1NG2A

Structure of autoinhibited p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
ILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosolic factor 1
publication title Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase activator
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A01
1NYFA 1G2BA 1ZLMA 3U23A 1WX6A 1QKXA 2EYYA 4JZ3A 3EG1A 1VYUA 4RTVA 1B3QA 2GGRA 2J7IA 1T3LA 1UFFA 2LMJA 1HJDA 3NMZC 2F2XA 1K9AA 1M3AA 2DA9A 2KYMA 1E6HA 1OEBA 1SRLA 4LE9A 2LQNA 4GBQA 2PZ1A 4R0KA 1WI7A 2K9GA 1X2KA 3VS6A 1UE9A 1YCSB 4AFSC 2JM8A 1YNZA 5IH2A 2K2MA 1KFZA 3RBBB 2ABLA 2K6DA 1ABOA 1NLOC 2PNIA 3I5RA 2KROA 5GJWB 1WXBA 4A63B 1AWWA 1PKSA 2AK5A 1NM7A 2MCNA 2GTOA 4J9FA 1RUWA 2LX7A 4LNPA 1HD3A 3JV3A 2GQIA 4DEXA 1PRLC 2KR3A 1NLPC 2D8JA 3R6NA 4Z89A 3VS2A 4D8KA 3UA7A 1HSQA 3SEMA 1ARKA 5IHKA 1UJYA 1T3SA 2FG0A 2EBPA 4OMLA 2JS0A 5IXBA 2HSPA 3THKA 4RTTA 1UECA 2LQWA 2YUOA 1NEBA 2EGEA 2FPEA 1GFCA 2FRYA 3M0SA 2EVRA 3ZL7C 4HVUA 2J06A 1SEMA 3M0UA 2LJ0A 2EGCA 1JO8A 1QWFA 3UA6A 1XOVA 1YWOA 2DM1A 3CQTA 2DNUA 2DF6A 4J9EA 2A08A 2EYZA 1KJWA 3PVQA 1BB9A 4RTWA 2AZVA 2ED0A 2KGTA 3VS0A 1ZUKA 2C0TA 4OMNA 2LCSA 1JU5C 3PE0A 3EHRA 5EC7A 4AFZC 1K76A 2HDAA 1AD5A 1SPKA 2E5KA 2LJ3A 2D0NA 4F14A 2BZXA 3SHWA 1GCQC 1I07A 2DL3A 4JJDA 1PWTA 2YDLA 1FMKA 4FSSA 2K3BA 1W70A 1CKBA 4F17A 5L23A 1H3HA 2D8HA 1OPKA 2HCKA 1SHGA 4CC7A 3I5SA 1GBRA 2FEIA 4X1VA 4RTUA 1Z9ZA 3KFVA 2CDTA 1WLPB 2W10A 1UHCA 1AWJA 1T0HA 3VS3A 1H8KA 1X43A 5I22A 3NHNA 2DVJA 3IQLA 2DL8A 4J9DA 2C0IA 4EIKA 2O2OA 1M8MA 1SHFA 2K79A 1FYNA 2B86A 2DRMA 5FWCA 2KT1A 1K0SA 2JT4A 3C0CA 2FO0A 2IIMA 1AEYA 1QKWA 1UHFA 2JMCA 2RN8A 4JJBA 4D8DA 2RQRA 2JS2A 2DBMA 1YN8A 1ZUYA 2J6KA 3NGPA 4AFUC 1VYTA 2GBQA 4J9GA 4CC3A 3EG0A 4LUDA 1GBQA 2O9SA 1Y0MA 2ROLA 1YP5A 3FJ5A 2OI3A 2LNHB 1G83A 4HXJA 1V1CA 3H0IA 3EG2A 1X6BA 2CT3A 2KE9A 2EPDA 1GFDA 1W6XA 1M27C 3M0TA 1ZX6A 2FRWA 1SSHA 5ECAA 4HVWA 2JXBA 2JTEA 1ZSGA 5IXFA 3RNJA 2KRNA 1AWOA 2A37A 2HBWA 2RQTA 2CUBA 2X3WD 1BK2A 4QT7A 4OMQA 3TSZA 1AOJA 1U06A 2W0ZA 2X3XD 2I0NA 2EW3A 2GTJA 3A98A 3M0PA 2RPNA 4JPBW 2EGAA 4LN2A 4Z8AA 3TVTA 1I0CA 2CT4A 1M3CA 2RQWA 2A36A 2RNAA 1BU1A 2L2PA 2DRKA 1U3OA 2CSIA 3GBQA 2H8HA 1E6GA 4KRTA 1QWEA 2V1QA 1JEGA 2LJ1A 1MV0B 2RF0A 4AG1C 4HCKA 4WCIA 1W1FA 2L3QA 4E6RA 2ECZA 1JXMA 1TUDA 1NEGA 3VRZA 1I1JA 1K1ZA 1PNJA 2J6FA 2CUDA 4LUEA 1Y57A 1IO6A 2DL5A 2HEQA 2KYBA 1K4US 4HVVA 2EQIA 4RTZA 3UATA 2DYBA 2ED1A 2DE0X 2AZSA 2YT6A 1RI9A 1UUEA 2XMFA 2KNBB 1E7OA 4AFQC 2LP5A 5IHNA 2KBTA 2RQVA 2DBKA 2AKKA 1JQQA 1K0XA 1ZUUA 2CH4A 4IIMA 2DL4A 1X2QA 1MUZA 1Z9QA 2FPFA 1U5SA 2JMAA 1UG1A 4J9BA 2O88A 1AZGB 2ENMA 3UF4A 4RTYA 4J9CA 3ULRB 2NUZA 3REAB 1N5ZA 1AZEA 2OJ2A 2CREA 1S1NA 4Z88A 2L0AA 1GCPA 2P4RA 2J05A 1AVZC 4DEYA 3QWXX 2DX1A 2F2WA 1X6GA 3H41A 1QLYA 3H0FA 1PHTA 1OPLA 1PRMC 3REBB 2EKHA 2NWMA 2DL7A 2PTKA 2M0YA 1KSWA 3PVLA 2DLPA 3LH5A 4J9HA 2OAWA 1UGVA 2CSQA 2SEMA 2M51A 3EHQA 2CH4W 4OMPA 3TSWA 2SRCA 1UJ0A 1B07A 3VS4A 1WA7A 5HCKA 1NYGA 1WXTA 3VS7A 1GL5A 5FW9A 1WDXA 2YUNA 2JM9A 2RQUA 1H92A 3EGUA 1WXUA 1X27A 2RMOA 2ROTA 2G6FX 1CKAA 2L3PA 1PKTA 2F2VA 2KT8A 4RTXA 5I11A 1A0NB 1ZBJA 2BTTA 2BZ8A 2KXDA 1KIKA 2KXCA 1VA7A 2ESWA 2QDLA 3I35A 1TG0A 1VYVA 2AKLA 2DMOA 1SRMA 2O9VA 4ESRA 4OMOA 1T0JA 4Y92A 3QWYA 2C0OA 4CC4B 1UDLA 2D1XA 2O31A 2GNCA 4CC2A 4ZNXA 2YUQA 2DILA 1WYXA 3O5ZA 2EYXA 4OMMA 4IIOA 1GRIA 2KRSA 4JJCA 2V1RA 1YWPA 2MIOA 2KEAA 2DJQA 1X69A 1CSKA 4AG2C 3VRYA 4GLMA 1EFNA 2VVKA 1J3TA 5GJVB 2J6OA 3EG3A 2VWFA 1NG2A 1TUCA 1AWXA 1JXOA 2YUPA 2EYWA 4J9IA 1GCQA 3I9QA 1M30A 5FWBA 1BBZA 2FPDA 1WIEA 4F16A 2L3SA 2KRMA 1MV3A 3VS1A 1M3BA 1ABQA 1UTIA 3M0RA 4JZ4A 1OOTA 4ORZA 2YSQA 3NPFA 5IHIA 1WFWA 1RLQC 2BZYA 2K7AA 2JW4A 1RLPC 1QCFA 3M0QA 4K11A 2MOXA 4RUGA 3H0HA 3VS5A 4M4ZA 1LCKA 2A28A 1OV3A 2LZ6B 2VKNA
chains in the Genus database with same CATH superfamily
3OYJA 1NYFA 4A4HA 2EKOA 3VUBA 8ATCB 1N8RU 1RAEB 3U23A 3CCLA 1SKUB 1N9SA 3OYMA 4M75A 1VQ9A 4M7DD 4EMHA 3HFNA 3M55A 1VQPQ 3EFRA 2YLBA 3JCMe 4Y28E 2LMJA 4C8QD 3A8MB 4EMKB 2E41A 3MKDA 5KYXB 4M7DF 2LQNA 2JTMA 1WI7A 1MNDA 1IRXA 4JLGA 4C5HA 1YCSB 2P0QA 4C8QF 2RI5A 1AT1B 2RHIA 2ABLA 3PNWC 3CCJT 1NLOC 2EAYA 3OS0A 3G71Q 4A4EA 4FL6A 2KROA 4MMLA 2CP5A 1K9MU 2MCNA 5FU7C 1S72Q 2LQKA 3I55Q 3CC2Q 3G4SQ 1KQ2A 1R0CB 2GQIA 2YXYA 1PRLC 5CKDA 2D8JA 1KC8R 4L59A 3VS2A 4D8KA 3UA7A 4TVRA 1YJ9Q 4LD6A 5IHKA 4C8QB 4M7DG 3V8LA 1TSFA 3OW2P 4FYWB 3EFSA 4RTTA 5GMKm 3MO8A 2AIRB 4E47A 2COWA 1FX7A 5J39A 4PNOA 1K73C 2OTJA 1B34B 2EVRA 3ZL7C 4FYVB 2LCCA 1VQLQ 2M1HA 5GANf 3OYIA 1VQ4T 1WGSA 5CCAA 2DNUA 3CC7Q 1KJWA 1BB9A 5GAN7 4E7HA 4FYYB 3VS0A 1UEBA 4KH1B 2RI2A 2A3LA 2EQJA 1M90C 3LLRA 2HDAA 1AD5A 2E5KA 2LJ3A 1KD1C 4F14A 2F5KA 1I07A 4E7LA 3V7CA 1VQ6T 3X24B 1SSFA 2K3BA 1KQSA 2PVDB 5HK0A 3C95A 5L23A 2JN0A 3QHSA 3CD6T 2FEIA 4X1VA 1UGQB 1Z9ZA 1WLPB 5GAMf 4EMKA 4C92E 2DPPB 2E6NA 4ATOA 2LQ8A 5KYXA 1M1GA 1W4SA 2RA2A 3VS3A 3UWNA 3E19A 1QVGA 1X43A 2Y90A 8AT1B 1M8MA 3LW5E 4XTZA 5LJ3d 3BW1A 3GNGA 3C0CA 1QKWA 2JMCA 2XK0A 2M02A 4KT0E 3EFOB 2R58A 2FB7A 1VQ5Q 1M1FA 4OP0A 5IN1A 4CC3A 2LDMA 1KD1R 4LUDA 2O9SA 1FMWA 3RMQA 2R5AA 2YWWA 3LH0A 2LNHB 3H0IA 1X6BA 2C06A 5FU6B 4GLKA 4C0DC 3L2ZA 1WPYA 4JUVA 1MGQA 1SSHA 5ECAA 1YIJQ 4C8QA 1S72A 3I55A 1VQKT 3CC2A 4M7DC 1AWOA 3JB9G 1V76A 2DD4A 3M53A 2KY9A 2QQ9A 3TQ7P 2X3WD 1BK2A 3TSZA 4C8QC 1YJ9A 2EW3A 2GTJA 1VQ8Q 4KGXB 2ZAEA 3VU3C 5FRNA 2NYSA 3A98A 2EGAA 4IUPA 2HL3A 4CRIA 1VQLA 1BKBA 1BU1A 3GBQA 3V8KA 2H8HA 1BI0A 2E6ZA 5GMKl 2V1QA 1MMDA 1D09B 3CC4Q 5GAOr 2RF0A 4AG1C 4HCKA 4WCIA 3SWNB 1W1FA 4E6RA 3OYGA 2DZCA 2GFUA 1NEGA 1YI2Q 5LL6S 3VRZA 3OW2S 3ME9A 1XJWB 1K1ZA 2F1LA 1PNJA 4C92D 4LUEA 1Q86C 4ZN1A 1NJIR 3BDLA 2KYBA 1K4US 1HYOA 2EQIA 4PLIA 1RABB 3UATA 2DYBA 3FLGA 3FIFA 4PFZA 2E3HA 3GNFB 3OA6A 2QA4Q 4J7FA 4C92F 5AYFA 3GLXA 5C0MA 5GMKh 3ZBDA 2E65A 5D7UA 4M75E 2E3IA 2DBKA 1JQQA 1AHJB 1K0XA 2KDSA 3EFOA 1YHQQ 1X2QA 2FPFA 2JMAA 1VQMQ 4J9BA 5GMKe 1Y71A 3OYBA 2YLCA 3OBYA 5D6WA 1PSEA 2RB6A 3PIPA 2EJGA 3REAB 1N5ZA 1IB8A 3CXCP 2OJ2A 3CCEQ 2CREA 3INZA 2AHJB 2L0AA 2BE7D 4B9WA 1D1CA 2DX1A 2F2WA 3L1AA 1PRMC 4HCCA 2EKHA 2DL7A 2HD0A 3PVLA 5CQYA 5A0DA 