2PMDA 1FRVA 3WIBA 4KDRA 1P9RA 1NU8A 4KIWA 4R6XA 2VHCA 2BFWA 3PNSA 4Q7EA 4D3XA 1KMQA 1YUBA 2PEZA 4Q7LA 4YYEA 3KSAC 3OA0A 5BSRA 3ECAA 4RK1A 2EW1A 3CX4A 4NVRA 1G63A 4NYMQ 2FFAA 5DP1A 1JQDA 3UG6A 1SZJG 5B1DA 3SSMA 4ER7A 2XCRB 4FVTA 2QYHA 3QEMA 4DV3B 1XVAA 1N5IA 3EEBA 3KB1A 1U04A 4P4UA 1Y8ZA 2GCNA 1I2AA 2FE4A 1PFGA 2ISCA 3GZTB 2H08A 3KZVA 3ST7A 3JQ9A 1T9HA 2DQZA 2VHQA 3GUUA 4KB5A 4CNQA 2YH2A 4UOZA 4EKEA 3O8RA 2VS1A 2ZITA 2XQFA 1PK8A 3L5KA 2UUCB 1Q11A 5CNIA 2NTVA 2QN7A 8ABPA 1NW9B 1WEHA 5EI5A 2Q45A 2I67A 2R7MA 1OLOA 3T0FA 1SULA 2XNHA 5CLHA 2V1XA 2H00A 3I64A 3WGQA 1S9HA 2C8VA 4P22A 2G06A 2W48A 5CM2Z 2V6FA 2E1PA 2QMEA 1RLIA 4JQZA 4XJVA 3BSYA 3SX0A 5IJAA 4HRAA 1TCVA 1NNI1 1WPQA 1E2PA 4FSXA 4IMIB 3EEIA 4YS6A 3TVYA 5INTA 1FC0A 2C2YA 3E84A 1RJGA 1KO5A 5H83A 3N0XA 3I52A 4QXQA 1P9LA 4FYXA 4GPBA 1U8TA 2Q2OA 1W88B 1H4SA 2SHKA 4URHA 4KZPA 3SP1A 2ORYA 3T7KA 1Z63A 1U3TA 4OO3A 3TKYA 2FEOA 1VHJA 2A0YA 5TXGA 4FR5A 4DYHA 1BROA 5KX5A 4WJZA 1N2CA 4O4LB 5JSZB 4YDQA 1YCDA 1RJEA 2OZKA 3GLIA 3VPBA 2NAFA 1R50A 4YLGA 2P2YA 2AR0A 2QSYA 2VJLA 3LCUA 2HU7A 3OKPA 3QZUA 3OLCX 4G2NA 4QEKA 4YO8A 3V1NA 5KTKA 3U4QB 2ZP1A 1UBSB 3P7MA 4LDJA 4CKXA 3F2VA 1KKLA 5TIIA 4Z4IA 2ATVA 1AGYA 1E1LA 2XJ4A 1PL7A 5I9SA 4AG3A 1XLTA 4FR0A 4BWGA 1OIWA 2R4QA 2ZDHA 2DETA 1UFKA 1DPGA 2CC2A 3MWJA 4OHMA 2I80A 3VGPA 2ZAGA 1NVVR 1N9GA 1WZNA 2VSXA 2GHQA 4IGIA 4I99A 2HU8A 3WK5A 2WAYA 1Y6JA 4IDFA 2ACEA 1YH3A 3AUKA 2O1XA 3MOIA 3QEMB 1XROA 1EG2A 4MVJH 4X8OA 5FTKA 3PL1A 4OP1A 4ZAZA 2WW8A 1NATA 4PEVA 1QZ3A 2GJSA 1LPBB 4H77A 3GJ0A 4I8XA 4XQEA 5JJBA 2FSHA 3BILA 5BN1A 5LQJA 1U28A 4GPD1 5D5QA 1Z28A 2J3HA 4BKRA 1G2IA 4D0GA 3DKPA 4C30A 1GTVA 4JASB 4I9FA 1TYDE 3MILA 1ITZA 