1NG2A

Structure of autoinhibited p47phox
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
176
structure length
176
Chain Sequence
b'ILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosolic factor 1
publication title Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase activator
total genus 39
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF16621 NECFESHC SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ng2A01
1OOTA 4RUGA 1UUEA 1WDXA 5IHIA 4DEXA 2EQIA 2EYXA 2FEIA 2JM9A 5IHKA 1PKSA 1UJ0A 2K6DA 1CKAA 1NYGA 2HDAA 1NLPC 2X3WD 2K2MA 3VRZA 3JV3A 3VS4A 2DA9A 1UJYA 1SRLA 4IIOA 1I0CA 2D8JA 1YN8A 4J9EA 1QKWA 2LNHB 2PTKA 2RNAA 2DX1A 4OMPA 1GFCA 1OPLA 2DMOA 1Y57A 2VWFA 3QWXX 2DBMA 1UFFA 3I35A 1S1NA 2L3QA 1TUCA 1RLQC 2RQWA 3REBB 1AWWA 3VS2A 2V1RA 2EGEA 3EG3A 2A36A 1RI9A 1BB9A 2VKNA 4Z8AA 1SHGA 2LJ3A 2KRNA 1JXOA 1OEBA 2O31A 2P4RA 2K3BA 1AZEA 1M3BA 4Y92A 2CUBA 2I0NA 2QDLA 3A98A 3REAB 1BU1A 2HBWA 1E6GA 4ORZA 3U23A 1K0XA 2FRYA 4LN2A 2DBKA 1HSQA 3RNJA 1VYTA 4AFQC 1JO8A 1V1CA 2JS2A 3O5ZA 1YCSB 1SPKA 2L3PA 2BZ8A 2HEQA 2YUOA 4ZNXA 2FO0A 1QWEA 4EIKA 2K7AA 4K11A 1AOJA 1ARKA 3UA6A 2C0TA 1VYVA 2YUNA 4RTYA 3H0FA 4F16A 2O2OA 5FW9A 2C0IA 2DL8A 2A08A 2LJ0A 2RQTA 3LH5A 3M0RA 1GBRA 4OMLA 1JU5C 2XMFA 1WXUA 1N5ZA 2J6FA 1VA7A 2CH4A 4QT7A 2DL4A 2PZ1A 1ZUUA 2ENMA 1ABOA 1B07A 2K9GA 1WA7A 1LCKA 2SEMA 1NEGA 1UDLA 1SHFA 4CC4B 2DJQA 4J9FA 3VS1A 1KSWA 2YUQA 1H8KA 1RLPC 4AG2C 2RMOA 1FMKA 2OI3A 1RUWA 1MV0B 2J7IA 1UHFA 3VS6A 1WI7A 1B3QA 4LE9A 1IO6A 2KRSA 4OMMA 2F2VA 2JS0A 4RTXA 4RTVA 2ROTA 1G83A 2GNCA 4J9DA 2M51A 3EHQA 4J9IA 1YNZA 1K9AA 3H0IA 1HJDA 1UHCA 1AZGB 2DF6A 4AG1C 2JMCA 2EYZA 1NM7A 1KFZA 4WCIA 2GBQA 4CC3A 3M0PA 1E6HA 1M3AA 1UTIA 4X1VA 1T3LA 1NG2A 3EHRA 3EG2A 2FPFA 3NPFA 2KXCA 2KBTA 3M0QA 2EW3A 4HXJA 3I5RA 5GJWB 4AFZC 1WIEA 1M30A 5EC7A 2MIOA 1A0NB 2KT8A 3RBBB 2LJ1A 1MUZA 2YDLA 2DL3A 2KE9A 1WX6A 1AD5A 2D1XA 1X43A 4LUDA 2CT3A 2EBPA 1WLPB 1E7OA 3UF4A 4Z89A 2CH4W 4AFUC 2ESWA 2A28A 2VVKA 3NHNA 1OPKA 1SSHA 2M0YA 1ZX6A 2NWMA 2PNIA 4JJCA 3M0SA 3UATA 4JZ3A 4OMQA 4GLMA 2ECZA 2CREA 1UECA 2E5KA 1SEMA 1Z9ZA 4OMNA 2EVRA 1X6GA 1QWFA 3NGPA 2DRMA 1NEBA 2CUDA 1VYUA 3NMZC 4CC7A 2O88A 3R6NA 1JXMA 4J9CA 1X2KA 2O9VA 2F2XA 3ZL7C 3EG1A 2B86A 5L23A 3VS7A 2YUPA 1Z9QA 2V1QA 3H0HA 1ZUYA 3KFVA 4M4ZA 3VRYA 1JQQA 1AWJA 2GTJA 1M8MA 2JW4A 2O9SA 1BK2A 1WXTA 1PRLC 4JZ4A 2NUZA 1CSKA 3GBQA 3VS5A 3TSZA 2C0OA 5IH2A 2ED0A 2OAWA 3EGUA 4OMOA 2KYMA 2IIMA 2L2PA 2RQRA 4FSSA 4HVUA 2DNUA 2KROA 5GJVB 3TVTA 2LQWA 4RTWA 2DYBA 1GCPA 2X3XD 4ESRA 1WYXA 4J9HA 3VS0A 2RQUA 2D0NA 2ROLA 2L3SA 1AWXA 1ZBJA 4HVVA 2KYBA 1QCFA 2GGRA 2LQNA 4J9BA 2AKLA 4KRTA 4GBQA 2LMJA 2F2WA 2MCNA 2J06A 1W1FA 1SRMA 1WXBA 1KIKA 2EGAA 1ABQA 2DL7A 1I07A 3M0UA 2JTEA 2FRWA 1TG0A 4E6RA 1T0JA 3UA7A 2BZYA 1YP5A 2K79A 2LP5A 4R0KA 4JPBW 2AZSA 3C0CA 4F14A 4HCKA 3PVLA 1XOVA 2HCKA 2EYYA 2H8HA 2W10A 2RQVA 1TUDA 2RPNA 1U3OA 2J6KA 1H3HA 2CT4A 3THKA 3CQTA 2JMAA 2BZXA 1EFNA 2EKHA 4JJBA 5IHNA 2ABLA 1PWTA 2A37A 1X2QA 1YWPA 4A63B 3SHWA 1NLOC 5I11A 3IQLA 2AZVA 1ZLMA 1M3CA 5FWBA 4LUEA 4IIMA 1T0HA 2KNBB 1K0SA 1X69A 1K4US 4AFSC 1K1ZA 1GL5A 3SEMA 2HSPA 1G2BA 4HVWA 3EG0A 1NYFA 2FG0A 3I9QA 2KEAA 5ECAA 4F17A 3H41A 5IXBA 1Y0MA 1PNJA 1ZUKA 1CKBA 2D8HA 1W6XA 2OJ2A 2MOXA 1GRIA 3FJ5A 2CSQA 2JM8A 3VS3A 1I1JA 2JT4A 2SRCA 1M27C 1QKXA 1T3SA 2AK5A 3TSWA 1BBZA 2CDTA 1FYNA 1GCQA 4RTTA 2J6OA 2J05A 4D8KA 1UGVA 3QWYA 4RTZA 2DILA 1YWOA 1ZSGA 2DM1A 2DRKA 2G6FX 2YSQA 2LX7A 2YT6A 4LNPA 3ULRB 4D8DA 1PRMC 2DVJA 1AVZC 5I22A 1PKTA 2ED1A 2GQIA 1GFDA 1J3TA 2GTOA 2FPEA 1AWOA 1HD3A 2RF0A 1JEGA 1PHTA 2KR3A 4Z88A 1H92A 2RN8A 1GBQA 2KRMA 1U06A 2EGCA 2DL5A 5FWCA 4JJDA 5HCKA 3PE0A 1X27A 2DE0X 1X6BA 1UE9A 2DLPA 2EPDA 2LCSA 2L0AA 1OV3A 2KT1A 2FPDA 2LZ6B 2BTTA 2JXBA 2KGTA 2CSIA 4CC2A 1W70A 3I5SA 2W0ZA 1K76A 1AEYA 4DEYA 2AKKA 1KJWA 4RTUA 2EYWA 4J9GA 1GCQC 3PVQA 2KXDA 1MV3A 1QLYA 1UG1A 1U5SA 5IXFA 1WFWA 3M0TA
chains in the Genus database with same CATH superfamily
3G6EA 2MWOA 2EQKA 1U1SA 5IHIA 4BE0A 4R56A 4M7AF 2EYXA 3G71A 1PKSA 6AT1B 4OGCA 1CKAA 1OULA 1VQOQ 1M1KR 1OQKA 3JCMb 3Q1JA 2DYIA 2ZZDA 4LXCA 3CC7Q 1I81A 2P0KA 4GLKA 4IIOA 3P8HA 3OY9A 1ACMB 3ASKA 1GFCA 2QTVA 1OPLA 2G3RA 2BIVA 5GANh 3OS2A 1UFFA 3I35A 4KGVB 4FT4A 3RMQA 2MYSA 4XTZA 3EG3A 2A36A 3E2UA 3MP6A 4QW2A 1OEBA 3EFSA 1YFNA 1HK9A 3JB9F 1Q86C 3CC2T 1YIJQ 2QDLA 1YITQ 3REAB 3QZ9B 4A4KA 4ORZA 4Q5WA 1BYMA 3UDCA 4C8QA 3BFMA 4AFQC 1JO8A 4ANJA 4QQDA 2DFUA 4ZNXA 1AHJB 2MWPA 2KVQG 4EIKA 2K7AA 2RJCA 4HCBA 4M78D 3ZFJA 2ZAEA 4HKEA 2C0TA 1YBYA 4RTYA 4F16A 3DLLA 1UGSB 4WTOB 2E12A 2DPPB 1JJ2A 4M75D 2RQTA 3LH5A 2XMFA 1N5ZA 1VQMA 1Q82C 2BKDN 2PVDB 4C5HA 3MO8A 3M9QA 1N8RC 2KQWA 1YJ9A 1WA7A 1UDLA 1M2VB 4WF2A 2B8AA 1KSWA 1RLPC 3CD6T 4Y28E 5KE2A 4AG2C 2XI9A 4J83A 2PVOB 2RMOA 3UT1A 3OS0A 2JOYA 1YI2A 2VGMA 1RUWA 4L5GA 1Y07A 2XDPA 4FM4B 2L8DA 4BUGA 1IO6A 1KQSP 2JS0A 4C8QC 4RTVA 1LNXA 4M7AG 2M51A 3EHQA 4J9IA 2RHXA 1VIFA 3CCEQ 2X4WA 1K9AA 3LWHA 1HJDA 1AZGB 2RK1A 1NJIU 3M57A 4UC4A 2EQJA 2VXFA 1QVFP 1VQ9A 1QMCA 4QVDA 2GBQA 4ZN1A 3CC4T 1NG2A 3EG2A 5CR2A 1QP3A 2FPFA 2KXCA 2NLUA 3P8BB 2COWA 2RO0A 4ZGJB 2M0OA 5LJ3e 1QCOA 5GMKj 4X9DA 4IUQA 4C8QF 3RBBB 3L2VA 5DY9A 2QA4A 2LJ1A 2YDLA 2DL3A 1YJWA 1WX6A 2VGNA 1VQ4Q 1AD5A 2D1XA 4F7UF 2CT3A 4J7FA 3JB9G 3QHSA 1JB0E 4HCCA 2FYKA 2PNIA 3EH2A 3CCLQ 4JJCA 4JZ3A 3P8DA 2V26A 3CBPA 4EMKB 1VQ6Q 1PG5B 3A5ZB 3V7RA 2DRMA 1NE8A 2CZ1B 3MKDA 3QSUA 1OI1A 3HL8A 1VQ5Q 5GMKm 2K5LA 1JXMA 4FYXB 5GAN4 1AT1B 3TQ7P 3ZL7C 3EG1A 2QQBA 1Z9QA 1C1AA 5GAMg 1KQSS 2EFIA 4AT1B 2VYTA 4HA8A 2K57A 1OYXA 4ELYC 1YJNA 1PD0A 1M2VA 5GAN2 1D1BA 2GTJA 2K2VA 2RB6A 4M7AE 1BK2A 4BDYA 4M78C 4MMLA 1KD1R 1QVFS 1FX7A 2C0OA 5LJ3f 1I5OB 4M75C 2C06A 1N9RA 4FSSA 4HVUA 5GMKl 1JRIA 2EIFA 1KC8U 2CGHA 3META 1WJSA 1OU9A 4J9HA 5CCAA 3OYJA 2A3LA 3V7SA 4FW1A 2RQUA 2ROLA 2KYBA 1YCYA 2LQNA 5FROA 2RHYA 1MNEA 1KC8R 4KRTA 4GBQA 3CPWA 2DJZA 2MCNA 1Q7YC 1K73U 2EJ9A 1WXBA 2OTLA 1ABQA 2BUDA 2DL7A 3JCMg 1I07A 1IRXA 3M0UA 5GMKh 3I56A 3NTIA 1ZHIA 5I2MA 4J8OA 2ZCFB 2KSSA 4R0KA 1RAAB 3GNFB 3LX7A 2IVWA 3HRUA 2H8HA 1I5LA 4F7UG 2GFUA 4ZN3A 1U3OA 3PFSA 3THKA 2ZGWA 