4ZTJA 1MMAA 1WZOA 2M51A 1M1KR 2OTLT 3EHQA 3CCRT 2FZGB 3S3OA 3X28B 4C92G 3QJYA 4RMOA 1BI2A 2DXTA 1OX8A 3TSWA 3E1SA 1UJ0A 1ZQ1A 2DIQA 2RO0A 1B07A 3ZEHA 1Q81C 1GL5A 3CCSQ 1Q7YC 1K73U 1Q82C 3VJPA 2Z0WA 2JM9A 4YTLA 2I2LA 1B7TA 5GAN4 5CAIA 2L3PA 4DQ2A 2F2VA 3CMAT 2LX9A 5KH6A 1NPPA 2EWNA 4VUBA 4DA4A 3G6EQ 1IHVA 2M16A 1KIKA 3SWNA 1VA7A 2P84A 2RI3A 2VASA 1M90U 3JCMd 2AKLA 2DAQA 2O9VA 2IG0A 4M7AD 4OMOA 2O31A 2Y4YA 4L6V5 4JRQA 3CC4A 1WYXA 5FROA 2DIGA 1N8RR 2K5IA 4JJCA 1FWZA 2EFIA 1YWPA 2HBPA 4UC4A 2MIOA 1X69A 3X20B 4BY6B 4M7AF 1YI2A 2KQWA 3P8DA 4OGCA 1R77A 1EFNA 1RADB 1IGQA 2HZYA 5GANg 4J9IA 4PLLA 3CCMT 1GCQA 3OYKA 3L2RA 2NUTB 2FPDA 3HRUA 4J5YA 4N4HA 3RKWA 2CP6A 2KRMA 3JCMX 4N4GA 2DERA 1VQ4A 2QA4A 2X35A 1OOTA 1QCOA 1OZ3A 3E2UA 3OMCA 1K8AC 1N27A 3CCQQ 1RLQC 2K7AA 4M75F 3M54A 1W2BP 1RLPC 3MHXA 2MAMA 1YHQA 1BIBA 3LGFA 4M7AB 3CMET 1VQMA 3CPWA 1G2BA 4B9XA 4HCBA 3CCUT 1ZLMA 1WNLA 4OF1A 2RM4A 1WX6A 4E7JA 1K9MR 1QKXA 1O75A 1VQ9Q 1VQ6A 4J7IA 2EJFA 4JZ3A 3EG1A 2RHXA 3CCEA 4BE2A 4R56A 4EDUA 3HPWA 2GGRA 1T3LA 1BI1A 1OU9A 4QQ6A 3NMZC 3OYNA 4C92C 5LJ5h 7AT1B 1QW1A 2E5QA 1YJNQ 1OEBA 4HA8A 1WHKA 2R5MA 2PZ1A 1QVFS 4HCZA 4AT1B 1KK7A 2JM8A 1YNZA 4M75G 5GMKj 1RAFB 4C8QE 2GF7A 2K6DA 1MMGA 3QXEB 3X26B 2CKKA 2XKOC 3CCSA 5A0LA 3NTIA 2JOYA 5GANe 2OAUA 3I5RA 1G3SA 2V8JA 4X9DA 1EZZB 1NM7A 2GTOA 2E10A 4J9FA 5FLXE 4ZGDB 3G6EA 3WXMB 2V8KA 4FW2A 4JDSA 1QP2A 4Z89A 2CP0A 4PJOB 1TS9A 2RHZA 1ARKA 3QIIA 1Q86U 3CEYA 2XIDA 4OMLA 1D0ZA 2VYTA 3THKA 1MMNA 1VQKA 4LDXA 4KUDK 4M77B 2YUOA 1U8RA 2EQMA 1BI3A 4HVUA 4HT8A 4OGEA 4A4FA 1JO8A 3CBMA 1U1TA 4ZTFA 2DF6A 4CI0C 2A08A 1WHLA 1YCYA 1TWBA 3PVQA 2EIFA 2AZVA 4OB1B 1ACMB 2NUPB 2QQBA 3JCMV 1JU5C 3J7AF 3PE0A 3EHRA 3P8BB 3G1JA 2R57A 4PJLA 1VIEA 4BD3A 4RCBA 4M7AA 2D0NA 3H6ZA 4R55A 2DXUA 3EGDA 2DL3A 2YDLA 1FMKA 2LVMA 3VKIA 3PGGA 1Q95G 1OPKA 2MWPA 1G3WA 2JZ2A 1I4K1 3QJ6A 4C0FA 1GBRA 3LWHA 3KFVA 2CDTA 3QYGB 3JCMh 2QTXA 2MI6A 2XHCA 2GCXA 3MCAB 1M2VB 1GXIE 4O6JA 2P0KA 1JRIA 2CZ1B 4PJJA 5LJ3f 2DL8A 4J9DA 1BYMA 3NTHA 4BB7A 2E12A 1ZA1B 2WSCE 1VQ5T 2K79A 2B86A 1QVPA 1Q81U 1Q7YU 3OMGA 1Q82U 1YJNA 2JT4A 4C5GA 4JJNK 2FO0A 4M75C 1AEYA 1UHFA 2DEUA 4D8DA 2HMAA 2DBMA 1OYXA 3L2VA 3X25B 5CVIA 4AFUC 2NLUA 3NGPA 1VYTA 5I2MA 2HNIA 2QQRA 3MJXA 3BDUA 2QEXT 2P4TA 4NL3A 1VQNT 3AHUA 4J6WA 1Y0MA 3L2UA 2RJDA 3HP9A 5I2SA 5KYWB 1WJSA 2OI3A 1G83A 1V1CA 2QK0A 4KGVB 4EPCA 3EG9A 3EG2A 2CT3A 2KE9A 4LDVA 4PJOA 3L2QA 1W6XA 2BE9B 1YBYA 2FRWA 5GAOn 4BI4A 4LDYA 2DJZA 3M9QA 4M77A 3RNJA 2RJEA 4XU0A 4JRKA 3CCRA 3BE3A 5HKCA 2RQTA 1V29B 3OYDA 4QT7A 4OMQA 5LJ5j 2PVOB 3URGA 1AOJA 4Q5WA 4WF2A 2W0ZA 1DJ7B 2I0NA 3MEAA 4KUIA 2K2VA 1LPLA 1G8XA 2NUPA 2RPNA 4ZGJB 5GANj 4C8QG 2RJCA 1N9RA 2A36A 4JRPA 2PVGB 4XTWA 1K8AU 1PG5B 5GAOp 3CMAA 2RK1A 2KK4A 4OB3B 3EH1A 4BE0A 1OULA 2E1HA 3SD4A 1YITT 1JJ2S 3FDRA 3UPUA 2KVQG 2L8DA 1M2VA 1OI1A 3CPFA 3C12A 2XDDA 4HVVA 4E7ZA 9ATCB 1TOVA 1ZSZB 2YT6A 2M9UA 2KAFA 5CR2A 4MDWA 2RD1A 1BCMA 2LP5A 2VXEA 5KYUB 5IHNA 2RQVA 5J3BA 1QQJA 4NS5A 3M58A 4GY5A 5J26A 1K73R 4MZTA 1Y07A 3C94A 1MUZA 5CKHA 3HFOA 4EMKC 2O88A 1AZGB 2ENMA 4RTYA 4QQGA 5KYWA 3JCMJ 4OB2B 1AZEA 4MZPA 3I56Q 3M56A 1M90R 3OSVA 3CCVT 4RG2A 3CCUA 3H0FA 1PHTA 1OPLA 2QGGA 1QVFA 3REBB 2JVVA 4MMKA 4XTXA 2DLPA 2LTOA 4F7UB 2XG8D 3ER0A 1XTDA 4OMPA 3OYLA 4FT4A 1XQHA 1WA7A 3VS7A 1SG5A 2YUNA 1H92A 1WXUA 1ZHIA 1B34A 2G6FX 2QXFA 1CKAA 4C0ZA 2HAXA 1PKTA 4RTXA 5I11A 3A5ZB 1ZBJA 2BZ8A 2KXDA 3CCJQ 2RHYA 4NL2A 5CQXA 1C6VX 3H9NA 1YJWT 1SF9A 4Y92A 1UDLA 2D1XA 3WVEB 1G3YA 2YUQA 4N4IA 4BI3A 4IIOA 2CP7A 2KRSA 3A8LB 4ANJA 4DBFA 5LJ5d 1WJRA 2DJQA 3OBWA 4DOWA 1ZSZA 2LRQA 4AG2C 2MF2A 3VRYA 4M7AE 6AT1B 1G3TA 4JS5A 3KUFA 2J6OA 2BIVA 3OS1A 2F5TX 2VWFA 5KYUA 1KQSP 5GANd 2EYWA 2LC4A 1MV3A 1VQ4Q 3VS1A 3V8JA 1ABQA 3EGXB 1LOJA 3M0RA 3L42A 4JZ4A 4ORZA 3JSCA 4Y91A 2VV5A 5DY9A 4A4GA 3CCLT 1QVGP 2FZCB 3E9GA 3H0HA 1JBMA 4FU6A 2EJ9A 2A28A 5CKEA 2GQVA 2VKNA 3FEOA 3MEUA 4PJMA 4XTVA 2L3RA 1VQ6Q 2X4XA 3GIBA 2XD0A 4F7UA 1VYUA 2MPXC 1TXQA 4RTVA 3I56A 1B3QA 5GAN2 3CD6Q 2HQXA 1UFFA 5LJ3g 1K9AA 5IAYA 3HRTA 1Q86R 2KYMA 4LE9A 3OYCA 2KMTA 3HHTB 4R0KA 5FU6C 2CZ0B 4PJOE 4IUUA 1UE9A 2K2MA 1KFZA 3QYHB 1Y7XA 1D1AA 1PC0A 4M78D 4M77E 2QDYB 1IXDA 1KHIA 1M8VA 1H641 1VQOT 2MYSA 2QQAA 1AWWA 1PKSA 1I81A 2AK5A 2CP3A 2CS7A 3DKMA 3KXTA 2E4HA 4M78F 1X01A 1HD3A 3JV3A 3CCJA 4DEXA 3R6NA 2OTJT 1M2OA 3RUXA 1G5VA 3AT1B 3F70A 1HSQA 4XQ3A 1UJYA 1T3SA 2FG0A 2EBPA 5IXBA 2FZKB 1VQKQ 2HSPA 3J81E 2BUDA 3SWNC 2WSFE 1I8FA 4D6WA 1NEBA 2EGEA 2FPEA 1GFCA 3HKSA 2FRYA 4X9CA 1VQ7T 2JNGA 3V7RA 1SEMA 2LJ0A 2EGCA 3EGXA 1QWFA 1YWOA 2DM1A 3LWIA 1RAAB 1JJ2A 1LJOA 4RTWA 1Q81R 2KGTA 2ED0A 4M78B 5LJ3e 3JB9J 1Q7YR 1Q82R 1ZUKA 2YRVA 5KYYB 4BI8B 2DXCA 4PL6A 3A1PA 5EC7A 4QVZA 2BZXA 1QCNA 3SHWA 1GCQC 4IUQA 1D3BB 4FSSA 5HY6A 5A0GA 1UGSB 4PKCC 4F17A 1OU8A 2PU9B 2HCKA 1VQPT 5DLOA 1NPRA 1UHCA 4XTYA 3M59A 1AWJA 4FT2A 3R6OA 4KULA 5GAMg 1IHWA 1RI0A 4M7AG 2X4YA 4PJOD 5I22A 2DVJA 2C0IA 3GOXA 3CD6A 4MDXA 1FYNA 2DRMA 3OSSC 5FWCA 2KT1A 1HK9A 4M77D 2IIMA 2G3RA 2RN8A 1D1BA 2RQRA 2JS2A 4PJOF 1YN8A 2JTFA 3G71T 1ZUYA 5GANh 4C0GA 1C0MA 1LVKA 3EG0A 3QZ9B 3CXCS 2QAZA 3S6WA 1K8AR 1ZA2B 4M77F 1S72T 3I55T 2ROLA 2ZGWA 3CC2T 1YP5A 1RACB 3FJ5A 3G4ST 4HXJA 2HKQB 1VOMA 2EPDA 3DLMA 3CCVA 1YJ9T 4HVWA 4EMGA 3OYYA 2JTEA 3QKJA 3RMSA 4RCCA 5IXFA 4JLIA 4B6MA 2CZ7B 2OTLQ 2A37A 3CCRQ 3JB9H 3RIRA 5KYNA 2MWOA 1VQLT 2QYZA 1WHJA 1R0BG 4N0AA 4E7IA 3QDFA 5GAMh 3H8ZA 1U06A 2HQHA 2X3XD 1IREB 3JAME 3LGLA 3CC7T 5FU7B 1X6OA 4PJOG 2DTHA 4M78A 3NFCA 5KYYA 2NUTA 4PK4A 1M3CA 4BY6C 1TH7A 3OYHA 2JUFA 4JRIA 5GAMe 2L2PA 3SDZA 2DRKA 1U3OA 2AT1B 4L5GA 2CSIA 2ZPEB 4M77G 3JCMQ 1E6GA 4KRTA 3CMAQ 1QWEA 5GAOl 2ATCB 3BY7A 5HK3A 1MV0B 4M78C 1D3BA 4DBRA 3OW2A 2L3QA 5GMKi 3V7SA 3RKXA 4BUGA 5M9OA 3JCMb 1P92A 2DD5A 2DKGA 2KI7A 5CK9A 2CUDA 4QKUA 5DM7R 4O5VA 2DL5A 2DZ9A 2HEQA 5L8RE 1FMVA 4RG8A 3D7SB 4RTZA 5KE3A 2DXBA 2ED1A 2DK3A 3CPWP 4M7AC 2K5FA 3TCJA 2ZPHB 4ZGEB 5AT1B 1H3ZA 3JCMW 1OQKA 3CCMQ 2LCLA 4F7UE 4PFOA 1R8OB 1ZUUA 2CH4A 2RHUA 2DL4A 2A7YA 1U5SA 3WVDB 1W2BS 3UF4A 4BACA 3A8OB 5FRMA 1KC8C 4P5NA 1S1NA 2FHDA 4Z88A 1GCPA 2RH2A 1AVZC 