4U2FA 2C2GA 3A6DA 4W5WA 5KTTA 4C6SA 4BU1A 2GPAA 3HO6A 1HPLA 4L27A 3ZH2A 4OXQA 1OV6A 1FNDA 2BBTA 2LNDA 5FORA 4C4XA 3I9V6 4XR9A 2WABA 2IQIA 3GRYA 4NG5A 4BAZA 4ZP1A 3TKLA 1VBNA 4BCCA 1JSZA 1M8GA 2H1HA 2ADMA 4H1VA 2ONYA 1QZZA 2BH2A 3K53A 2O0LA 4P7JA 4WE3A 4YV7A 1L5RA 3TW8A 4L0DA 1J21A 2NV2B 1U2ZA 5FLYA 3BD9A 1YDHA 4KQXA 1JAIA 6Q21A 1BYUA 5EJ5A 2VZ8A 4QELA 2W2NA 1V7QA 2FUNB 1D03A 5F1YA 5H02A 4H1WA 1H6BA 1UMBA 5GTDA 2H17A 2ODNA 3O0DA 1LX6A 3K9WA 4QODA 4QOJA 3FAKA 1G2OA 4L73A 5KX5B 1NF2A 3F9IA 2MT9A 3E82A 4X6LA 4RS4A 1G66A 1N2CB 4UMDA 3RJ5A 3D0RA 3I4LA 4UTVA 4G2TA 4OVKA 2XEXA 3GLIB 2QX7A 4YI5A 2C31A 2W9XA 3PQ8A 2JCGA 1U1CA 3H99A 4NS1A 5HOEA 4AS1A 2Y4NA 4Q3BA 1EVJA 5JNLA 2RB4A 4OAOA 4MPJA 5K03A 1IHDA 3G2IA 4TUYA 4XQ9A 4BTVA 5A5EA 2QZZA 2QGZA 3GUZA 3ND7A 4IOMA 2H48A 3A3PA 3JD4A 2GZRA 4QHSA 5DM0A 2WMDA 1WS6A 2IP4A 2ES4A 3U4IA 2XCSB 4Y1FA 1N9GB 4RY2A 1TAHA 1JFTA 1XD8A 3CH5A 3J7TA 4JLKA 3A9WA 3DE4X 4QU9A 4BNHA 2X0RA 4YCNA 5ISMA 1OFUX 1QV6A 2FPSA 4FHZA 4ZFNA 1YS4A 4CN9A 5I48A 1PCXA 5FL7A 3M3PA 4O0LA 3MQ2A 3GLIE 1OMOA 1XFAA 5EXDA 1MA3A 3IYLW 2Q6IA 3ND8A 5KC9A 2DPGA 3RUEA 3STWA 1J90A 3C3MA 4PPGA 5JAPA 3FFWA 3AF3A 2OV4A 5KHOC 2OZVA 1XSEA 4IWNA 3WIUA 2P6PA 3EW7A 4LBZA 3LSYA 4KGXA 3ML1A 4OJYA 3GLFE 1W36B 2X5OA 4EKYA 3V1LA 1M2JA 1ZM3A 3CF4A 2ZE8A 3Q5EA 4BNWA 2VPZA 5AK4A 3K2BA 3ICWA 3W05A 1IN8A 5EWMA 1YQTA 5JH7F 4XB2A 3SKVA 3PPVA 1MG0A 1EFRA 1POXA 3H17A 3NC4A 4GX0A 3VZQA 1CV2A 5IJ0A 1O9HA 4R1MA 4ND7A 5HKLA 3NXKA 4TMFA 1ZJZA 1T8UA 4QSMA 2ZB4A 3ABZA 2PLWA 3DNPA 3SR3A 3TW8B 5IM4F 1P4JA 5A0TA 5B7GA 2IEYA 2DUUA 2AX4A 1R0ZA 3RLFA 2WYHA 3ESQA 2CNWA 4FTWA 2W2LD 3CLRC 1UMBB 2IUTA 2IHYA 3LOQA 3RVLA 4LC1A 3U1TA 1NXPA 