1NGMA

Crystal structure of a yeast brf1-tbp-dna ternary complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*AP*TP*AP*AP*AP*AP*AP*AP*AP*TP*GP*TP*TP*TP*TP*TP*
publication title Crystal structure of a transcription factor IIIB core interface ternary complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 25
structure length 180
sequence length 180
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2002-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ngmA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ngmA02
1VOKA 2G30A 1VOLB 3VN5A 1KYDA 1VTOA 1QN3A 1KY6A 1QN4A 4B0AA 1QN9A 1TBPA 1PZDA 1QN7A 1QNAA 1QN5A 2Z8UA 1RM1A 3OCIA 1MP9A 1KYUA 1QTPA 3ASMA 1VTLE 1QNBA 5IYCP 1YTBA 1NH2A 1QNEA 2MJ7A 5IYBP 1TBAB 1R4XA 3HS8A 1QTSA 4ROCB 2D0AA 1QN8A 1AISA 1TGHA 5IYDP 4ROEB 1W80A 1B9KA 1PCZA 2D0BA 3OC3C 4WZSD 1JFIC 1QNCA 1KYFA 1E42A 2IV9A 1QN6A 1NGMA 1YTFA 3HS9A 3H1ZA 1KY7A 2IV8A 1C9BB 2D0CA 4PY5A 1CDWA 4RODB 1D3UA 3EIKA 1NVPA 2VJ0A
chains in the Genus database with same CATH superfamily
1VOLB 3VN5A 1K35A 3D7QA 1QN4A 2QLVA 1TBPA 5JMVD 3OSMA 2PWWA 1QNAA 2QREA 2Z8UA 1J3MA 1M5Q1 3OCIA 5KL0A 1JDYA 2QRDA 1M3HA 2NOIA 1VTLE 3D4VA 1C4GA 3BKQX 5BMNA 4HJHA 1NH2A 1TBAB 5HSHA 1N3CA 1N3AA 4D7RA 3OH6A 2HKPA 4EAKA 2NVMA 3T4NA 1YQMA 3TDHA 1JFIC 3ENOC 3DPTA 2JHJA 1LWWA 1UT7A 2HL8A 3HS9A 3PMGA 1PVSA 2IV8A 2QR1A 3SNSA 1C9BB 1CDWA 4PY5A 1D3UA 4EAGA 2NOEA 1NVPA 5AN4A 2OOYA 3CVSA 2V92A 1UT4A 1VOKA 1LWVA 2I5WA 2FKMX 1HU0A 3I0XA 1WJWA 2LAEA 4B0AA 1P5DX 1QN7A 1QN5A 3F0ZA 3IH7A 2YH5A 1V5SA 1TUOA 5IYBP 1R4XA 2HL9A 5BMPA 4EAIA 1QN8A 2Y8LA 1FN7A 1LXTA 4ROEB 2D0BA 2NOBA 2NOLA 1KYFA 2IV9A 1QN6A 1NGMA 2EHBD 2NLVA 5JN5A 1YTFA 1WQAA 2D0CA 1Q9UA 2H5AX 3OGDA 3EIKA 2JHNA 3UW2A 1LWYA 2HZSA 1XSZA 3F10A 2G30A 1KYDA 1YQKA 1VTOA 1QN3A 1KY6A 2FGTA 3N89A 2H4LX 2XHIA 2DKDA 4EJZA 4QG5A 3OSTA 3OH9A 4MRQA 1KYUA 3C04A 1UL7A 1QTPA 1YQRA 1QNBA 2JOIA 3CWUA 1QNEA 2F7LA 2MJ7A 4WX8A 2O3OA 1MPGA 3HS8A 3OLPA 4Q11A 3EAYA 3PDKA 4EALA 2NOHA 1KO9A 1B9KA 1PCZA 3OC3C 4WZSD 4IL8A 3CWAA 1E42A 1PCJX 3ULXA 3KTUA 2OOXA 2QRCA 2JPIA 3KRMA 4TPSA 4CFFA 3I3WA 1KY7A 5F9CA 2YA3A 2ZFDB 3OSEA 1KFIA 3RPJA 3NA5A 1P5GX 2FKFA 1QN9A 4C7PA 2MZ8A 2V8QA 1PZDA 3CVTA 1KFQA 1RM1A 1K2YX 1MP9A 1VKLA 3RSMA 1M3QA 3CW7A 3ASMA 4BJUA 4EJYA 3TE5A 1C47A 5IYCP 1YTBA 1N39A 2V9JA 1PCMX 4ROCB 3CWSA 5IYDP 1T6AA 1QTSA 1TGHA 2D0AA 2NWVA 1AISA 3I0WA 1EBMA 4I8OA 4DULA 2HZMA 1DIZA 1W80A 2DKAA 2DKCA 2FUVA 4D7QA 1QNCA 2NOFA 2Z0FA 3DPUA 5EPCA 1EUVA 4EAJA 1YQLA 3CWTA 3H1ZA 3ENCA 4WXAA 2R5XA 4RODB 2NOZA 2Y8QA 2VJ0A