3CQTA 1D1AA 1K9MC 3DLMA 1YHQQ 2BZXA 3OYBA 1EFNA 2IPOB 2DETA 4EMKA 2LNVA 3G4SQ 2A37A 1KQ1A 1PCXA 2GF7A 5I11A 1OU8A 1ZLMA 3DB3A 4IIMA 1K0SA 1X69A 2OTJT 1K1ZA 4OP0A 3JCMd 3HKSA 1NYFA 2KEAA 3FIFA 1TSFA 1WQ7A 2YLBA 2RHIA 4RCBA 5IXBA 1ZUKA 3VV0A 1VQ8Q 2MOXA 1GRIA 2JM8A 4VUBA 1VQLT 3RUXA 4KGXB 1I1JA 2PU9B 3CEYA 1XQHA 1T3SA 2AK5A 3SB2A 3OYLA 1VQPQ 1BBZA 1GCQA 1W2BA 2J6OA 1WPYA 3I55A 1WQWA 1G3TA 1ZSGA 4E7HA 2CP0A 2YSQA 3H9NA 4DBQA 4IKFA 2XD0A 5GAOn 3UPUA 1WHHA 3F70A 3RIRA 3UWNA 3VYHB 3GNGA 3L2WA 1JEGA 1WHKA 4C5IA 3M56A 1D3BB 2RN8A 4J5YA 1GBQA 3RESA 4F7UE 3G71T 3MCAB 4M7AD 4OB1B 3LWIA 5HCKA 3MJXA 1X27A 4XU1A 3RDVA 4JLGA 1VQNA 1HYOA 5KYUB 2KGTA 2CSIA 4CC2A 4KUDK 1UGQB 1R77A 2P84A 3I5SA 1AEYA 2AKKA 4OB0B 2EYWA 4J9GA 1GCQC 3PVQA 4OVAA 1KG1A 3OYFA 3A8HB 3VUZA 2K5IA 3OB9A 3M0TA 3CCQQ 2VB6A 2JZ2A 2VASA 3GP8A 3HPWA 4FYVB 1WDXA 4KH1B 5KCOA 3JB9D 1G8XA 4BI3A 2JM9A 5IHKA 1KQSA 1VIEA 1VQLQ 2K6DA 3CPFA 2HDAA 3FRNA 2OX7A 2X3WD 2VC8A 2K2MA 3VRZA 5GMKi 2DA9A 4MZTA 1SRLA 2NUTB 3OBYA 1I4K1 1YN8A 3QYHB 4J9EA 1QW1A 2RNAA 3C95A 2RA2A 4OF1A 5CKDA 2KAFA 2DMOA 1V76A 1KHIA 2VWFA 1X75C 2DBMA 3PMIA 3GOXA 3REBB 2L3QA 1ZA2B 2EGEA 4DOVA 2LT1A 1QCNA 1VQMT 1Q81C 4Z8AA 1SHGA 2K3BA 1RL2A 2HKQB 3HFNA 1AZEA 4JRKA 5CKBA 1YJ9T 2CUBA 2I0NA 1N6AA 5GAMj 2QXFA 1BU1A 2CP6A 2E3IA 1E6GA 4PK4A 3U23A 1K0XA 2FRYA 4LN2A 2PUOB 1YI2T 1D3BA 4ZGDB 2JS2A 5IAYA 2DTIA 1YCSB 1OX9A 1KHCA 1S72A 2HEQA 4J6WA 2F5KA 3RMSA 2QEXQ 3M54A 4Y91A 1BI0A 1ARKA 2XDDA 3CCRA 5KYUA 2AT1B 2E5QA 2O2OA 2JN0A 2MMPA 3NTKA 4L6V5 5FW9A 1VQ9T 2E41A 2DL8A 4F7UB 2LJ0A 5CQXA 3LLRA 2F5TX 1GBRA 1JU5C 2J6FA 3J7AF 1M8VA 2DL4A 2PZ1A 1WHJA 4GY5A 4A4HA 4XU0A 1ABOA 4M7AC 4JDSA 3CCQA 1M90C 2YRDA 4JRIA 4J9FA 4OB2B 2QA4T 1H8KA 1YJWT 3OYNA 4PJLA 3CMEQ 1FMKA 2VUBA 3CCJQ 4KUIA 4IURA 2ZPHB 1IZ6A 2NYSA 4PLIA 1UHFA 3CMAQ 2RHZA 1WI7A 1BI3A 1IGQA 4DBHA 2FHDA 2F2VA 4RTXA 2ROTA 2YRVA 4C92B 2GNCA 4C5GA 4J9DA 1K8AC 4FW2A 1RAEB 1YNZA 4NS5A 2YXYA 1M1KU 3CCUA 2NUTA 5D6XA 4N0AA 2QYZA 1VQ7A 1UHCA 5CKHA 2A0FB 4BE2A 2JMCA 2MI6A 1NM7A 1QVGA 4XU3A 2COZA 3PIPA 1E6HA 1M3AA 2DTOA 2LRQA 2GFAA 3OW2P 1VQKA 2DXTA 2EW3A 3I5RA 4EMGA 3CCVQ 5KYNA 1EZZB 1M30A 2MF2A 2L3RA 1A0NB 3VU3C 4II1A 1MUZA 3FEOA 3BY7A 3HRTA 2KE9A 3L1AA 2LX9A 5LL6S 4LD6A 1YJNT 1X43A 2DZ9A 5GAMh 1WLPB 1SG5A 3CXCA 3NHNA 5I21A 2LQKA 1U8RA 1SSHA 2M0YA 1WGSA 2NWMA 5FU7B 4E7KA 1K73C 3HRSA 3BW1A 2M02A 4HT9A 3QZ5B 1SEMA 3NFCA 1WHLA 1X6GA 1QWFA 3LYIA 1WJRA 3NGPA 1NEBA 2CUDA 3NMZC 4B9XA 3CCSA 3OQ5A 1GXIE 2O4XB 3EFRA 1X2KA 2O9VA 4F7UA 5FU6B 3VS7A 2V1QA 2RHUA 2RK2A 3GIBA 2XK0A 2OTLT 4B9WA 3QBYA 3WVEB 3X20B 1BCMA 4M4ZA 2HL5C 1AWJA 3I56T 2JW4A 1UEBA 2O9SA 3CMEA 4JZ4A 3A8LB 3GBQA 4PLLA 3JCMh 1PM3A 3VS5A 4BB7A 4EMHA 4OMOA 3VYGA 3JB9I 2IIMA 2MK5A 3OYEA 2RQRA 3OW2S 2HBPA 4BI4A 4C92A 1NZ9A 2DIGA 2DNUA 5GJVB 4TVRA 2LQWA 3FC3A 2X9HA 1GCPA 3FLGA 3RR6A 1WYXA 3VS0A 4HVVA 1ZBJA 2ZPGB 1M9SA 1QCFA 2M1HA 3PMTA 3X26B 1VQOA 5GMKe 2AKLA 4XQ3A 2YRCA 1W1FA 2EJFA 3OSSC 3CC7A 4PJJA 1PC0A 2FRWA 1T0JA 1F1BB 1YP5A 2KMTA 4CI0C 2LP5A 3JCMX 4JPBW 3C0CA 3CC2Q 1DJ7B 4F14A 3PVLA 5KH6A 2EYYA 2RQVA 1TUDA 1UB4A 1H3HA 1EIFA 1YIJA 1Q81R 5KYXB 3WVDB 3I55T 1YITA 4JJBA 5IHNA 2XDBA 2WSCE 1PWTA 3L2QA 4A63B 1ZSZB 3E19A 2DERA 9ATCB 1H3ZA 2AZVA 5FWBA 2O4XA 5A0GA 2GCXA 2BE7D 2KNBB 1K4US 3A1PA 1GL5A 2CZ0B 2QK0A 2Y90A 4ZTJA 3EG0A 5LJ5d 3H41A 1Y0MA 1PNJA 3OYCA 4L59A 3H6ZA 2XKOC 3DB4A 2CSQA 3PTAA 4C92F 1Q95G 2JT4A 3OYHA 1M27C 1QKXA 3CBMA 1KD1U 4IUUA 3CD6Q 2CDTA 2ZPIB 2DXBA 3VKIA 1KK7A 2E10A 3HHTB 4RTTA 2QQAA 4D8KA 3QWYA 4RTZA 5FU7C 5M9OA 2DM1A 4E2FB 1MHNA 4LNPA 1M90R 1BCOA 4DOWA 3NTHA 5J26A 3CCMT 1V29B 4O6JA 1M4ZA 1PKTA 2RJDA 2GQIA 1J3TA 1HD3A 1PD1A 1RAGB 3OYKA 1H92A 3CCEA 3CC4Q 4XTWA 3X28B 1RADB 5HK0A 2KRMA 1U06A 1BI1A 2EGCA 5FWCA 3MEUA 2DIQA 3PE0A 4KBMB 2DE0X 1X6BA 2DLPA 4RG2A 2L0AA 2E6ZA 3CC2A 1OV3A 2HKNA 4FL6A 5J39A 4JS4A 3S3MA 3HSBA 3WXMB 1KJWA 5HY6A 3JCMP 5KYXA 1VQ4A 2CP5A 1MV3A 3JSCA 4LD9K 2KI7A 1UG1A 5IXFA 3GF5A 1ZSZA 2HQHA 2ZPFB 5GANd 3CCLA 4C0FA 2HZYA 3OBWA 1OOTA 2JTMA 4J7IA 4RUGA 1UUEA 1VQ6A 4C0DB 2D6FA 1UJ0A 3N5BB 4E7JA 1Q86R 1S72T 4M77F 1VQ5A 2FZCB 1W4SA 2OAUA 4C0GA 3ER0A 1TTHB 2EQMA 5CKFA 2D8JA 5DLOA 3GLXA 1TUGB 2LNHB 2PTKA 2IG0A 2DX1A 4XK8E 4OMPA 3CD6A 1Y57A 4C92G 5J3BA 3CCMQ 4PFZA 4ZTFA 3OYIA 2PQWA 1S1NA 3SD4A 1TUCA 1RLQC 5C6SA 1M1FA 2V1RA 3X25B 2HAXA 4KT0E 3V8JA 1RI9A 2VKNA 2E4HA 4PJOG 3RKYA 2KRNA 4M7DB 1JXOA 2JNGA 2QTXA 4LDYA 2R57A 1M1KC 1WJQA 1M3BA 4A4EA 3A98A 3TCJA 5L8RE 1OX8A 2E64A 1Q82R 1HSQA 3RNJA 1V1CA 2CYZB 1N8RR 2L3PA 3QYGB 2BZ8A 2YUOA 2FO0A 1QWEA 4EMKC 2RJEA 4K11A 5CAIA 5GAOm 1QVPA 4XTUA 1FXXA 1VYVA 2HSEB 2JTFA 2YUNA 3CCUT 3G6ET 1VQ7T 5GAOr 1G3WA 4D6WA 1MGQA 3EG9B 1BIBA 3MHXA 5I2SA 5FRMA 2A08A 1WXUA 1BKBA 2WSEE 4QT7A 3OMCA 1VQKT 1NPRA 2DD4A 3KBGA 4HT8A 2K9GA 1PSEA 1H641 3SDZA 4CC4B 3VS1A 2V8IA 2YUQA 4M78G 4X34A 3MP1A 1O75A 2HMAA 3S6WA 5GAN8 1YHQA 5LJ5j 2P4TA 3M4YA 5GAOl 2DK3A 3VS6A 5CKEA 4LE9A 3G4SA 2KRSA 4XTYA 4M75G 1KQ2A 2OTJQ 4C92E 4PNOA 1G83A 4PFPA 2LC4A 3E1SA 2MAMA 3G7ZA 2LDMA 2D9TA 2RI3A 3H0IA 1XJWB 1LVKA 4M77G 1OZ3A 2EYZA 2PUKB 1KFZA 3QJ6A 1UTIA 1T3LA 2HD0A 3H8ZA 1VOMA 2KBTA 1VQ8A 2RJFA 3M0QA 4HXJA 5GAMe 4AFZC 1WIEA 1LOJA 1R0BG 4M7DA 5EC7A 1QVFA 2MIOA 2KT8A 4RMOA 1VQPA 4BI8B 1TOVA 2XIDA 3PGGA 1D0ZA 2EBPA 1E7OA 3UF4A 2CH4W 2VVKA 3LW5E 3JRZA 1OPKA 1ZX6A 3G6EQ 2ATCB 2KDSA 3JCMQ 4DBRA 4NL3A 2CREA 1UECA 3G71Q 3OA6A 1NJIC 3JCMc 3FJPA 2FZGB 4E47A 2H3EB 1VYUA 3OYDA 3EG9A 2O88A 2X4YA 3R6NA 4FYYB 1X01A 4J9CA 1D0XA 2B86A 1OZ2A 1VQOT 5EG2A 4EPCA 2YUPA 2LQ8A 4FSXA 3H0HA 1ZUYA 2M9UA 3JCMe 5GANj 3AHUA 4XAXB 1UGPB 3VRYA 1JQQA 1M8MA 4MMKA 3OYGA 2NUZA 1CSKA 4DBFA 1Q7YR 1TS9A 5GAMf 4MDXA 1WZOA 3TSZA 5LJ5h 2RI5A 2OAWA 1Y7XA 4M77E 4E7SA 2KYMA 2DO3A 2ZPBB 3V7CA 2L2PA 3FDRA 3QKJA 3CPWP 3R6OA 1LPLA 4XU2A 1UGRB 2DYBA 1K9MU 1YIJT 1G3YA 1YITT 4Z02A 1AWXA 3AT1B 2LT4A 2GGRA 4DA4A 1VQLA 3QDFA 4NOYA 2P0PA 4J9BA 4M7DF 1K9MR 2F2WA 2QAZA 2J06A 1KD1C 5LJ3d 2COYA 1KIKA 2EGAA 4J6YA 2P0QA 2JTEA 5KYWB 2QASA 4PJOB 4E6RA 3ZEHA 3UA7A 2BZYA 1M5Q1 1ZQ1A 1VQMQ 2CP3A 2DZCA 2AZSA 4HCKA 2QI2A 1YJ9Q 3JCMf 2Y4XA 4E7IA 1XOVA 4QKUA 2W10A 1Y71A 