1NG2A

Structure of autoinhibited p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
b'ILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosolic factor 1
molecule tags Oxidoreductase activator
source organism Homo sapiens
publication title Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A01
4J9CA 1X27A 4OMPA 2J06A 4DEXA 3VRYA 2RQVA 1TUCA 1YN8A 1MV3A 2CSIA 2LZ6B 2DL8A 3EG2A 2G6FX 1KSWA 4J9HA 1ABOA 1WFWA 2M0YA 2XMFA 1FYNA 1NLPC 4AFQC 2ABLA 2AKLA 1NLOC 4F17A 4J9DA 1X2QA 2GQIA 4DEYA 1OOTA 2GTOA 5IH2A 1WLPB 3VS0A 1B3QA 4F16A 2JM8A 4HVVA 4IIOA 2KRNA 1QWFA 1UE9A 3RNJA 2DA9A 2KYMA 1PWTA 1T0HA 3VS3A 2C0IA 5FWBA 2KRSA 2D1XA 2YUQA 2O9VA 1GCQC 1U5SA 2V1RA 4GBQA 2HDAA 2DLPA 2HBWA 2EGCA 1VA7A 3JV3A 5GJVB 2MCNA 2DL3A 1OEBA 1NG2A 1AWXA 1OV3A 4X1VA 2BZXA 1ZUUA 1FMKA 1RUWA 1WDXA 2K6DA 3PE0A 2FPDA 3UA6A 1SRLA 1UFFA 2K9GA 2MIOA 4QT7A 3VS6A 2O88A 1GL5A 2FPFA 2M51A 2KYBA 2OJ2A 1RLPC 2MOXA 1IO6A 4AFUC 1ZUYA 1K0XA 1PKTA 2H8HA 3M0TA 1H92A 2K2MA 1JO8A 2DM1A 2YT6A 3VS1A 1GBQA 1ZLMA 1H3HA 4HCKA 1QKXA 1OPLA 2F2WA 1GCQA 1UHCA 1GFCA 1SHFA 1W6XA 3REAB 4AFSC 2HSPA 2DF6A 2L3SA 2LJ3A 2LJ1A 1UG1A 2OAWA 2K3BA 2C0OA 1RI9A 2DMOA 4LUEA 1JQQA 2ED1A 2EYWA 2YUOA 5I22A 5FW9A 1A0NB 1LCKA 1TG0A 1ZBJA 2LX7A 3PVQA 1S1NA 1BK2A 1M3BA 4OMLA 3O5ZA 4JZ4A 1YWPA 2CH4W 2PZ1A 4Z88A 3EGUA 3NPFA 1K0SA 2F2VA 2J6KA 2VVKA 1X2KA 2RNAA 2YUPA 3SEMA 1WIEA 1SEMA 1GCPA 1PRMC 1VYUA 3SHWA 2KT1A 2KT8A 4AG2C 1XOVA 2FG0A 5IXBA 1I1JA 2EYXA 3M0RA 1QLYA 5IXFA 3UF4A 4JZ3A 1ARKA 2EGEA 4JJBA 2GTJA 3UA7A 1WA7A 1OPKA 2FO0A 2KBTA 4LE9A 2D0NA 1WX6A 1WXTA 2HCKA 4RTWA 4JPBW 1E6GA 1K9AA 3REBB 2YUNA 1ABQA 1AVZC 4Z89A 2EPDA 5GJWB 2P4RA 1NEBA 2AZVA 3M0SA 3NMZC 3EG1A 1U3OA 2K79A 3M0QA 4ORZA 2CT3A 1SPKA 2VWFA 3H41A 3RBBB 1T3LA 1VYTA 2W10A 2RMOA 3QWXX 4D8DA 2PNIA 2EVRA 1RLQC 1I07A 2RQRA 3I5RA 2ESWA 2LCSA 4Z8AA 4R0KA 5I11A 2DVJA 4JJDA 2CSQA 4WCIA 2HEQA 1JXMA 2RQUA 2L0AA 2CREA 1M8MA 2OI3A 2BZYA 1PRLC 4Y92A 1AEYA 4ESRA 1T0JA 3CQTA 2O9SA 3VRZA 3VS5A 1AOJA 3TSZA 1PKSA 2V1QA 1NYFA 2VKNA 2LQNA 4AFZC 2KROA 1TUDA 2JM9A 2FRWA 1NM7A 2J7IA 1M3AA 3VS4A 2EYYA 1HSQA 2RF0A 4RTZA 4RTTA 2BZ8A 1YNZA 2A37A 2LJ0A 5ECAA 3FJ5A 1J3TA 2JTEA 3A98A 2KEAA 2A36A 2EYZA 1T3SA 3H0IA 3THKA 2QDLA 2PTKA 1AZGB 1X43A 3H0HA 1ZX6A 4IIMA 4FSSA 2AK5A 2ENMA 3I5SA 4ZNXA 1N5ZA 2FEIA 1X6GA 2J6OA 4J9EA 1UJ0A 4LUDA 2F2XA 1BBZA 2KRMA 2J6FA 1UJYA 2FPEA 3VS2A 1Y57A 3KFVA 2JS2A 4HVWA 3ZL7C 1Z9ZA 2DBKA 2SEMA 4J9FA 3C0CA 1KIKA 1MV0B 2CUDA 2DL7A 2JMCA 5HCKA 4A63B 1Y0MA 5EC7A 2RN8A 2SRCA 2A08A 1UTIA 2O31A 1SHGA 3M0UA 1K76A 1GRIA 4J9IA 1E6HA 3NHNA 2ED0A 2KXCA 1W70A 4CC4B 4RTYA 2CDTA 1H8KA 1HJDA 2ECZA 3EG0A 3PVLA 2KNBB 4HXJA 2EBPA 2JMAA 1NEGA 4D8KA 1VYVA 1UECA 1CKAA 1JXOA 1YCSB 2D8HA 2YSQA 2DILA 2EQIA 2GBQA 3GBQA 5IHKA 5FWCA 4AG1C 1UHFA 1UDLA 1M3CA 2CUBA 1I0CA 1GBRA 1UGVA 2KR3A 1G83A 1CSKA 4OMNA 2C0TA 2FRYA 2CH4A 4RTVA 1JEGA 2JT4A 2DNUA 2NUZA 2BTTA 2JW4A 1Z9QA 3EHQA 1SSHA 2JS0A 3R6NA 4CC7A 2JXBA 5IHIA 3I9QA 1WXUA 1U06A 4J9GA 1AWWA 4RTUA 3I35A 2A28A 2J05A 2L3PA 4LN2A 2GGRA 4RUGA 4OMMA 2NWMA 3IQLA 3M0PA 2DRKA 4KRTA 1YWOA 4E6RA 1PHTA 2EKHA 4K11A 2LMJA 1AWJA 2X3XD 2YDLA 2ROTA 2KXDA 4F14A 1X69A 1K4US 2LNHB 2RQWA 2AZSA 4HVUA 2L3QA 3VS7A 2DX1A 2DL4A 2O2OA 1V1CA 3LH5A 1EFNA 1E7OA 1WI7A 1AWOA 2EGAA 1SRMA 2RPNA 1UUEA 1WYXA 1NYGA 1W1FA 3TVTA 1BU1A 5L23A 1WXBA 1MUZA 2B86A 4OMOA 1JU5C 3U23A 1HD3A 1M30A 1ZSGA 4JJCA 1BB9A 2DYBA 1AZEA 2DJQA 2D8JA 2KGTA 2GNCA 2DRMA 1QWEA 2CT4A 3TSWA 2K7AA 2I0NA 1AD5A 1KJWA 2IIMA 4RTXA 1CKBA 4GLMA 1YP5A 2ROLA 1PNJA 1G2BA 1ZUKA 2AKKA 2EW3A 2L2PA 1B07A 3EHRA 1QCFA 2X3WD 1KFZA 4EIKA 3H0FA 3QWYA 2KE9A 3NGPA 2LQWA 2LP5A 1GFDA 5IHNA 3ULRB 3UATA 2RQTA 4LNPA 4J9BA 1QKWA 4OMQA 1X6BA 2DE0X 4CC2A 1K1ZA 2W0ZA 2DL5A 2DBMA 1M27C 4M4ZA 4CC3A 3EG3A 2E5KA
chains in the Genus database with same CATH superfamily
2DXBA 3BE3A 4J9CA 3CCQA 2J06A 3VRYA 1M9SA 1M5Q1 2FZGB 3MEVA 1TXQA 2LZ6B 3EG2A 2G6FX 1KSWA 3PIPA 1YJ9Q 3QDRB 2M0YA 2XMFA 4MZPA 4AFQC 2ABLA 2LDMA 1IGUA 1MNDA 2NUTA 4F17A 3CCSA 3CC4A 3QUIA 1X2QA 2FHDA 1YJNA 1U1TA 4DEYA 5GAN8 2GTOA 4E7IA 2XU8A 1D1CA 3L42A 3VS0A 3LH0A 4A53A 2VXFA 4M77A 5LJ5d 4IIOA 1OU9A 4DOWA 4XTUA 3CMAT 1DJ7B 3JCMc 2P0QA 2F5KA 5LJ5f 3CCMQ 3V8KA 4GBQA 2V1RA 4F7UG 5DM7R 3OB9A 5GJVB 3OW2P 2DL3A 3VUZA 3S3NA 5HKCA 3QBYA 1OV3A 2RM4A 2XHCA 1UFFA 3VS6A 1GL5A 2M51A 1QP2A 2R5AA 2OJ2A 2GF7A 4J6XA 7AT1B 1K0XA 1QVGS 4PL6A 1RADB 4BUGA 1C0MA 2EQUA 4HCKA 1QKXA 2VYTA 3F70A 1UHCA 1EX4A 1SHFA 4M75D 4PKCC 3SWNC 4M75F 2DF6A 1UG1A 2OAWA 3GLXA 4PFOA 2FL7A 1VQPA 2GFUA 4NL3A 1FMWA 5I22A 4FL6A 1TG0A 3JRZA 4OB2B 4NOYA 1M2VA 1ZBJA 2EWNA 3FB9A 2DTOA 4KUIA 4OMLA 3JAME 3O5ZA 4JZ4A 5GAMf 1Y96A 1NPRA 5GAOn 2RNAA 1WIEA 1SEMA 1GCPA 1PRMC 2CP6A 3SHWA 2CZ0B 1PC0A 2YHTA 3Q1JA 1ARKA 2EGEA 3OSVA 2GTJA 1M8VA 5FROA 1IB8A 1Q82U 2D0NA 1PD0A 1WX6A 1FX7A 4JPBW 1BCOA 3QZ5B 4KUDK 1VQKQ 1Q82R 4OMFB 1ABQA 5LL6S 3JCMW 4L6V5 2DKGA 1JJ2P 2LCCA 4EPCA 3R6OA 1MMGA 1M1GA 3OYFA 1IHWA 2E6NA 4C0GA 3RBBB 1VQ5A 3EAEA 1VYTA 2RO0A 2RMOA 3QWXX 4D8DA 4BY6C 2RQRA 3ZEHA 2E4HA 2DZCA 4FIBA 4MMKA 4R0KA 2LNVA 3TREA 2K5LA 4PJOG 3ZBDA 3UDCA 1M8MA 2BZYA 2PUKB 1PRLC 4M75E 1AEYA 3VS5A 2QQSA 1PCXA 4XU3A 1NYFA 1M1FA 3S6WA 2DEUA 2JM9A 3HPWA 3VS4A 3GOXA 1VQMQ 1YI2T 4FU6A 2Y90A 2RF0A 4RTZA 1BKBA 3D7SB 4RG8A 2LJ0A 2MF2A 3FJ5A 2JTEA 4PJOF 4RCCA 2A36A 3H8ZA 2XDBA 3THKA 2QDLA 3CCMA 1Q86R 2QXFA 2YLBA 1TWBA 1ZX6A 4J6YA 3ASKA 1SF9A 2EJGA 2AK5A 2ENMA 3MKDA 4ANJA 4M78G 1X6GA 1N8RU 4M7DG 4N4IA 1OQKA 2F2XA 2FPEA 2NUPB 1Q7YR 1N8RR 1FMVA 3EFRA 5C6SA 2PVOB 5KYYB 1UGPB 1R77A 3GP8A 1BI1A 4J9FA 1KIKA 2F1LA 1MV0B 2DYIA 4A63B 1LPLA 2RN8A 3OS1A 2SRCA 1KQSA 1YHQA 3MCAB 3M0UA 3CCVQ 1GRIA 3NHNA 5D7UA 1PD1A 2JTFA 3JSCA 4F7UB 4JJNK 2RJDA 3HL8A 2JJ9A 4BY6B 2JMAA 4NL2A 2X4JA 5GANh 1UECA 1JXOA 2LVMA 2M9UA 1NPPA 2E70A 2YSQA 1EZZB 2MPXC 3SDZA 4HCZA 4AG1C 1UEBA 1QP3A 1UHFA 2MWOA 4HT8A 1WGSA 3L2WA 1RAAB 2QQ9A 2L89A 4OMNA 2C0TA 2F69A 3QG1A 1JEGA 2JT4A 2DNUA 1IHVA 3EH2A 4GLKA 2MYSA 4MDXA 1SSHA 4CC7A 5IHIA 3JCMJ 4MZMA 3META 4J9GA 4OB1B 5KYUB 3QSUA 3INZA 1V76A 3IQLA 3M0PA 3OA6A 4J83A 3URGA 4E6RA 3CMEQ 4BE2A 1YJ9T 