2EQUA 3QWXX 3CMEQ 2Y4XA 3CCUQ 4KBMB 3HL8A 1QLYA 3OS5A 3A8HB 1YIJT 3HRSA 4OMFB 1KSWA 1KHCA 4J9HA 4XU2A 1BCOA 1UGVA 2CSQA 3QPHA 2LT1A 5A2QE 2COYA 4IUVA 2X4JA 3O8VA 3VS4A 1VQ8T 1NYGA 2DYIA 1WDXA 3SB2A 3NTKA 2RQUA 1X27A 2RMOA 4PJOC 2OTLA 1TTHB 1IGUA 4BDYA 4C0DB 2FVUA 4LDWA 4M77C 3CC4T 1A0NB 2XDPA 2KXCA 4M7DB 2PQWA 3OYEA 4FIBA 1TG0A 1VQOA 1VYVA 4HT9A 4J8OA 2HL5C 1WHGA 5GAN6 4ESRA 4WTOB 1T0JA 1YI2T 3QWYA 3MEWA 3Q1JA 3ASKA 4FYXB 2GNCA 4BDZA 5GAN3 5DLQE 5KCOA 5LJ5f 3OQ5A 4OMMA 3MP1A 1QP3A 5EG2A 2V1RA 1FXXA 2KEAA 2O4XB 1CSKA 3VYGA 4GLMA 2QA4T 3ZFJA 3T9NA 5GJVB 3PIOA 4MZMA 3EG3A 1JXOA 2CGHA 1BBZA 1KQ1A 4F16A 3N5BB 1YHQT 3PFSA 4OB0B 1VQ7A 5GAMj 1M3BA 1VQMT 2YSQA 3NPFA 5IHIA 1WFWA 2HQEA 3CCMA 4F7UF 4C5IA 5CKFA 1TUGB 1UGPB 4K11A 3CCET 3DB3A 4FM4B 4RUGA 3QG1A 4M4ZA 1LCKA 1OV3A 2LZ6B 2ZPGB 4X34A 3JB9D 2DTOA 1WQWA 2LNVA 1N6AA 4C5EA 4RKUE 2EYYA 3CPWS 3QZ5B 4ELYC 4Z02A 1WQ7A 1F1BB 2QTVA 1VQPA 2J7IA 3JB9F 1PSFA 3FRNA 3CMEA 2DETA 1HJDA 2VC8A 3MP8A 3PT9A 3HSBA 2F2XA 2PUKB 1M3AA 1RL2A 3LYIA 2DA9A 1E6HA 1SRLA 3CCST 2XI9A 3GPLA 4GBQA 1IZ6A 2K9GA 1X2KA 2X9HA 2DVEA 3CXCA 3VS6A 3FJPA 4AFSC 3QO3A 5IH2A 1PD0A 2M0OA 3RBBB 1M4ZA 2D9TA 4LXCA 4F7UG 1NBEB 2RJFA 4DOVA 4LD9K 3G6ET 1ABOA 2EYQA 1D0XA 2PNIA 4M7DA 3BFMA 3G71A 5GJWB 1WXBA 2ZCFB 4A63B 2QEXQ 1PCXA 2K57A 2FYKA 3OB9A 1VQNQ 2RK2A 1OX9A 3JCMf 1NJIC 1RUWA 2LX7A 4LNPA 4M78E 3G4SA 2KR3A 1NLPC 3MPUB 1WHMA 2O4XA 3TU4K 1UB4A 3JCMP 3SEMA 5I21A 4J6YA 2JS0A 2GFAA 1UECA 2K3XA 2LQWA 3M0SA 4J83A 4JS4A 1VUBA 2J06A 2P0PA 3M0UA 3UA6A 2A0FB 1XOVA 3CQTA 4PJNA 4XAXB 4J9EA 2MMPA 2EYZA 3CC7A 3A8GB 3CCQT 2COZA 4QVDA 5KE2A 2HKNA 2C0TA 4HKEA 4OMNA 2LCSA 2DTIA 5CKBA 1ZSZC 2VB6A 4A54A 4AFZC 1K76A 1PD1A 1SPKA 1RAIB 3QSUA 4NOYA 4XU1A 3JB9I 2XDBA 4JJDA 3MEVA 1PWTA 1MNEA 1KC8U 1VQ9T 1W70A 2D0QB 1M1KC 1CKBA 1YITQ 2L5QA 2XU8A 3EAEA 1H3HA 2D8HA 3M4YA 2YRDA 2D6FA 1SHGA 4CC7A 3I5SA 4RTUA 3PMIA 2FL7A 2W10A 1VIFA 3P8HA 1YJNT 2QG9B 3QBYA 1T0HA 1LNXA 2JJ9A 5GAMd 4KGZB 1XNIA 1W2BA 1H8KA 2CZ6B 3IQLA 3NHNA 4ELZC 2V8IA 1JB0E 4EIKA 2DEQA 4XK8E 2O2OA 4E7KA 1SHFA 4V2SA 1QVFP 4ME7A 3SFMA 1K0SA 2CP2A 2O01E 2X4WA 3E9FA 2XICA 3S3MA 4JJBA 3MP6A 2ZZDA 3UDCA 2E70A 2J6KA 5KCHA 2GBQA 3C4SA 1VQ5A 4J9GA 3RERA 3GF5A 2ZPIB 1GBQA 4C92B 2WSEE 1N8RC 1UGRB 2ZPBB 2EQKA 4IKFA 2PUOB 3PMTA 4E7SA 2IPOB 3TEEA 3OYFA 3JCMc 1GFDA 1M27C 3CCVQ 4A4KA 3M0TA 1ZX6A 2QEXA 1C1AA 3UT1A 3KBGA 2JXBA 1YIJA 1VQNA 2QASA 2K5LA 1ZSGA 5C6SA 2K3YA 2KRNA 2HBWA 3OY9A 5CO7A 4DBHA 1M9SA 1NE8A 2CUBA 1RAHB 2QQSA 1VQ8A 3VUZA 3QUIA 5CIUA 3CBPA 3OYAA 5GAOm 3M0PA 4JPBW 4Z8AA 3TVTA 4LN2A 1I5OB 1I0CA 2CT4A 5LJ3h 4AMCA 2RQWA 3META 3TREA 2RNAA 1KD1U 2K4YA 1Y96B 1JEGA 1K9MC 2LJ1A 5LJ5g 2ECZA 1JXMA 1TUDA 1YJWQ 2VXFA 1I1JA 4M78G 1EIFA 2DFUA 5D6XA 2J6FA 1Y57A 1IO6A 4M75D 1M5Q1 4DBQA 1HXDA 3QDRB 1YITA 3EH2A 3HTRA 4FSXA 3PTAA 2YRCA 3LX7A 2DE0X 3VV0A 3DB4A 2AZSA 1KQSS 1WJQA 5GAN5 1RI9A 2ZPFB 2BKDN 1UUEA 2XMFA 2KNBB 4QW2A 1E7OA 4AFQC 3J80E 2KBTA 3G7ZA 3GP8A 2AKKA 4A53A 3VYHB 4IIMA 1U1SA 4XU3A 2KSSA 3FC3A 1BIAA 4QQDA 1Z9QA 1UG1A 3S3NA 1QVGS 2V26A 3EGDB 4OVAA 4J9CA 2H3JA 3CBOA 4C92A 1KG1A 3CCLQ 2H3EB 3ULRB 2NUZA 2P4RA 2J05A 1RAGB 4DEYA 2OX7A 3OS2A 1NJIU 1X6GA 3H41A 2MK5A 4F04B 2DO3A 2NWMA 1I5LA 2PTKA 2M0YA 2F69A 5GAOq 4M75B 3LH5A 2OAWA 4M7DE 1PM3A 2SEMA 2VUBA 3RDVA 3M4GA 2CH4W 1ZBXA 3RESA 5LJ5e 2SRCA 2E64A 4QVCA 3M5AA 5HCKA 4IUTA 1WXTA 5FW9A 3EGUA 2QGFB 2ROTA 2IVWA 1Y96A 2KT8A 3DLLA 1D0YA 2BTTA 3FB9A 4PFPA 2CYZB 2ESWA 2QDLA 3JCMg 3M57A 1VQOQ 3I35A 2DMOA 1EX4A 3EG9B 1SRMA 2HSEB 4N0AC 1YFNA 4IURA 2C0OA 4CC4B 4CC2A 5GAN8 4ZNXA 1JJ2P 4KH0B 2DILA 3O5ZA 2EYXA 2VGNA 2L89A 1M1KU 1GRIA 2WACA 2OTJQ 1OZ2A 1YJWA 4XTUA 3RR6A 2VVKA 1J3TA 1MHNA 3RKYA 2QI2A 1X75C 1NG2A 1TUCA 1AWXA 2YUPA 4FW1A 4LDUA 3I9QA 1QMCA 1M30A 5FWBA 4BE1A 5IT9E 1WIEA 4FCYA 1VQ7Q 2L3SA 2X51A 1UTIA 1NZ9A 4J6XA 1O9SA 2BZYA 4E2FB 2JW4A 3CCQA 2B8AA 5LJ3j 4II1A 1QCFA 1TU0B 2YHTA 3M0QA 2MOXA 2VGMA 3VS5A 4ZN3A 2LT4A 3JRZA 3I56T 1WHHA 5D6YA 3L2WA
chains in the Genus database with same CATH topology
1NYFA 1G2BA 1ZLMA 3U23A 1WX6A 1QKXA 2EYYA 4JZ3A 3EG1A 1VYUA 4RTVA 1B3QA 2GGRA 2J7IA 1T3LA 1UFFA 2LMJA 1HJDA 3NMZC 2F2XA 1K9AA 1M3AA 2DA9A 2KYMA 1E6HA 1OEBA 1SRLA 4LE9A 2LQNA 4GBQA 2PZ1A 4R0KA 1WI7A 2K9GA 1X2KA 3VS6A 1UE9A 1YCSB 4AFSC 2JM8A 1YNZA 5IH2A 2K2MA 1KFZA 3RBBB 2ABLA 2K6DA 1ABOA 1NLOC 2PNIA 3I5RA 2KROA 5GJWB 1WXBA 4A63B 1AWWA 1PKSA 2AK5A 1NM7A 2MCNA 2GTOA 4J9FA 1RUWA 2LX7A 4LNPA 1HD3A 3JV3A 2GQIA 4DEXA 1PRLC 2KR3A 1NLPC 2D8JA 3R6NA 4Z89A 3VS2A 4D8KA 3UA7A 1HSQA 3SEMA 1ARKA 5IHKA 1UJYA 1T3SA 2FG0A 2EBPA 4OMLA 2JS0A 5IXBA 2HSPA 3THKA 4RTTA 1UECA 2LQWA 2YUOA 1NEBA 2EGEA 2FPEA 1GFCA 2FRYA 3M0SA 2EVRA 3ZL7C 4HVUA 2J06A 1SEMA 3M0UA 2LJ0A 2EGCA 1JO8A 1QWFA 3UA6A 1XOVA 1YWOA 2DM1A 3CQTA 2DNUA 2DF6A 4J9EA 2A08A 2EYZA 1KJWA 3PVQA 1BB9A 4RTWA 2AZVA 2ED0A 2KGTA 3VS0A 1ZUKA 2C0TA 4OMNA 2LCSA 1JU5C 3PE0A 3EHRA 5EC7A 4AFZC 1K76A 2HDAA 1AD5A 1SPKA 2E5KA 2LJ3A 2D0NA 4F14A 2BZXA 3SHWA 1GCQC 1I07A 2DL3A 4JJDA 1PWTA 2YDLA 1FMKA 4FSSA 2K3BA 1W70A 1CKBA 4F17A 5L23A 1H3HA 2D8HA 1OPKA 2HCKA 1SHGA 4CC7A 3I5SA 1GBRA 2FEIA 4X1VA 4RTUA 1Z9ZA 3KFVA 2CDTA 1WLPB 2W10A 1UHCA 1AWJA 1T0HA 3VS3A 1H8KA 1X43A 5I22A 3NHNA 2DVJA 3IQLA 2DL8A 4J9DA 2C0IA 4EIKA 2O2OA 1M8MA 1SHFA 2K79A 1FYNA 2B86A 2DRMA 5FWCA 2KT1A 1K0SA 2JT4A 3C0CA 2FO0A 2IIMA 1AEYA 1QKWA 1UHFA 2JMCA 2RN8A 4JJBA 4D8DA 2RQRA 2JS2A 2DBMA 1YN8A 1ZUYA 2J6KA 3NGPA 4AFUC 1VYTA 2GBQA 4J9GA 4CC3A 3EG0A 4LUDA 1GBQA 2O9SA 1Y0MA 2ROLA 1YP5A 3FJ5A 2OI3A 2LNHB 1G83A 4HXJA 1V1CA 3H0IA 3EG2A 1X6BA 2CT3A 2KE9A 2EPDA 1GFDA 1W6XA 1M27C 3M0TA 1ZX6A 2FRWA 1SSHA 5ECAA 4HVWA 2JXBA 2JTEA 1ZSGA 5IXFA 3RNJA 2KRNA 1AWOA 2A37A 2HBWA 2RQTA 2CUBA 2X3WD 1BK2A 4QT7A 4OMQA 3TSZA 1AOJA 1U06A 2W0ZA 2X3XD 2I0NA 2EW3A 2GTJA 3A98A 3M0PA 2RPNA 4JPBW 2EGAA 4LN2A 4Z8AA 3TVTA 1I0CA 2CT4A 1M3CA 2RQWA 2A36A 2RNAA 1BU1A 2L2PA 2DRKA 1U3OA 2CSIA 3GBQA 2H8HA 1E6GA 4KRTA 1QWEA 2V1QA 1JEGA 2LJ1A 1MV0B 2RF0A 4AG1C 4HCKA 4WCIA 1W1FA 2L3QA 4E6RA 2ECZA 1JXMA 1TUDA 1NEGA 3VRZA 1I1JA 1K1ZA 1PNJA 2J6FA 2CUDA 4LUEA 1Y57A 1IO6A 2DL5A 2HEQA 2KYBA 1K4US 