chains in the Genus database with same CATH topology
1VOLB 3VN5A 1QN4A 1TBPA 3OSMA 1QNAA 2Z8UA 3OCIA 1M3HA 2NOIA 1VTLE 1NH2A 1TBAB 1N3CA 1N3AA 1JFIC 3DPTA 1LWWA 1UT7A 3HS9A 2IV8A 1C9BB 4PY5A 3SNSA 1CDWA 1D3UA 2NOEA 1NVPA 5AN4A 1LWVA 1UT4A 1VOKA 2I5WA 1HU0A 3I0XA 2LAEA 4B0AA 1QN7A 1QN5A 3F0ZA 3IH7A 2YH5A 5IYBP 1R4XA 1QN8A 1FN7A 4ROEB 2D0BA 2NOBA 2NOLA 1KYFA 2IV9A 1QN6A 1NGMA 1YTFA 2D0CA 3EIKA 1LWYA 2HZSA 3F10A 2G30A 1KYDA 1YQKA 1VTOA 1QN3A 1KY6A 2FGTA 3N89A 2XHIA 4EJZA 3OSTA 1KYUA 1QTPA 1YQRA 1QNBA 2JOIA 1QNEA 1YQMA 2MJ7A 2O3OA 3HS8A 2NOHA 4Q11A 1KO9A 1B9KA 1PCZA 3OC3C 4WZSD 1E42A 3ULXA 3KTUA 3KRMA 4TPSA 1KY7A 3RPJA 1QN9A 2MZ8A 1PZDA 1RM1A 1MP9A 1M3QA 3ASMA 4EJYA 5IYCP 1YTBA 1N39A 4ROCB 5IYDP 1TGHA 1QTSA 2D0AA 1EBMA 1AISA 3I0WA 4I8OA 4DULA 2HZMA 1W80A 2NOFA 1QNCA 3DPUA 1YQLA 3H1ZA 4RODB 2NOZA 2VJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOK A;  2G30 A;  1VOL B;  3VN5 A;  1KYD A;  1VTO A;  1QN3 A;  1KY6 A;  1QN4 A;  4B0A A;  1QN9 A;  1TBP A;  1PZD A;  1QN7 A;  1QNA A;  1QN5 A;  2Z8U A;  1RM1 A;  3OCI A;  1MP9 A;  1KYU A;  1QTP A;  3ASM A;  1VTL E;  1QNB A;  5IYC P;  1YTB A;  1NH2 A;  1QNE A;  2MJ7 A;  5IYB P;  1TBA B;  1R4X A;  3HS8 A;  1QTS A;  4ROC B;  2D0A A;  1QN8 A;  1AIS A;  1TGH A;  5IYD P;  4ROE B;  1W80 A;  1B9K A;  1PCZ A;  2D0B A;  3OC3 C;  4WZS D;  1JFI C;  1QNC A;  1KYF A;  1E42 A;  2IV9 A;  1QN6 A;  1NGM A;  1YTF A;  3HS9 A;  3H1Z A;  1KY7 A;  2IV8 A;  1C9B B;  2D0C A;  4PY5 A;  1CDW A;  4ROD B;  1D3U A;  3EIK A;  1NVP A;  2VJ0 A; 
#chains in the Genus database with same CATH topology
 1VOL B;  3VN5 A;  1K35 A;  3D7Q A;  1QN4 A;  2QLV A;  1TBP A;  5JMV D;  3OSM A;  2PWW A;  1QNA A;  2QRE A;  2Z8U A;  1J3M A;  1M5Q 1;  3OCI A;  5KL0 A;  1JDY A;  2QRD A;  1M3H A;  2NOI A;  1VTL E;  3D4V A;  1C4G A;  3BKQ X;  5BMN A;  4HJH A;  1NH2 A;  1TBA B;  5HSH A;  1N3C A;  1N3A A;  4D7R A;  3OH6 A;  2HKP A;  4EAK A;  2NVM A;  3T4N A;  1YQM A;  3TDH A;  1JFI C;  3ENO C;  3DPT A;  2JHJ A;  1LWW A;  1UT7 A;  2HL8 A;  3HS9 A;  3PMG A;  1PVS A;  2IV8 A;  2QR1 A;  3SNS A;  1C9B B;  1CDW A;  4PY5 A;  1D3U A;  4EAG A;  2NOE A;  1NVP A;  5AN4 A;  2OOY A;  3CVS A;  2V92 A;  1UT4 A;  1VOK A;  1LWV A;  2I5W A;  2FKM X;  1HU0 A;  3I0X A;  1WJW A;  2LAE A;  4B0A A;  1P5D X;  1QN7 A;  1QN5 A;  3F0Z A;  3IH7 A;  2YH5 A;  1V5S A;  1TUO A;  5IYB P;  1R4X A;  2HL9 A;  5BMP A;  4EAI A;  1QN8 A;  2Y8L A;  1FN7 A;  1LXT A;  4ROE B;  2D0B A;  2NOB A;  2NOL A;  1KYF A;  2IV9 A;  1QN6 A;  1NGM A;  2EHB D;  2NLV A;  5JN5 A;  1YTF A;  1WQA A;  2D0C A;  