4K11A 2LMJA 1AWJA 2KQWA 2RHYA 1D0YA 2QDYB 2ZPFB 2VC8A 3RMQA 4M75B 1TOVA 3TQ7P 2LNHB 2RQWA 2ATCB 2RK1A 2AZSA 1WPYA 2L3QA 1YCYA 2OTJT 1D1AA 4LXCA 3CCRQ 1SSFA 1WI7A 4KGVB 1AWOA 2O4XB 2MMPA 5CKEA 2ZCFB 2QASA 1W1FA 1ZA2B 3TVTA 2MI6A 2ZPBB 2HD0A 1YJ9A 4HCCA 4FSXA 3U23A 1JJ2S 3MP6A 3JCMf 1VQ4T 5KYWB 5AYFA 2VUBA 1D3BA 2DYBA 1AZEA 1AHJB 2DJQA 3OMCA 2HQXA 1AT1B 3CPWA 1QWEA 2P4TA 2RHXA 2K7AA 1LNXA 2IIMA 5IN1A 3X20B 4GLMA 1PNJA 1G2BA 3CXCA 3CC7A 2DD5A 2MWPA 4M77C 2X3WD 5GMKj 4DBHA 1YITA 4EIKA 3JCMb 3CC2T 3MEUA 2KSSA 5CQXA 2P0KA 2CP0A 4J5YA 3EG9B 4J6WA 3M9QA 3ULRB 5GAN6 1X6BA 1N9RA 2W0ZA 1VQMT 4C8QC 4M4ZA 3CCST 4CC3A 3EG3A 1I4K1 4X9CA 5GAN7 1N27A 1QVPA 1YN8A 1MV3A 2CSIA 5FU6C 3FRNA 3G1JA 2DL8A 2GFAA 1NZ9A 1R8OB 1WFWA 3GF5A 5KCOA 1FYNA 4M78D 4JS5A 4PJOE 4M7DE 2KVQG 5LJ3d 4M7DD 2XIDA 1BI2A 1TSFA 3V7RA 1VQ8A 3MJXA 3OYIA 1QVGP 1WLPB 1B3QA 5DY9A 4F16A 3A8GB 2QTVA 4HVVA 3BDLA 3MO8A 4O5VA 1U1SA 3RKXA 4F7UE 3CC7T 2QQAA 2RJCA 4EMKC 2EYQA 3G71A 2R58A 2ZGWA 4C92G 3LW5E 2D1XA 3RMSA 2JVVA 2HDAA 2DLPA 2HBWA 1BIBA 3CCVT 3JV3A 3BDUA 2CS7A 2D6FA 3OYAA 3J7AF 3CCJA 4PJOC 4KULA 1NBEB 2QYZA 5LJ3f 3OW2A 1ZUUA 1FMKA 1RUWA 4D6WA 2K6DA 2HNIA 1M90U 2FPDA 3X28B 1SRLA 1M90C 2MIOA 4JS4A 1VQPT 2O88A 3PTAA 2KYBA 2MOXA 2DXTA 1VIEA 4AFUC 1LVKA 3JB9I 1H92A 2K2MA 2BE9B 2DM1A 3DKMA 2F2WA 4FYVB 4JLIA 2O4XA 2VB6A 4PK4A 1KHCA 2FVUA 1W6XA 1WHMA 5KYXB 4XAXB 1UGQB 3PMIA 2LJ3A 5FLXE 2LJ1A 5KYXA 1K8AR 3JCMh 2EQJA 4O6JA 2XDDA 2DMOA 1JQQA 2ED1A 4FYXB 1A0NB 2LQKA 5FW9A 1VQ7A 1Y71A 2K5IA 2LX7A 3PVQA 1S1NA 5D6YA 1BK2A 2RI3A 3QXEB 4EMGA 2JNGA 4BI4A 1VQOQ 3CMET 2COWA 5A0DA 5GAN2 2EJ9A 4IKFA 2CH4W 2H3JA 2RH2A 2YLCA 1VQ6A 4LDUA 1QVFA 2YRVA 4M78E 4M7AA 4BB7A 4PFPA 1VQ9Q 3SEMA 2KT1A 4AG2C 1PM3A 1XOVA 4C0ZA 1QLYA 5IXFA 4JZ3A 4BE0A 3UA7A 3L2QA 1VQNQ 1M2OA 2FO0A 1OPKA 2NLUA 5GANe 1NE8A 4LE9A 4BD3A 4C5GA 4M75C 4C8QG 1XQHA 1E6GA 4KH1B 4A4HA 3I56A 2HMAA 1N9SA 2P4RA 2AZVA 2V8IA 4EMKA 1VQNA 4JLGA 3HSBA 2XICA 1U3OA 2V8JA 3CC4T 4ORZA 4XTXA 2HL5C 5KYYA 1SPKA 2VWFA 3CCEA 1P92A 4M7AF 3OW2S 2HZYA 2LRQA 3CC2Q 1VQ5Q 3CPFA 1QW1A 1B34A 2PNIA 2EVRA 4F7UA 3I56Q 1X01A 2LCSA 4Z8AA 2DVJA 4JJDA 2XD0A 2RQUA 2L0AA 4C0DC 2HBPA 2OI3A 2PVGB 1S72T 4ZGJB 2COZA 3JCMQ 4ESRA 1T0JA 2HSEB 2O9SA 3CQTA 3TSZA 3E19A 1WJQA 3CXCS 4LD9K 1Y96B 4AFZC 1YJWQ 3CPWS 1Q81R 4C5HA 3GNFB 2X51A 3PIOA 4M78C 3CEYA 1C6VX 2A37A 4XU1A 5ECAA 4EDUA 1IGQA 1IZ6A 3A8LB 2L8DA 4YTLA 1T3SA 1M1KR 3CBPA 1YIJT 1K8AC 3JCMd 2EAYA 2RHIA 4FSSA 1YHQT 3TU4K 4C0FA 4C8QE 1N5ZA 4XK8E 2QA4A 5LJ5j 3G71Q 4TVRA 2KRMA 4FYWB 3HRSA 2JS2A 4HVWA 4OF1A 5LJ3h 5CR2A 2DBKA 4PFZA 2DJZA 5GANg 2DZ9A 1G8XA 2JMCA 1Y0MA 1KC8C 4M77G 2O31A 5GMKh 1E6HA 2R5MA 1VQ6Q 2ED0A 1JBMA 5J39A 5CCAA 4X34A 3CMAQ 3OYCA 3S3OA 4PJOD 3HKSA 3PVLA 1Y7XA 1KD1C 2XKOC 2KNBB 2EBPA 3JB9F 3DLLA 5D6XA 4D8KA 1CKAA 4AT1B 1IRXA 4QVZA 4M7AB 4XTYA 3L2UA 5FWCA 5GAN5 1YIJQ 1K8AU 5FU7C 1I0CA 3LWIA 3NTKA 2ZAEA 2EQKA 3CCRA 3OS0A 1G83A 5D6WA 1OU8A 2A0FB 1XNIA 3RESA 3OYLA 2JW4A 3EHQA 2JS0A 3LGFA 3VJPA 4FM4B 5GAOq 3AT1B 5AT1B 4RTUA 3I35A 2PUOB 3I55T 1KC8U 2GGRA 1NJIC 5LJ5g 5CO7A 2QA4T 3QKJA 4KRTA 5A2QE 4C8QD 1PHTA 1WHHA 5A0GA 2E3IA 2EKHA 3QYHB 2X4WA 2X4XA 1X69A 4P5NA 4FW1A 3I55A 2O2OA 1V1CA 1EFNA 2AT1B 2DTHA 4Y28E 2JOYA 1UUEA 2DD4A 1WYXA 1NYGA 3CMAA 4MZTA 1BU1A 2B86A 4OMOA 1ZSGA 4N4GA 4JJCA 3C12A 5FU6B 1S72Q 1BB9A 1OI1A 1I5LA 3SB2A 3KXTA 2KGTA 2GNCA 2DRMA 3CCUT 2CT4A 2I0NA 1UGSB 3EG9A 5HY6A 1CKBA 5CQYA 5KCHA 2EW3A 2AKKA 2ROLA 2L2PA 1QCFA 1KFZA 4NS5A 1WHGA 3N5BB 3CXCP 3FEOA 2KE9A 1WHKA 2LP5A 1UB4A 5HK0A 3CCLQ 4EMKB 1WJSA 4LNPA 1ZHIA 2EIFA 3QJ6A 3G4SQ 3QZ9B 3CCUA 1D3BB 1TS9A 3M5AA 3P8DA 1YJNT 1X27A 1LOJA 4OMPA 2RQVA 1TUCA 1VQ7T 3SD4A 1YHQQ 1KG1A 4A4KA 2E12A 4J9HA 1ABOA 2RB6A 1KK7A 3VU3C 3G4SA 3JB9H 2K5FA 1N6AA 1QMCA 3SFMA 4XTWA 1TUGB 1NLOC 3O8VA 1WHLA 1ZBXA 2M1HA 1VQLA 3OYMA 3GPLA 4J9DA 2YRCA 2GQIA 3CCQT 3RDVA 2KRNA 3RNJA 2DA9A 4RKUE 2H3EB 5FRNA 4GY5A 2C0IA 2KRSA 1YITT 2ZPIB 1GCQC 1U5SA 2MCNA 1BYMA 4M7DA 1OEBA 4X1VA 4IUVA 4JDSA 5GANj 3J80E 3ER0A 3PE0A 5LJ3e 3LGLA 1VQMA 1KC8R 1PG5B 2LQ8A 2K9GA 4C5IA 4QT7A 2FPFA 4LDXA 2OTLT 1VQ5T 1IO6A 1PKTA 2H8HA 3FDRA 5GAOp 1JO8A 2DXUA 3E1SA 1GBQA 1ZLMA 5KYUA 1GCQA 2E6ZA 4E7SA 2DEQA 1GFCA 3P8BB 2NYSA 2GCXA 3HFOA 5FU7B 3REAB 2HSPA 2CZ6B 3OYHA 2K3BA 5KE2A 3H6ZA 2M02A 3QYGB 3HTRA 4M78B 1VQKA 2EQMA 5GMKe 2EYWA 3RKYA 3CC7Q 1M3BA 3SWNA 4E7ZA 1V29B 3MPUB 4OGCA 5DLOA 4KGZB 5GAMg 2RJEA 2A3LA 4M78A 5L8RE 3G4ST 1TH7A 1YWPA 3NPFA 1K0SA 2J6KA 1X2KA 3CD6T 3ZFJA 3CCJT 2D0QB 2QEXA 4EMHA 4V2SA 1K9MU 1I1JA 3M0RA 3UF4A 5GMKl 2EFIA 4JJBA 2K3XA 2VGNA 4KH0B 1YJWA 1WA7A 1ZA1B 1M90R 2JUFA 4C92D 3MEAA 1WXTA 1X6OA 2HCKA 4RTWA 4DA4A 3PT9A 3REBB 2YUNA 1MGQA 1OYXA 3OS5A 2VASA 2EPDA 2QGGA 8AT1B 2KDSA 3M55A 3OSSC 3CD6A 4M7AE 3NMZC 3EG1A 4E7KA 2LX9A 2K79A 5C0MA 4MMLA 4XTZA 1RAIB 1T3LA 2RI5A 4BI3A 2W10A 4PJJA 1ZSZC 1HYOA 4OVAA 3VUBA 1MMDA 1RLQC 1I07A 3I5RA 2ESWA 4R56A 4Y91A 5I11A 2CSQA 3E9GA 4WCIA 2HEQA 4M75A 2XI9A 3FC3A 1NJIU 2PU9B 2CREA 1JJ2A 4CRIA 4AMCA 2L5QA 4FYYB 4BDZA 2CP5A 1QVFP 5GAN4 1RL2A 3VYGA 4XTVA 4PJOB 3QDFA 3L1AA 2P84A 2VKNA 2LQNA 2ZZDA 1YI2Q 3H9NA 1TUDA 3JB9G 3E9FA 1NM7A 2J7IA 2O01E 3OYBA 3RKWA 3CCRT 1D0ZA 2EYYA 2Z0WA 2DIQA 4Q5WA 1WQWA 2HAXA 1VQLQ 4R55A 4KBMB 1LJOA 3HRUA 3RIRA 4DQ2A 2YWWA 3MHXA 3A98A 1WQ7A 3M58A 1VQNT 4ELYC 2EYZA 5LJ3j 1AZGB 3QHSA 3PFSA 1U8RA 1ZSZA 1RACB 2DPPB 4IIMA 3CD6Q 5LJ5h 2MK5A 1VQ7Q 3I5SA 2FB7A 4ZN1A 4ZNXA 2KMTA 2OAUA 2HKNA 1YJNQ 1UJ0A 4LUDA 3CCSQ 2QQRA 3LLRA 1BBZA 1UJYA 1W2BP 1Y57A 4ELZC 2IPOB 4M77F 4FT4A 3ZL7C 1RAFB 2CKKA 2SEMA 4FCYA 3C0CA 2DL7A 3CC2A 2A08A 1UTIA 2CGHA 2DERA 3QPHA 1K76A 2A7YA 2QQBA 4KGXB 3OYNA 4CC4B 4RTYA 1H8KA 2KI7A 2YRDA 1PSFA 2ECZA 3EG0A 2RI2A 2E3HA 4DBQA 2WSFE 3OMGA 5CAIA 2LCLA 3A8MB 5GAOl 2GQVA 2KAFA 3CCQQ 2D8HA 2Y4YA 4RCBA 4E7LA 2DILA 2GBQA 4JRIA 4E7JA 1EIFA 3EGXA 3JCMP 1UDLA 1M3CA 2QAZA 3MP1A 2QI2A 2EJFA 4M7DF 1GBRA 5GANd 1M1KC 3E2UA 3HHTB 1M1KU 5CKBA 1VQ4A 1ZQ1A 4PJOA 1BIAA 2HQHA 1JRIA 2NUZA 1Z9QA 2NUPA 5LJ3g 3R6NA 2ZPGB 2JXBA 3NFCA 3A1PA 1VQOA 1U06A 1SKUB 1Q95G 2VGMA 2A28A 4LN2A 5KH6A 4ZTJA 4PJMA 3CCJQ 4C5EA 3CCLT 1BCMA 