4HVVA 2EQIA 4RTZA 3UATA 2DYBA 2ED1A 2DE0X 2AZSA 2YT6A 1RI9A 1UUEA 2XMFA 2KNBB 1E7OA 4AFQC 2LP5A 5IHNA 2KBTA 2RQVA 2DBKA 2AKKA 1JQQA 1K0XA 1ZUUA 2CH4A 4IIMA 2DL4A 1X2QA 1MUZA 1Z9QA 2FPFA 1U5SA 2JMAA 1UG1A 4J9BA 2O88A 1AZGB 2ENMA 3UF4A 4RTYA 4J9CA 3ULRB 2NUZA 3REAB 1N5ZA 1AZEA 2OJ2A 2CREA 1S1NA 4Z88A 2L0AA 1GCPA 2P4RA 2J05A 1AVZC 4DEYA 3QWXX 2DX1A 2F2WA 1X6GA 3H41A 1QLYA 3H0FA 1PHTA 1OPLA 1PRMC 3REBB 2EKHA 2NWMA 2DL7A 2PTKA 2M0YA 1KSWA 3PVLA 2DLPA 3LH5A 4J9HA 2OAWA 1UGVA 2CSQA 2SEMA 2M51A 3EHQA 2CH4W 4OMPA 3TSWA 2SRCA 1UJ0A 1B07A 3VS4A 1WA7A 5HCKA 1NYGA 1WXTA 3VS7A 1GL5A 5FW9A 1WDXA 2YUNA 2JM9A 2RQUA 1H92A 3EGUA 1WXUA 1X27A 2RMOA 2ROTA 2G6FX 1CKAA 2L3PA 1PKTA 2F2VA 2KT8A 4RTXA 5I11A 1A0NB 1ZBJA 2BTTA 2BZ8A 2KXDA 1KIKA 2KXCA 1VA7A 2ESWA 2QDLA 3I35A 1TG0A 1VYVA 2AKLA 2DMOA 1SRMA 2O9VA 4ESRA 4OMOA 1T0JA 4Y92A 3QWYA 2C0OA 4CC4B 1UDLA 2D1XA 2O31A 2GNCA 4CC2A 4ZNXA 2YUQA 2DILA 1WYXA 3O5ZA 2EYXA 4OMMA 4IIOA 1GRIA 2KRSA 4JJCA 2V1RA 1YWPA 2MIOA 2KEAA 2DJQA 1X69A 1CSKA 4AG2C 3VRYA 4GLMA 1EFNA 2VVKA 1J3TA 5GJVB 2J6OA 3EG3A 2VWFA 1NG2A 1TUCA 1AWXA 1JXOA 2YUPA 2EYWA 4J9IA 1GCQA 3I9QA 1M30A 5FWBA 1BBZA 2FPDA 1WIEA 4F16A 2L3SA 2KRMA 1MV3A 3VS1A 1M3BA 1ABQA 1UTIA 3M0RA 4JZ4A 1OOTA 4ORZA 2YSQA 3NPFA 5IHIA 1WFWA 1RLQC 2BZYA 2K7AA 2JW4A 1RLPC 1QCFA 3M0QA 4K11A 2MOXA 4RUGA 3H0HA 3VS5A 4M4ZA 1LCKA 2A28A 1OV3A 2LZ6B 2VKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYF A;  1G2B A;  1ZLM A;  3U23 A;  1WX6 A;  1QKX A;  2EYY A;  4JZ3 A;  3EG1 A;  1VYU A;  4RTV A;  1B3Q A;  2GGR A;  2J7I A;  1T3L A;  1UFF A;  2LMJ A;  1HJD A;  3NMZ C;  2F2X A;  1K9A A;  1M3A A;  2DA9 A;  2KYM A;  1E6H A;  1OEB A;  1SRL A;  4LE9 A;  2LQN A;  4GBQ A;  2PZ1 A;  4R0K A;  1WI7 A;  2K9G A;  1X2K A;  3VS6 A;  1UE9 A;  1YCS B;  4AFS C;  2JM8 A;  1YNZ A;  5IH2 A;  2K2M A;  1KFZ A;  3RBB B;  2ABL A;  2K6D A;  1ABO A;  1NLO C;  2PNI A;  3I5R A;  2KRO A;  5GJW B;  1WXB A;  4A63 B;  1AWW A;  1PKS A;  2AK5 A;  1NM7 A;  2MCN A;  2GTO A;  4J9F A;  1RUW A;  2LX7 A;  4LNP A;  1HD3 A;  3JV3 A;  2GQI A;  4DEX A;  1PRL C;  2KR3 A;  1NLP C;  2D8J A;  3R6N A;  4Z89 A;  3VS2 A;  4D8K A;  3UA7 A;  1HSQ A;  3SEM A;  1ARK A;  5IHK A;  1UJY A;  1T3S A;  2FG0 A;  2EBP A;  4OML A;  2JS0 A;  5IXB A;  2HSP A;  3THK A;  4RTT A;  1UEC A;  2LQW A;  2YUO A;  1NEB A;  2EGE A;  2FPE A;  1GFC A;  2FRY A;  3M0S A;  2EVR A;  3ZL7 C;  4HVU A;  2J06 A;  1SEM A;  3M0U A;  2LJ0 A;  2EGC A;  1JO8 A;  1QWF A;  3UA6 A;  1XOV A;  1YWO A;  2DM1 A;  3CQT A;  2DNU A;  2DF6 A;  4J9E A;  2A08 A;  2EYZ A;  1KJW A;  3PVQ A;  1BB9 A;  4RTW A;  2AZV A;  2ED0 A;  2KGT A;  3VS0 A;  1ZUK A;  2C0T A;  4OMN A;  2LCS A;  1JU5 C;  3PE0 A;  3EHR A;  5EC7 A;  4AFZ C;  1K76 A;  2HDA A;  1AD5 A;  1SPK A;  2E5K A;  2LJ3 A;  2D0N A;  4F14 A;  2BZX A;  3SHW A;  1GCQ C;  1I07 A;  2DL3 A;  4JJD A;  1PWT A;  2YDL A;  1FMK A;  4FSS A;  2K3B A;  1W70 A;  1CKB A;  4F17 A;  5L23 A;  1H3H A;  2D8H A;  1OPK A;  2HCK A;  1SHG A;  4CC7 A;  3I5S A;  1GBR A;  2FEI A;  4X1V A;  4RTU A;  1Z9Z A;  3KFV A;  2CDT A;  1WLP B;  2W10 A;  1UHC A;  1AWJ A;  1T0H A;  3VS3 A;  1H8K A;  1X43 A;  5I22 A;  3NHN A;  2DVJ A;  3IQL A;  2DL8 A;  4J9D A;  2C0I A;  4EIK A;  2O2O A;  1M8M A;  1SHF A;  2K79 A;  1FYN A;  2B86 A;  2DRM A;  5FWC A;  2KT1 A;  1K0S A;  2JT4 A;  3C0C A;  2FO0 A;  2IIM A;  1AEY A;  1QKW A;  1UHF A;  2JMC A;  2RN8 A;  4JJB A;  4D8D A;  2RQR A;  2JS2 A;  2DBM A;  1YN8 A;  1ZUY A;  2J6K A;  3NGP A;  4AFU C;  1VYT A;  2GBQ A;  4J9G A;  4CC3 A;  3EG0 A;  4LUD A;  1GBQ A;  2O9S A;  1Y0M A;  2ROL A;  1YP5 A;  3FJ5 A;  2OI3 A;  2LNH B;  1G83 A;  4HXJ A;  1V1C A;  3H0I A;  3EG2 A;  1X6B A;  2CT3 A;  2KE9 A;  2EPD A;  1GFD A;  1W6X A;  1M27 C;  3M0T A;  1ZX6 A;  2FRW A;  1SSH A;  5ECA A;  4HVW A;  2JXB A;  2JTE A;  1ZSG A;  5IXF A;  3RNJ A;  2KRN A;  1AWO A;  2A37 A;  2HBW A;  2RQT A;  2CUB A;  2X3W D;  1BK2 A;  4QT7 A;  4OMQ A;  3TSZ A;  1AOJ A;  1U06 A;  2W0Z A;  2X3X D;  2I0N A;  2EW3 A;  2GTJ A;  3A98 A;  3M0P A;  2RPN A;  4JPB W;  2EGA A;  4LN2 A;  4Z8A A;  3TVT A;  1I0C A;  2CT4 A;  1M3C A;  2RQW A;  2A36 A;  2RNA A;  1BU1 A;  2L2P A;  2DRK A;  1U3O A;  2CSI A;  3GBQ A;  2H8H A;  1E6G A;  4KRT A;  1QWE A;  2V1Q A;  1JEG A;  2LJ1 A;  1MV0 B;  2RF0 A;  4AG1 C;  4HCK A;  4WCI A;  1W1F A;  2L3Q A;  4E6R A;  2ECZ A;  1JXM A;  1TUD A;  1NEG A;  3VRZ A;  1I1J A;  1K1Z A;  1PNJ A;  2J6F A;  2CUD A;  4LUE A;  1Y57 A;  1IO6 A;  2DL5 A;  2HEQ A;  2KYB A;  1K4U S;  4HVV A;  2EQI A;  4RTZ A;  3UAT A;  2DYB A;  2ED1 A;  2DE0 X;  2AZS A;  2YT6 A;  1RI9 A;  1UUE A;  2XMF A;  2KNB B;  1E7O A;  4AFQ C;  2LP5 A;  5IHN A;  2KBT A;  2RQV A;  2DBK A;  2AKK A;  1JQQ A;  1K0X A;  1ZUU A;  2CH4 A;  4IIM A;  2DL4 A;  1X2Q A;  1MUZ A;  1Z9Q A;  2FPF A;  1U5S A;  2JMA A;  1UG1 A;  4J9B A;  2O88 A;  1AZG B;  2ENM A;  3UF4 A;  4RTY A;  4J9C A;  3ULR B;  2NUZ A;  3REA B;  1N5Z A;  1AZE A;  2OJ2 A;  2CRE A;  1S1N A;  4Z88 A;  2L0A A;  1GCP A;  2P4R A;  2J05 A;  1AVZ C;  4DEY A;  3QWX X;  2DX1 A;  2F2W A;  1X6G A;  3H41 A;  1QLY A;  3H0F A;  1PHT A;  1OPL A;  1PRM C;  3REB B;  2EKH A;  2NWM A;  2DL7 A;  2PTK A;  2M0Y A;  1KSW A;  3PVL A;  2DLP A;  3LH5 A;  4J9H A;  2OAW A;  1UGV A;  2CSQ A;  2SEM A;  2M51 A;  3EHQ A;  2CH4 W;  4OMP A;  3TSW A;  2SRC A;  1UJ0 A;  1B07 A;  3VS4 A;  1WA7 A;  5HCK A;  1NYG A;  1WXT A;  3VS7 A;  1GL5 A;  5FW9 A;  1WDX A;  2YUN A;  2JM9 A;  2RQU A;  1H92 A;  3EGU A;  1WXU A;  1X27 A;  2RMO A;  2ROT A;  2G6F X;  1CKA A;  2L3P A;  1PKT A;  2F2V A;  2KT8 A;  4RTX A;  5I11 A;  1A0N B;  1ZBJ A;  2BTT A;  2BZ8 A;  2KXD A;  1KIK A;  2KXC A;  1VA7 A;  2ESW A;  2QDL A;  3I35 A;  1TG0 A;  1VYV A;  2AKL A;  2DMO A;  1SRM A;  2O9V A;  4ESR A;  4OMO A;  1T0J A;  4Y92 A;  3QWY A;  2C0O A;  4CC4 B;  1UDL A;  2D1X A;  2O31 A;  2GNC A;  4CC2 A;  4ZNX A;  2YUQ A;  2DIL A;  1WYX A;  3O5Z A;  2EYX A;  4OMM A;  4IIO A;  1GRI A;  2KRS A;  4JJC A;  2V1R A;  1YWP A;  2MIO A;  2KEA A;  2DJQ A;  1X69 A;  1CSK A;  4AG2 C;  3VRY A;  4GLM A;  1EFN A;  2VVK A;  1J3T A;  5GJV B;  2J6O A;  3EG3 A;  2VWF A;  1NG2 A;  1TUC A;  1AWX A;  1JXO A;  2YUP A;  2EYW A;  4J9I A;  1GCQ A;  3I9Q A;  1M30 A;  5FWB A;  1BBZ A;  2FPD A;  1WIE A;  4F16 A;  2L3S A;  2KRM A;  1MV3 A;  3VS1 A;  1M3B A;  1ABQ A;  1UTI A;  3M0R A;  4JZ4 A;  1OOT A;  4ORZ A;  2YSQ A;  3NPF A;  5IHI A;  1WFW A;  1RLQ C;  2BZY A;  2K7A A;  2JW4 A;  1RLP C;  1QCF A;  3M0Q A;  4K11 A;  2MOX A;  4RUG A;  3H0H A;  3VS5 A;  4M4Z A;  1LCK A;  2A28 A;  1OV3 A;  2LZ6 B;  2VKN A; 