1D09B 2I2LA 2RPNA 4C92D 2LTOA 4BY6B 1KC8C 1YI2Q 2JMAA 2HL3A 3ME9A 4O5VA 2EKHA 1O9SA 2ABLA 2CKKA 4PJOD 1X2QA 1B34B 1NLOC 8AT1B 2DXUA 1B7TA 2JJ9A 4JUVA 2R5AA 2QQ9A 2DEUA 2E65A 4LUEA 1T0HA 4BD3A 2QEXA 4ZGEB 4AFSC 3SEMA 2X35A 3V8KA 3URGA 1VQ9Q 2QQRA 5ECAA 3CPWS 3CCET 4LDVA 5GAN3 2QQSA 1W2BP 2RH2A 1CKBA 2FL7A 2D8HA 4N0AC 4MZPA 3VS3A 2HQXA 4PFOA 4M78B 2Y4YA 2SRCA 2QA4Q 4CRIA 4PJNA 2DD5A 3QJYA 1YJWQ 2XU8A 3TSWA 1FYNA 4LDXA 3LH0A 3C4SA 2CZ6B 5HKCA 4A54A 4M75B 3GPLA 1IB8A 3OYYA 2DRKA 2VXEA 2LX7A 3ULRB 4D8DA 1D0YA 1VQ4T 1PRMC 3CCJA 1AVZC 1SSFA 5I22A 2ZPEB 3CMAA 2ED1A 4M77B 3DKMA 4JRPA 3CCLT 2FPEA 1AWOA 2RF0A 3E9FA 4YTLA 2HQEA 1PHTA 2R58A 4FT2A 3M53A 4M7DG 1VQ6T 5KYWA 3OS1A 5HK3A 3QG1A 4PJOA 5FRNA 1XNIA 4JJDA 2R5MA 1VQ5T 1UE9A 3L42A 2LCSA 3INZA 1I8FA 4N4HA 4PKCC 4M77D 2FPDA 2LZ6B 2X51A 2JXBA 4A4FA 1YJNQ 3HFOA 3CCVA 1U1TA 1W70A 2LCLA 5LJ5g 5A0DA 2K3XA 1NPPA 1W2BS 1XTDA 4N4GA 1Q81U 1N9SA 1B34A 2V8KA 1WFWA 2XICA 2EQUA 2QGGA 2LCCA 4DEXA 3J80E 3MEWA 3C94A 2EQIA 8ATCB 1BI2A 2FEIA 2FVUA 4C92C 1NYGA 1NLPC 1R0CB 4KGZB 2GQVA 4P5NA 3JV3A 3VS4A 5A0LA 2OTLQ 1NJIR 3EH1A 1UJYA 4PJOC 4MZMA 2FB7A 1I0CA 2F69A 4M78A 1QKWA 3I56Q 5IN1A 3QWXX 1RAIB 2RQWA 1AWWA 4M75A 3VS2A 5KYYB 2A7YA 4BY6C 4OMFB 5KE3A 1BB9A 2LJ3A 4M7DE 2O31A 1VQNT 2P4RA 3EGDB 3T9NA 1M90U 4M77A 4Y92A 3M58A 2EJGA 3OMGA 5LJ3j 2HBWA 4PJOF 3EGXB 2DBKA 2RI2A 2AIRB 1VYTA 3L2ZA 1YHQT 3O5ZA 4XTVA 5DLQE 1SPKA 3G4ST 1G3SA 2E1HA 4RG8A 3JCMW 5GANg 1AOJA 1K8AU 3UA6A 2XHCA 3H0FA 1HXDA 5GAN5 5FU6C 1QQJA 2C0IA 4PL6A 4FCYA 3M0RA 4MDWA 4OMLA 3E9GA 1K8AR 2EAYA 2JVVA 1ZA1B 4C5EA 1VA7A 4RKUE 2CH4A 3O8VA 1VQ8T 2WSFE 1ZUUA 2EYQA 2ENMA 1B07A 1LCKA 2SEMA 1TU0B 1NEGA 3LGFA 1SHFA 3I55Q 2DJQA 1JBMA 2YLCA 1VQPT 2OI3A 4BACA 3PNWC 4IUPA 4M77C 1MV0B 3A8MB 2J7IA 7AT1B 5GAN6 1QVGP 3JB9J 1B3QA 2NUPB 4OMMA 4M78F 4XTXA 5GAMd 4ELZC 2V8JA 1Q86U 4M75F 2K3YA 2DF6A 4AG1C 4JS5A 3A8GB 5CQYA 3KUFA 4ATOA 4WCIA 1K73R 4CC3A 4PJMA 3M0PA 4B6MA 1R8OB 4X1VA 3EHRA 1VQNQ 4C8QG 3NPFA 2X4XA 4J6XA 5KYYA 4V2SA 3CBOA 1N27A 2QG9B 4QQ6A 3CXCP 5GJWB 3L2UA 4QVCA 1TH7A 3EGDA 3RERA 4R55A 1MNDA 3VUBA 3CCRT 4E7ZA 4LUDA 2HNIA 5LJ3h 1Y96B 4Z89A 3EGXA 4OGEA 4AFUC 3OW2A 3JCMJ 2ESWA 2A28A 3EFOB 2QGFB 2EWNA 2WACA 3JB9H 1NBEB 2JUFA 1Q82U 3M0SA 3UATA 5DM7R 4OMQA 3OYMA 3M55A 1MMGA 4GLMA 2L89A 1N8RU 2ECZA 3PIOA 3CCQT 2E5KA 2KY9A 1ZSZC 1Z9ZA 1TWBA 2EVRA 4IUVA 4OMNA 2YWWA 3OYAA 4FIBA 3CC4A 3J81E 4CC7A 3TEEA 5C0MA 1ZBXA 2PVGB 1IREB 3A8OB 3M5AA 2F2XA 1P92A 5L23A 1JJ2P 1QVGS 1WHGA 2DTHA 5KCHA 3KFVA 3S3OA 4QVZA 4M7DD 2RM4A 1MMDA 1LJOA 5LJ5e 5CO7A 5FLXE 1RAHB 2DXCA 2DAQA 4KULA 4M7AB 3SWNB 4DQ2A 3EAEA 1WXTA 4BE1A 1PRLC 1MMAA 5CVIA 5IH2A 2ED0A 1IHVA 4JRQA 5AYFA 3EGUA 2K5FA 2NUPA 3QUIA 3RKWA 3QPHA 2KROA 3CXCS 4C8QE 3TVTA 1SKUB 4F04B 4RTWA 2X3XD 3D7SB 4ESRA 1C0MA 1S72Q 1MMNA 2D0NA 2L3SA 2CZ7B 1FMVA 4N4IA 4OB3B 2O01E 2E6NA 2LMJA 2F1LA 2QEXT 3CCRQ 1SRMA 3MPUB 4LDUA 5AT1B 3BE3A 4A53A 3HP9A 3RKXA 3TU4K 1TG0A 4PJOE 4KH0B 1VUBA 2K79A 5GAOp 5D7UA 3CCMA 3CCST 2CP2A 1Y96A 4NL2A 2CP7A 4FU6A 3EFOA 3PT9A 2HCKA 5CIUA 5A2QE 1QP2A 1JJ2S 2BE9B 5LJ5f 3S3NA 2J6KA 1EX4A 2AHJB 2CT4A 3OSVA 4E7LA 4BDZA 2VV5A 3C12A 3BDLA 3CMET 1YWPA 3SHWA 1M1GA 3CCJT 5GAOq 4JLIA 3IQLA 3TREA 3L2RA 1M3CA 3CMAT 5GANe 2E70A 3CCUQ 1VQ7Q 3QDRB 4JJNK 4C0DC 4HCZA 2HSPA 1G2BA 4HVWA 1FWZA 2FG0A 3I9QA 4F17A 2CS7A 2KK4A 4X9CA 4EDUA 5D6YA 3ZBDA 1W6XA 2OJ2A 3SWNA 1VQKQ 4M7AA 3FJ5A 3VJPA 2X4JA 1C6VX 4M78E 5D6WA 1Q7YU 2DKGA 2K4YA 1RABB 5LJ3g 3QXEB 3CC7T 3M59A 3CCVT 3M4GA 4RCCA 2J05A 2L5QA 1UGVA 4M75E 3BDUA 3JAME 1RI0A 2DILA 1YWOA 1G5VA 2G6FX 2H3JA 2YT6A 2DEQA 4M7DC 2DVJA 3MP8A 3HTRA 4A4GA 2LVMA 1TXQA 4FYWB 1RACB 1WHMA 2Z0WA 3V8LA 1IXDA 1GFDA 1FMWA 2DVEA 2RD1A 2GTOA 2OTJA 4ME7A 2KR3A 4Z88A 4C8QB 3OS5A 5GAN7 1WNLA 3LGLA 3CCSQ 1RAFB 1PSFA 5CK9A 1SF9A 2DL5A 5GANf 3G1JA 2M16A 1BIAA 3MEAA 2EPDA 2KT1A 4C0ZA 3SWNC 4AMCA 2BTTA 4LDWA 2XG8D 2D0QB 4IUTA 2QDYB 2W0ZA 5IT9E 1IGUA 1K76A 4DEYA 4C8QD 2YHTA 1IHWA 4RTUA 2KXDA 1QLYA 2MPXC 3QO3A 3QIIA 3KXTA 1U5SA 1D1CA 3SFMA 1M2OA 2EKOA 1X6OA 3JCMV 2FZKB 3FB9A 4QQGA 3MEVA 2E3HA 3X24B
chains in the Genus database with same CATH topology
1OOTA 4RUGA 1UUEA 1WDXA 5IHIA 4DEXA 2EQIA 2EYXA 2FEIA 2JM9A 5IHKA 1PKSA 1UJ0A 2K6DA 1CKAA 1NYGA 2HDAA 1NLPC 2X3WD 2K2MA 3VRZA 3JV3A 3VS4A 2DA9A 1UJYA 1SRLA 4IIOA 1I0CA 2D8JA 1YN8A 4J9EA 1QKWA 2LNHB 2PTKA 2RNAA 2DX1A 4OMPA 1GFCA 1OPLA 2DMOA 1Y57A 2VWFA 3QWXX 2DBMA 1UFFA 3I35A 1S1NA 2L3QA 1TUCA 1RLQC 2RQWA 3REBB 1AWWA 3VS2A 2V1RA 2EGEA 3EG3A 2A36A 1RI9A 1BB9A 2VKNA 4Z8AA 1SHGA 2LJ3A 2KRNA 1JXOA 1OEBA 2O31A 2P4RA 2K3BA 1AZEA 1M3BA 4Y92A 2CUBA 2I0NA 2QDLA 3A98A 3REAB 1BU1A 2HBWA 1E6GA 4ORZA 3U23A 1K0XA 2FRYA 4LN2A 2DBKA 1HSQA 3RNJA 1VYTA 4AFQC 1JO8A 1V1CA 2JS2A 3O5ZA 1YCSB 1SPKA 2L3PA 2BZ8A 2HEQA 2YUOA 4ZNXA 2FO0A 1QWEA 4EIKA 2K7AA 4K11A 1AOJA 1ARKA 3UA6A 2C0TA 1VYVA 2YUNA 4RTYA 3H0FA 4F16A 2O2OA 5FW9A 2C0IA 2DL8A 2A08A 2LJ0A 2RQTA 3LH5A 3M0RA 1GBRA 4OMLA 1JU5C 2XMFA 1WXUA 1N5ZA 2J6FA 1VA7A 2CH4A 4QT7A 2DL4A 2PZ1A 1ZUUA 2ENMA 1ABOA 1B07A 2K9GA 1WA7A 1LCKA 2SEMA 1NEGA 1UDLA 1SHFA 4CC4B 2DJQA 4J9FA 3VS1A 1KSWA 2YUQA 1H8KA 1RLPC 4AG2C 2RMOA 1FMKA 2OI3A 1RUWA 1MV0B 2J7IA 1UHFA 3VS6A 1WI7A 1B3QA 4LE9A 1IO6A 2KRSA 4OMMA 2F2VA 2JS0A 4RTXA 4RTVA 2ROTA 1G83A 2GNCA 4J9DA 2M51A 3EHQA 4J9IA 1YNZA 1K9AA 3H0IA 1HJDA 1UHCA 1AZGB 2DF6A 4AG1C 2JMCA 2EYZA 1NM7A 1KFZA 4WCIA 2GBQA 4CC3A 3M0PA 1E6HA 1M3AA 1UTIA 4X1VA 1T3LA 1NG2A 3EHRA 3EG2A 2FPFA 3NPFA 2KXCA 2KBTA 3M0QA 2EW3A 4HXJA 3I5RA 5GJWB 4AFZC 1WIEA 1M30A 5EC7A 2MIOA 1A0NB 2KT8A 3RBBB 2LJ1A 1MUZA 2YDLA 2DL3A 2KE9A 1WX6A 1AD5A 2D1XA 1X43A 4LUDA 2CT3A 2EBPA 1WLPB 1E7OA 3UF4A 4Z89A 2CH4W 4AFUC 2ESWA 2A28A 2VVKA 3NHNA 1OPKA 1SSHA 2M0YA 1ZX6A 2NWMA 2PNIA 4JJCA 3M0SA 3UATA 4JZ3A 4OMQA 4GLMA 2ECZA 2CREA 1UECA 2E5KA 1SEMA 1Z9ZA 4OMNA 2EVRA 1X6GA 1QWFA 3NGPA 2DRMA 1NEBA 2CUDA 1VYUA 3NMZC 4CC7A 2O88A 3R6NA 1JXMA 4J9CA 1X2KA 2O9VA 2F2XA 3ZL7C 3EG1A 2B86A 5L23A 3VS7A 2YUPA 1Z9QA 2V1QA 3H0HA 1ZUYA 3KFVA 4M4ZA 3VRYA 1JQQA 1AWJA 2GTJA 1M8MA 2JW4A 2O9SA 1BK2A 1WXTA 1PRLC 4JZ4A 2NUZA 1CSKA 3GBQA 3VS5A 3TSZA 2C0OA 5IH2A 2ED0A 2OAWA 