5CKHA 1QCNA 1MNEA 3M4GA 5GAMj 3I55Q 2DRKA 2LT1A 2DVEA 2E41A 1QVFS 4PJNA 1QQJA 2C06A 1Q86U 2V8KA 2YXYA 8ATCB 1QCOA 1YI2A 4XU2A 1G3WA 5I2MA 1Q86C 2WSEE 2ROTA 2DAQA 4F14A 1K4US 5GAOm 3CPWP 1G3TA 5FRMA 2DL4A 2XDPA 4LD6A 4M77D 3HFNA 3LH5A 3G6EQ 1RABB 2RPNA 2X35A 3RERA 1K73U 4C0DB 1N8RC 1O9SA 1WXBA 3EFOA 4C8QA 1FXXA 2WSCE 2B8AA 4FW2A 3M59A 1HD3A 1M30A 1WNLA 3CCVA 1K73R 2RA2A 2EKOA 2D8JA 2OX7A 1NJIR 3BFMA 3T9NA 3JCMV 1R0BG 2RJFA 3TSWA 3WXMB 1OZ3A 4QVCA 1Q7YC 1KJWA 4BI8B 1ZUKA 3CCUQ 1BI3A 4IUUA 5IAYA 5HK3A 2OTLA 3H0FA 2IG0A 3QWYA 1Q7YU 1GFDA 4IURA 1XJWB 1YITQ 1QKWA 4CC2A 1K1ZA 2DL5A 4M75G 2DBMA 4ZGEB 2ZPEB 3A5ZB 4RG2A 1VQOT 3VYHB 2F5TX 4A4FA 1VQ8T 2V26A 2OTJQ 1YJWT 2DFUA 4DEXA 3OYEA 4HA8A 1TTHB 3FLGA 4A54A 4FT2A 2FYKA 1I8FA 1NLPC 3S3MA 3M4YA 4HKEA 2AKLA 3V8JA 1VUBA 3G6EA 4II1A 3JB9J 4QQGA 1OOTA 1OULA 3HRTA 5IH2A 2CZ7B 3GNGA 4F7UF 1VQ8Q 2AHJB 3OYKA 3VKIA 4M7DB 2JM8A 1WZOA 1H3ZA 1QWFA 3DLMA 1UE9A 1M2VB 2KYMA 1TU0B 4L59A 1PWTA 1T0HA 2M16A 1MMNA 2CP3A 3VS3A 3CMEA 5FWBA 1VQ6T 2YUQA 2O9VA 3WVEB 4C92F 2EGCA 1OZ2A 1VA7A 2LC4A 3G6ET 2RK2A 1NG2A 1AWXA 4LDYA 4M77B 4X9DA 2BZXA 4A4EA 1WDXA 3KBGA 3UA6A 2NUTB 1QVGA 1Q81C 4PJLA 3X24B 2BKDN 1RLPC 2E10A 3G71T 2Y4XA 1ZUYA 3M0TA 4C8QB 5CKDA 1WJRA 2YT6A 3VS1A 4HT9A 1H3HA 3LWHA 3CBOA 1Y07A 1OPLA 5M9OA 1D1BA 2QGFB 3G7ZA 5DLQE 6AT1B 4AFSC 2E5QA 2L3SA 3X25B 2IVWA 1G5VA 2MAMA 2C0OA 2KK4A 4BDYA 1MHNA 1RI9A 4L5GA 4OGEA 4E47A 2K4YA 2CYZB 4LUEA 3EFOB 2YUOA 3VV0A 1LCKA 4JRPA 4C92E 1M4ZA 2CZ1B 4XU0A 2DK3A 3PNWC 4IUTA 5KYNA 4B6MA 3QIIA 2PZ1A 4Z88A 3EGUA 2F2VA 4OP0A 1VQ9T 2VVKA 2YUPA 1VIFA 4MDWA 1VYUA 2KT8A 1I81A 2FG0A 3OYGA 5IXBA 2EYXA 3WVDB 3C4SA 2KBTA 4E2FB 2G3RA 1K9AA 4JRQA 4J7FA 1AVZC 1UGRB 2XK0A 4Z89A 2L3RA 5GJWB 4PLLA 2QG9B 5J3BA 2CP2A 1WHJA 1NEBA 1XTDA 3M0SA 3CCEQ 3EGDB 4QW2A 3UPUA 2FZCB 5GAMd 3M0QA 3OY9A 2CT3A 1BI0A 3M53A 3H41A 3C95A 5GAMh 3DB4A 4N4HA 3OBYA 1G3YA 3M56A 5GAOr 3EGXB 2JTMA 4ZTFA 1JXMA 2QK0A 1H641 2X9HA 3BW1A 2LTOA 4Y92A 5EG2A 1KD1R 1I5OB 2JN0A 3VRZA 1KQSS 3M57A 5IT9E 1AOJA 2HKQB 1C1AA 4JRKA 3CC4Q 3CCMT 2QTXA 1PKSA 2V1QA 1YFNA 3L2VA 2KROA 1D0XA 2AIRB 1HXDA 2FRWA 5KE3A 3UWNA 1M3AA 3ME9A 2FZKB 1HSQA 1OX8A 4RTTA 2BZ8A 1YNZA 4M7AD 1ZSZB 1S72A 2COYA 3OQ5A 1J3TA 1MMAA 2E64A 2KEAA 1W4SA 5I21A 3H0IA 1B7TA 3CBMA 4QKUA 5GANf 2PTKA 1X43A 3H0HA 3RUXA 4Z02A 2E1HA 2VXEA 1RAHB 4C92A 3CCLA 2K3YA 4J8OA 2D9TA 2JZ2A 2LT4A 3L2ZA 4QVDA 2FEIA 3EFSA 3LX7A 4N0AC 2J6OA 4J9EA 2CP7A 2X4YA 5GMKi 4M7DC 3VS2A 1IREB 2J6FA 3NTHA 3KFVA 3A8OB 3RR6A 1IXDA 2K57A 5J26A 5KYWA 1Z9ZA 1W2BA 1KQSP 1SG5A 2QEXT 2CUDA 1GXIE 3CCET 5HCKA 4OB3B 5EC7A 2KY9A 1YBYA 3HP9A 2DXCA 4QQDA 3JCMg 1SHGA 4M7AC 4J9IA 1RAGB 3JCMe 2KXCA 3JCMX 1W70A 2DO3A 4C92B 4N0AA 2CDTA 1HJDA 3A8HB 3I56T 2DIGA 3EH1A 4HXJA 2M0OA 1RAEB 1NEGA 4VUBA 9ATCB 2WACA 1VYVA 1YCSB 4ZN3A 4JUVA 1VQ4Q 2OTJA 5A0LA 2EQIA 3GBQA 5IHKA 3QJYA 2QA4Q 2PVDB 2R57A 2RHUA 4DOVA 4XQ3A 2XG8D 2BIVA 5GMKm 4UC4A 2I2LA 4ZGDB 3JB9D 2CUBA 4WTOB 1Q82C 1YIJA 1UGVA 4LDWA 2KR3A 3V8LA 1CSKA 2FRYA 2BE7D 2CH4A 4RTVA 5CKFA 3OYJA 3LYIA 2PQWA 4B9WA 2QEXQ 3L2RA 1ACMB 4BACA 5I2SA 1R0CB 2BTTA 2HL3A 3DB3A 3I9QA 4M77E 4A4GA 1K73C 4J7IA 1D09B 1WXUA 5CVIA 3PMTA 4PNOA 1AWWA 4DBRA 2L3PA 2J05A 4B9XA 3TEEA 5CK9A 4RUGA 3P8HA 2HQEA 4OMMA 3V7SA 2NWMA 3TCJA 4M78F 1OX9A 4C8QF 4HCBA 4BE1A 1B34B 1YWOA 3MEWA 3OYDA 2DETA 3FJPA 2OTLQ 2RD1A 1JB0E 5GAMe 4KT0E 1KD1U 3UT1A 3M54A 2X3XD 4QQ6A 3X26B 2YDLA 2KXDA 4PLIA 4OB0B 2BUDA 1VQLT 4HVUA 3VS7A 2DX1A 4ME7A 3FIFA 3NTIA 1E7OA 4F04B 3SWNB 2EGAA 3OBWA 5GAN3 1SRMA 2K2VA 3OYYA 3MP8A 3KUFA 5L23A 1MUZA 1KHIA 4DBFA 1JU5C 4CI0C 2E65A 1KQ2A 4WF2A 4E7HA 1VQKT 3GIBA 1KQ1A 3AHUA 1Q81U 5CIUA 4C92C 1VQPQ 4IUPA 4RMOA 1AD5A 4RTXA 4ATOA 1YP5A 2RHZA 2P0PA 1K9MR 1B07A 3EHRA 1RI0A 3J81E 1W2BS 4LDVA 1X75C 1PSEA 1K9MC 3NGPA 3QO3A 1HK9A 3C94A 1G3SA 5LJ5e 2LQWA 2VV5A 1VOMA 1F1BB 2DTIA 1FWZA 3PGGA 4IUQA 1VQ9A 5IHNA 3BY7A 3EGDA 2ZPHB 3UATA 2RQTA 4J9BA 4OMQA 2DE0X 4M7AG 1M27C 1O75A 3V7CA 2E5KA 3OS2A
chains in the Genus database with same CATH topology
4J9CA 1X27A 4OMPA 2J06A 4DEXA 3VRYA 2RQVA 1TUCA 1YN8A 1MV3A 2CSIA 2LZ6B 2DL8A 3EG2A 2G6FX 1KSWA 4J9HA 1ABOA 1WFWA 2M0YA 2XMFA 1FYNA 1NLPC 4AFQC 2ABLA 2AKLA 1NLOC 4F17A 4J9DA 1X2QA 2GQIA 4DEYA 1OOTA 2GTOA 5IH2A 1WLPB 3VS0A 1B3QA 4F16A 2JM8A 4HVVA 4IIOA 2KRNA 1QWFA 1UE9A 3RNJA 2DA9A 2KYMA 1PWTA 1T0HA 3VS3A 2C0IA 5FWBA 2KRSA 2D1XA 2YUQA 2O9VA 1GCQC 1U5SA 2V1RA 4GBQA 2HDAA 2DLPA 2HBWA 2EGCA 1VA7A 3JV3A 5GJVB 2MCNA 2DL3A 1OEBA 1NG2A 1AWXA 1OV3A 4X1VA 2BZXA 1ZUUA 1FMKA 1RUWA 1WDXA 2K6DA 3PE0A 2FPDA 3UA6A 1SRLA 1UFFA 2K9GA 2MIOA 4QT7A 3VS6A 2O88A 1GL5A 2FPFA 2M51A 2KYBA 2OJ2A 1RLPC 2MOXA 1IO6A 4AFUC 1ZUYA 1K0XA 1PKTA 2H8HA 3M0TA 1H92A 2K2MA 1JO8A 2DM1A 2YT6A 3VS1A 1GBQA 1ZLMA 1H3HA 4HCKA 1QKXA 1OPLA 2F2WA 1GCQA 1UHCA 1GFCA 1SHFA 1W6XA 3REAB 4AFSC 2HSPA 2DF6A 2L3SA 2LJ3A 2LJ1A 1UG1A 2OAWA 2K3BA 2C0OA 1RI9A 2DMOA 4LUEA 1JQQA 2ED1A 2EYWA 2YUOA 5I22A 5FW9A 1A0NB 1LCKA 1TG0A 1ZBJA 2LX7A 3PVQA 1S1NA 1BK2A 1M3BA 4OMLA 3O5ZA 4JZ4A 1YWPA 2CH4W 2PZ1A 4Z88A 3EGUA 3NPFA 1K0SA 2F2VA 2J6KA 2VVKA 1X2KA 2RNAA 2YUPA 3SEMA 1WIEA 1SEMA 1GCPA 1PRMC 1VYUA 3SHWA 2KT1A 2KT8A 4AG2C 1XOVA 2FG0A 5IXBA 1I1JA 2EYXA 3M0RA 1QLYA 5IXFA 3UF4A 4JZ3A 1ARKA 2EGEA 4JJBA 2GTJA 3UA7A 1WA7A 1OPKA 2FO0A 2KBTA 4LE9A 2D0NA 1WX6A 1WXTA 2HCKA 4RTWA 4JPBW 1E6GA 1K9AA 3REBB 2YUNA 1ABQA 1AVZC 4Z89A 2EPDA 5GJWB 2P4RA 1NEBA 2AZVA 3M0SA 3NMZC 3EG1A 1U3OA 2K79A 3M0QA 4ORZA 2CT3A 1SPKA 2VWFA 3H41A 3RBBB 1T3LA 1VYTA 2W10A 2RMOA 3QWXX 4D8DA 2PNIA 2EVRA 1RLQC 1I07A 2RQRA 3I5RA 2ESWA 2LCSA 4Z8AA 4R0KA 5I11A 2DVJA 4JJDA 2CSQA 4WCIA 2HEQA 1JXMA 2RQUA 2L0AA 2CREA 1M8MA 2OI3A 2BZYA 1PRLC 4Y92A 1AEYA 4ESRA 1T0JA 3CQTA 2O9SA 3VRZA 3VS5A 1AOJA 3TSZA 1PKSA 2V1QA 1NYFA 2VKNA 2LQNA 4AFZC 2KROA 1TUDA 2JM9A 2FRWA 1NM7A 2J7IA 1M3AA 3VS4A 2EYYA 1HSQA 2RF0A 4RTZA 4RTTA 2BZ8A 1YNZA 2A37A 2LJ0A 5ECAA 3FJ5A 1J3TA 2JTEA 3A98A 2KEAA 2A36A 2EYZA 1T3SA 3H0IA 3THKA 2QDLA 2PTKA 1AZGB 1X43A 3H0HA 1ZX6A 4IIMA 4FSSA 2AK5A 2ENMA 3I5SA 4ZNXA 1N5ZA 2FEIA 1X6GA 2J6OA 4J9EA 1UJ0A 4LUDA 2F2XA 1BBZA 2KRMA 2J6FA 1UJYA 2FPEA 