#chains in the Genus database with same CATH topology
 3OYJ A;  1NYF A;  4A4H A;  2EKO A;  3VUB A;  8ATC B;  1N8R U;  1RAE B;  3U23 A;  3CCL A;  1SKU B;  1N9S A;  3OYM A;  4M75 A;  1VQ9 A;  4M7D D;  4EMH A;  3HFN A;  3M55 A;  1VQP Q;  3EFR A;  2YLB A;  3JCM e;  4Y28 E;  2LMJ A;  4C8Q D;  3A8M B;  4EMK B;  2E41 A;  3MKD A;  5KYX B;  4M7D F;  2LQN A;  2JTM A;  1WI7 A;  1MND A;  1IRX A;  4JLG A;  4C5H A;  1YCS B;  2P0Q A;  4C8Q F;  2RI5 A;  1AT1 B;  2RHI A;  2ABL A;  3PNW C;  3CCJ T;  1NLO C;  2EAY A;  3OS0 A;  3G71 Q;  4A4E A;  4FL6 A;  2KRO A;  4MML A;  2CP5 A;  1K9M U;  2MCN A;  5FU7 C;  1S72 Q;  2LQK A;  3I55 Q;  3CC2 Q;  3G4S Q;  1KQ2 A;  1R0C B;  2GQI A;  2YXY A;  1PRL C;  5CKD A;  2D8J A;  1KC8 R;  4L59 A;  3VS2 A;  4D8K A;  3UA7 A;  4TVR A;  1YJ9 Q;  4LD6 A;  5IHK A;  4C8Q B;  4M7D G;  3V8L A;  1TSF A;  3OW2 P;  4FYW B;  3EFS A;  4RTT A;  5GMK m;  3MO8 A;  2AIR B;  4E47 A;  2COW A;  1FX7 A;  5J39 A;  4PNO A;  1K73 C;  2OTJ A;  1B34 B;  2EVR A;  3ZL7 C;  4FYV B;  2LCC A;  1VQL Q;  2M1H A;  5GAN f;  3OYI A;  1VQ4 T;  1WGS A;  5CCA A;  2DNU A;  3CC7 Q;  1KJW A;  1BB9 A;  5GAN 7;  4E7H A;  4FYY B;  3VS0 A;  1UEB A;  4KH1 B;  2RI2 A;  2A3L A;  2EQJ A;  1M90 C;  3LLR A;  2HDA A;  1AD5 A;  2E5K A;  2LJ3 A;  1KD1 C;  4F14 A;  2F5K A;  1I07 A;  4E7L A;  3V7C A;  1VQ6 T;  3X24 B;  1SSF A;  2K3B A;  1KQS A;  2PVD B;  5HK0 A;  3C95 A;  5L23 A;  2JN0 A;  3QHS A;  3CD6 T;  2FEI A;  4X1V A;  1UGQ B;  1Z9Z A;  1WLP B;  5GAM f;  4EMK A;  4C92 E;  2DPP B;  2E6N A;  4ATO A;  2LQ8 A;  5KYX A;  1M1G A;  1W4S A;  2RA2 A;  3VS3 A;  3UWN A;  3E19 A;  1QVG A;  1X43 A;  2Y90 A;  8AT1 B;  1M8M A;  3LW5 E;  4XTZ A;  5LJ3 d;  3BW1 A;  3GNG A;  3C0C A;  1QKW A;  2JMC A;  2XK0 A;  2M02 A;  4KT0 E;  3EFO B;  2R58 A;  2FB7 A;  1VQ5 Q;  1M1F A;  4OP0 A;  5IN1 A;  4CC3 A;  2LDM A;  1KD1 R;  4LUD A;  2O9S A;  1FMW A;  3RMQ A;  2R5A A;  2YWW A;  3LH0 A;  2LNH B;  3H0I A;  1X6B A;  2C06 A;  5FU6 B;  4GLK A;  4C0D C;  3L2Z A;  1WPY A;  4JUV A;  1MGQ A;  1SSH A;  5ECA A;  1YIJ Q;  4C8Q A;  1S72 A;  3I55 A;  1VQK T;  3CC2 A;  4M7D C;  1AWO A;  3JB9 G;  1V76 A;  2DD4 A;  3M53 A;  2KY9 A;  2QQ9 A;  3TQ7 P;  2X3W D;  1BK2 A;  3TSZ A;  4C8Q C;  1YJ9 A;  2EW3 A;  2GTJ A;  1VQ8 Q;  4KGX B;  2ZAE A;  3VU3 C;  5FRN A;  2NYS A;  3A98 A;  2EGA A;  4IUP A;  2HL3 A;  4CRI A;  1VQL A;  1BKB A;  1BU1 A;  3GBQ A;  3V8K A;  2H8H A;  1BI0 A;  2E6Z A;  5GMK l;  2V1Q A;  1MMD A;  1D09 B;  3CC4 Q;  5GAO r;  2RF0 A;  4AG1 C;  4HCK A;  4WCI A;  3SWN B;  1W1F A;  4E6R A;  3OYG A;  2DZC A;  2GFU A;  1NEG A;  1YI2 Q;  5LL6 S;  3VRZ A;  3OW2 S;  3ME9 A;  1XJW B;  1K1Z A;  2F1L A;  1PNJ A;  4C92 D;  4LUE A;  1Q86 C;  4ZN1 A;  1NJI R;  3BDL A;  2KYB A;  1K4U S;  1HYO A;  2EQI A;  4PLI A;  1RAB B;  3UAT A;  2DYB A;  3FLG A;  3FIF A;  4PFZ A;  2E3H A;  3GNF B;  3OA6 A;  2QA4 Q;  4J7F A;  4C92 F;  5AYF A;  3GLX A;  5C0M A;  5GMK h;  3ZBD A;  2E65 A;  5D7U A;  4M75 E;  2E3I A;  2DBK A;  1JQQ A;  1AHJ B;  1K0X A;  2KDS A;  3EFO A;  1YHQ Q;  1X2Q A;  2FPF A;  2JMA A;  1VQM Q;  4J9B A;  5GMK e;  1Y71 A;  3OYB A;  2YLC A;  3OBY A;  5D6W A;  1PSE A;  2RB6 A;  3PIP A;  2EJG A;  3REA B;  1N5Z A;  1IB8 A;  3CXC P;  2OJ2 A;  3CCE Q;  2CRE A;  3INZ A;  2AHJ B;  2L0A A;  2BE7 D;  4B9W A;  1D1C A;  2DX1 A;  2F2W A;  3L1A A;  1PRM C;  4HCC A;  2EKH A;  2DL7 A;  2HD0 A;  3PVL A;  5CQY A;  5A0D A;  4ZTJ A;  1MMA A;  1WZO A;  2M51 A;  1M1K R;  2OTL T;  3EHQ A;  3CCR T;  2FZG B;  3S3O A;  3X28 B;  4C92 G;  3QJY A;  4RMO A;  1BI2 A;  2DXT A;  1OX8 A;  3TSW A;  3E1S A;  1UJ0 A;  1ZQ1 A;  2DIQ A;  2RO0 A;  1B07 A;  3ZEH A;  1Q81 C;  1GL5 A;  3CCS Q;  1Q7Y C;  1K73 U;  1Q82 C;  3VJP A;  2Z0W A;  2JM9 A;  4YTL A;  2I2L A;  1B7T A;  5GAN 4;  5CAI A;  2L3P A;  4DQ2 A;  2F2V A;  3CMA T;  2LX9 A;  5KH6 A;  1NPP A;  2EWN A;  4VUB A;  4DA4 A;  3G6E Q;  1IHV A;  2M16 A;  1KIK A;  3SWN A;  1VA7 A;  2P84 A;  2RI3 A;  2VAS A;  1M90 U;  3JCM d;  2AKL A;  2DAQ A;  2O9V A;  2IG0 A;  4M7A D;  4OMO A;  2O31 A;  2Y4Y A;  4L6V 5;  4JRQ A;  3CC4 A;  1WYX A;  5FRO A;  2DIG A;  1N8R R;  2K5I A;  4JJC A;  1FWZ A;  2EFI A;  1YWP A;  2HBP A;  4UC4 A;  2MIO A;  1X69 A;  3X20 B;  4BY6 B;  4M7A F;  1YI2 A;  2KQW A;  3P8D A;  4OGC A;  1R77 A;  1EFN A;  1RAD B;  1IGQ A;  2HZY A;  5GAN g;  4J9I A;  4PLL A;  3CCM T;  1GCQ A;  3OYK A;  3L2R A;  2NUT B;  2FPD A;  3HRU A;  4J5Y A;  4N4H A;  3RKW A;  2CP6 A;  2KRM A;  3JCM X;  4N4G A;  2DER A;  1VQ4 A;  2QA4 A;  2X35 A;  1OOT A;  1QCO A;  1OZ3 A;  3E2U A;  3OMC A;  1K8A C;  1N27 A;  3CCQ Q;  1RLQ C;  2K7A A;  4M75 F;  3M54 A;  1W2B P;  1RLP C;  3MHX A;  2MAM A;  1YHQ A;  1BIB A;  3LGF A;  4M7A B;  3CME T;  1VQM A;  3CPW A;  1G2B A;  4B9X A;  4HCB A;  3CCU T;  1ZLM A;  1WNL A;  4OF1 A;  2RM4 A;  1WX6 A;  4E7J A;  1K9M R;  1QKX A;  1O75 A;  1VQ9 Q;  1VQ6 A;  4J7I A;  2EJF A;  4JZ3 A;  3EG1 A;  2RHX A;  3CCE A;  4BE2 A;  4R56 A;  4EDU A;  3HPW A;  2GGR A;  1T3L A;  1BI1 A;  1OU9 A;  4QQ6 A;  3NMZ C;  3OYN A;  4C92 C;  5LJ5 h;  7AT1 B;  1QW1 A;  2E5Q A;  1YJN Q;  1OEB A;  4HA8 A;  1WHK A;  2R5M A;  2PZ1 A;  1QVF S;  4HCZ A;  4AT1 B;  1KK7 A;  2JM8 A;  1YNZ A;  4M75 G;  5GMK j;  1RAF B;  4C8Q E;  2GF7 A;  2K6D A;  1MMG A;  3QXE B;  3X26 B;  2CKK A;  2XKO C;  3CCS A;  5A0L A;  3NTI A;  2JOY A;  5GAN e;  2OAU A;  3I5R A;  1G3S A;  2V8J A;  4X9D A;  1EZZ B;  1NM7 A;  2GTO A;  2E10 A;  4J9F A;  5FLX E;  4ZGD B;  3G6E A;  3WXM B;  2V8K A;  4FW2 A;  4JDS A;  1QP2 A;  