1Q9U A;  2H5A X;  3OGD A;  3EIK A;  2JHN A;  3UW2 A;  1LWY A;  2HZS A;  1XSZ A;  3F10 A;  2G30 A;  1KYD A;  1YQK A;  1VTO A;  1QN3 A;  1KY6 A;  2FGT A;  3N89 A;  2H4L X;  2XHI A;  2DKD A;  4EJZ A;  4QG5 A;  3OST A;  3OH9 A;  4MRQ A;  1KYU A;  3C04 A;  1UL7 A;  1QTP A;  1YQR A;  1QNB A;  2JOI A;  3CWU A;  1QNE A;  2F7L A;  2MJ7 A;  4WX8 A;  2O3O A;  1MPG A;  3HS8 A;  3OLP A;  4Q11 A;  3EAY A;  3PDK A;  4EAL A;  2NOH A;  1KO9 A;  1B9K A;  1PCZ A;  3OC3 C;  4WZS D;  4IL8 A;  3CWA A;  1E42 A;  1PCJ X;  3ULX A;  3KTU A;  2OOX A;  2QRC A;  2JPI A;  3KRM A;  4TPS A;  4CFF A;  3I3W A;  1KY7 A;  5F9C A;  2YA3 A;  2ZFD B;  3OSE A;  1KFI A;  3RPJ A;  3NA5 A;  1P5G X;  2FKF A;  1QN9 A;  4C7P A;  2MZ8 A;  2V8Q A;  1PZD A;  3CVT A;  1KFQ A;  1RM1 A;  1K2Y X;  1MP9 A;  1VKL A;  3RSM A;  1M3Q A;  3CW7 A;  3ASM A;  4BJU A;  4EJY A;  3TE5 A;  1C47 A;  5IYC P;  1YTB A;  1N39 A;  2V9J A;  1PCM X;  4ROC B;  3CWS A;  5IYD P;  1T6A A;  1QTS A;  1TGH A;  2D0A A;  2NWV A;  1AIS A;  3I0W A;  1EBM A;  4I8O A;  4DUL A;  2HZM A;  1DIZ A;  1W80 A;  2DKA A;  2DKC A;  2FUV A;  4D7Q A;  1QNC A;  2NOF A;  2Z0F A;  3DPU A;  5EPC A;  1EUV A;  4EAJ A;  1YQL A;  3CWT A;  3H1Z A;  3ENC A;  4WXA A;  2R5X A;  4ROD B;  2NOZ A;  2Y8Q A;  2VJ0 A; 
#chains in the Genus database with same CATH homology
 1VOL B;  3VN5 A;  1QN4 A;  1TBP A;  3OSM A;  1QNA A;  2Z8U A;  3OCI A;  1M3H A;  2NOI A;  1VTL E;  1NH2 A;  1TBA B;  1N3C A;  1N3A A;  1JFI C;  3DPT A;  1LWW A;  1UT7 A;  3HS9 A;  2IV8 A;  1C9B B;  4PY5 A;  3SNS A;  1CDW A;  1D3U A;  2NOE A;  1NVP A;  5AN4 A;  1LWV A;  1UT4 A;  1VOK A;  2I5W A;  1HU0 A;  3I0X A;  2LAE A;  4B0A A;  1QN7 A;  1QN5 A;  3F0Z A;  3IH7 A;  2YH5 A;  5IYB P;  1R4X A;  1QN8 A;  1FN7 A;  4ROE B;  2D0B A;  2NOB A;  2NOL A;  1KYF A;  2IV9 A;  1QN6 A;  1NGM A;  1YTF A;  2D0C A;  3EIK A;  1LWY A;  2HZS A;  3F10 A;  2G30 A;  1KYD A;  1YQK A;  1VTO A;  1QN3 A;  1KY6 A;  2FGT A;  3N89 A;  2XHI A;  4EJZ A;  3OST A;  1KYU A;  1QTP A;  1YQR A;  1QNB A;  2JOI A;  1QNE A;  1YQM A;  2MJ7 A;  2O3O A;  3HS8 A;  2NOH A;  4Q11 A;  1KO9 A;  1B9K A;  1PCZ A;  3OC3 C;  4WZS D;  1E42 A;  3ULX A;  3KTU A;  3KRM A;  4TPS A;  1KY7 A;  3RPJ A;  1QN9 A;  2MZ8 A;  1PZD A;  1RM1 A;  1MP9 A;  1M3Q A;  3ASM A;  4EJY A;  5IYC P;  1YTB A;  1N39 A;  4ROC B;  5IYD P;  1TGH A;  1QTS A;  2D0A A;  1EBM A;  1AIS A;  3I0W A;  4I8O A;  4DUL A;  2HZM A;  1W80 A;  2NOF A;  1QNC A;  3DPU A;  1YQL A;  3H1Z A;  4ROD B;  2NOZ A;  2VJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...