3EGUA 4OMOA 2KYMA 2IIMA 2L2PA 2RQRA 4FSSA 4HVUA 2DNUA 2KROA 5GJVB 3TVTA 2LQWA 4RTWA 2DYBA 1GCPA 2X3XD 4ESRA 1WYXA 4J9HA 3VS0A 2RQUA 2D0NA 2ROLA 2L3SA 1AWXA 1ZBJA 4HVVA 2KYBA 1QCFA 2GGRA 2LQNA 4J9BA 2AKLA 4KRTA 4GBQA 2LMJA 2F2WA 2MCNA 2J06A 1W1FA 1SRMA 1WXBA 1KIKA 2EGAA 1ABQA 2DL7A 1I07A 3M0UA 2JTEA 2FRWA 1TG0A 4E6RA 1T0JA 3UA7A 2BZYA 1YP5A 2K79A 2LP5A 4R0KA 4JPBW 2AZSA 3C0CA 4F14A 4HCKA 3PVLA 1XOVA 2HCKA 2EYYA 2H8HA 2W10A 2RQVA 1TUDA 2RPNA 1U3OA 2J6KA 1H3HA 2CT4A 3THKA 3CQTA 2JMAA 2BZXA 1EFNA 2EKHA 4JJBA 5IHNA 2ABLA 1PWTA 2A37A 1X2QA 1YWPA 4A63B 3SHWA 1NLOC 5I11A 3IQLA 2AZVA 1ZLMA 1M3CA 5FWBA 4LUEA 4IIMA 1T0HA 2KNBB 1K0SA 1X69A 1K4US 4AFSC 1K1ZA 1GL5A 3SEMA 2HSPA 1G2BA 4HVWA 3EG0A 1NYFA 2FG0A 3I9QA 2KEAA 5ECAA 4F17A 3H41A 5IXBA 1Y0MA 1PNJA 1ZUKA 1CKBA 2D8HA 1W6XA 2OJ2A 2MOXA 1GRIA 3FJ5A 2CSQA 2JM8A 3VS3A 1I1JA 2JT4A 2SRCA 1M27C 1QKXA 1T3SA 2AK5A 3TSWA 1BBZA 2CDTA 1FYNA 1GCQA 4RTTA 2J6OA 2J05A 4D8KA 1UGVA 3QWYA 4RTZA 2DILA 1YWOA 1ZSGA 2DM1A 2DRKA 2G6FX 2YSQA 2LX7A 2YT6A 4LNPA 3ULRB 4D8DA 1PRMC 2DVJA 1AVZC 5I22A 1PKTA 2ED1A 2GQIA 1GFDA 1J3TA 2GTOA 2FPEA 1AWOA 1HD3A 2RF0A 1JEGA 1PHTA 2KR3A 4Z88A 1H92A 2RN8A 1GBQA 2KRMA 1U06A 2EGCA 2DL5A 5FWCA 4JJDA 5HCKA 3PE0A 1X27A 2DE0X 1X6BA 1UE9A 2DLPA 2EPDA 2LCSA 2L0AA 1OV3A 2KT1A 2FPDA 2LZ6B 2BTTA 2JXBA 2KGTA 2CSIA 4CC2A 1W70A 3I5SA 2W0ZA 1K76A 1AEYA 4DEYA 2AKKA 1KJWA 4RTUA 2EYWA 4J9GA 1GCQC 3PVQA 2KXDA 1MV3A 1QLYA 1UG1A 1U5SA 5IXFA 1WFWA 3M0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOT A;  4RUG A;  1UUE A;  1WDX A;  5IHI A;  4DEX A;  2EQI A;  2EYX A;  2FEI A;  2JM9 A;  5IHK A;  1PKS A;  1UJ0 A;  2K6D A;  1CKA A;  1NYG A;  2HDA A;  1NLP C;  2X3W D;  2K2M A;  3VRZ A;  3JV3 A;  3VS4 A;  2DA9 A;  1UJY A;  1SRL A;  4IIO A;  1I0C A;  2D8J A;  1YN8 A;  4J9E A;  1QKW A;  2LNH B;  2PTK A;  2RNA A;  2DX1 A;  4OMP A;  1GFC A;  1OPL A;  2DMO A;  1Y57 A;  2VWF A;  3QWX X;  2DBM A;  1UFF A;  3I35 A;  1S1N A;  2L3Q A;  1TUC A;  1RLQ C;  2RQW A;  3REB B;  1AWW A;  3VS2 A;  2V1R A;  2EGE A;  3EG3 A;  2A36 A;  1RI9 A;  1BB9 A;  2VKN A;  4Z8A A;  1SHG A;  2LJ3 A;  2KRN A;  1JXO A;  1OEB A;  2O31 A;  2P4R A;  2K3B A;  1AZE A;  1M3B A;  4Y92 A;  2CUB A;  2I0N A;  2QDL A;  3A98 A;  3REA B;  1BU1 A;  2HBW A;  1E6G A;  4ORZ A;  3U23 A;  1K0X A;  2FRY A;  4LN2 A;  2DBK A;  1HSQ A;  3RNJ A;  1VYT A;  4AFQ C;  1JO8 A;  1V1C A;  2JS2 A;  3O5Z A;  1YCS B;  1SPK A;  2L3P A;  2BZ8 A;  2HEQ A;  2YUO A;  4ZNX A;  2FO0 A;  1QWE A;  4EIK A;  2K7A A;  4K11 A;  1AOJ A;  1ARK A;  3UA6 A;  2C0T A;  1VYV A;  2YUN A;  4RTY A;  3H0F A;  4F16 A;  2O2O A;  5FW9 A;  2C0I A;  2DL8 A;  2A08 A;  2LJ0 A;  2RQT A;  3LH5 A;  3M0R A;  1GBR A;  4OML A;  1JU5 C;  2XMF A;  1WXU A;  1N5Z A;  2J6F A;  1VA7 A;  2CH4 A;  4QT7 A;  2DL4 A;  2PZ1 A;  1ZUU A;  2ENM A;  1ABO A;  1B07 A;  2K9G A;  1WA7 A;  1LCK A;  2SEM A;  1NEG A;  1UDL A;  1SHF A;  4CC4 B;  2DJQ A;  4J9F A;  3VS1 A;  1KSW A;  2YUQ A;  1H8K A;  1RLP C;  4AG2 C;  2RMO A;  1FMK A;  2OI3 A;  1RUW A;  1MV0 B;  2J7I A;  1UHF A;  3VS6 A;  1WI7 A;  1B3Q A;  4LE9 A;  1IO6 A;  2KRS A;  4OMM A;  2F2V A;  2JS0 A;  4RTX A;  4RTV A;  2ROT A;  1G83 A;  2GNC A;  4J9D A;  2M51 A;  3EHQ A;  4J9I A;  1YNZ A;  1K9A A;  3H0I A;  1HJD A;  1UHC A;  1AZG B;  2DF6 A;  4AG1 C;  2JMC A;  2EYZ A;  1NM7 A;  1KFZ A;  4WCI A;  2GBQ A;  4CC3 A;  3M0P A;  1E6H A;  1M3A A;  1UTI A;  4X1V A;  1T3L A;  1NG2 A;  3EHR A;  3EG2 A;  2FPF A;  3NPF A;  2KXC A;  2KBT A;  3M0Q A;  2EW3 A;  4HXJ A;  3I5R A;  5GJW B;  4AFZ C;  1WIE A;  1M30 A;  5EC7 A;  2MIO A;  1A0N B;  2KT8 A;  3RBB B;  2LJ1 A;  1MUZ A;  2YDL A;  2DL3 A;  2KE9 A;  1WX6 A;  1AD5 A;  2D1X A;  1X43 A;  4LUD A;  2CT3 A;  2EBP A;  1WLP B;  1E7O A;  3UF4 A;  4Z89 A;  2CH4 W;  4AFU C;  2ESW A;  2A28 A;  2VVK A;  3NHN A;  1OPK A;  1SSH A;  2M0Y A;  1ZX6 A;  2NWM A;  2PNI A;  4JJC A;  3M0S A;  3UAT A;  4JZ3 A;  4OMQ A;  4GLM A;  2ECZ A;  2CRE A;  1UEC A;  2E5K A;  1SEM A;  1Z9Z A;  4OMN A;  2EVR A;  1X6G A;  1QWF A;  3NGP A;  2DRM A;  1NEB A;  2CUD A;  1VYU A;  3NMZ C;  4CC7 A;  2O88 A;  3R6N A;  1JXM A;  4J9C A;  1X2K A;  2O9V A;  2F2X A;  3ZL7 C;  3EG1 A;  2B86 A;  5L23 A;  3VS7 A;  2YUP A;  1Z9Q A;  2V1Q A;  3H0H A;  1ZUY A;  3KFV A;  4M4Z A;  3VRY A;  1JQQ A;  1AWJ A;  2GTJ A;  1M8M A;  2JW4 A;  2O9S A;  1BK2 A;  1WXT A;  1PRL C;  4JZ4 A;  2NUZ A;  1CSK A;  3GBQ A;  3VS5 A;  3TSZ A;  2C0O A;  5IH2 A;  2ED0 A;  2OAW A;  3EGU A;  4OMO A;  2KYM A;  2IIM A;  2L2P A;  2RQR A;  4FSS A;  4HVU A;  2DNU A;  2KRO A;  5GJV B;  3TVT A;  2LQW A;  4RTW A;  2DYB A;  1GCP A;  2X3X D;  4ESR A;  1WYX A;  4J9H A;  3VS0 A;  2RQU A;  2D0N A;  2ROL A;  2L3S A;  1AWX A;  1ZBJ A;  4HVV A;  2KYB A;  1QCF A;  2GGR A;  2LQN A;  4J9B A;  2AKL A;  4KRT A;  4GBQ A;  2LMJ A;  2F2W A;  2MCN A;  2J06 A;  1W1F A;  1SRM A;  1WXB A;  1KIK A;  2EGA A;  1ABQ A;  2DL7 A;  1I07 A;  3M0U A;  2JTE A;  2FRW A;  1TG0 A;  4E6R A;  1T0J A;  3UA7 A;  2BZY A;  1YP5 A;  2K79 A;  2LP5 A;  4R0K A;  4JPB W;  2AZS A;  3C0C A;  4F14 A;  4HCK A;  3PVL A;  1XOV A;  2HCK A;  2EYY A;  2H8H A;  2W10 A;  2RQV A;  1TUD A;  2RPN A;  1U3O A;  2J6K A;  1H3H A;  2CT4 A;  3THK A;  3CQT A;  2JMA A;  2BZX A;  1EFN A;  2EKH A;  4JJB A;  5IHN A;  2ABL A;  1PWT A;  2A37 A;  1X2Q A;  1YWP A;  4A63 B;  3SHW A;  1NLO C;  5I11 A;  3IQL A;  2AZV A;  1ZLM A;  1M3C A;  5FWB A;  4LUE A;  4IIM A;  1T0H A;  2KNB B;  1K0S A;  1X69 A;  1K4U S;  4AFS C;  1K1Z A;  1GL5 A;  3SEM A;  2HSP A;  1G2B A;  4HVW A;  3EG0 A;  1NYF A;  2FG0 A;  3I9Q A;  2KEA A;  5ECA A;  4F17 A;  3H41 A;  5IXB A;  1Y0M A;  1PNJ A;  1ZUK A;  1CKB A;  2D8H A;  1W6X A;  2OJ2 A;  2MOX A;  1GRI A;  3FJ5 A;  2CSQ A;  2JM8 A;  3VS3 A;  1I1J A;  2JT4 A;  2SRC A;  1M27 C;  1QKX A;  1T3S A;  2AK5 A;  3TSW A;  1BBZ A;  2CDT A;  1FYN A;  1GCQ A;  4RTT A;  2J6O A;  2J05 A;  4D8K A;  1UGV A;  3QWY A;  4RTZ A;  2DIL A;  1YWO A;  1ZSG A;  2DM1 A;  2DRK A;  2G6F X;  2YSQ A;  2LX7 A;  2YT6 A;  4LNP A;  3ULR B;  4D8D A;  1PRM C;  2DVJ A;  1AVZ C;  5I22 A;  1PKT A;  2ED1 A;  2GQI A;  1GFD A;  1J3T A;  2GTO A;  2FPE A;  1AWO A;  1HD3 A;  2RF0 A;  1JEG A;  1PHT A;  2KR3 A;  4Z88 A;  1H92 A;  2RN8 A;  1GBQ A;  2KRM A;  1U06 A;  2EGC A;  2DL5 A;  5FWC A;  4JJD A;  5HCK A;  3PE0 A;  1X27 A;  2DE0 X;  1X6B A;  1UE9 A;  2DLP A;  2EPD A;  2LCS A;  2L0A A;  1OV3 A;  2KT1 A;  2FPD A;  2LZ6 B;  2BTT A;  2JXB A;  2KGT A;  2CSI A;  4CC2 A;  1W70 A;  3I5S A;  2W0Z A;  1K76 A;  1AEY A;  4DEY A;  2AKK A;  1KJW A;  4RTU A;  2EYW A;  4J9G A;  1GCQ C;  3PVQ A;  2KXD A;  1MV3 A;  1QLY A;  1UG1 A;  1U5S A;  5IXF A;  1WFW A;  3M0T A; 