1KSJA 3NUGA 4MKGA 3GOQA 1KEVA 4WXMA 3SX4A 3HY6A 3AGPA 3L7NA 4KE7A 1XVVA 1QV9A 3ZHRA 5CA1F 4DMHA 1SZCA 2R8YA 2XI4A 2X8JB 5BWBA 5FUBA 4FS8A 2KX7A 4U7DA 3ZUGA 4UTRA 1L7NA 1YASA 2GARA 3HH8A 4KG7A 2R8XA 1I7QB 3LL7A 4PLTA 1CYEA 4TUYB 5DLDA 5L4SA 3K9CA 3B1VA 3L1JA 3M6XA 2JIZA 4OXKA 1UXHA 2AEFA 4L8LA 1FQKA 4P7FA 3M2PA 4RYLA 2FWIA 5FYQA 4WX2B 4YYZA 1SU6A 2DQYA 2YN4A 4U9HS 3G9XA 3VR5A 4EEZA 1L4MA 2GCEA 3ODGA 4XARA 3OOEA 5JAMA 1UT5A 2HK8A 4JN6B 1M5TA 1UDWA 2XZTA 4W9NC 2BGKA 3EHEA 2FOLA 3PC2A 1T24A 4U8GA 4G0YA 1YB1A 4ARAA 5JS8A 2D13A 3DH0A 3E70C 1WZCA 4F86A 4W9RA 2Z3WA 2VRBA 1WIWA 2G6BA 1HSOA 1J42A 3D6AA 3EUFA 4WACA 4Z0TA 3IPCA 1UEJA 2VP5A 4DHEA 4INJA 4DDTA 2GUGA 1UWCA 3V2GA 4AQYB 3HSSA 2C0CA 1NLUA 4ZQBA 2YVLA 2IHVA 5LD2B 1DEHA 2RGBA 4QPJC 2VWQA 3ZZ0A 2YJ3A 1RD4A 1R9NA 2OB1A 1XK6A 1MAHA 4HZUA 4ZTUB 1UPUA 4Q1CA 5HMLA 1IWPB 1QIIA 2A9OA 1YDWA 4AC9A 4B8YA 3N87A 1QVRA 1EFAA 5J1SB 5DNUA 2PSFA 4W5JA 2QUJA 3W06A 4QWMA 1DFIA 3OKFA 5B1IA 1ADJA 4NABA 2ZR7A 3GGDA 4MA4A 4WXYB 5E9WA 1XDBA 5JY6A 3PNQA 4LHYA 2FPXA 2H2FA 1PUXA 4R5MA 1CUEA 1QB7A 2KMLA 5TT1A 4MW5A 2P6RA 1UZAA 2X0JA 5TRTA 1Q7TA 2YV3A 5PNTA 1TRHA 4HQ0A 5KWSA 3W1EA 3TL6A 1SBNE 2Z2IA 5L3SA 3AP1A 1FPMA 3N8KA 2PN1A 4JVMA 3QE9Y 3DOCA 4FZ3A 4OCZA 4KE9A 1QS0A 3AR8A 4OHUA 3KV3O 4OKNA 4KRYA 4PC7A 3SYRA 3WI7A 3VXKA 3N0WA 3H2KA 3PCXA 1SVMA 1R74A 2CSUA 1ZIDA 3L8FA 2QJTA 4EUSA 5J2UF 1GPJA 4C3ZA 2HNKA 1JKJA 1M1ZA 3KFLA 1SUBA 3MUNA 1Q0LA 4PGMA 4YDRA 2HBYA 1C8KA 2HHAA 3CNOA 3G79A 3ZCUA 4H1UA 3DT9A 5H1YA 3LBIA 1BEZA 1QG4A 5TMBA 3GCWA 1ODLA 1HDEA 2WDPA 4PO9A 1L7VC 1Z45A 3VR4D 2QEQA 4WLEA 4YJKA 1XHLA 1PJAA 1IFXA 1T5BA 2QUKA 5K7SA 2C8KA 1OWMA 2J5KA 1EE9A 3I1YA 2BGRA 5FBKA 2H0AA 