3VS2A 1Y57A 3KFVA 2JS2A 4HVWA 3ZL7C 1Z9ZA 2DBKA 2SEMA 4J9FA 3C0CA 1KIKA 1MV0B 2CUDA 2DL7A 2JMCA 5HCKA 4A63B 1Y0MA 5EC7A 2RN8A 2SRCA 2A08A 1UTIA 2O31A 1SHGA 3M0UA 1K76A 1GRIA 4J9IA 1E6HA 3NHNA 2ED0A 2KXCA 1W70A 4CC4B 4RTYA 2CDTA 1H8KA 1HJDA 2ECZA 3EG0A 3PVLA 2KNBB 4HXJA 2EBPA 2JMAA 1NEGA 4D8KA 1VYVA 1UECA 1CKAA 1JXOA 1YCSB 2D8HA 2YSQA 2DILA 2EQIA 2GBQA 3GBQA 5IHKA 5FWCA 4AG1C 1UHFA 1UDLA 1M3CA 2CUBA 1I0CA 1GBRA 1UGVA 2KR3A 1G83A 1CSKA 4OMNA 2C0TA 2FRYA 2CH4A 4RTVA 1JEGA 2JT4A 2DNUA 2NUZA 2BTTA 2JW4A 1Z9QA 3EHQA 1SSHA 2JS0A 3R6NA 4CC7A 2JXBA 5IHIA 3I9QA 1WXUA 1U06A 4J9GA 1AWWA 4RTUA 3I35A 2A28A 2J05A 2L3PA 4LN2A 2GGRA 4RUGA 4OMMA 2NWMA 3IQLA 3M0PA 2DRKA 4KRTA 1YWOA 4E6RA 1PHTA 2EKHA 4K11A 2LMJA 1AWJA 2X3XD 2YDLA 2ROTA 2KXDA 4F14A 1X69A 1K4US 2LNHB 2RQWA 2AZSA 4HVUA 2L3QA 3VS7A 2DX1A 2DL4A 2O2OA 1V1CA 3LH5A 1EFNA 1E7OA 1WI7A 1AWOA 2EGAA 1SRMA 2RPNA 1UUEA 1WYXA 1NYGA 1W1FA 3TVTA 1BU1A 5L23A 1WXBA 1MUZA 2B86A 4OMOA 1JU5C 3U23A 1HD3A 1M30A 1ZSGA 4JJCA 1BB9A 2DYBA 1AZEA 2DJQA 2D8JA 2KGTA 2GNCA 2DRMA 1QWEA 2CT4A 3TSWA 2K7AA 2I0NA 1AD5A 1KJWA 2IIMA 4RTXA 1CKBA 4GLMA 1YP5A 2ROLA 1PNJA 1G2BA 1ZUKA 2AKKA 2EW3A 2L2PA 1B07A 3EHRA 1QCFA 2X3WD 1KFZA 4EIKA 3H0FA 3QWYA 2KE9A 3NGPA 2LQWA 2LP5A 1GFDA 5IHNA 3ULRB 3UATA 2RQTA 4LNPA 4J9BA 1QKWA 4OMQA 1X6BA 2DE0X 4CC2A 1K1ZA 2W0ZA 2DL5A 2DBMA 1M27C 4M4ZA 4CC3A 3EG3A 2E5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9C A;  1X27 A;  4OMP A;  2J06 A;  4DEX A;  3VRY A;  2RQV A;  1TUC A;  1YN8 A;  1MV3 A;  2CSI A;  2LZ6 B;  2DL8 A;  3EG2 A;  2G6F X;  1KSW A;  4J9H A;  1ABO A;  1WFW A;  2M0Y A;  2XMF A;  1FYN A;  1NLP C;  4AFQ C;  2ABL A;  2AKL A;  1NLO C;  4F17 A;  4J9D A;  1X2Q A;  2GQI A;  4DEY A;  1OOT A;  2GTO A;  5IH2 A;  1WLP B;  3VS0 A;  1B3Q A;  4F16 A;  2JM8 A;  4HVV A;  4IIO A;  2KRN A;  1QWF A;  1UE9 A;  3RNJ A;  2DA9 A;  2KYM A;  1PWT A;  1T0H A;  3VS3 A;  2C0I A;  5FWB A;  2KRS A;  2D1X A;  2YUQ A;  2O9V A;  1GCQ C;  1U5S A;  2V1R A;  4GBQ A;  2HDA A;  2DLP A;  2HBW A;  2EGC A;  1VA7 A;  3JV3 A;  5GJV B;  2MCN A;  2DL3 A;  1OEB A;  1NG2 A;  1AWX A;  1OV3 A;  4X1V A;  2BZX A;  1ZUU A;  1FMK A;  1RUW A;  1WDX A;  2K6D A;  3PE0 A;  2FPD A;  3UA6 A;  1SRL A;  1UFF A;  2K9G A;  2MIO A;  4QT7 A;  3VS6 A;  2O88 A;  1GL5 A;  2FPF A;  2M51 A;  2KYB A;  2OJ2 A;  1RLP C;  2MOX A;  1IO6 A;  4AFU C;  1ZUY A;  1K0X A;  1PKT A;  2H8H A;  3M0T A;  1H92 A;  2K2M A;  1JO8 A;  2DM1 A;  2YT6 A;  3VS1 A;  1GBQ A;  1ZLM A;  1H3H A;  4HCK A;  1QKX A;  1OPL A;  2F2W A;  1GCQ A;  1UHC A;  1GFC A;  1SHF A;  1W6X A;  3REA B;  4AFS C;  2HSP A;  2DF6 A;  2L3S A;  2LJ3 A;  2LJ1 A;  1UG1 A;  2OAW A;  2K3B A;  2C0O A;  1RI9 A;  2DMO A;  4LUE A;  1JQQ A;  2ED1 A;  2EYW A;  2YUO A;  5I22 A;  5FW9 A;  1A0N B;  1LCK A;  1TG0 A;  1ZBJ A;  2LX7 A;  3PVQ A;  1S1N A;  1BK2 A;  1M3B A;  4OML A;  3O5Z A;  4JZ4 A;  1YWP A;  2CH4 W;  2PZ1 A;  4Z88 A;  3EGU A;  3NPF A;  1K0S A;  2F2V A;  2J6K A;  2VVK A;  1X2K A;  2RNA A;  2YUP A;  3SEM A;  1WIE A;  1SEM A;  1GCP A;  1PRM C;  1VYU A;  3SHW A;  2KT1 A;  2KT8 A;  4AG2 C;  1XOV A;  2FG0 A;  5IXB A;  1I1J A;  2EYX A;  3M0R A;  1QLY A;  5IXF A;  3UF4 A;  4JZ3 A;  1ARK A;  2EGE A;  4JJB A;  2GTJ A;  3UA7 A;  1WA7 A;  1OPK A;  2FO0 A;  2KBT A;  4LE9 A;  2D0N A;  1WX6 A;  1WXT A;  2HCK A;  4RTW A;  4JPB W;  1E6G A;  1K9A A;  3REB B;  2YUN A;  1ABQ A;  1AVZ C;  4Z89 A;  2EPD A;  5GJW B;  2P4R A;  1NEB A;  2AZV A;  3M0S A;  3NMZ C;  3EG1 A;  1U3O A;  2K79 A;  3M0Q A;  4ORZ A;  2CT3 A;  1SPK A;  2VWF A;  3H41 A;  3RBB B;  1T3L A;  1VYT A;  2W10 A;  2RMO A;  3QWX X;  4D8D A;  2PNI A;  2EVR A;  1RLQ C;  1I07 A;  2RQR A;  3I5R A;  2ESW A;  2LCS A;  4Z8A A;  4R0K A;  5I11 A;  2DVJ A;  4JJD A;  2CSQ A;  4WCI A;  2HEQ A;  1JXM A;  2RQU A;  2L0A A;  2CRE A;  1M8M A;  2OI3 A;  2BZY A;  1PRL C;  4Y92 A;  1AEY A;  4ESR A;  1T0J A;  3CQT A;  2O9S A;  3VRZ A;  3VS5 A;  1AOJ A;  3TSZ A;  1PKS A;  2V1Q A;  1NYF A;  2VKN A;  2LQN A;  4AFZ C;  2KRO A;  1TUD A;  2JM9 A;  2FRW A;  1NM7 A;  2J7I A;  1M3A A;  3VS4 A;  2EYY A;  1HSQ A;  2RF0 A;  4RTZ A;  4RTT A;  2BZ8 A;  1YNZ A;  2A37 A;  2LJ0 A;  5ECA A;  3FJ5 A;  1J3T A;  2JTE A;  3A98 A;  2KEA A;  2A36 A;  2EYZ A;  1T3S A;  3H0I A;  3THK A;  2QDL A;  2PTK A;  1AZG B;  1X43 A;  3H0H A;  1ZX6 A;  4IIM A;  4FSS A;  2AK5 A;  2ENM A;  3I5S A;  4ZNX A;  1N5Z A;  2FEI A;  1X6G A;  2J6O A;  4J9E A;  1UJ0 A;  4LUD A;  2F2X A;  1BBZ A;  2KRM A;  2J6F A;  1UJY A;  2FPE A;  3VS2 A;  1Y57 A;  3KFV A;  2JS2 A;  4HVW A;  3ZL7 C;  1Z9Z A;  2DBK A;  2SEM A;  4J9F A;  3C0C A;  1KIK A;  1MV0 B;  2CUD A;  2DL7 A;  2JMC A;  5HCK A;  4A63 B;  1Y0M A;  5EC7 A;  2RN8 A;  2SRC A;  2A08 A;  1UTI A;  2O31 A;  1SHG A;  3M0U A;  1K76 A;  1GRI A;  4J9I A;  1E6H A;  3NHN A;  2ED0 A;  2KXC A;  1W70 A;  4CC4 B;  4RTY A;  2CDT A;  1H8K A;  1HJD A;  2ECZ A;  3EG0 A;  3PVL A;  2KNB B;  4HXJ A;  2EBP A;  2JMA A;  1NEG A;  4D8K A;  1VYV A;  1UEC A;  1CKA A;  1JXO A;  1YCS B;  2D8H A;  2YSQ A;  2DIL A;  2EQI A;  2GBQ A;  3GBQ A;  5IHK A;  5FWC A;  4AG1 C;  1UHF A;  1UDL A;  1M3C A;  2CUB A;  1I0C A;  1GBR A;  1UGV A;  2KR3 A;  1G83 A;  1CSK A;  4OMN A;  2C0T A;  2FRY A;  2CH4 A;  4RTV A;  1JEG A;  2JT4 A;  2DNU A;  2NUZ A;  2BTT A;  2JW4 A;  1Z9Q A;  3EHQ A;  1SSH A;  2JS0 A;  3R6N A;  4CC7 A;  2JXB A;  5IHI A;  3I9Q A;  1WXU A;  1U06 A;  4J9G A;  1AWW A;  4RTU A;  3I35 A;  2A28 A;  2J05 A;  2L3P A;  4LN2 A;  2GGR A;  4RUG A;  4OMM A;  2NWM A;  3IQL A;  3M0P A;  2DRK A;  4KRT A;  1YWO A;  4E6R A;  1PHT A;  2EKH A;  4K11 A;  2LMJ A;  1AWJ A;  2X3X D;  2YDL A;  2ROT A;  2KXD A;  4F14 A;  1X69 A;  1K4U S;  2LNH B;  2RQW A;  2AZS A;  4HVU A;  2L3Q A;  3VS7 A;  2DX1 A;  2DL4 A;  2O2O A;  1V1C A;  3LH5 A;  1EFN A;  1E7O A;  1WI7 A;  1AWO A;  2EGA A;  1SRM A;  2RPN A;  1UUE A;  1WYX A;  1NYG A;  1W1F A;  3TVT A;  1BU1 A;  5L23 A;  1WXB A;  1MUZ A;  2B86 A;  4OMO A;  1JU5 C;  3U23 A;  1HD3 A;  1M30 A;  1ZSG A;  4JJC A;  1BB9 A;  2DYB A;  1AZE A;  2DJQ A;  2D8J A;  2KGT A;  2GNC A;  2DRM A;  1QWE A;  2CT4 A;  3TSW A;  2K7A A;  2I0N A;  1AD5 A;  1KJW A;  2IIM A;  4RTX A;  1CKB A;  4GLM A;  1YP5 A;  2ROL A;  1PNJ A;  1G2B A;  1ZUK A;  2AKK A;  2EW3 A;  2L2P A;  1B07 A;  3EHR A;  1QCF A;  2X3W D;  1KFZ A;  4EIK A;  3H0F A;  3QWY A;  2KE9 A;  3NGP A;  2LQW A;  2LP5 A;  1GFD A;  5IHN A;  3ULR B;  3UAT A;  2RQT A;  4LNP A;  4J9B A;  1QKW A;  4OMQ A;  1X6B A;  2DE0 X;  4CC2 A;  1K1Z A;  2W0Z A;  2DL5 A;  2DBM A;  1M27 C;  4M4Z A;  4CC3 A;  3EG3 A;  2E5K A; 