#chains in the Genus database with same CATH topology
 3G6E A;  2MWO A;  2EQK A;  1U1S A;  5IHI A;  4BE0 A;  4R56 A;  4M7A F;  2EYX A;  3G71 A;  1PKS A;  6AT1 B;  4OGC A;  1CKA A;  1OUL A;  1VQO Q;  1M1K R;  1OQK A;  3JCM b;  3Q1J A;  2DYI A;  2ZZD A;  4LXC A;  3CC7 Q;  1I81 A;  2P0K A;  4GLK A;  4IIO A;  3P8H A;  3OY9 A;  1ACM B;  3ASK A;  1GFC A;  2QTV A;  1OPL A;  2G3R A;  2BIV A;  5GAN h;  3OS2 A;  1UFF A;  3I35 A;  4KGV B;  4FT4 A;  3RMQ A;  2MYS A;  4XTZ A;  3EG3 A;  2A36 A;  3E2U A;  3MP6 A;  4QW2 A;  1OEB A;  3EFS A;  1YFN A;  1HK9 A;  3JB9 F;  1Q86 C;  3CC2 T;  1YIJ Q;  2QDL A;  1YIT Q;  3REA B;  3QZ9 B;  4A4K A;  4ORZ A;  4Q5W A;  1BYM A;  3UDC A;  4C8Q A;  3BFM A;  4AFQ C;  1JO8 A;  4ANJ A;  4QQD A;  2DFU A;  4ZNX A;  1AHJ B;  2MWP A;  2KVQ G;  4EIK A;  2K7A A;  2RJC A;  4HCB A;  4M78 D;  3ZFJ A;  2ZAE A;  4HKE A;  2C0T A;  1YBY A;  4RTY A;  4F16 A;  3DLL A;  1UGS B;  4WTO B;  2E12 A;  2DPP B;  1JJ2 A;  4M75 D;  2RQT A;  3LH5 A;  2XMF A;  1N5Z A;  1VQM A;  1Q82 C;  2BKD N;  2PVD B;  4C5H A;  3MO8 A;  3M9Q A;  1N8R C;  2KQW A;  1YJ9 A;  1WA7 A;  1UDL A;  1M2V B;  4WF2 A;  2B8A A;  1KSW A;  1RLP C;  3CD6 T;  4Y28 E;  5KE2 A;  4AG2 C;  2XI9 A;  4J83 A;  2PVO B;  2RMO A;  3UT1 A;  3OS0 A;  2JOY A;  1YI2 A;  2VGM A;  1RUW A;  4L5G A;  1Y07 A;  2XDP A;  4FM4 B;  2L8D A;  4BUG A;  1IO6 A;  1KQS P;  2JS0 A;  4C8Q C;  4RTV A;  1LNX A;  4M7A G;  2M51 A;  3EHQ A;  4J9I A;  2RHX A;  1VIF A;  3CCE Q;  2X4W A;  1K9A A;  3LWH A;  1HJD A;  1AZG B;  2RK1 A;  1NJI U;  3M57 A;  4UC4 A;  2EQJ A;  2VXF A;  1QVF P;  1VQ9 A;  1QMC A;  4QVD A;  2GBQ A;  4ZN1 A;  3CC4 T;  1NG2 A;  3EG2 A;  5CR2 A;  1QP3 A;  2FPF A;  2KXC A;  2NLU A;  3P8B B;  2COW A;  2RO0 A;  4ZGJ B;  2M0O A;  5LJ3 e;  1QCO A;  5GMK j;  4X9D A;  4IUQ A;  4C8Q F;  3RBB B;  3L2V A;  5DY9 A;  2QA4 A;  2LJ1 A;  2YDL A;  2DL3 A;  1YJW A;  1WX6 A;  2VGN A;  1VQ4 Q;  1AD5 A;  2D1X A;  4F7U F;  2CT3 A;  4J7F A;  3JB9 G;  3QHS A;  1JB0 E;  4HCC A;  2FYK A;  2PNI A;  3EH2 A;  3CCL Q;  4JJC A;  4JZ3 A;  3P8D A;  2V26 A;  3CBP A;  4EMK B;  1VQ6 Q;  1PG5 B;  3A5Z B;  3V7R A;  2DRM A;  1NE8 A;  2CZ1 B;  3MKD A;  3QSU A;  1OI1 A;  3HL8 A;  1VQ5 Q;  5GMK m;  2K5L A;  1JXM A;  4FYX B;  5GAN 4;  1AT1 B;  3TQ7 P;  3ZL7 C;  3EG1 A;  2QQB A;  1Z9Q A;  1C1A A;  5GAM g;  1KQS S;  2EFI A;  4AT1 B;  2VYT A;  4HA8 A;  2K57 A;  1OYX A;  4ELY C;  1YJN A;  1PD0 A;  1M2V A;  5GAN 2;  1D1B A;  2GTJ A;  2K2V A;  2RB6 A;  4M7A E;  1BK2 A;  4BDY A;  4M78 C;  4MML A;  1KD1 R;  1QVF S;  1FX7 A;  2C0O A;  5LJ3 f;  1I5O B;  4M75 C;  2C06 A;  1N9R A;  4FSS A;  4HVU A;  5GMK l;  1JRI A;  2EIF A;  1KC8 U;  2CGH A;  3MET A;  1WJS A;  1OU9 A;  4J9H A;  5CCA A;  3OYJ A;  2A3L A;  3V7S A;  4FW1 A;  2RQU A;  2ROL A;  2KYB A;  1YCY A;  2LQN A;  5FRO A;  2RHY A;  1MNE A;  1KC8 R;  4KRT A;  4GBQ A;  3CPW A;  2DJZ A;  2MCN A;  1Q7Y C;  1K73 U;  2EJ9 A;  1WXB A;  2OTL A;  1ABQ A;  2BUD A;  2DL7 A;  3JCM g;  1I07 A;  1IRX A;  3M0U A;  5GMK h;  3I56 A;  3NTI A;  1ZHI A;  5I2M A;  4J8O A;  2ZCF B;  2KSS A;  4R0K A;  1RAA B;  3GNF B;  3LX7 A;  2IVW A;  3HRU A;  2H8H A;  1I5L A;  4F7U G;  2GFU A;  4ZN3 A;  1U3O A;  3PFS A;  3THK A;  2ZGW A;  3CQT A;  1D1A A;  1K9M C;  3DLM A;  1YHQ Q;  2BZX A;  3OYB A;  1EFN A;  2IPO B;  2DET A;  4EMK A;  2LNV A;  3G4S Q;  2A37 A;  1KQ1 A;  1PCX A;  2GF7 A;  5I11 A;  1OU8 A;  1ZLM A;  3DB3 A;  4IIM A;  1K0S A;  1X69 A;  2OTJ T;  1K1Z A;  4OP0 A;  3JCM d;  3HKS A;  1NYF A;  2KEA A;  3FIF A;  1TSF A;  1WQ7 A;  2YLB A;  2RHI A;  4RCB A;  5IXB A;  1ZUK A;  3VV0 A;  1VQ8 Q;  2MOX A;  1GRI A;  2JM8 A;  4VUB A;  1VQL T;  3RUX A;  4KGX B;  1I1J A;  2PU9 B;  3CEY A;  1XQH A;  1T3S A;  2AK5 A;  3SB2 A;  3OYL A;  1VQP Q;  1BBZ A;  1GCQ A;  1W2B A;  2J6O A;  1WPY A;  3I55 A;  1WQW A;  1G3T A;  1ZSG A;  4E7H A;  2CP0 A;  2YSQ A;  3H9N A;  4DBQ A;  4IKF A;  2XD0 A;  5GAO n;  3UPU A;  1WHH A;  3F70 A;  3RIR A;  3UWN A;  3VYH B;  3GNG A;  3L2W A;  1JEG A;  1WHK A;  4C5I A;  3M56 A;  1D3B B;  2RN8 A;  4J5Y A;  1GBQ A;  3RES A;  4F7U E;  3G71 T;  3MCA B;  4M7A D;  4OB1 B;  3LWI A;  5HCK A;  3MJX A;  1X27 A;  4XU1 A;  3RDV A;  4JLG A;  1VQN A;  1HYO A;  5KYU B;  2KGT A;  2CSI A;  4CC2 A;  4KUD K;  1UGQ B;  1R77 A;  2P84 A;  3I5S A;  1AEY A;  2AKK A;  4OB0 B;  2EYW A;  4J9G A;  1GCQ C;  3PVQ A;  4OVA A;  1KG1 A;  3OYF A;  3A8H B;  3VUZ A;  2K5I A;  3OB9 A;  3M0T A;  3CCQ Q;  2VB6 A;  2JZ2 A;  2VAS A;  3GP8 A;  3HPW A;  4FYV B;  1WDX A;  4KH1 B;  5KCO A;  3JB9 D;  1G8X A;  4BI3 A;  2JM9 A;  5IHK A;  1KQS A;  1VIE A;  1VQL Q;  2K6D A;  3CPF A;  2HDA A;  3FRN A;  2OX7 A;  2X3W D;  2VC8 A;  2K2M A;  3VRZ A;  5GMK i;  2DA9 A;  4MZT A;  1SRL A;  2NUT B;  3OBY A;  1I4K 1;  1YN8 A;  3QYH B;  4J9E A;  1QW1 A;  2RNA A;  3C95 A;  2RA2 A;  4OF1 A;  5CKD A;  2KAF A;  2DMO A;  1V76 A;  1KHI A;  2VWF A;  1X75 C;  2DBM A;  3PMI A;  3GOX A;  3REB B;  2L3Q A;  1ZA2 B;  2EGE A;  4DOV A;  2LT1 A;  1QCN A;  1VQM T;  1Q81 C;  4Z8A A;  1SHG A;  2K3B A;  1RL2 A;  2HKQ B;  3HFN A;  1AZE A;  4JRK A;  5CKB A;  1YJ9 T;  2CUB A;  2I0N A;  1N6A A;  5GAM j;  2QXF A;  1BU1 A;  2CP6 A;  2E3I A;  1E6G A;  4PK4 A;  3U23 A;  1K0X A;  2FRY A;  4LN2 A;  2PUO B;  1YI2 T;  1D3B A;  4ZGD B;  2JS2 A;  5IAY A;  2DTI A;  1YCS B;  1OX9 A;  1KHC A;  1S72 A;  2HEQ A;  4J6W A;  2F5K A;  3RMS A;  2QEX Q;  3M54 A;  4Y91 A;  1BI0 A;  1ARK A;  2XDD A;  3CCR A;  5KYU A;  2AT1 