1DXQA 2PA0A 2VF5X 3QXSA 5C5EA 3KKOA 5T67A 2ATCA 4AJ2A 2C5AA 1VJ1A 4B4DA 1UC5B 3D7LA 3SCZA 1VBFA 4YWJA 4GLBA 3CR7A 4E11A 5C32A 1N3LA 1LZKA 1S2OA 1J0BA 2W2KA 2R65A 1SNYA 4JELA 1T2VA 4DNOA 4F91B 2R5FA 5KJ6A 3ICQB 1U0SY 1CERA 2A88A 3KKKA 1X7GA 4K6KA 4DJTA 3K71B 3AUUA 2V4UA 1U7DA 3VPHA 3C3KA 1HLFA 1WMAA 1DXOA 3DT6A 3MTAA 3QWAA 4L02A 4QDZA 4YCBA 4A6PA 1CR1A 3AM5A 3QFCA 3L0ZA 3BD7A 4RGVA 2JHCA 5GPBA 3EH2A 4A7PA 1GLNA 1UKZA 2XYHA 4GI7A 2I66A 3L8MA 2YFKA 1FA9A 4JT9A 5TY0A 1UT6A 3L7BA 4EZEA 5IJXA 3IQGX 2VJYA 2I2FA 4NG4A 4P81A 2GM3A 4UE6A 2D7DA 1UF9A 3KXLA 4W5OA 4D56A 2ACWA 2D0OB 4X7MA 5EP1A 3TW6A 4KOAA 3S8EA 13PKA 2AJDA 3VKVA 8ATCA 1HK7A 1T6ZA 4PQRA 4YTEA 3DYVA 1XVIA 1A8SA 2QQ5A 2BY4A 2HT1A 1E2FA 1XTSA 4FS3A 2GNOA 4RKEA 1E60A 4PSAA 2ZSFA 4JI4B 2Q5HA 3QXJA 1Z07A 2AFVA 4XM0A 4XQCA 4DPLA 4Q9HA 4OXXA 1OGJA 3GI1A 1QS0B 2L17A 1ABEA 1GO2A 2I1QA 4ZAVA 2X9GA 1WG8A 1Q0RA 1SQFA 3ZV7A 3IE1A 1SWVA 3V7UA 3OCYA 5AVWA 2WVAA 2WICA 2P62A 2GFIA 4G37A 3GRZA 1FX0B 5AKZA 1C7ZA 1N5DA 2FPGB 4E2WA 1ZN9A 1ZMTA 3VPFA 3AK4A 2EGGA 1JKJB 3IHLA 3KJFA 4JHLA 4M7OA 4MWTA 4HGNA 2NU6B 4YJ3F 1QR6A 3NO4A 2QD3A 5E1BA 3CTPA 1FMCA 4B17A 2XOKA 2FW0A 1A50B 1DBVO 1SM4A 4L22A 1QR2A 1CLUA 4Q18A 4XIJA 4QGBA 4TOIA 4G86A 1MABA 1TKAA 2IZ7A 5KCMA 3TQCA 3PEYA 1HDOA 1XC7A 3OBBA 3FKQA 4J1NA 4AWBA 1OZGA 1QYXA 1LDNA 4J76A 3SS8A 5U4QA 4IEEA 3V48A 1BS2A 5ITSA 1PJCA 1H5UA 1KMIY 3Q2IA 1KI2A 2AC2A 2QQGA 1L1FA 3LRTA 1FRFS 1L1EA 5IDXA 4CKYA 2RGGA 4AJEA 3A05A 3WXMA 2QMQA 4W5QA 2W2KB 1DQPA 3GLHA 3PQ4A 4HDAA 4UBOA 3ZEAA 2E5LB 2C4KA 1FP2A 1E3EA 1CQZA 1G5IA 1C41A 4G0NA 1LEHA 1SXJD 1LB1B 3A1EA 4IVRA 3V55A 4KLNA 3KPJA 4FI3F 5IDYA 3VC7A 3ZE9A 2FVYA 4AN4A 4QYTA 2PPVA 4BU0A 