#chains in the Genus database with same CATH topology
 2DXB A;  3BE3 A;  4J9C A;  3CCQ A;  2J06 A;  3VRY A;  1M9S A;  1M5Q 1;  2FZG B;  3MEV A;  1TXQ A;  2LZ6 B;  3EG2 A;  2G6F X;  1KSW A;  3PIP A;  1YJ9 Q;  3QDR B;  2M0Y A;  2XMF A;  4MZP A;  4AFQ C;  2ABL A;  2LDM A;  1IGU A;  1MND A;  2NUT A;  4F17 A;  3CCS A;  3CC4 A;  3QUI A;  1X2Q A;  2FHD A;  1YJN A;  1U1T A;  4DEY A;  5GAN 8;  2GTO A;  4E7I A;  2XU8 A;  1D1C A;  3L42 A;  3VS0 A;  3LH0 A;  4A53 A;  2VXF A;  4M77 A;  5LJ5 d;  4IIO A;  1OU9 A;  4DOW A;  4XTU A;  3CMA T;  1DJ7 B;  3JCM c;  2P0Q A;  2F5K A;  5LJ5 f;  3CCM Q;  3V8K A;  4GBQ A;  2V1R A;  4F7U G;  5DM7 R;  3OB9 A;  5GJV B;  3OW2 P;  2DL3 A;  3VUZ A;  3S3N A;  5HKC A;  3QBY A;  1OV3 A;  2RM4 A;  2XHC A;  1UFF A;  3VS6 A;  1GL5 A;  2M51 A;  1QP2 A;  2R5A A;  2OJ2 A;  2GF7 A;  4J6X A;  7AT1 B;  1K0X A;  1QVG S;  4PL6 A;  1RAD B;  4BUG A;  1C0M A;  2EQU A;  4HCK A;  1QKX A;  2VYT A;  3F70 A;  1UHC A;  1EX4 A;  1SHF A;  4M75 D;  4PKC C;  3SWN C;  4M75 F;  2DF6 A;  1UG1 A;  2OAW A;  3GLX A;  4PFO A;  2FL7 A;  1VQP A;  2GFU A;  4NL3 A;  1FMW A;  5I22 A;  4FL6 A;  1TG0 A;  3JRZ A;  4OB2 B;  4NOY A;  1M2V A;  1ZBJ A;  2EWN A;  3FB9 A;  2DTO A;  4KUI A;  4OML A;  3JAM E;  3O5Z A;  4JZ4 A;  5GAM f;  1Y96 A;  1NPR A;  5GAO n;  2RNA A;  1WIE A;  1SEM A;  1GCP A;  1PRM C;  2CP6 A;  3SHW A;  2CZ0 B;  1PC0 A;  2YHT A;  3Q1J A;  1ARK A;  2EGE A;  3OSV A;  2GTJ A;  1M8V A;  5FRO A;  1IB8 A;  1Q82 U;  2D0N A;  1PD0 A;  1WX6 A;  1FX7 A;  4JPB W;  1BCO A;  3QZ5 B;  4KUD K;  1VQK Q;  1Q82 R;  4OMF B;  1ABQ A;  5LL6 S;  3JCM W;  4L6V 5;  2DKG A;  1JJ2 P;  2LCC A;  4EPC A;  3R6O A;  1MMG A;  1M1G A;  3OYF A;  1IHW A;  2E6N A;  4C0G A;  3RBB B;  1VQ5 A;  3EAE A;  1VYT A;  2RO0 A;  2RMO A;  3QWX X;  4D8D A;  4BY6 C;  2RQR A;  3ZEH A;  2E4H A;  2DZC A;  4FIB A;  4MMK A;  4R0K A;  2LNV A;  3TRE A;  2K5L A;  4PJO G;  3ZBD A;  3UDC A;  1M8M A;  2BZY A;  2PUK B;  1PRL C;  4M75 E;  1AEY A;  3VS5 A;  2QQS A;  1PCX A;  4XU3 A;  1NYF A;  1M1F A;  3S6W A;  2DEU A;  2JM9 A;  3HPW A;  3VS4 A;  3GOX A;  1VQM Q;  1YI2 T;  4FU6 A;  2Y90 A;  2RF0 A;  4RTZ A;  1BKB A;  3D7S B;  4RG8 A;  2LJ0 A;  2MF2 A;  3FJ5 A;  2JTE A;  4PJO F;  4RCC A;  2A36 A;  3H8Z A;  2XDB A;  3THK A;  2QDL A;  3CCM A;  1Q86 R;  2QXF A;  2YLB A;  1TWB A;  1ZX6 A;  4J6Y A;  3ASK A;  1SF9 A;  2EJG A;  2AK5 A;  2ENM A;  3MKD A;  4ANJ A;  4M78 G;  1X6G A;  1N8R U;  4M7D G;  4N4I A;  1OQK A;  2F2X A;  2FPE A;  2NUP B;  1Q7Y R;  1N8R R;  1FMV A;  3EFR A;  5C6S A;  2PVO B;  5KYY B;  1UGP B;  1R77 A;  3GP8 A;  1BI1 A;  4J9F A;  1KIK A;  2F1L A;  1MV0 B;  2DYI A;  4A63 B;  1LPL A;  2RN8 A;  3OS1 A;  2SRC A;  1KQS A;  1YHQ A;  3MCA B;  3M0U A;  3CCV Q;  1GRI A;  3NHN A;  5D7U A;  1PD1 A;  2JTF A;  3JSC A;  4F7U B;  4JJN K;  2RJD A;  3HL8 A;  2JJ9 A;  4BY6 B;  2JMA A;  4NL2 A;  2X4J A;  5GAN h;  1UEC A;  1JXO A;  2LVM A;  2M9U A;  1NPP A;  2E70 A;  2YSQ A;  1EZZ B;  2MPX C;  3SDZ A;  4HCZ A;  4AG1 C;  1UEB A;  1QP3 A;  1UHF A;  2MWO A;  4HT8 A;  1WGS A;  3L2W A;  1RAA B;  2QQ9 A;  2L89 A;  4OMN A;  2C0T A;  2F69 A;  3QG1 A;  1JEG A;  2JT4 A;  2DNU A;  1IHV A;  3EH2 A;  4GLK A;  2MYS A;  4MDX A;  1SSH A;  4CC7 A;  5IHI A;  3JCM J;  4MZM A;  3MET A;  4J9G A;  4OB1 B;  5KYU B;  3QSU A;  3INZ A;  1V76 A;  3IQL A;  3M0P A;  3OA6 A;  4J83 A;  3URG A;  4E6R A;  3CME Q;  4BE2 A;  1YJ9 T;  4K11 A;  2LMJ A;  1AWJ A;  2KQW A;  2RHY A;  1D0Y A;  2QDY B;  2ZPF B;  2VC8 A;  3RMQ A;  4M75 B;  1TOV A;  3TQ7 P;  2LNH B;  2RQW A;  2ATC B;  2RK1 A;  2AZS A;  1WPY A;  2L3Q A;  1YCY A;  2OTJ T;  1D1A A;  4LXC A;  3CCR Q;  1SSF A;  1WI7 A;  4KGV B;  1AWO A;  2O4X B;  2MMP A;  5CKE A;  2ZCF B;  2QAS A;  1W1F A;  1ZA2 B;  3TVT A;  2MI6 A;  2ZPB B;  2HD0 A;  1YJ9 A;  4HCC A;  4FSX A;  3U23 A;  1JJ2 S;  3MP6 A;  3JCM f;  1VQ4 T;  5KYW B;  5AYF A;  2VUB A;  1D3B A;  2DYB A;  1AZE A;  1AHJ B;  2DJQ A;  3OMC A;  2HQX A;  1AT1 B;  3CPW A;  1QWE A;  2P4T A;  2RHX A;  2K7A A;  1LNX A;  2IIM A;  5IN1 A;  3X20 B;  4GLM A;  1PNJ A;  1G2B A;  3CXC A;  3CC7 A;  2DD5 A;  2MWP A;  4M77 C;  2X3W D;  5GMK j;  4DBH A;  1YIT A;  4EIK A;  3JCM b;  3CC2 T;  3MEU A;  2KSS A;  5CQX A;  2P0K A;  2CP0 A;  4J5Y A;  3EG9 B;  4J6W A;  3M9Q A;  3ULR B;  5GAN 6;  1X6B A;  1N9R A;  2W0Z A;  1VQM T;  4C8Q C;  4M4Z A;  3CCS T;  4CC3 A;  3EG3 A;  1I4K 1;  4X9C A;  5GAN 7;  1N27 A;  1QVP A;  1YN8 A;  1MV3 A;  2CSI A;  5FU6 C;  3FRN A;  3G1J A;  2DL8 A;  2GFA A;  1NZ9 A;  1R8O B;  1WFW A;  3GF5 A;  5KCO A;  1FYN A;  4M78 D;  4JS5 A;  4PJO E;  4M7D E;  2KVQ G;  5LJ3 d;  4M7D D;  2XID A;  1BI2 A;  1TSF A;  3V7R A;  1VQ8 A;  3MJX A;  3OYI A;  1QVG P;  1WLP B;  1B3Q A;  5DY9 A;  4F16 A;  3A8G B;  2QTV A;  4HVV A;  3BDL A;  3MO8 A;  4O5V A;  1U1S A;  3RKX A;  4F7U E;  3CC7 T;  2QQA A;  2RJC A;  4EMK C;  2EYQ A;  3G71 A;  2R58 A;  2ZGW A;  4C92 G;  3LW5 E;  2D1X A;  3RMS A;  2JVV A;  2HDA A;  2DLP A;  2HBW A;  1BIB A;  3CCV T;  3JV3 A;  3BDU A;  2CS7 A;  2D6F A;  3OYA A;  3J7A F;  3CCJ A;  4PJO C;  4KUL A;  1NBE B;  2QYZ A;  5LJ3 f;  3OW2 A;  1ZUU A;  1FMK A;  1RUW A;  4D6W A;  2K6D A;  2HNI A;  1M90 U;  2FPD A;  3X28 B;  1SRL A;  1M90 C;  2MIO A;  4JS4 A;  1VQP T;  2O88 A;  3PTA A;  2KYB A;  2MOX A;  2DXT A;  1VIE A;  4AFU C;  1LVK A;  3JB9 I;  1H92 A;  2K2M A;  2BE9 B;  2DM1 A;  3DKM A;  2F2W A;  4FYV B;  4JLI A;  2O4X A;  2VB6 A;  4PK4 A;  1KHC A;  2FVU A;  1W6X A;  1WHM A;  5KYX B;  4XAX B;  1UGQ B;  3PMI A;  