4Z89 A;  2CP0 A;  4PJO B;  1TS9 A;  2RHZ A;  1ARK A;  3QII A;  1Q86 U;  3CEY A;  2XID A;  4OML A;  1D0Z A;  2VYT A;  3THK A;  1MMN A;  1VQK A;  4LDX A;  4KUD K;  4M77 B;  2YUO A;  1U8R A;  2EQM A;  1BI3 A;  4HVU A;  4HT8 A;  4OGE A;  4A4F A;  1JO8 A;  3CBM A;  1U1T A;  4ZTF A;  2DF6 A;  4CI0 C;  2A08 A;  1WHL A;  1YCY A;  1TWB A;  3PVQ A;  2EIF A;  2AZV A;  4OB1 B;  1ACM B;  2NUP B;  2QQB A;  3JCM V;  1JU5 C;  3J7A F;  3PE0 A;  3EHR A;  3P8B B;  3G1J A;  2R57 A;  4PJL A;  1VIE A;  4BD3 A;  4RCB A;  4M7A A;  2D0N A;  3H6Z A;  4R55 A;  2DXU A;  3EGD A;  2DL3 A;  2YDL A;  1FMK A;  2LVM A;  3VKI A;  3PGG A;  1Q95 G;  1OPK A;  2MWP A;  1G3W A;  2JZ2 A;  1I4K 1;  3QJ6 A;  4C0F A;  1GBR A;  3LWH A;  3KFV A;  2CDT A;  3QYG B;  3JCM h;  2QTX A;  2MI6 A;  2XHC A;  2GCX A;  3MCA B;  1M2V B;  1GXI E;  4O6J A;  2P0K A;  1JRI A;  2CZ1 B;  4PJJ A;  5LJ3 f;  2DL8 A;  4J9D A;  1BYM A;  3NTH A;  4BB7 A;  2E12 A;  1ZA1 B;  2WSC E;  1VQ5 T;  2K79 A;  2B86 A;  1QVP A;  1Q81 U;  1Q7Y U;  3OMG A;  1Q82 U;  1YJN A;  2JT4 A;  4C5G A;  4JJN K;  2FO0 A;  4M75 C;  1AEY A;  1UHF A;  2DEU A;  4D8D A;  2HMA A;  2DBM A;  1OYX A;  3L2V A;  3X25 B;  5CVI A;  4AFU C;  2NLU A;  3NGP A;  1VYT A;  5I2M A;  2HNI A;  2QQR A;  3MJX A;  3BDU A;  2QEX T;  2P4T A;  4NL3 A;  1VQN T;  3AHU A;  4J6W A;  1Y0M A;  3L2U A;  2RJD A;  3HP9 A;  5I2S A;  5KYW B;  1WJS A;  2OI3 A;  1G83 A;  1V1C A;  2QK0 A;  4KGV B;  4EPC A;  3EG9 A;  3EG2 A;  2CT3 A;  2KE9 A;  4LDV A;  4PJO A;  3L2Q A;  1W6X A;  2BE9 B;  1YBY A;  2FRW A;  5GAO n;  4BI4 A;  4LDY A;  2DJZ A;  3M9Q A;  4M77 A;  3RNJ A;  2RJE A;  4XU0 A;  4JRK A;  3CCR A;  3BE3 A;  5HKC A;  2RQT A;  1V29 B;  3OYD A;  4QT7 A;  4OMQ A;  5LJ5 j;  2PVO B;  3URG A;  1AOJ A;  4Q5W A;  4WF2 A;  2W0Z A;  1DJ7 B;  2I0N A;  3MEA A;  4KUI A;  2K2V A;  1LPL A;  1G8X A;  2NUP A;  2RPN A;  4ZGJ B;  5GAN j;  4C8Q G;  2RJC A;  1N9R A;  2A36 A;  4JRP A;  2PVG B;  4XTW A;  1K8A U;  1PG5 B;  5GAO p;  3CMA A;  2RK1 A;  2KK4 A;  4OB3 B;  3EH1 A;  4BE0 A;  1OUL A;  2E1H A;  3SD4 A;  1YIT T;  1JJ2 S;  3FDR A;  3UPU A;  2KVQ G;  2L8D A;  1M2V A;  1OI1 A;  3CPF A;  3C12 A;  2XDD A;  4HVV A;  4E7Z A;  9ATC B;  1TOV A;  1ZSZ B;  2YT6 A;  2M9U A;  2KAF A;  5CR2 A;  4MDW A;  2RD1 A;  1BCM A;  2LP5 A;  2VXE A;  5KYU B;  5IHN A;  2RQV A;  5J3B A;  1QQJ A;  4NS5 A;  3M58 A;  4GY5 A;  5J26 A;  1K73 R;  4MZT A;  1Y07 A;  3C94 A;  1MUZ A;  5CKH A;  3HFO A;  4EMK C;  2O88 A;  1AZG B;  2ENM A;  4RTY A;  4QQG A;  5KYW A;  3JCM J;  4OB2 B;  1AZE A;  4MZP A;  3I56 Q;  3M56 A;  1M90 R;  3OSV A;  3CCV T;  4RG2 A;  3CCU A;  3H0F A;  1PHT A;  1OPL A;  2QGG A;  1QVF A;  3REB B;  2JVV A;  4MMK A;  4XTX A;  2DLP A;  2LTO A;  4F7U B;  2XG8 D;  3ER0 A;  1XTD A;  4OMP A;  3OYL A;  4FT4 A;  1XQH A;  1WA7 A;  3VS7 A;  1SG5 A;  2YUN A;  1H92 A;  1WXU A;  1ZHI A;  1B34 A;  2G6F X;  2QXF A;  1CKA A;  4C0Z A;  2HAX A;  1PKT A;  4RTX A;  5I11 A;  3A5Z B;  1ZBJ A;  2BZ8 A;  2KXD A;  3CCJ Q;  2RHY A;  4NL2 A;  5CQX A;  1C6V X;  3H9N A;  1YJW T;  1SF9 A;  4Y92 A;  1UDL A;  2D1X A;  3WVE B;  1G3Y A;  2YUQ A;  4N4I A;  4BI3 A;  4IIO A;  2CP7 A;  2KRS A;  3A8L B;  4ANJ A;  4DBF A;  5LJ5 d;  1WJR A;  2DJQ A;  3OBW A;  4DOW A;  1ZSZ A;  2LRQ A;  4AG2 C;  2MF2 A;  3VRY A;  4M7A E;  6AT1 B;  1G3T A;  4JS5 A;  3KUF A;  2J6O A;  2BIV A;  3OS1 A;  2F5T X;  2VWF A;  5KYU A;  1KQS P;  5GAN d;  2EYW A;  2LC4 A;  1MV3 A;  1VQ4 Q;  3VS1 A;  3V8J A;  1ABQ A;  3EGX B;  1LOJ A;  3M0R A;  3L42 A;  4JZ4 A;  4ORZ A;  3JSC A;  4Y91 A;  2VV5 A;  5DY9 A;  4A4G A;  3CCL T;  1QVG P;  2FZC B;  3E9G A;  3H0H A;  1JBM A;  4FU6 A;  2EJ9 A;  2A28 A;  5CKE A;  2GQV A;  2VKN A;  3FEO A;  3MEU A;  4PJM A;  4XTV A;  2L3R A;  1VQ6 Q;  2X4X A;  3GIB A;  2XD0 A;  4F7U A;  1VYU A;  2MPX C;  1TXQ A;  4RTV A;  3I56 A;  1B3Q A;  5GAN 2;  3CD6 Q;  2HQX A;  1UFF A;  5LJ3 g;  1K9A A;  5IAY A;  3HRT A;  1Q86 R;  2KYM A;  4LE9 A;  3OYC A;  2KMT A;  3HHT B;  4R0K A;  5FU6 C;  2CZ0 B;  4PJO E;  4IUU A;  1UE9 A;  2K2M A;  1KFZ A;  3QYH B;  1Y7X A;  1D1A A;  1PC0 A;  4M78 D;  4M77 E;  2QDY B;  1IXD A;  1KHI A;  1M8V A;  1H64 1;  1VQO T;  2MYS A;  2QQA A;  1AWW A;  1PKS A;  1I81 A;  2AK5 A;  2CP3 A;  2CS7 A;  3DKM A;  3KXT A;  2E4H A;  4M78 F;  1X01 A;  1HD3 A;  3JV3 A;  3CCJ A;  4DEX A;  3R6N A;  2OTJ T;  1M2O A;  3RUX A;  1G5V A;  3AT1 B;  3F70 A;  1HSQ A;  4XQ3 A;  1UJY A;  1T3S A;  2FG0 A;  2EBP A;  5IXB A;  2FZK B;  1VQK Q;  2HSP A;  3J81 E;  2BUD A;  3SWN C;  2WSF E;  1I8F A;  4D6W A;  1NEB A;  2EGE A;  2FPE A;  1GFC A;  3HKS A;  2FRY A;  4X9C A;  1VQ7 T;  2JNG A;  3V7R A;  1SEM A;  2LJ0 A;  2EGC A;  3EGX A;  1QWF A;  1YWO A;  2DM1 A;  3LWI A;  1RAA B;  1JJ2 A;  1LJO A;  4RTW A;  1Q81 R;  2KGT A;  2ED0 A;  4M78 B;  5LJ3 e;  3JB9 J;  1Q7Y R;  1Q82 R;  1ZUK A;  2YRV A;  5KYY B;  4BI8 B;  2DXC A;  4PL6 A;  3A1P A;  5EC7 A;  4QVZ A;  2BZX A;  1QCN A;  3SHW A;  1GCQ C;  4IUQ A;  1D3B B;  4FSS A;  5HY6 A;  5A0G A;  1UGS B;  4PKC C;  4F17 A;  1OU8 A;  2PU9 B;  2HCK A;  1VQP T;  5DLO A;  1NPR A;  1UHC A;  4XTY A;  3M59 A;  1AWJ A;  4FT2 A;  3R6O A;  4KUL A;  5GAM g;  1IHW A;  1RI0 A;  4M7A G;  2X4Y A;  4PJO D;  5I22 A;  2DVJ A;  2C0I A;  3GOX A;  3CD6 A;  4MDX A;  1FYN A;  2DRM A;  3OSS C;  5FWC A;  2KT1 A;  1HK9 A;  4M77 D;  2IIM A;  2G3R A;  2RN8 A;  1D1B A;  2RQR A;  2JS2 A;  4PJO F;  1YN8 A;  2JTF A;  3G71 T;  1ZUY A;  5GAN h;  4C0G A;  1C0M A;  1LVK A;  3EG0 A;  3QZ9 B;  3CXC S;  2QAZ A;  3S6W A;  1K8A R;  1ZA2 B;  4M77 F;  1S72 T;  3I55 T;  2ROL A;  2ZGW A;  3CC2 T;  1YP5 A;  1RAC B;  3FJ5 A;  3G4S T;  4HXJ A;  2HKQ B;  1VOM A;  2EPD A;  3DLM A;  3CCV A;  1YJ9 T;  4HVW A;  4EMG A;  3OYY A;  2JTE A;  3QKJ A;  3RMS A;  4RCC A;  5IXF A;  4JLI A;  4B6M A;  2CZ7 B;  2OTL Q;  2A37 A;  3CCR Q;  3JB9 H;  3RIR A;  5KYN A;  2MWO A;  1VQL T;  2QYZ A;  1WHJ A;  1R0B G;  4N0A A;  4E7I A;  3QDF A;  5GAM h;  3H8Z A;  1U06 A;  2HQH A;  2X3X D;  1IRE B;  3JAM E;  3LGL A;  3CC7 T;  5FU7 B;  1X6O A;  4PJO G;  2DTH