3WAJA 4KC0A 4LRSB 2OCGA 1P1CA 2TYSB 2UKDA 3E7XA 1KWKA 4JJAA 3GLKA 5J58A 4HMQA 1XJCA 1D1QA 4B6GA 1P74A 1WX1A 2W98A 2HBRA 4WKOA 1DOZA 2F1JA 3PR3A 4UHHA 4WV3A 3DNMA 4X44A 3N8HA 2WM8A 2ASEA 4KV9A 4EW2A 5T4HA 1BU8A 3FNRA 2A92A 4WL0A 1VL6A 1XQWA 2CXOA 4Q15A 4ZT4A 2AKYA 3ANXA 1T8TA 3C14C 3FCSB 5ALIA 4C4YA 2I76A 3OX1A 3KPWA 3QVWA 3ZHSA 1I80A 2PCJA 4J2OA 3VYUB 4ZYVA 1FL9A 1MA0A 2P2ZA 2J3JA 2ZATA 4XE5A 1U98A 2CHFA 5DM70 1GPUA 4N6NA 3LTNC 3RVQA 1XRQA 2WF6A 3S81A 3ONVA 1BQEA 1A9ZA 3L7DA 3PIRA 4PQYA 2BEKA 3Q3VA 6YASA 3PFIA 3RC7A 3FTQA 1QYWA 4EYOA 1SEVA 1JFVA 4LAFA 3PUVA 4C1NA 4ECEA 5ANRB 3BSSA 4J1TA 4AS2A 4B2IA 2C9DA 1YS7A 2Q5IA 3L1UA 1Z13A 4JSTA 3JQ8A 4OK3A 2VTBA 1RYFA 5JAZA 4YAEA 4NZ9A 5BSKA 2O4CA 1QSGA 3OCWA 2GBLC 3RE1A 5JJLA 1RJ9A 4ESHA 4KIUA 1CDDA 4RIEA 3HDQA 3NDJA 2G4LA 2PZJA 3OPQA 1ZS9A 3LECA 3NHZA 2BR4A 3FDXA 3IDFA 1I2CA 2FFBA 4LQ4A 3O03A 4X7PA 1GPYA 1J7KA 4PGHA 2AWNA 4YQYA 4AUMA 1XU9A 3M1YA 4MXDA 1CY6A 1TQ4A 1HE1C 2W6ID 2QVYX 5FP0A 4MUBA 1F1BA 3CKYA 2B2XA 2V0NA 2JKYA 1QVZA 4BB0A 3ADOA 3RC1A 2EU8A 3HFJA 2EOAA 3KT0A 4J9UE 1G19A 3B3AA 4NFHA 3ZGYA 3EZGA 4FMCF 4AUNA 2ILVA 2F59A 1WY5A 1I3LA 3GLHB 1V37A 3LPCA 2FX5A 3DFFA 3PC3A 4ZT5A 3LIIA 3UH0A 3T1QA 1WOYA 2GAJA 1THTA 2QNRA 3F4KA 4X90A 5GV7A 3KYBA 3ROTA 1T29A 2ADOA 4YCLA 2FQQA 4JJGA 4M1OA 4G5HA 4ZPJA 2NWQA 2Z8YM 3G5TA 5JI2E 2H92A 3GYBA 1CBUA 5DCUA 3Q41A 4REQA 1RBYA 4KUGA 2C9MA 4GRIA 3TMAA 3M6UA 2PGJA 3PVZA 4WUTA 3IEIA 4Y6SA 5C34B 4BAGA 4EO4A 6ADHA 2DEUA 4OYLA 3G17A 3KXDA 1S3GA 1G5FA 5E2AA 5MN4A 3TD2A 4E1AA 2XVZA 3IC5A 1GZ7A 5ITWA 3HBMA 5L3VA 4JWKA 2X3YA 1QGAA 1ZD1A 2RDMA 3A4IA 5B6PA 5FULA 2ZVPX 4E4TA 4EKDA 4BMCA 4QIHA 2D2XA 3S1LA 3SI7A 2HMYB 2Q7DA 