B;  2E5Q A;  2O2O A;  2JN0 A;  2MMP A;  3NTK A;  4L6V 5;  5FW9 A;  1VQ9 T;  2E41 A;  2DL8 A;  4F7U B;  2LJ0 A;  5CQX A;  3LLR A;  2F5T X;  1GBR A;  1JU5 C;  2J6F A;  3J7A F;  1M8V A;  2DL4 A;  2PZ1 A;  1WHJ A;  4GY5 A;  4A4H A;  4XU0 A;  1ABO A;  4M7A C;  4JDS A;  3CCQ A;  1M90 C;  2YRD A;  4JRI A;  4J9F A;  4OB2 B;  2QA4 T;  1H8K A;  1YJW T;  3OYN A;  4PJL A;  3CME Q;  1FMK A;  2VUB A;  3CCJ Q;  4KUI A;  4IUR A;  2ZPH B;  1IZ6 A;  2NYS A;  4PLI A;  1UHF A;  3CMA Q;  2RHZ A;  1WI7 A;  1BI3 A;  1IGQ A;  4DBH A;  2FHD A;  2F2V A;  4RTX A;  2ROT A;  2YRV A;  4C92 B;  2GNC A;  4C5G A;  4J9D A;  1K8A C;  4FW2 A;  1RAE B;  1YNZ A;  4NS5 A;  2YXY A;  1M1K U;  3CCU A;  2NUT A;  5D6X A;  4N0A A;  2QYZ A;  1VQ7 A;  1UHC A;  5CKH A;  2A0F B;  4BE2 A;  2JMC A;  2MI6 A;  1NM7 A;  1QVG A;  4XU3 A;  2COZ A;  3PIP A;  1E6H A;  1M3A A;  2DTO A;  2LRQ A;  2GFA A;  3OW2 P;  1VQK A;  2DXT A;  2EW3 A;  3I5R A;  4EMG A;  3CCV Q;  5KYN A;  1EZZ B;  1M30 A;  2MF2 A;  2L3R A;  1A0N B;  3VU3 C;  4II1 A;  1MUZ A;  3FEO A;  3BY7 A;  3HRT A;  2KE9 A;  3L1A A;  2LX9 A;  5LL6 S;  4LD6 A;  1YJN T;  1X43 A;  2DZ9 A;  5GAM h;  1WLP B;  1SG5 A;  3CXC A;  3NHN A;  5I21 A;  2LQK A;  1U8R A;  1SSH A;  2M0Y A;  1WGS A;  2NWM A;  5FU7 B;  4E7K A;  1K73 C;  3HRS A;  3BW1 A;  2M02 A;  4HT9 A;  3QZ5 B;  1SEM A;  3NFC A;  1WHL A;  1X6G A;  1QWF A;  3LYI A;  1WJR A;  3NGP A;  1NEB A;  2CUD A;  3NMZ C;  4B9X A;  3CCS A;  3OQ5 A;  1GXI E;  2O4X B;  3EFR A;  1X2K A;  2O9V A;  4F7U A;  5FU6 B;  3VS7 A;  2V1Q A;  2RHU A;  2RK2 A;  3GIB A;  2XK0 A;  2OTL T;  4B9W A;  3QBY A;  3WVE B;  3X20 B;  1BCM A;  4M4Z A;  2HL5 C;  1AWJ A;  3I56 T;  2JW4 A;  1UEB A;  2O9S A;  3CME A;  4JZ4 A;  3A8L B;  3GBQ A;  4PLL A;  3JCM h;  1PM3 A;  3VS5 A;  4BB7 A;  4EMH A;  4OMO A;  3VYG A;  3JB9 I;  2IIM A;  2MK5 A;  3OYE A;  2RQR A;  3OW2 S;  2HBP A;  4BI4 A;  4C92 A;  1NZ9 A;  2DIG A;  2DNU A;  5GJV B;  4TVR A;  2LQW A;  3FC3 A;  2X9H A;  1GCP A;  3FLG A;  3RR6 A;  1WYX A;  3VS0 A;  4HVV A;  1ZBJ A;  2ZPG B;  1M9S A;  1QCF A;  2M1H A;  3PMT A;  3X26 B;  1VQO A;  5GMK e;  2AKL A;  4XQ3 A;  2YRC A;  1W1F A;  2EJF A;  3OSS C;  3CC7 A;  4PJJ A;  1PC0 A;  2FRW A;  1T0J A;  1F1B B;  1YP5 A;  2KMT A;  4CI0 C;  2LP5 A;  3JCM X;  4JPB W;  3C0C A;  3CC2 Q;  1DJ7 B;  4F14 A;  3PVL A;  5KH6 A;  2EYY A;  2RQV A;  1TUD A;  1UB4 A;  1H3H A;  1EIF A;  1YIJ A;  1Q81 R;  5KYX B;  3WVD B;  3I55 T;  1YIT A;  4JJB A;  5IHN A;  2XDB A;  2WSC E;  1PWT A;  3L2Q A;  4A63 B;  1ZSZ B;  3E19 A;  2DER A;  9ATC B;  1H3Z A;  2AZV A;  5FWB A;  2O4X A;  5A0G A;  2GCX A;  2BE7 D;  2KNB B;  1K4U S;  3A1P A;  1GL5 A;  2CZ0 B;  2QK0 A;  2Y90 A;  4ZTJ A;  3EG0 A;  5LJ5 d;  3H41 A;  1Y0M A;  1PNJ A;  3OYC A;  4L59 A;  3H6Z A;  2XKO C;  3DB4 A;  2CSQ A;  3PTA A;  4C92 F;  1Q95 G;  2JT4 A;  3OYH A;  1M27 C;  1QKX A;  3CBM A;  1KD1 U;  4IUU A;  3CD6 Q;  2CDT A;  2ZPI B;  2DXB A;  3VKI A;  1KK7 A;  2E10 A;  3HHT B;  4RTT A;  2QQA A;  4D8K A;  3QWY A;  4RTZ A;  5FU7 C;  5M9O A;  2DM1 A;  4E2F B;  1MHN A;  4LNP A;  1M90 R;  1BCO A;  4DOW A;  3NTH A;  5J26 A;  3CCM T;  1V29 B;  4O6J A;  1M4Z A;  1PKT A;  2RJD A;  2GQI A;  1J3T A;  1HD3 A;  1PD1 A;  1RAG B;  3OYK A;  1H92 A;  3CCE A;  3CC4 Q;  4XTW A;  3X28 B;  1RAD B;  5HK0 A;  2KRM A;  1U06 A;  1BI1 A;  2EGC A;  5FWC A;  3MEU A;  2DIQ A;  3PE0 A;  4KBM B;  2DE0 X;  1X6B A;  2DLP A;  4RG2 A;  2L0A A;  2E6Z A;  3CC2 A;  1OV3 A;  2HKN A;  4FL6 A;  5J39 A;  4JS4 A;  3S3M A;  3HSB A;  3WXM B;  1KJW A;  5HY6 A;  3JCM P;  5KYX A;  1VQ4 A;  2CP5 A;  1MV3 A;  3JSC A;  4LD9 K;  2KI7 A;  1UG1 A;  5IXF A;  3GF5 A;  1ZSZ A;  2HQH A;  2ZPF B;  5GAN d;  3CCL A;  4C0F A;  2HZY A;  3OBW A;  1OOT A;  2JTM A;  4J7I A;  4RUG A;  1UUE A;  1VQ6 A;  4C0D B;  2D6F A;  1UJ0 A;  3N5B B;  4E7J A;  1Q86 R;  1S72 T;  4M77 F;  1VQ5 A;  2FZC B;  1W4S A;  2OAU A;  4C0G A;  3ER0 A;  1TTH B;  2EQM A;  5CKF A;  2D8J A;  5DLO A;  3GLX A;  1TUG B;  2LNH B;  2PTK A;  2IG0 A;  2DX1 A;  4XK8 E;  4OMP A;  3CD6 A;  1Y57 A;  4C92 G;  5J3B A;  3CCM Q;  4PFZ A;  4ZTF A;  3OYI A;  2PQW A;  1S1N A;  3SD4 A;  1TUC A;  1RLQ C;  5C6S A;  1M1F A;  2V1R A;  3X25 B;  2HAX A;  4KT0 E;  3V8J A;  1RI9 A;  2VKN A;  2E4H A;  4PJO G;  3RKY A;  2KRN A;  4M7D B;  1JXO A;  2JNG A;  2QTX A;  4LDY A;  2R57 A;  1M1K C;  1WJQ A;  1M3B A;  4A4E A;  3A98 A;  3TCJ A;  5L8R E;  1OX8 A;  2E64 A;  1Q82 R;  1HSQ A;  3RNJ A;  1V1C A;  2CYZ B;  1N8R R;  2L3P A;  3QYG B;  2BZ8 A;  2YUO A;  2FO0 A;  1QWE A;  4EMK C;  2RJE A;  4K11 A;  5CAI A;  5GAO m;  1QVP A;  4XTU A;  1FXX A;  1VYV A;  2HSE B;  2JTF A;  2YUN A;  3CCU T;  3G6E T;  1VQ7 T;  5GAO r;  1G3W A;  4D6W A;  1MGQ A;  3EG9 B;  1BIB A;  3MHX A;  5I2S A;  5FRM A;  2A08 A;  1WXU A;  1BKB A;  2WSE E;  4QT7 A;  3OMC A;  1VQK T;  1NPR A;  2DD4 A;  3KBG A;  4HT8 A;  2K9G A;  1PSE A;  1H64 1;  3SDZ A;  4CC4 B;  3VS1 A;  2V8I A;  2YUQ A;  4M78 G;  4X34 A;  3MP1 A;  1O75 A;  2HMA A;  3S6W A;  5GAN 8;  1YHQ A;  5LJ5 j;  2P4T A;  3M4Y A;  5GAO l;  2DK3 A;  3VS6 A;  5CKE A;  4LE9 A;  3G4S A;  2KRS A;  4XTY A;  4M75 G;  1KQ2 A;  2OTJ Q;  4C92 E;  4PNO A;  1G83 A;  4PFP A;  2LC4 A;  3E1S A;  2MAM A;  3G7Z A;  2LDM A;  2D9T A;  2RI3 A;  3H0I A;  1XJW B;  1LVK A;  4M77 G;  1OZ3 A;  2EYZ A;  2PUK B;  1KFZ A;  3QJ6 A;  1UTI A;  1T3L A;  2HD0 A;  3H8Z A;  1VOM A;  2KBT A;  1VQ8 A;  2RJF A;  3M0Q A;  4HXJ A;  5GAM e;  4AFZ C;  1WIE A;  1LOJ A;  1R0B G;  4M7D A;  5EC7 A;  1QVF A;  2MIO A;  2KT8 A;  4RMO A;  1VQP A;  4BI8 B;  1TOV A;  2XID A;  3PGG A;  1D0Z A;  2EBP A;  1E7O A;  3UF4 A;  2CH4 W;  2VVK A;  3LW5 E;  3JRZ A;  1OPK A;  1ZX6 A;  3G6E Q;  2ATC B;  2KDS A;  3JCM Q;  4DBR A;  4NL3 A;  2CRE A;  1UEC A;  3G71 Q;  3OA6 A;  1NJI C;  3JCM c;  3FJP A;  2FZG B;  4E47 A;  2H3E B;  1VYU A;  3OYD A;  3EG9 A;  2O88 A;  2X4Y A;  3R6N A;  4FYY B;  1X01 A;  4J9C A;  1D0X A;  2B86 A;  1OZ2 A;  1VQO T;  5EG2 A;  4EPC A;  2YUP A;  2LQ8 A;  4FSX A;  3H0H A;  1ZUY A;  2M9U A;  3JCM e;  5GAN j;  3AHU A;  4XAX