2LJ3 A;  5FLX E;  2LJ1 A;  5KYX A;  1K8A R;  3JCM h;  2EQJ A;  4O6J A;  2XDD A;  2DMO A;  1JQQ A;  2ED1 A;  4FYX B;  1A0N B;  2LQK A;  5FW9 A;  1VQ7 A;  1Y71 A;  2K5I A;  2LX7 A;  3PVQ A;  1S1N A;  5D6Y A;  1BK2 A;  2RI3 A;  3QXE B;  4EMG A;  2JNG A;  4BI4 A;  1VQO Q;  3CME T;  2COW A;  5A0D A;  5GAN 2;  2EJ9 A;  4IKF A;  2CH4 W;  2H3J A;  2RH2 A;  2YLC A;  1VQ6 A;  4LDU A;  1QVF A;  2YRV A;  4M78 E;  4M7A A;  4BB7 A;  4PFP A;  1VQ9 Q;  3SEM A;  2KT1 A;  4AG2 C;  1PM3 A;  1XOV A;  4C0Z A;  1QLY A;  5IXF A;  4JZ3 A;  4BE0 A;  3UA7 A;  3L2Q A;  1VQN Q;  1M2O A;  2FO0 A;  1OPK A;  2NLU A;  5GAN e;  1NE8 A;  4LE9 A;  4BD3 A;  4C5G A;  4M75 C;  4C8Q G;  1XQH A;  1E6G A;  4KH1 B;  4A4H A;  3I56 A;  2HMA A;  1N9S A;  2P4R A;  2AZV A;  2V8I A;  4EMK A;  1VQN A;  4JLG A;  3HSB A;  2XIC A;  1U3O A;  2V8J A;  3CC4 T;  4ORZ A;  4XTX A;  2HL5 C;  5KYY A;  1SPK A;  2VWF A;  3CCE A;  1P92 A;  4M7A F;  3OW2 S;  2HZY A;  2LRQ A;  3CC2 Q;  1VQ5 Q;  3CPF A;  1QW1 A;  1B34 A;  2PNI A;  2EVR A;  4F7U A;  3I56 Q;  1X01 A;  2LCS A;  4Z8A A;  2DVJ A;  4JJD A;  2XD0 A;  2RQU A;  2L0A A;  4C0D C;  2HBP A;  2OI3 A;  2PVG B;  1S72 T;  4ZGJ B;  2COZ A;  3JCM Q;  4ESR A;  1T0J A;  2HSE B;  2O9S A;  3CQT A;  3TSZ A;  3E19 A;  1WJQ A;  3CXC S;  4LD9 K;  1Y96 B;  4AFZ C;  1YJW Q;  3CPW S;  1Q81 R;  4C5H A;  3GNF B;  2X51 A;  3PIO A;  4M78 C;  3CEY A;  1C6V X;  2A37 A;  4XU1 A;  5ECA A;  4EDU A;  1IGQ A;  1IZ6 A;  3A8L B;  2L8D A;  4YTL A;  1T3S A;  1M1K R;  3CBP A;  1YIJ T;  1K8A C;  3JCM d;  2EAY A;  2RHI A;  4FSS A;  1YHQ T;  3TU4 K;  4C0F A;  4C8Q E;  1N5Z A;  4XK8 E;  2QA4 A;  5LJ5 j;  3G71 Q;  4TVR A;  2KRM A;  4FYW B;  3HRS A;  2JS2 A;  4HVW A;  4OF1 A;  5LJ3 h;  5CR2 A;  2DBK A;  4PFZ A;  2DJZ A;  5GAN g;  2DZ9 A;  1G8X A;  2JMC A;  1Y0M A;  1KC8 C;  4M77 G;  2O31 A;  5GMK h;  1E6H A;  2R5M A;  1VQ6 Q;  2ED0 A;  1JBM A;  5J39 A;  5CCA A;  4X34 A;  3CMA Q;  3OYC A;  3S3O A;  4PJO D;  3HKS A;  3PVL A;  1Y7X A;  1KD1 C;  2XKO C;  2KNB B;  2EBP A;  3JB9 F;  3DLL A;  5D6X A;  4D8K A;  1CKA A;  4AT1 B;  1IRX A;  4QVZ A;  4M7A B;  4XTY A;  3L2U A;  5FWC A;  5GAN 5;  1YIJ Q;  1K8A U;  5FU7 C;  1I0C A;  3LWI A;  3NTK A;  2ZAE A;  2EQK A;  3CCR A;  3OS0 A;  1G83 A;  5D6W A;  1OU8 A;  2A0F B;  1XNI A;  3RES A;  3OYL A;  2JW4 A;  3EHQ A;  2JS0 A;  3LGF A;  3VJP A;  4FM4 B;  5GAO q;  3AT1 B;  5AT1 B;  4RTU A;  3I35 A;  2PUO B;  3I55 T;  1KC8 U;  2GGR A;  1NJI C;  5LJ5 g;  5CO7 A;  2QA4 T;  3QKJ A;  4KRT A;  5A2Q E;  4C8Q D;  1PHT A;  1WHH A;  5A0G A;  2E3I A;  2EKH A;  3QYH B;  2X4W A;  2X4X A;  1X69 A;  4P5N A;  4FW1 A;  3I55 A;  2O2O A;  1V1C A;  1EFN A;  2AT1 B;  2DTH A;  4Y28 E;  2JOY A;  1UUE A;  2DD4 A;  1WYX A;  1NYG A;  3CMA A;  4MZT A;  1BU1 A;  2B86 A;  4OMO A;  1ZSG A;  4N4G A;  4JJC A;  3C12 A;  5FU6 B;  1S72 Q;  1BB9 A;  1OI1 A;  1I5L A;  3SB2 A;  3KXT A;  2KGT A;  2GNC A;  2DRM A;  3CCU T;  2CT4 A;  2I0N A;  1UGS B;  3EG9 A;  5HY6 A;  1CKB A;  5CQY A;  5KCH A;  2EW3 A;  2AKK A;  2ROL A;  2L2P A;  1QCF A;  1KFZ A;  4NS5 A;  1WHG A;  3N5B B;  3CXC P;  3FEO A;  2KE9 A;  1WHK A;  2LP5 A;  1UB4 A;  5HK0 A;  3CCL Q;  4EMK B;  1WJS A;  4LNP A;  1ZHI A;  2EIF A;  3QJ6 A;  3G4S Q;  3QZ9 B;  3CCU A;  1D3B B;  1TS9 A;  3M5A A;  3P8D A;  1YJN T;  1X27 A;  1LOJ A;  4OMP A;  2RQV A;  1TUC A;  1VQ7 T;  3SD4 A;  1YHQ Q;  1KG1 A;  4A4K A;  2E12 A;  4J9H A;  1ABO A;  2RB6 A;  1KK7 A;  3VU3 C;  3G4S A;  3JB9 H;  2K5F A;  1N6A A;  1QMC A;  3SFM A;  4XTW A;  1TUG B;  1NLO C;  3O8V A;  1WHL A;  1ZBX A;  2M1H A;  1VQL A;  3OYM A;  3GPL A;  4J9D A;  2YRC A;  2GQI A;  3CCQ T;  3RDV A;  2KRN A;  3RNJ A;  2DA9 A;  4RKU E;  2H3E B;  5FRN A;  4GY5 A;  2C0I A;  2KRS A;  1YIT T;  2ZPI B;  1GCQ C;  1U5S A;  2MCN A;  1BYM A;  4M7D A;  1OEB A;  4X1V A;  4IUV A;  4JDS A;  5GAN j;  3J80 E;  3ER0 A;  3PE0 A;  5LJ3 e;  3LGL A;  1VQM A;  1KC8 R;  1PG5 B;  2LQ8 A;  2K9G A;  4C5I A;  4QT7 A;  2FPF A;  4LDX A;  2OTL T;  1VQ5 T;  1IO6 A;  1PKT A;  2H8H A;  3FDR A;  5GAO p;  1JO8 A;  2DXU A;  3E1S A;  1GBQ A;  1ZLM A;  5KYU A;  1GCQ A;  2E6Z A;  4E7S A;  2DEQ A;  1GFC A;  3P8B B;  2NYS A;  2GCX A;  3HFO A;  5FU7 B;  3REA B;  2HSP A;  2CZ6 B;  3OYH A;  2K3B A;  5KE2 A;  3H6Z A;  2M02 A;  3QYG B;  3HTR A;  4M78 B;  1VQK A;  2EQM A;  5GMK e;  2EYW A;  3RKY A;  3CC7 Q;  1M3B A;  3SWN A;  4E7Z A;  1V29 B;  3MPU B;  4OGC A;  5DLO A;  4KGZ B;  5GAM g;  2RJE A;  2A3L A;  4M78 A;  5L8R E;  3G4S T;  1TH7 A;  1YWP A;  3NPF A;  1K0S A;  2J6K A;  1X2K A;  3CD6 T;  3ZFJ A;  3CCJ T;  2D0Q B;  2QEX A;  4EMH A;  4V2S A;  1K9M U;  1I1J A;  3M0R A;  3UF4 A;  5GMK l;  2EFI A;  4JJB A;  2K3X A;  2VGN A;  4KH0 B;  1YJW A;  1WA7 A;  1ZA1 B;  1M90 R;  2JUF A;  4C92 D;  3MEA A;  1WXT A;  1X6O A;  2HCK A;  4RTW A;  4DA4 A;  3PT9 A;  3REB B;  2YUN A;  1MGQ A;  1OYX A;  3OS5 A;  2VAS A;  2EPD A;  2QGG A;  8AT1 B;  2KDS A;  3M55 A;  3OSS C;  3CD6 A;  4M7A E;  3NMZ C;  3EG1 A;  4E7K A;  2LX9 A;  2K79 A;  5C0M A;  4MML A;  4XTZ A;  1RAI B;  1T3L A;  2RI5 A;  4BI3 A;  2W10 A;  4PJJ A;  1ZSZ C;  1HYO A;  4OVA A;  3VUB A;  1MMD A;  1RLQ C;  1I07 A;  3I5R A;  2ESW A;  4R56 A;  4Y91 A;  5I11 A;  2CSQ A;  3E9G A;  4WCI A;  2HEQ A;  4M75 A;  2XI9 A;  3FC3 A;  1NJI U;  2PU9 B;  2CRE A;  1JJ2 A;  4CRI A;  4AMC A;  2L5Q A;  4FYY B;  4BDZ A;  2CP5 A;  1QVF P;  5GAN 4;  1RL2 A;  3VYG A;  4XTV A;  4PJO B;  3QDF A;  3L1A A;  2P84 A;  2VKN A;  2LQN A;  2ZZD A;  1YI2 Q;  3H9N A;  1TUD A;  3JB9 G;  3E9F A;  1NM7 A;  2J7I A;  2O01 E;  3OYB A;  3RKW A;  3CCR T;  1D0Z A;  2EYY A;  2Z0W A;  2DIQ A;  4Q5W A;  1WQW A;  2HAX A;  1VQL Q;  4R55 A;  4KBM B;  1LJO A;  3HRU A;  3RIR A;  4DQ2 A;  2YWW A;  3MHX A;  3A98 A;  1WQ7 A;  3M58 A;  1VQN T;  4ELY C;  2EYZ A;  5LJ3 j;  1AZG B;  3QHS A;  3PFS A;  1U8R A;  1ZSZ A;  1RAC B;  2DPP B;  4IIM A;  3CD6 Q;  5LJ5 h;  2MK5 A;  1VQ7 Q;  3I5S A;  2FB7 A;  4ZN1 A;  4ZNX A;  2KMT A;  2OAU A;  2HKN A;  1YJN Q;  1UJ0 A;  4LUD A;  3CCS Q;  2QQR A;  3LLR A;  1BBZ A;  