2JBWA 5I7AA 1Z2EA 1OB2A 2BKXA 2YFYA 1R8XA 4EX7A 5AKLA 7AT1A 1F4VA 3UK6A 4HQNA 4YAKA 3OZXA 3LY7A 2HQOA 1X7YA 2O5EA 3BGOS 5C7LO 1ZYUA 3RQIA 1WVIA 3PQ6A 4TLLB 3ZQ6A 1KJIA 2QTVB 2X9NA 3Q3EA 3CJTA 5CNMA 3VTZA 5AJHA 3AUXA 1RE1A 3JQ8B 4M1KA 4BJ5A 4D9FA 3W5CA 3OIDA 4X54A 5GAJA 5JNTA 3MS7A 4PZ0A 3AUYA 4OU4A 5IBCA 3M83A 1L4EA 2FWBA 1RJ9B 3E3MA 1KAEA 3FUVA 3QBTA 1ULZA 2GZDA 2V65A 2XOEA 3G23A 1ZH0A 3AI3A 1BDIA 1K2VN 3EVNA 4R9SA 1W5SA 4INZA 4KQIA 4PV7A 5CU7A 4ZO9A 4EGSA 5AMXA 2WILA 2YXDA 3NRCA 5JH7A 1O95A 2JJ2D 3TZCA 5KVAA 2A9RA 2R6AA 3QNMA 5AQEA 3B3FA 3ZPXA 3IQDB 1UIMA 2P9HA 2NPOA 2PS3A 4DSZA 2HRZA 4LK3A 1M0EA 1KXJA 3TPZA 3CEAA 5HX7A 1O0BA 1KEEA 5BR4A 4XWYA 3OFSA 2NYRA 2F17A 4YDHB 4W7HA 1J1ZA 4Y3UA 3CX6A 4W99A 3OMXA 5KYKA 2VSFA 4LBWA 1USKA 2E9SA 3EF3A 3WJ1A 4BO9A 4DARA 2P77A 2TECE 3ZH9B 1Z6XA 3WLRA 2LBPA 1BW9A 1Z35A 1GLVA 3ILYA 1P2VA 3LF2A 3DULA 1IULA 2ACKA 3IQWA 4PCLA 3D1JA 4DV5B 2AYYA 2POQX 2VJKA 1DEOA 2AEEA 4QEDA 4REQB 1MJ5A 2NXEA 2O3QA 1IY2A 2R62A 2ZRLA 1GGJA 2HCRA 2KLHA 2GLXA 4OEHA 4C03A 1JDNA 3LXUX 4C0BA 5GZ3A 1OH7A 3C6ZA 5EKSA 3I6BA 4CTOA 4YXFA 1E79D 1H6DA 3HMKA 3EQ8A 1LSJA 2AOVA 2YZGA 4CIAA 2FUCA 4M88A 3CNHA 3LPDA 4TKVA 1EGAA 2I29A 4RETA 4YLEA 1ZI9A 3TOZA 1VIMA 2YJNA 5FAXA 1JZQA 1XQ1A 2VQ6A 4DA9A 5CCDA 1DKOA 1RHQA 2WAAA 1V6SA 2VIIA 2Z5GA 5KNCH 4YGXB 3BH6A 4OQDA 1WEKA 2G6TA 3DL0A 2HUNA 4FCVA 3O8CA 1X7YB 5AICA 3A9TA 1G4HA 4B2LA 2PKYX 2IZ6A 1E7YA 4GMHA 1CF9A 3ACBA 2OWEA 4FHEA 2AH5A 4HN2A 4F1JA 1CWUA 3AFGA 1MIHA 1SRQA 3PHCA 4PGFA 5CIWA 3O90A 1F9EA 1XX6A 3M9WA 1H0RA 4UDXX 3B1WA 2CNKA 3WZLA 2VBCA 2Z6QA 5MN6A 4G5OA 3BVPA 4EENA 4IOLA 4BZQA 2IS2A 1RLUA 1CZUA 1ZICA 5AW7A 3D81A 3PICA 1Z5PA 5HDBB 2GN4A 3VU9B