A;  4M78 A;  3NFC A;  5KYY A;  2NUT A;  4PK4 A;  1M3C A;  4BY6 C;  1TH7 A;  3OYH A;  2JUF A;  4JRI A;  5GAM e;  2L2P A;  3SDZ A;  2DRK A;  1U3O A;  2AT1 B;  4L5G A;  2CSI A;  2ZPE B;  4M77 G;  3JCM Q;  1E6G A;  4KRT A;  3CMA Q;  1QWE A;  5GAO l;  2ATC B;  3BY7 A;  5HK3 A;  1MV0 B;  4M78 C;  1D3B A;  4DBR A;  3OW2 A;  2L3Q A;  5GMK i;  3V7S A;  3RKX A;  4BUG A;  5M9O A;  3JCM b;  1P92 A;  2DD5 A;  2DKG A;  2KI7 A;  5CK9 A;  2CUD A;  4QKU A;  5DM7 R;  4O5V A;  2DL5 A;  2DZ9 A;  2HEQ A;  5L8R E;  1FMV A;  4RG8 A;  3D7S B;  4RTZ A;  5KE3 A;  2DXB A;  2ED1 A;  2DK3 A;  3CPW P;  4M7A C;  2K5F A;  3TCJ A;  2ZPH B;  4ZGE B;  5AT1 B;  1H3Z A;  3JCM W;  1OQK A;  3CCM Q;  2LCL A;  4F7U E;  4PFO A;  1R8O B;  1ZUU A;  2CH4 A;  2RHU A;  2DL4 A;  2A7Y A;  1U5S A;  3WVD B;  1W2B S;  3UF4 A;  4BAC A;  3A8O B;  5FRM A;  1KC8 C;  4P5N A;  1S1N A;  2FHD A;  4Z88 A;  1GCP A;  2RH2 A;  1AVZ C;  2EQU A;  3QWX X;  3CME Q;  2Y4X A;  3CCU Q;  4KBM B;  3HL8 A;  1QLY A;  3OS5 A;  3A8H B;  1YIJ T;  3HRS A;  4OMF B;  1KSW A;  1KHC A;  4J9H A;  4XU2 A;  1BCO A;  1UGV A;  2CSQ A;  3QPH A;  2LT1 A;  5A2Q E;  2COY A;  4IUV A;  2X4J A;  3O8V A;  3VS4 A;  1VQ8 T;  1NYG A;  2DYI A;  1WDX A;  3SB2 A;  3NTK A;  2RQU A;  1X27 A;  2RMO A;  4PJO C;  2OTL A;  1TTH B;  1IGU A;  4BDY A;  4C0D B;  2FVU A;  4LDW A;  4M77 C;  3CC4 T;  1A0N B;  2XDP A;  2KXC A;  4M7D B;  2PQW A;  3OYE A;  4FIB A;  1TG0 A;  1VQO A;  1VYV A;  4HT9 A;  4J8O A;  2HL5 C;  1WHG A;  5GAN 6;  4ESR A;  4WTO B;  1T0J A;  1YI2 T;  3QWY A;  3MEW A;  3Q1J A;  3ASK A;  4FYX B;  2GNC A;  4BDZ A;  5GAN 3;  5DLQ E;  5KCO A;  5LJ5 f;  3OQ5 A;  4OMM A;  3MP1 A;  1QP3 A;  5EG2 A;  2V1R A;  1FXX A;  2KEA A;  2O4X B;  1CSK A;  3VYG A;  4GLM A;  2QA4 T;  3ZFJ A;  3T9N A;  5GJV B;  3PIO A;  4MZM A;  3EG3 A;  1JXO A;  2CGH A;  1BBZ A;  1KQ1 A;  4F16 A;  3N5B B;  1YHQ T;  3PFS A;  4OB0 B;  1VQ7 A;  5GAM j;  1M3B A;  1VQM T;  2YSQ A;  3NPF A;  5IHI A;  1WFW A;  2HQE A;  3CCM A;  4F7U F;  4C5I A;  5CKF A;  1TUG B;  1UGP B;  4K11 A;  3CCE T;  3DB3 A;  4FM4 B;  4RUG A;  3QG1 A;  4M4Z A;  1LCK A;  1OV3 A;  2LZ6 B;  2ZPG B;  4X34 A;  3JB9 D;  2DTO A;  1WQW A;  2LNV A;  1N6A A;  4C5E A;  4RKU E;  2EYY A;  3CPW S;  3QZ5 B;  4ELY C;  4Z02 A;  1WQ7 A;  1F1B B;  2QTV A;  1VQP A;  2J7I A;  3JB9 F;  1PSF A;  3FRN A;  3CME A;  2DET A;  1HJD A;  2VC8 A;  3MP8 A;  3PT9 A;  3HSB A;  2F2X A;  2PUK B;  1M3A A;  1RL2 A;  3LYI A;  2DA9 A;  1E6H A;  1SRL A;  3CCS T;  2XI9 A;  3GPL A;  4GBQ A;  1IZ6 A;  2K9G A;  1X2K A;  2X9H A;  2DVE A;  3CXC A;  3VS6 A;  3FJP A;  4AFS C;  3QO3 A;  5IH2 A;  1PD0 A;  2M0O A;  3RBB B;  1M4Z A;  2D9T A;  4LXC A;  4F7U G;  1NBE B;  2RJF A;  4DOV A;  4LD9 K;  3G6E T;  1ABO A;  2EYQ A;  1D0X A;  2PNI A;  4M7D A;  3BFM A;  3G71 A;  5GJW B;  1WXB A;  2ZCF B;  4A63 B;  2QEX Q;  1PCX A;  2K57 A;  2FYK A;  3OB9 A;  1VQN Q;  2RK2 A;  1OX9 A;  3JCM f;  1NJI C;  1RUW A;  2LX7 A;  4LNP A;  4M78 E;  3G4S A;  2KR3 A;  1NLP C;  3MPU B;  1WHM A;  2O4X A;  3TU4 K;  1UB4 A;  3JCM P;  3SEM A;  5I21 A;  4J6Y A;  2JS0 A;  2GFA A;  1UEC A;  2K3X A;  2LQW A;  3M0S A;  4J83 A;  4JS4 A;  1VUB A;  2J06 A;  2P0P A;  3M0U A;  3UA6 A;  2A0F B;  1XOV A;  3CQT A;  4PJN A;  4XAX B;  4J9E A;  2MMP A;  2EYZ A;  3CC7 A;  3A8G B;  3CCQ T;  2COZ A;  4QVD A;  5KE2 A;  2HKN A;  2C0T A;  4HKE A;  4OMN A;  2LCS A;  2DTI A;  5CKB A;  1ZSZ C;  2VB6 A;  4A54 A;  4AFZ C;  1K76 A;  1PD1 A;  1SPK A;  1RAI B;  3QSU A;  4NOY A;  4XU1 A;  3JB9 I;  2XDB A;  4JJD A;  3MEV A;  1PWT A;  1MNE A;  1KC8 U;  1VQ9 T;  1W70 A;  2D0Q B;  1M1K C;  1CKB A;  1YIT Q;  2L5Q A;  2XU8 A;  3EAE A;  1H3H A;  2D8H A;  3M4Y A;  2YRD A;  2D6F A;  1SHG A;  4CC7 A;  3I5S A;  4RTU A;  3PMI A;  2FL7 A;  2W10 A;  1VIF A;  3P8H A;  1YJN T;  2QG9 B;  3QBY A;  1T0H A;  1LNX A;  2JJ9 A;  5GAM d;  4KGZ B;  1XNI A;  1W2B A;  1H8K A;  2CZ6 B;  3IQL A;  3NHN A;  4ELZ C;  2V8I A;  1JB0 E;  4EIK A;  2DEQ A;  4XK8 E;  2O2O A;  4E7K A;  1SHF A;  4V2S A;  1QVF P;  4ME7 A;  3SFM A;  1K0S A;  2CP2 A;  2O01 E;  2X4W A;  3E9F A;  2XIC A;  3S3M A;  4JJB A;  3MP6 A;  2ZZD A;  3UDC A;  2E70 A;  2J6K A;  5KCH A;  2GBQ A;  3C4S A;  1VQ5 A;  4J9G A;  3RER A;  3GF5 A;  2ZPI B;  1GBQ A;  4C92 B;  2WSE E;  1N8R C;  1UGR B;  2ZPB B;  2EQK A;  4IKF A;  2PUO B;  3PMT A;  4E7S A;  2IPO B;  3TEE A;  3OYF A;  3JCM c;  1GFD A;  1M27 C;  3CCV Q;  4A4K A;  3M0T A;  1ZX6 A;  2QEX A;  1C1A A;  3UT1 A;  3KBG A;  2JXB A;  1YIJ A;  1VQN A;  2QAS A;  2K5L A;  1ZSG A;  5C6S A;  2K3Y A;  2KRN A;  2HBW A;  3OY9 A;  5CO7 A;  4DBH A;  1M9S A;  1NE8 A;  2CUB A;  1RAH B;  2QQS A;  1VQ8 A;  3VUZ A;  3QUI A;  5CIU A;  3CBP A;  3OYA A;  5GAO m;  3M0P A;  4JPB W;  4Z8A A;  3TVT A;  4LN2 A;  1I5O B;  1I0C A;  2CT4 A;  5LJ3 h;  4AMC A;  2RQW A;  3MET A;  3TRE A;  2RNA A;  1KD1 U;  2K4Y A;  1Y96 B;  1JEG A;  1K9M C;  2LJ1 A;  5LJ5 g;  2ECZ A;  1JXM A;  1TUD A;  1YJW Q;  2VXF A;  1I1J A;  4M78 G;  1EIF A;  2DFU A;  5D6X A;  2J6F A;  1Y57 A;  1IO6 A;  4M75 D;  1M5Q 1;  4DBQ A;  1HXD A;  3QDR B;  1YIT A;  3EH2 A;  3HTR A;  4FSX A;  3PTA A;  2YRC A;  3LX7 A;  2DE0 X;  3VV0 A;  3DB4 A;  2AZS A;  1KQS S;  1WJQ A;  5GAN 5;  1RI9 A;  2ZPF B;  2BKD N;  1UUE A;  2XMF A;  2KNB B;  4QW2 A;  1E7O A;  4AFQ C;  3J80 E;  2KBT A;  3G7Z A;  3GP8 A;  2AKK A;  4A53 A;  3VYH B;  4IIM A;  1U1S A;  4XU3 A;  2KSS A;  3FC3 A;  1BIA A;  4QQD A;  1Z9Q A;  1UG1 A;  3S3N A;  1QVG S;  2V26 A;  3EGD B;  4OVA A;  4J9C A;  2H3J A;  3CBO A;  4C92 A;  1KG1 A;  3CCL Q;  2H3E B;  3ULR B;  2NUZ A;  2P4R A;  2J05 A;  1RAG B;  4DEY A;  2OX7 A;  3OS2 A;  1NJI U;  1X6G A;  3H41 A;  2MK5 A;  4F04 B;  2DO3 A;  2NWM A;  1I5L A;  2PTK A;  2M0Y A;  2F69 A;  5GAO q;  4M75 B;  3LH5 A;  2OAW A;  4M7D E;  1PM3 A;  2SEM A;  2VUB A;  3RDV A;  3M4G A;  2CH4 W;  1ZBX A;  3RES A;  5LJ5 e;  2SRC A;  2E64 A;  4QVC A;  3M5A A;  5HCK A;  4IUT A;  1WXT A;  5FW9 A;  3EGU A;  2QGF B;  2ROT A;  2IVW A;  1Y96 A;  2KT8 A;  3DLL A;  1D0Y A;  2BTT A;  3FB9 A;  4PFP A;  2CYZ B;  2ESW A;  2QDL A;  3JCM g;  3M57 A;  1VQO Q;  3I35 A;  2DMO A;  1EX4 A;  3EG9 B;  1SRM A;  2HSE B;  4N0A C;  1YFN A;  4IUR A;  2C0O A;  4CC4 B;  4CC2 A;  5GAN 8;  4ZNX A;  1JJ2 P;  4KH0 B;  2DIL A;  3O5Z A;  2EYX A;  2VGN A;  2L89 A;  1M1K U;  1GRI A;  2WAC A;  2OTJ Q;  1OZ2 A;  1YJW A;  4XTU A;  3RR6 A;  2VVK A;  1J3T A;  1MHN A;  3RKY A;  2QI2 A;  1X75 C;  1NG2 A;  1TUC A;  1AWX A;  2YUP A;  4FW1 A;  4LDU A;  3I9Q A;  1QMC A;  1M30 A;  5FWB A;  4BE1 A;  5IT9 E;  1WIE A;  4FCY A;  1VQ7 Q;  2L3S A;  2X51 A;  1UTI A;  1NZ9 A;  4J6X A;  1O9S A;  2BZY A;  4E2F B;  2JW4 A;  3CCQ A;  2B8A A;  5LJ3 j;  4II1 A;  1QCF A;  1TU0 B;  2YHT A;  3M0Q A;  2MOX A;  2VGM A;  3VS5 A;  4ZN3 A;  2LT4 A;  3JRZ A;  3I56 T;  1WHH A;  5D6Y A;  3L2W A; 