1UJY A;  1W2B P;  1Y57 A;  4ELZ C;  2IPO B;  4M77 F;  4FT4 A;  3ZL7 C;  1RAF B;  2CKK A;  2SEM A;  4FCY A;  3C0C A;  2DL7 A;  3CC2 A;  2A08 A;  1UTI A;  2CGH A;  2DER A;  3QPH A;  1K76 A;  2A7Y A;  2QQB A;  4KGX B;  3OYN A;  4CC4 B;  4RTY A;  1H8K A;  2KI7 A;  2YRD A;  1PSF A;  2ECZ A;  3EG0 A;  2RI2 A;  2E3H A;  4DBQ A;  2WSF E;  3OMG A;  5CAI A;  2LCL A;  3A8M B;  5GAO l;  2GQV A;  2KAF A;  3CCQ Q;  2D8H A;  2Y4Y A;  4RCB A;  4E7L A;  2DIL A;  2GBQ A;  4JRI A;  4E7J A;  1EIF A;  3EGX A;  3JCM P;  1UDL A;  1M3C A;  2QAZ A;  3MP1 A;  2QI2 A;  2EJF A;  4M7D F;  1GBR A;  5GAN d;  1M1K C;  3E2U A;  3HHT B;  1M1K U;  5CKB A;  1VQ4 A;  1ZQ1 A;  4PJO A;  1BIA A;  2HQH A;  1JRI A;  2NUZ A;  1Z9Q A;  2NUP A;  5LJ3 g;  3R6N A;  2ZPG B;  2JXB A;  3NFC A;  3A1P A;  1VQO A;  1U06 A;  1SKU B;  1Q95 G;  2VGM A;  2A28 A;  4LN2 A;  5KH6 A;  4ZTJ A;  4PJM A;  3CCJ Q;  4C5E A;  3CCL T;  1BCM A;  5CKH A;  1QCN A;  1MNE A;  3M4G A;  5GAM j;  3I55 Q;  2DRK A;  2LT1 A;  2DVE A;  2E41 A;  1QVF S;  4PJN A;  1QQJ A;  2C06 A;  1Q86 U;  2V8K A;  2YXY A;  8ATC B;  1QCO A;  1YI2 A;  4XU2 A;  1G3W A;  5I2M A;  1Q86 C;  2WSE E;  2ROT A;  2DAQ A;  4F14 A;  1K4U S;  5GAO m;  3CPW P;  1G3T A;  5FRM A;  2DL4 A;  2XDP A;  4LD6 A;  4M77 D;  3HFN A;  3LH5 A;  3G6E Q;  1RAB B;  2RPN A;  2X35 A;  3RER A;  1K73 U;  4C0D B;  1N8R C;  1O9S A;  1WXB A;  3EFO A;  4C8Q A;  1FXX A;  2WSC E;  2B8A A;  4FW2 A;  3M59 A;  1HD3 A;  1M30 A;  1WNL A;  3CCV A;  1K73 R;  2RA2 A;  2EKO A;  2D8J A;  2OX7 A;  1NJI R;  3BFM A;  3T9N A;  3JCM V;  1R0B G;  2RJF A;  3TSW A;  3WXM B;  1OZ3 A;  4QVC A;  1Q7Y C;  1KJW A;  4BI8 B;  1ZUK A;  3CCU Q;  1BI3 A;  4IUU A;  5IAY A;  5HK3 A;  2OTL A;  3H0F A;  2IG0 A;  3QWY A;  1Q7Y U;  1GFD A;  4IUR A;  1XJW B;  1YIT Q;  1QKW A;  4CC2 A;  1K1Z A;  2DL5 A;  4M75 G;  2DBM A;  4ZGE B;  2ZPE B;  3A5Z B;  4RG2 A;  1VQO T;  3VYH B;  2F5T X;  4A4F A;  1VQ8 T;  2V26 A;  2OTJ Q;  1YJW T;  2DFU A;  4DEX A;  3OYE A;  4HA8 A;  1TTH B;  3FLG A;  4A54 A;  4FT2 A;  2FYK A;  1I8F A;  1NLP C;  3S3M A;  3M4Y A;  4HKE A;  2AKL A;  3V8J A;  1VUB A;  3G6E A;  4II1 A;  3JB9 J;  4QQG A;  1OOT A;  1OUL A;  3HRT A;  5IH2 A;  2CZ7 B;  3GNG A;  4F7U F;  1VQ8 Q;  2AHJ B;  3OYK A;  3VKI A;  4M7D B;  2JM8 A;  1WZO A;  1H3Z A;  1QWF A;  3DLM A;  1UE9 A;  1M2V B;  2KYM A;  1TU0 B;  4L59 A;  1PWT A;  1T0H A;  2M16 A;  1MMN A;  2CP3 A;  3VS3 A;  3CME A;  5FWB A;  1VQ6 T;  2YUQ A;  2O9V A;  3WVE B;  4C92 F;  2EGC A;  1OZ2 A;  1VA7 A;  2LC4 A;  3G6E T;  2RK2 A;  1NG2 A;  1AWX A;  4LDY A;  4M77 B;  4X9D A;  2BZX A;  4A4E A;  1WDX A;  3KBG A;  3UA6 A;  2NUT B;  1QVG A;  1Q81 C;  4PJL A;  3X24 B;  2BKD N;  1RLP C;  2E10 A;  3G71 T;  2Y4X A;  1ZUY A;  3M0T A;  4C8Q B;  5CKD A;  1WJR A;  2YT6 A;  3VS1 A;  4HT9 A;  1H3H A;  3LWH A;  3CBO A;  1Y07 A;  1OPL A;  5M9O A;  1D1B A;  2QGF B;  3G7Z A;  5DLQ E;  6AT1 B;  4AFS C;  2E5Q A;  2L3S A;  3X25 B;  2IVW A;  1G5V A;  2MAM A;  2C0O A;  2KK4 A;  4BDY A;  1MHN A;  1RI9 A;  4L5G A;  4OGE A;  4E47 A;  2K4Y A;  2CYZ B;  4LUE A;  3EFO B;  2YUO A;  3VV0 A;  1LCK A;  4JRP A;  4C92 E;  1M4Z A;  2CZ1 B;  4XU0 A;  2DK3 A;  3PNW C;  4IUT A;  5KYN A;  4B6M A;  3QII A;  2PZ1 A;  4Z88 A;  3EGU A;  2F2V A;  4OP0 A;  1VQ9 T;  2VVK A;  2YUP A;  1VIF A;  4MDW A;  1VYU A;  2KT8 A;  1I81 A;  2FG0 A;  3OYG A;  5IXB A;  2EYX A;  3WVD B;  3C4S A;  2KBT A;  4E2F B;  2G3R A;  1K9A A;  4JRQ A;  4J7F A;  1AVZ C;  1UGR B;  2XK0 A;  4Z89 A;  2L3R A;  5GJW B;  4PLL A;  2QG9 B;  5J3B A;  2CP2 A;  1WHJ A;  1NEB A;  1XTD A;  3M0S A;  3CCE Q;  3EGD B;  4QW2 A;  3UPU A;  2FZC B;  5GAM d;  3M0Q A;  3OY9 A;  2CT3 A;  1BI0 A;  3M53 A;  3H41 A;  3C95 A;  5GAM h;  3DB4 A;  4N4H A;  3OBY A;  1G3Y A;  3M56 A;  5GAO r;  3EGX B;  2JTM A;  4ZTF A;  1JXM A;  2QK0 A;  1H64 1;  2X9H A;  3BW1 A;  2LTO A;  4Y92 A;  5EG2 A;  1KD1 R;  1I5O B;  2JN0 A;  3VRZ A;  1KQS S;  3M57 A;  5IT9 E;  1AOJ A;  2HKQ B;  1C1A A;  4JRK A;  3CC4 Q;  3CCM T;  2QTX A;  1PKS A;  2V1Q A;  1YFN A;  3L2V A;  2KRO A;  1D0X A;  2AIR B;  1HXD A;  2FRW A;  5KE3 A;  3UWN A;  1M3A A;  3ME9 A;  2FZK B;  1HSQ A;  1OX8 A;  4RTT A;  2BZ8 A;  1YNZ A;  4M7A D;  1ZSZ B;  1S72 A;  2COY A;  3OQ5 A;  1J3T A;  1MMA A;  2E64 A;  2KEA A;  1W4S A;  5I21 A;  3H0I A;  1B7T A;  3CBM A;  4QKU A;  5GAN f;  2PTK A;  1X43 A;  3H0H A;  3RUX A;  4Z02 A;  2E1H A;  2VXE A;  1RAH B;  4C92 A;  3CCL A;  2K3Y A;  4J8O A;  2D9T A;  2JZ2 A;  2LT4 A;  3L2Z A;  4QVD A;  2FEI A;  3EFS A;  3LX7 A;  4N0A C;  2J6O A;  4J9E A;  2CP7 A;  2X4Y A;  5GMK i;  4M7D C;  3VS2 A;  1IRE B;  2J6F A;  3NTH A;  3KFV A;  3A8O B;  3RR6 A;  1IXD A;  2K57 A;  5J26 A;  5KYW A;  1Z9Z A;  1W2B A;  1KQS P;  1SG5 A;  2QEX T;  2CUD A;  1GXI E;  3CCE T;  5HCK A;  4OB3 B;  5EC7 A;  2KY9 A;  1YBY A;  3HP9 A;  2DXC A;  4QQD A;  3JCM g;  1SHG A;  4M7A C;  4J9I A;  1RAG B;  3JCM e;  2KXC A;  3JCM X;  1W70 A;  2DO3 A;  4C92 B;  4N0A A;  2CDT A;  1HJD A;  3A8H B;  3I56 T;  2DIG A;  3EH1 A;  4HXJ A;  2M0O A;  1RAE B;  1NEG A;  4VUB A;  9ATC B;  2WAC A;  1VYV A;  1YCS B;  4ZN3 A;  4JUV A;  1VQ4 Q;  2OTJ A;  5A0L A;  2EQI A;  3GBQ A;  5IHK A;  3QJY A;  2QA4 Q;  2PVD B;  2R57 A;  2RHU A;  4DOV A;  4XQ3 A;  2XG8 D;  2BIV A;  5GMK m;  4UC4 A;  2I2L A;  4ZGD B;  3JB9 D;  2CUB A;  4WTO B;  1Q82 C;  1YIJ A;  1UGV A;  4LDW A;  2KR3 A;  3V8L A;  1CSK A;  2FRY A;  2BE7 D;  2CH4 A;  4RTV A;  5CKF A;  3OYJ A;  3LYI A;  2PQW A;  4B9W A;  2QEX Q;  3L2R A;  1ACM B;  4BAC A;  5I2S A;  1R0C B;  2BTT A;  2HL3 A;  3DB3 A;  3I9Q A;  4M77 E;  4A4G A;  1K73 C;  4J7I A;  1D09 B;  1WXU A;  5CVI A;  3PMT A;  4PNO A;  1AWW A;  4DBR A;  2L3P A;  2J05 A;  4B9X A;  3TEE A;  5CK9 A;  4RUG A;  3P8H A;  2HQE A;  4OMM A;  3V7S A;  2NWM A;  3TCJ A;  4M78 F;  1OX9 A;  4C8Q F;  4HCB A;  4BE1 A;  1B34 B;  1YWO A;  3MEW A;  3OYD A;  2DET A;  3FJP A;  2OTL Q;  2RD1 A;  1JB0 E;  5GAM e;  4KT0 E;  1KD1 U;  3UT1 A;  3M54 A;  2X3X D;  4QQ6 A;  3X26 B;  2YDL A;  2KXD A;  4PLI A;  4OB0 B;  2BUD A;  1VQL T;  4HVU A;  3VS7 A;  2DX1 A;  4ME7 A;  3FIF A;  3NTI A;  1E7O A;  4F04 B;  3SWN B;  2EGA A;  3OBW A;  5GAN 3;  1SRM A;  2K2V A;  3OYY A;  3MP8 A;  3KUF A;  5L23 A;  1MUZ A;  1KHI A;  4DBF A;  1JU5 C;  4CI0 C;  2E65 A;  1KQ2 A;  4WF2 A;  4E7H A;  1VQK T;  3GIB A;  1KQ1 A;  3AHU A;  1Q81 U;  5CIU A;  4C92 C;  1VQP Q;  4IUP A;  4RMO A;  1AD5 A;  4RTX A;  4ATO A;  1YP5 A;  2RHZ A;  2P0P A;  1K9M R;  1B07 A;  3EHR A;  1RI0 A;  3J81 E;  1W2B S;  4LDV A;  1X75 C;  1PSE A;  1K9M C;  3NGP A;  3QO3 A;  1HK9 A;  3C94 A;  1G3S A;  5LJ5 e;  2LQW A;  2VV5 A;  1VOM A;  1F1B B;  2DTI A;  1FWZ A;  3PGG A;  4IUQ A;  1VQ9 A;  5IHN A;  3BY7 A;  3EGD A;  2ZPH B;  3UAT A;  2RQT A;  4J9B A;  4OMQ A;  2DE0 X;  4M7A G;  1M27 C;  1O75 A;  3V7C A;  2E5K A;  3OS2 A; 