B;  1UGP B;  3VRY A;  1JQQ A;  1M8M A;  4MMK A;  3OYG A;  2NUZ A;  1CSK A;  4DBF A;  1Q7Y R;  1TS9 A;  5GAM f;  4MDX A;  1WZO A;  3TSZ A;  5LJ5 h;  2RI5 A;  2OAW A;  1Y7X A;  4M77 E;  4E7S A;  2KYM A;  2DO3 A;  2ZPB B;  3V7C A;  2L2P A;  3FDR A;  3QKJ A;  3CPW P;  3R6O A;  1LPL A;  4XU2 A;  1UGR B;  2DYB A;  1K9M U;  1YIJ T;  1G3Y A;  1YIT T;  4Z02 A;  1AWX A;  3AT1 B;  2LT4 A;  2GGR A;  4DA4 A;  1VQL A;  3QDF A;  4NOY A;  2P0P A;  4J9B A;  4M7D F;  1K9M R;  2F2W A;  2QAZ A;  2J06 A;  1KD1 C;  5LJ3 d;  2COY A;  1KIK A;  2EGA A;  4J6Y A;  2P0Q A;  2JTE A;  5KYW B;  2QAS A;  4PJO B;  4E6R A;  3ZEH A;  3UA7 A;  2BZY A;  1M5Q 1;  1ZQ1 A;  1VQM Q;  2CP3 A;  2DZC A;  2AZS A;  4HCK A;  2QI2 A;  1YJ9 Q;  3JCM f;  2Y4X A;  4E7I A;  1XOV A;  4QKU A;  2W10 A;  1Y71 A;  1D09 B;  2I2L A;  2RPN A;  4C92 D;  2LTO A;  4BY6 B;  1KC8 C;  1YI2 Q;  2JMA A;  2HL3 A;  3ME9 A;  4O5V A;  2EKH A;  1O9S A;  2ABL A;  2CKK A;  4PJO D;  1X2Q A;  1B34 B;  1NLO C;  8AT1 B;  2DXU A;  1B7T A;  2JJ9 A;  4JUV A;  2R5A A;  2QQ9 A;  2DEU A;  2E65 A;  4LUE A;  1T0H A;  4BD3 A;  2QEX A;  4ZGE B;  4AFS C;  3SEM A;  2X35 A;  3V8K A;  3URG A;  1VQ9 Q;  2QQR A;  5ECA A;  3CPW S;  3CCE T;  4LDV A;  5GAN 3;  2QQS A;  1W2B P;  2RH2 A;  1CKB A;  2FL7 A;  2D8H A;  4N0A C;  4MZP A;  3VS3 A;  2HQX A;  4PFO A;  4M78 B;  2Y4Y A;  2SRC A;  2QA4 Q;  4CRI A;  4PJN A;  2DD5 A;  3QJY A;  1YJW Q;  2XU8 A;  3TSW A;  1FYN A;  4LDX A;  3LH0 A;  3C4S A;  2CZ6 B;  5HKC A;  4A54 A;  4M75 B;  3GPL A;  1IB8 A;  3OYY A;  2DRK A;  2VXE A;  2LX7 A;  3ULR B;  4D8D A;  1D0Y A;  1VQ4 T;  1PRM C;  3CCJ A;  1AVZ C;  1SSF A;  5I22 A;  2ZPE B;  3CMA A;  2ED1 A;  4M77 B;  3DKM A;  4JRP A;  3CCL T;  2FPE A;  1AWO A;  2RF0 A;  3E9F A;  4YTL A;  2HQE A;  1PHT A;  2R58 A;  4FT2 A;  3M53 A;  4M7D G;  1VQ6 T;  5KYW A;  3OS1 A;  5HK3 A;  3QG1 A;  4PJO A;  5FRN A;  1XNI A;  4JJD A;  2R5M A;  1VQ5 T;  1UE9 A;  3L42 A;  2LCS A;  3INZ A;  1I8F A;  4N4H A;  4PKC C;  4M77 D;  2FPD A;  2LZ6 B;  2X51 A;  2JXB A;  4A4F A;  1YJN Q;  3HFO A;  3CCV A;  1U1T A;  1W70 A;  2LCL A;  5LJ5 g;  5A0D A;  2K3X A;  1NPP A;  1W2B S;  1XTD A;  4N4G A;  1Q81 U;  1N9S A;  1B34 A;  2V8K A;  1WFW A;  2XIC A;  2EQU A;  2QGG A;  2LCC A;  4DEX A;  3J80 E;  3MEW A;  3C94 A;  2EQI A;  8ATC B;  1BI2 A;  2FEI A;  2FVU A;  4C92 C;  1NYG A;  1NLP C;  1R0C B;  4KGZ B;  2GQV A;  4P5N A;  3JV3 A;  3VS4 A;  5A0L A;  2OTL Q;  1NJI R;  3EH1 A;  1UJY A;  4PJO C;  4MZM A;  2FB7 A;  1I0C A;  2F69 A;  4M78 A;  1QKW A;  3I56 Q;  5IN1 A;  3QWX X;  1RAI B;  2RQW A;  1AWW A;  4M75 A;  3VS2 A;  5KYY B;  2A7Y A;  4BY6 C;  4OMF B;  5KE3 A;  1BB9 A;  2LJ3 A;  4M7D E;  2O31 A;  1VQN T;  2P4R A;  3EGD B;  3T9N A;  1M90 U;  4M77 A;  4Y92 A;  3M58 A;  2EJG A;  3OMG A;  5LJ3 j;  2HBW A;  4PJO F;  3EGX B;  2DBK A;  2RI2 A;  2AIR B;  1VYT A;  3L2Z A;  1YHQ T;  3O5Z A;  4XTV A;  5DLQ E;  1SPK A;  3G4S T;  1G3S A;  2E1H A;  4RG8 A;  3JCM W;  5GAN g;  1AOJ A;  1K8A U;  3UA6 A;  2XHC A;  3H0F A;  1HXD A;  5GAN 5;  5FU6 C;  1QQJ A;  2C0I A;  4PL6 A;  4FCY A;  3M0R A;  4MDW A;  4OML A;  3E9G A;  1K8A R;  2EAY A;  2JVV A;  1ZA1 B;  4C5E A;  1VA7 A;  4RKU E;  2CH4 A;  3O8V A;  1VQ8 T;  2WSF E;  1ZUU A;  2EYQ A;  2ENM A;  1B07 A;  1LCK A;  2SEM A;  1TU0 B;  1NEG A;  3LGF A;  1SHF A;  3I55 Q;  2DJQ A;  1JBM A;  2YLC A;  1VQP T;  2OI3 A;  4BAC A;  3PNW C;  4IUP A;  4M77 C;  1MV0 B;  3A8M B;  2J7I A;  7AT1 B;  5GAN 6;  1QVG P;  3JB9 J;  1B3Q A;  2NUP B;  4OMM A;  4M78 F;  4XTX A;  5GAM d;  4ELZ C;  2V8J A;  1Q86 U;  4M75 F;  2K3Y A;  2DF6 A;  4AG1 C;  4JS5 A;  3A8G B;  5CQY A;  3KUF A;  4ATO A;  4WCI A;  1K73 R;  4CC3 A;  4PJM A;  3M0P A;  4B6M A;  1R8O B;  4X1V A;  3EHR A;  1VQN Q;  4C8Q G;  3NPF A;  2X4X A;  4J6X A;  5KYY A;  4V2S A;  3CBO A;  1N27 A;  2QG9 B;  4QQ6 A;  3CXC P;  5GJW B;  3L2U A;  4QVC A;  1TH7 A;  3EGD A;  3RER A;  4R55 A;  1MND A;  3VUB A;  3CCR T;  4E7Z A;  4LUD A;  2HNI A;  5LJ3 h;  1Y96 B;  4Z89 A;  3EGX A;  4OGE A;  4AFU C;  3OW2 A;  3JCM J;  2ESW A;  2A28 A;  3EFO B;  2QGF B;  2EWN A;  2WAC A;  3JB9 H;  1NBE B;  2JUF A;  1Q82 U;  3M0S A;  3UAT A;  5DM7 R;  4OMQ A;  3OYM A;  3M55 A;  1MMG A;  4GLM A;  2L89 A;  1N8R U;  2ECZ A;  3PIO A;  3CCQ T;  2E5K A;  2KY9 A;  1ZSZ C;  1Z9Z A;  1TWB A;  2EVR A;  4IUV A;  4OMN A;  2YWW A;  3OYA A;  4FIB A;  3CC4 A;  3J81 E;  4CC7 A;  3TEE A;  5C0M A;  1ZBX A;  2PVG B;  1IRE B;  3A8O B;  3M5A A;  2F2X A;  1P92 A;  5L23 A;  1JJ2 P;  1QVG S;  1WHG A;  2DTH A;  5KCH A;  3KFV A;  3S3O A;  4QVZ A;  4M7D D;  2RM4 A;  1MMD A;  1LJO A;  5LJ5 e;  5CO7 A;  5FLX E;  1RAH B;  2DXC A;  2DAQ A;  4KUL A;  4M7A B;  3SWN B;  4DQ2 A;  3EAE A;  1WXT A;  4BE1 A;  1PRL C;  1MMA A;  5CVI A;  5IH2 A;  2ED0 A;  1IHV A;  4JRQ A;  5AYF A;  3EGU A;  2K5F A;  2NUP A;  3QUI A;  3RKW A;  3QPH A;  2KRO A;  3CXC S;  4C8Q E;  3TVT A;  1SKU B;  4F04 B;  4RTW A;  2X3X D;  3D7S B;  4ESR A;  1C0M A;  1S72 Q;  1MMN A;  2D0N A;  2L3S A;  2CZ7 B;  1FMV A;  4N4I A;  4OB3 B;  2O01 E;  2E6N A;  2LMJ A;  2F1L A;  2QEX T;  3CCR Q;  1SRM A;  3MPU B;  4LDU A;  5AT1 B;  3BE3 A;  4A53 A;  3HP9 A;  3RKX A;  3TU4 K;  1TG0 A;  4PJO E;  4KH0 B;  1VUB A;  2K79 A;  5GAO p;  5D7U A;  3CCM A;  3CCS T;  2CP2 A;  1Y96 A;  4NL2 A;  2CP7 A;  4FU6 A;  3EFO A;  3PT9 A;  2HCK A;  5CIU A;  5A2Q E;  1QP2 A;  1JJ2 S;  2BE9 B;  5LJ5 f;  3S3N A;  2J6K A;  1EX4 A;  2AHJ B;  2CT4 A;  3OSV A;  4E7L A;  4BDZ A;  2VV5 A;  3C12 A;  3BDL A;  3CME T;  1YWP A;  3SHW A;  1M1G A;  3CCJ T;  5GAO q;  4JLI A;  3IQL A;  3TRE A;  3L2R A;  1M3C A;  3CMA T;  5GAN e;  2E70 A;  3CCU Q;  1VQ7 Q;  3QDR B;  4JJN K;  4C0D C;  4HCZ A;  2HSP A;  1G2B A;  4HVW A;  1FWZ A;  2FG0 A;  3I9Q A;  4F17 A;  2CS7 A;  2KK4 A;  4X9C A;  4EDU A;  5D6Y A;  3ZBD A;  1W6X A;  2OJ2 A;  3SWN A;  1VQK Q;  4M7A A;  3FJ5 A;  3VJP A;  2X4J A;  1C6V X;  4M78 E;  5D6W A;  1Q7Y U;  2DKG A;  2K4Y A;  1RAB B;  5LJ3 g;  3QXE B;  3CC7 T;  3M59 A;  3CCV T;  3M4G A;  4RCC A;  2J05 A;  2L5Q A;  1UGV A;  4M75 E;  3BDU A;  3JAM E;  1RI0 A;  2DIL A;  1YWO A;  1G5V A;  2G6F X;  2H3J A;  2YT6 A;  2DEQ A;  4M7D C;  2DVJ A;  3MP8 A;  3HTR A;  4A4G A;  2LVM A;  1TXQ A;  4FYW B;  1RAC B;  1WHM A;  2Z0W A;  3V8L A;  1IXD A;  1GFD A;  1FMW A;  2DVE A;  2RD1 A;  2GTO A;  2OTJ A;  4ME7 A;  2KR3 A;  4Z88 A;  4C8Q B;  3OS5 A;  5GAN 7;  1WNL A;  3LGL A;  3CCS Q;  1RAF B;  1PSF A;  5CK9 A;  1SF9 A;  2DL5 A;  5GAN f;  3G1J A;  2M16 A;  1BIA A;  3MEA A;  2EPD A;  2KT1 A;  4C0Z A;  3SWN C;  4AMC A;  2BTT A;  4LDW A;  2XG8 D;  2D0Q B;  4IUT A;  2QDY B;  2W0Z A;  5IT9 E;  1IGU A;  1K76 A;  4DEY A;  4C8Q D;  2YHT A;  1IHW A;  4RTU A;  2KXD A;  1QLY A;  2MPX C;  3QO3 A;  3QII A;  3KXT A;  1U5S A;  1D1C A;  3SFM A;  1M2O A;  2EKO A;  1X6O A;  3JCM V;  2FZK B;  3FB9 A;  4QQG A;  3MEV A;  2E3H A;  3X24 B; 