#chains in the Genus database with same CATH homology
 1NYF A;  1G2B A;  1ZLM A;  3U23 A;  1WX6 A;  1QKX A;  2EYY A;  4JZ3 A;  3EG1 A;  1VYU A;  4RTV A;  1B3Q A;  2GGR A;  2J7I A;  1T3L A;  1UFF A;  2LMJ A;  1HJD A;  3NMZ C;  2F2X A;  1K9A A;  1M3A A;  2DA9 A;  2KYM A;  1E6H A;  1OEB A;  1SRL A;  4LE9 A;  2LQN A;  4GBQ A;  2PZ1 A;  4R0K A;  1WI7 A;  2K9G A;  1X2K A;  3VS6 A;  1UE9 A;  1YCS B;  4AFS C;  2JM8 A;  1YNZ A;  5IH2 A;  2K2M A;  1KFZ A;  3RBB B;  2ABL A;  2K6D A;  1ABO A;  1NLO C;  2PNI A;  3I5R A;  2KRO A;  5GJW B;  1WXB A;  4A63 B;  1AWW A;  1PKS A;  2AK5 A;  1NM7 A;  2MCN A;  2GTO A;  4J9F A;  1RUW A;  2LX7 A;  4LNP A;  1HD3 A;  3JV3 A;  2GQI A;  4DEX A;  1PRL C;  2KR3 A;  1NLP C;  2D8J A;  3R6N A;  4Z89 A;  3VS2 A;  4D8K A;  3UA7 A;  1HSQ A;  3SEM A;  1ARK A;  5IHK A;  1UJY A;  1T3S A;  2FG0 A;  2EBP A;  4OML A;  2JS0 A;  5IXB A;  2HSP A;  3THK A;  4RTT A;  1UEC A;  2LQW A;  2YUO A;  1NEB A;  2EGE A;  2FPE A;  1GFC A;  2FRY A;  3M0S A;  2EVR A;  3ZL7 C;  4HVU A;  2J06 A;  1SEM A;  3M0U A;  2LJ0 A;  2EGC A;  1JO8 A;  1QWF A;  3UA6 A;  1XOV A;  1YWO A;  2DM1 A;  3CQT A;  2DNU A;  2DF6 A;  4J9E A;  2A08 A;  2EYZ A;  1KJW A;  3PVQ A;  1BB9 A;  4RTW A;  2AZV A;  2ED0 A;  2KGT A;  3VS0 A;  1ZUK A;  2C0T A;  4OMN A;  2LCS A;  1JU5 C;  3PE0 A;  3EHR A;  5EC7 A;  4AFZ C;  1K76 A;  2HDA A;  1AD5 A;  1SPK A;  2E5K A;  2LJ3 A;  2D0N A;  4F14 A;  2BZX A;  3SHW A;  1GCQ C;  1I07 A;  2DL3 A;  4JJD A;  1PWT A;  2YDL A;  1FMK A;  4FSS A;  2K3B A;  1W70 A;  1CKB A;  4F17 A;  5L23 A;  1H3H A;  2D8H A;  1OPK A;  2HCK A;  1SHG A;  4CC7 A;  3I5S A;  1GBR A;  2FEI A;  4X1V A;  4RTU A;  1Z9Z A;  3KFV A;  2CDT A;  1WLP B;  2W10 A;  1UHC A;  1AWJ A;  1T0H A;  3VS3 A;  1H8K A;  1X43 A;  5I22 A;  3NHN A;  2DVJ A;  3IQL A;  2DL8 A;  4J9D A;  2C0I A;  4EIK A;  2O2O A;  1M8M A;  1SHF A;  2K79 A;  1FYN A;  2B86 A;  2DRM A;  5FWC A;  2KT1 A;  1K0S A;  2JT4 A;  3C0C A;  2FO0 A;  2IIM A;  1AEY A;  1QKW A;  1UHF A;  2JMC A;  2RN8 A;  4JJB A;  4D8D A;  2RQR A;  2JS2 A;  2DBM A;  1YN8 A;  1ZUY A;  2J6K A;  3NGP A;  4AFU C;  1VYT A;  2GBQ A;  4J9G A;  4CC3 A;  3EG0 A;  4LUD A;  1GBQ A;  2O9S A;  1Y0M A;  2ROL A;  1YP5 A;  3FJ5 A;  2OI3 A;  2LNH B;  1G83 A;  4HXJ A;  1V1C A;  3H0I A;  3EG2 A;  1X6B A;  2CT3 A;  2KE9 A;  2EPD A;  1GFD A;  1W6X A;  1M27 C;  3M0T A;  1ZX6 A;  2FRW A;  1SSH A;  5ECA A;  4HVW A;  2JXB A;  2JTE A;  1ZSG A;  5IXF A;  3RNJ A;  2KRN A;  1AWO A;  2A37 A;  2HBW A;  2RQT A;  2CUB A;  2X3W D;  1BK2 A;  4QT7 A;  4OMQ A;  3TSZ A;  1AOJ A;  1U06 A;  2W0Z A;  2X3X D;  2I0N A;  2EW3 A;  2GTJ A;  3A98 A;  3M0P A;  2RPN A;  4JPB W;  2EGA A;  4LN2 A;  4Z8A A;  3TVT A;  1I0C A;  2CT4 A;  1M3C A;  2RQW A;  2A36 A;  2RNA A;  1BU1 A;  2L2P A;  2DRK A;  1U3O A;  2CSI A;  3GBQ A;  2H8H A;  1E6G A;  4KRT A;  1QWE A;  2V1Q A;  1JEG A;  2LJ1 A;  1MV0 B;  2RF0 A;  4AG1 C;  4HCK A;  4WCI A;  1W1F A;  2L3Q A;  4E6R A;  2ECZ A;  1JXM A;  1TUD A;  1NEG A;  3VRZ A;  1I1J A;  1K1Z A;  1PNJ A;  2J6F A;  2CUD A;  4LUE A;  1Y57 A;  1IO6 A;  2DL5 A;  2HEQ A;  2KYB A;  1K4U S;  4HVV A;  2EQI A;  4RTZ A;  3UAT A;  2DYB A;  2ED1 A;  2DE0 X;  2AZS A;  2YT6 A;  1RI9 A;  1UUE A;  2XMF A;  2KNB B;  1E7O A;  4AFQ C;  2LP5 A;  5IHN A;  2KBT A;  2RQV A;  2DBK A;  2AKK A;  1JQQ A;  1K0X A;  1ZUU A;  2CH4 A;  4IIM A;  2DL4 A;  1X2Q A;  1MUZ A;  1Z9Q A;  2FPF A;  1U5S A;  2JMA A;  1UG1 A;  4J9B A;  2O88 A;  1AZG B;  2ENM A;  3UF4 A;  4RTY A;  4J9C A;  3ULR B;  2NUZ A;  3REA B;  1N5Z A;  1AZE A;  2OJ2 A;  2CRE A;  1S1N A;  4Z88 A;  2L0A A;  1GCP A;  2P4R A;  2J05 A;  1AVZ C;  4DEY A;  3QWX X;  2DX1 A;  2F2W A;  1X6G A;  3H41 A;  1QLY A;  3H0F A;  1PHT A;  1OPL A;  1PRM C;  3REB B;  2EKH A;  2NWM A;  2DL7 A;  2PTK A;  2M0Y A;  1KSW A;  3PVL A;  2DLP A;  3LH5 A;  4J9H A;  2OAW A;  1UGV A;  2CSQ A;  2SEM A;  2M51 A;  3EHQ A;  2CH4 W;  4OMP A;  3TSW A;  2SRC A;  1UJ0 A;  1B07 A;  3VS4 A;  1WA7 A;  5HCK A;  1NYG A;  1WXT A;  3VS7 A;  1GL5 A;  5FW9 A;  1WDX A;  2YUN A;  2JM9 A;  2RQU A;  1H92 A;  3EGU A;  1WXU A;  1X27 A;  2RMO A;  2ROT A;  2G6F X;  1CKA A;  2L3P A;  1PKT A;  2F2V A;  2KT8 A;  4RTX A;  5I11 A;  1A0N B;  1ZBJ A;  2BTT A;  2BZ8 A;  2KXD A;  1KIK A;  2KXC A;  1VA7 A;  2ESW A;  2QDL A;  3I35 A;  1TG0 A;  1VYV A;  2AKL A;  2DMO A;  1SRM A;  2O9V A;  4ESR A;  4OMO A;  1T0J A;  4Y92 A;  3QWY A;  2C0O A;  4CC4 B;  1UDL A;  2D1X A;  2O31 A;  2GNC A;  4CC2 A;  4ZNX A;  2YUQ A;  2DIL A;  1WYX A;  3O5Z A;  2EYX A;  4OMM A;  4IIO A;  1GRI A;  2KRS A;  4JJC A;  2V1R A;  1YWP A;  2MIO A;  2KEA A;  2DJQ A;  1X69 A;  1CSK A;  4AG2 C;  3VRY A;  4GLM A;  1EFN A;  2VVK A;  1J3T A;  5GJV B;  2J6O A;  3EG3 A;  2VWF A;  1NG2 A;  1TUC A;  1AWX A;  1JXO A;  2YUP A;  2EYW A;  4J9I A;  1GCQ A;  3I9Q A;  1M30 A;  5FWB A;  1BBZ A;  2FPD A;  1WIE A;  4F16 A;  2L3S A;  2KRM A;  1MV3 A;  3VS1 A;  1M3B A;  1ABQ A;  1UTI A;  3M0R A;  4JZ4 A;  1OOT A;  4ORZ A;  2YSQ A;  3NPF A;  5IHI A;  1WFW A;  1RLQ C;  2BZY A;  2K7A A;  2JW4 A;  1RLP C;  1QCF A;  3M0Q A;  4K11 A;  2MOX A;  4RUG A;  3H0H A;  3VS5 A;  4M4Z A;  1LCK A;  2A28 A;  1OV3 A;  2LZ6 B;  2VKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...