#chains in the Genus database with same CATH homology
 4J9C A;  1X27 A;  4OMP A;  2J06 A;  4DEX A;  3VRY A;  2RQV A;  1TUC A;  1YN8 A;  1MV3 A;  2CSI A;  2LZ6 B;  2DL8 A;  3EG2 A;  2G6F X;  1KSW A;  4J9H A;  1ABO A;  1WFW A;  2M0Y A;  2XMF A;  1FYN A;  1NLP C;  4AFQ C;  2ABL A;  2AKL A;  1NLO C;  4F17 A;  4J9D A;  1X2Q A;  2GQI A;  4DEY A;  1OOT A;  2GTO A;  5IH2 A;  1WLP B;  3VS0 A;  1B3Q A;  4F16 A;  2JM8 A;  4HVV A;  4IIO A;  2KRN A;  1QWF A;  1UE9 A;  3RNJ A;  2DA9 A;  2KYM A;  1PWT A;  1T0H A;  3VS3 A;  2C0I A;  5FWB A;  2KRS A;  2D1X A;  2YUQ A;  2O9V A;  1GCQ C;  1U5S A;  2V1R A;  4GBQ A;  2HDA A;  2DLP A;  2HBW A;  2EGC A;  1VA7 A;  3JV3 A;  5GJV B;  2MCN A;  2DL3 A;  1OEB A;  1NG2 A;  1AWX A;  1OV3 A;  4X1V A;  2BZX A;  1ZUU A;  1FMK A;  1RUW A;  1WDX A;  2K6D A;  3PE0 A;  2FPD A;  3UA6 A;  1SRL A;  1UFF A;  2K9G A;  2MIO A;  4QT7 A;  3VS6 A;  2O88 A;  1GL5 A;  2FPF A;  2M51 A;  2KYB A;  2OJ2 A;  1RLP C;  2MOX A;  1IO6 A;  4AFU C;  1ZUY A;  1K0X A;  1PKT A;  2H8H A;  3M0T A;  1H92 A;  2K2M A;  1JO8 A;  2DM1 A;  2YT6 A;  3VS1 A;  1GBQ A;  1ZLM A;  1H3H A;  4HCK A;  1QKX A;  1OPL A;  2F2W A;  1GCQ A;  1UHC A;  1GFC A;  1SHF A;  1W6X A;  3REA B;  4AFS C;  2HSP A;  2DF6 A;  2L3S A;  2LJ3 A;  2LJ1 A;  1UG1 A;  2OAW A;  2K3B A;  2C0O A;  1RI9 A;  2DMO A;  4LUE A;  1JQQ A;  2ED1 A;  2EYW A;  2YUO A;  5I22 A;  5FW9 A;  1A0N B;  1LCK A;  1TG0 A;  1ZBJ A;  2LX7 A;  3PVQ A;  1S1N A;  1BK2 A;  1M3B A;  4OML A;  3O5Z A;  4JZ4 A;  1YWP A;  2CH4 W;  2PZ1 A;  4Z88 A;  3EGU A;  3NPF A;  1K0S A;  2F2V A;  2J6K A;  2VVK A;  1X2K A;  2RNA A;  2YUP A;  3SEM A;  1WIE A;  1SEM A;  1GCP A;  1PRM C;  1VYU A;  3SHW A;  2KT1 A;  2KT8 A;  4AG2 C;  1XOV A;  2FG0 A;  5IXB A;  1I1J A;  2EYX A;  3M0R A;  1QLY A;  5IXF A;  3UF4 A;  4JZ3 A;  1ARK A;  2EGE A;  4JJB A;  2GTJ A;  3UA7 A;  1WA7 A;  1OPK A;  2FO0 A;  2KBT A;  4LE9 A;  2D0N A;  1WX6 A;  1WXT A;  2HCK A;  4RTW A;  4JPB W;  1E6G A;  1K9A A;  3REB B;  2YUN A;  1ABQ A;  1AVZ C;  4Z89 A;  2EPD A;  5GJW B;  2P4R A;  1NEB A;  2AZV A;  3M0S A;  3NMZ C;  3EG1 A;  1U3O A;  2K79 A;  3M0Q A;  4ORZ A;  2CT3 A;  1SPK A;  2VWF A;  3H41 A;  3RBB B;  1T3L A;  1VYT A;  2W10 A;  2RMO A;  3QWX X;  4D8D A;  2PNI A;  2EVR A;  1RLQ C;  1I07 A;  2RQR A;  3I5R A;  2ESW A;  2LCS A;  4Z8A A;  4R0K A;  5I11 A;  2DVJ A;  4JJD A;  2CSQ A;  4WCI A;  2HEQ A;  1JXM A;  2RQU A;  2L0A A;  2CRE A;  1M8M A;  2OI3 A;  2BZY A;  1PRL C;  4Y92 A;  1AEY A;  4ESR A;  1T0J A;  3CQT A;  2O9S A;  3VRZ A;  3VS5 A;  1AOJ A;  3TSZ A;  1PKS A;  2V1Q A;  1NYF A;  2VKN A;  2LQN A;  4AFZ C;  2KRO A;  1TUD A;  2JM9 A;  2FRW A;  1NM7 A;  2J7I A;  1M3A A;  3VS4 A;  2EYY A;  1HSQ A;  2RF0 A;  4RTZ A;  4RTT A;  2BZ8 A;  1YNZ A;  2A37 A;  2LJ0 A;  5ECA A;  3FJ5 A;  1J3T A;  2JTE A;  3A98 A;  2KEA A;  2A36 A;  2EYZ A;  1T3S A;  3H0I A;  3THK A;  2QDL A;  2PTK A;  1AZG B;  1X43 A;  3H0H A;  1ZX6 A;  4IIM A;  4FSS A;  2AK5 A;  2ENM A;  3I5S A;  4ZNX A;  1N5Z A;  2FEI A;  1X6G A;  2J6O A;  4J9E A;  1UJ0 A;  4LUD A;  2F2X A;  1BBZ A;  2KRM A;  2J6F A;  1UJY A;  2FPE A;  3VS2 A;  1Y57 A;  3KFV A;  2JS2 A;  4HVW A;  3ZL7 C;  1Z9Z A;  2DBK A;  2SEM A;  4J9F A;  3C0C A;  1KIK A;  1MV0 B;  2CUD A;  2DL7 A;  2JMC A;  5HCK A;  4A63 B;  1Y0M A;  5EC7 A;  2RN8 A;  2SRC A;  2A08 A;  1UTI A;  2O31 A;  1SHG A;  3M0U A;  1K76 A;  1GRI A;  4J9I A;  1E6H A;  3NHN A;  2ED0 A;  2KXC A;  1W70 A;  4CC4 B;  4RTY A;  2CDT A;  1H8K A;  1HJD A;  2ECZ A;  3EG0 A;  3PVL A;  2KNB B;  4HXJ A;  2EBP A;  2JMA A;  1NEG A;  4D8K A;  1VYV A;  1UEC A;  1CKA A;  1JXO A;  1YCS B;  2D8H A;  2YSQ A;  2DIL A;  2EQI A;  2GBQ A;  3GBQ A;  5IHK A;  5FWC A;  4AG1 C;  1UHF A;  1UDL A;  1M3C A;  2CUB A;  1I0C A;  1GBR A;  1UGV A;  2KR3 A;  1G83 A;  1CSK A;  4OMN A;  2C0T A;  2FRY A;  2CH4 A;  4RTV A;  1JEG A;  2JT4 A;  2DNU A;  2NUZ A;  2BTT A;  2JW4 A;  1Z9Q A;  3EHQ A;  1SSH A;  2JS0 A;  3R6N A;  4CC7 A;  2JXB A;  5IHI A;  3I9Q A;  1WXU A;  1U06 A;  4J9G A;  1AWW A;  4RTU A;  3I35 A;  2A28 A;  2J05 A;  2L3P A;  4LN2 A;  2GGR A;  4RUG A;  4OMM A;  2NWM A;  3IQL A;  3M0P A;  2DRK A;  4KRT A;  1YWO A;  4E6R A;  1PHT A;  2EKH A;  4K11 A;  2LMJ A;  1AWJ A;  2X3X D;  2YDL A;  2ROT A;  2KXD A;  4F14 A;  1X69 A;  1K4U S;  2LNH B;  2RQW A;  2AZS A;  4HVU A;  2L3Q A;  3VS7 A;  2DX1 A;  2DL4 A;  2O2O A;  1V1C A;  3LH5 A;  1EFN A;  1E7O A;  1WI7 A;  1AWO A;  2EGA A;  1SRM A;  2RPN A;  1UUE A;  1WYX A;  1NYG A;  1W1F A;  3TVT A;  1BU1 A;  5L23 A;  1WXB A;  1MUZ A;  2B86 A;  4OMO A;  1JU5 C;  3U23 A;  1HD3 A;  1M30 A;  1ZSG A;  4JJC A;  1BB9 A;  2DYB A;  1AZE A;  2DJQ A;  2D8J A;  2KGT A;  2GNC A;  2DRM A;  1QWE A;  2CT4 A;  3TSW A;  2K7A A;  2I0N A;  1AD5 A;  1KJW A;  2IIM A;  4RTX A;  1CKB A;  4GLM A;  1YP5 A;  2ROL A;  1PNJ A;  1G2B A;  1ZUK A;  2AKK A;  2EW3 A;  2L2P A;  1B07 A;  3EHR A;  1QCF A;  2X3W D;  1KFZ A;  4EIK A;  3H0F A;  3QWY A;  2KE9 A;  3NGP A;  2LQW A;  2LP5 A;  1GFD A;  5IHN A;  3ULR B;  3UAT A;  2RQT A;  4LNP A;  4J9B A;  1QKW A;  4OMQ A;  1X6B A;  2DE0 X;  4CC2 A;  1K1Z A;  2W0Z A;  2DL5 A;  2DBM A;  1M27 C;  4M4Z A;  4CC3 A;  3EG3 A;  2E5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...