#chains in the Genus database with same CATH homology
 1OOT A;  4RUG A;  1UUE A;  1WDX A;  5IHI A;  4DEX A;  2EQI A;  2EYX A;  2FEI A;  2JM9 A;  5IHK A;  1PKS A;  1UJ0 A;  2K6D A;  1CKA A;  1NYG A;  2HDA A;  1NLP C;  2X3W D;  2K2M A;  3VRZ A;  3JV3 A;  3VS4 A;  2DA9 A;  1UJY A;  1SRL A;  4IIO A;  1I0C A;  2D8J A;  1YN8 A;  4J9E A;  1QKW A;  2LNH B;  2PTK A;  2RNA A;  2DX1 A;  4OMP A;  1GFC A;  1OPL A;  2DMO A;  1Y57 A;  2VWF A;  3QWX X;  2DBM A;  1UFF A;  3I35 A;  1S1N A;  2L3Q A;  1TUC A;  1RLQ C;  2RQW A;  3REB B;  1AWW A;  3VS2 A;  2V1R A;  2EGE A;  3EG3 A;  2A36 A;  1RI9 A;  1BB9 A;  2VKN A;  4Z8A A;  1SHG A;  2LJ3 A;  2KRN A;  1JXO A;  1OEB A;  2O31 A;  2P4R A;  2K3B A;  1AZE A;  1M3B A;  4Y92 A;  2CUB A;  2I0N A;  2QDL A;  3A98 A;  3REA B;  1BU1 A;  2HBW A;  1E6G A;  4ORZ A;  3U23 A;  1K0X A;  2FRY A;  4LN2 A;  2DBK A;  1HSQ A;  3RNJ A;  1VYT A;  4AFQ C;  1JO8 A;  1V1C A;  2JS2 A;  3O5Z A;  1YCS B;  1SPK A;  2L3P A;  2BZ8 A;  2HEQ A;  2YUO A;  4ZNX A;  2FO0 A;  1QWE A;  4EIK A;  2K7A A;  4K11 A;  1AOJ A;  1ARK A;  3UA6 A;  2C0T A;  1VYV A;  2YUN A;  4RTY A;  3H0F A;  4F16 A;  2O2O A;  5FW9 A;  2C0I A;  2DL8 A;  2A08 A;  2LJ0 A;  2RQT A;  3LH5 A;  3M0R A;  1GBR A;  4OML A;  1JU5 C;  2XMF A;  1WXU A;  1N5Z A;  2J6F A;  1VA7 A;  2CH4 A;  4QT7 A;  2DL4 A;  2PZ1 A;  1ZUU A;  2ENM A;  1ABO A;  1B07 A;  2K9G A;  1WA7 A;  1LCK A;  2SEM A;  1NEG A;  1UDL A;  1SHF A;  4CC4 B;  2DJQ A;  4J9F A;  3VS1 A;  1KSW A;  2YUQ A;  1H8K A;  1RLP C;  4AG2 C;  2RMO A;  1FMK A;  2OI3 A;  1RUW A;  1MV0 B;  2J7I A;  1UHF A;  3VS6 A;  1WI7 A;  1B3Q A;  4LE9 A;  1IO6 A;  2KRS A;  4OMM A;  2F2V A;  2JS0 A;  4RTX A;  4RTV A;  2ROT A;  1G83 A;  2GNC A;  4J9D A;  2M51 A;  3EHQ A;  4J9I A;  1YNZ A;  1K9A A;  3H0I A;  1HJD A;  1UHC A;  1AZG B;  2DF6 A;  4AG1 C;  2JMC A;  2EYZ A;  1NM7 A;  1KFZ A;  4WCI A;  2GBQ A;  4CC3 A;  3M0P A;  1E6H A;  1M3A A;  1UTI A;  4X1V A;  1T3L A;  1NG2 A;  3EHR A;  3EG2 A;  2FPF A;  3NPF A;  2KXC A;  2KBT A;  3M0Q A;  2EW3 A;  4HXJ A;  3I5R A;  5GJW B;  4AFZ C;  1WIE A;  1M30 A;  5EC7 A;  2MIO A;  1A0N B;  2KT8 A;  3RBB B;  2LJ1 A;  1MUZ A;  2YDL A;  2DL3 A;  2KE9 A;  1WX6 A;  1AD5 A;  2D1X A;  1X43 A;  4LUD A;  2CT3 A;  2EBP A;  1WLP B;  1E7O A;  3UF4 A;  4Z89 A;  2CH4 W;  4AFU C;  2ESW A;  2A28 A;  2VVK A;  3NHN A;  1OPK A;  1SSH A;  2M0Y A;  1ZX6 A;  2NWM A;  2PNI A;  4JJC A;  3M0S A;  3UAT A;  4JZ3 A;  4OMQ A;  4GLM A;  2ECZ A;  2CRE A;  1UEC A;  2E5K A;  1SEM A;  1Z9Z A;  4OMN A;  2EVR A;  1X6G A;  1QWF A;  3NGP A;  2DRM A;  1NEB A;  2CUD A;  1VYU A;  3NMZ C;  4CC7 A;  2O88 A;  3R6N A;  1JXM A;  4J9C A;  1X2K A;  2O9V A;  2F2X A;  3ZL7 C;  3EG1 A;  2B86 A;  5L23 A;  3VS7 A;  2YUP A;  1Z9Q A;  2V1Q A;  3H0H A;  1ZUY A;  3KFV A;  4M4Z A;  3VRY A;  1JQQ A;  1AWJ A;  2GTJ A;  1M8M A;  2JW4 A;  2O9S A;  1BK2 A;  1WXT A;  1PRL C;  4JZ4 A;  2NUZ A;  1CSK A;  3GBQ A;  3VS5 A;  3TSZ A;  2C0O A;  5IH2 A;  2ED0 A;  2OAW A;  3EGU A;  4OMO A;  2KYM A;  2IIM A;  2L2P A;  2RQR A;  4FSS A;  4HVU A;  2DNU A;  2KRO A;  5GJV B;  3TVT A;  2LQW A;  4RTW A;  2DYB A;  1GCP A;  2X3X D;  4ESR A;  1WYX A;  4J9H A;  3VS0 A;  2RQU A;  2D0N A;  2ROL A;  2L3S A;  1AWX A;  1ZBJ A;  4HVV A;  2KYB A;  1QCF A;  2GGR A;  2LQN A;  4J9B A;  2AKL A;  4KRT A;  4GBQ A;  2LMJ A;  2F2W A;  2MCN A;  2J06 A;  1W1F A;  1SRM A;  1WXB A;  1KIK A;  2EGA A;  1ABQ A;  2DL7 A;  1I07 A;  3M0U A;  2JTE A;  2FRW A;  1TG0 A;  4E6R A;  1T0J A;  3UA7 A;  2BZY A;  1YP5 A;  2K79 A;  2LP5 A;  4R0K A;  4JPB W;  2AZS A;  3C0C A;  4F14 A;  4HCK A;  3PVL A;  1XOV A;  2HCK A;  2EYY A;  2H8H A;  2W10 A;  2RQV A;  1TUD A;  2RPN A;  1U3O A;  2J6K A;  1H3H A;  2CT4 A;  3THK A;  3CQT A;  2JMA A;  2BZX A;  1EFN A;  2EKH A;  4JJB A;  5IHN A;  2ABL A;  1PWT A;  2A37 A;  1X2Q A;  1YWP A;  4A63 B;  3SHW A;  1NLO C;  5I11 A;  3IQL A;  2AZV A;  1ZLM A;  1M3C A;  5FWB A;  4LUE A;  4IIM A;  1T0H A;  2KNB B;  1K0S A;  1X69 A;  1K4U S;  4AFS C;  1K1Z A;  1GL5 A;  3SEM A;  2HSP A;  1G2B A;  4HVW A;  3EG0 A;  1NYF A;  2FG0 A;  3I9Q A;  2KEA A;  5ECA A;  4F17 A;  3H41 A;  5IXB A;  1Y0M A;  1PNJ A;  1ZUK A;  1CKB A;  2D8H A;  1W6X A;  2OJ2 A;  2MOX A;  1GRI A;  3FJ5 A;  2CSQ A;  2JM8 A;  3VS3 A;  1I1J A;  2JT4 A;  2SRC A;  1M27 C;  1QKX A;  1T3S A;  2AK5 A;  3TSW A;  1BBZ A;  2CDT A;  1FYN A;  1GCQ A;  4RTT A;  2J6O A;  2J05 A;  4D8K A;  1UGV A;  3QWY A;  4RTZ A;  2DIL A;  1YWO A;  1ZSG A;  2DM1 A;  2DRK A;  2G6F X;  2YSQ A;  2LX7 A;  2YT6 A;  4LNP A;  3ULR B;  4D8D A;  1PRM C;  2DVJ A;  1AVZ C;  5I22 A;  1PKT A;  2ED1 A;  2GQI A;  1GFD A;  1J3T A;  2GTO A;  2FPE A;  1AWO A;  1HD3 A;  2RF0 A;  1JEG A;  1PHT A;  2KR3 A;  4Z88 A;  1H92 A;  2RN8 A;  1GBQ A;  2KRM A;  1U06 A;  2EGC A;  2DL5 A;  5FWC A;  4JJD A;  5HCK A;  3PE0 A;  1X27 A;  2DE0 X;  1X6B A;  1UE9 A;  2DLP A;  2EPD A;  2LCS A;  2L0A A;  1OV3 A;  2KT1 A;  2FPD A;  2LZ6 B;  2BTT A;  2JXB A;  2KGT A;  2CSI A;  4CC2 A;  1W70 A;  3I5S A;  2W0Z A;  1K76 A;  1AEY A;  4DEY A;  2AKK A;  1KJW A;  4RTU A;  2EYW A;  4J9G A;  1GCQ C;  3PVQ A;  2KXD A;  1MV3 A;  1QLY A;  1UG1 A;  1U5S A;  5IXF A;  1WFW A;  3M0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...