1NGQH

N1g9 (igg1-lambda) fab fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
220
structure length
215
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N1G9 (IGG1-LAMBDA)
publication title Three-dimensional structures of the Fab fragment of murine N1G9 antibody from the primary immune response and of its complex with (4-hydroxy-3-nitrophenyl)acetate.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 42
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 1995-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngqH02
3D87B 3MNZB 4Q9BA 2HTLD 1CLYL 4OTXH 4ZFOA 4D9LL 1KTLB 4O2CB 3GSNH 3GGWB 5K9KA 3MA9L 4X5XA 1Q1JL 1OSPH 4U1IA 3H0TB 3BZDA 2HVKA 1T1ZB 5IK3A 4LHJB 3RA7H 1KULA 4I48B 4P2QB 3QEGL 1DL7H 3D39A 4LOUD 2MFNA 1TITA 2DMKA 1TZGH 1EV2E 4NQEB 1WFUA 5D5MA 1BMGA 5AYUL 4LLMB 3P4MA 1CFBA 1MEXH 3OXRA 1ZHKB 3SGDH 4H88H 3T0WA 4FA8A 3T1WA 1N3NA 7FABH 4M4RA 4G6KL 3MGTB 5GIRB 1NGYB 3ZHLA 4ZTPH 2HKHL 5BXFB 4MXVF 3IKCA 5FYJH 4JZJB 1ULVA 3RI5K 4ZMAT 3DUUA 4G7VL 4DWHA 3NCFB 1OPGH 3TZVA 4J1UA 3KPQA 3VJ6B 4DFIA 1JF1A 1X6NA 1A4JB 1OW0A 2ARWA 4Z7UE 2P45B 1F3JA 5CHNA 3S5LG 5T1KD 4KRNA 4APQB 4JFFA 1P7QD 4OGXH 1CQKA 1DFBH 1FV1A 1J0HA 4RX4A 5C2BH 3RKDC 4AK1A 1X3DA 4N1EA 5EB9A 5HHQA 1K6QL 2YUZA 2AGJL 3F6IA 3HS0B 4R2GD 5F7NC 5JOEA 3PG2A 4PGBA 2H1PL 4U6VL 4XNUH 4ZSOB 5T1DH 4QWWC 1FZKA 1R3KA 5BOZG 5J57B 1CDIA 1G9EA 1AHWB 1TXKA 5J13C 1G7QA 3MREA 4FQLL 2XA8H 3C6SA 3TO4C 4RQQB 4GG8B 2X4OB 3O6MH 4J4PC 3UJJL 3QHZL 5E8NA 4JGUA 3VCLB 5I1EL 3H9SE 4QT5A 4HJGA 1J8HE 5L6YH 3BH9B 1AQKH 1TCRA 1T89C 3GSUA 4MSWB 5DUBA 2V5SA 3FOLB 4NBYB 1U8NB 4QOKB 4KTEL 4ETQB 2VRAA 1CGSH 3VI4E 4BZ2H 3KS0J 3C6LB 1HKFA 3BEVA 1NGPH 2QHLA 2ADFL 4IRJC 3KJ4C 1FDLH 3W11C 3IU3B 3ZDYF 1HHJB 3QI9C 3HI1B 3DX9B 1NMBH 4WEBL 3RL2A 2PW2B 5EU4A 1ZHNB 5CIPB 1XGTA 4OF6A 1UENA 3LKRA 2HVJB 2OZ4H 5D1XD 3FO0L 3ILPB 4ZS6C 2C3HA 5I73C 2AJSH 2BVEA 2W0KA 3LS4H 5GGRY 2A6KB 3IXAB 2R1WB 2EYSB 4JO2L 2BK8A 3BPCB 1CYGA 4JFEE 4Y1AD 4OCWL 4PGCA 5CJQH 1VGKB 4HC1A 4BZ1H 1NCBH 5DD1L 4RAHA 2IALB 5JHLL 2G5RA 3A0OA 4HS3A 4AEHH 3OJDA 5KS9E 4JPIB 1X7QB 4IJ3C 5C09D 3VFTA 3EHBC 3MJ6A 3U6RA 2O5YH 3VRJB 4PS4L 4AH2B 3PJSB 1A8JH 3MTRA 3WFHA 1A7RL 2XZAL 3MV01 1DEEA 3SKJH 5DQ9A 4KXZI 1MY5A 5I1AB 4CADA 5C0BB 1FCCA 4ODHH 2XFXB 3CSBA 5TDNA 3QFJA 4K9EC 1EEUA 5C9JB 5EZIH 4LKCA 4JN2A 3EJJX 3ARDC 5C0EA 4QHUA 5INDB 1TFHA 2DD8H 4AEIL 1T03L 2Z31B 5I2IB 1BOGA 4OGAD 4DTGH 3D39E 4LHUA 5I6XC 1FRGL 3V7AE 4NQUA 3NIFE 4J3WA 2Q8AL 2F5AH 4HDIA 3GRWL 4XX1E 2ARJQ 2NR6D 5D5ME 2IBZX 2AK4A 1HHIB 2B8OT 4KJPC 3EOYG 3MLRH 1YNLH 4XPGH 3L3GA 4GRMB 1U3HB 3HZKB 3V5KB 1X5HA 1A6TA 3VFNB 1QRNB 4ZDHB 1QFWL 4UOW0 5DEGB 4XCNA 4DW2H 4JPWH 3ROLB 4EOWH 2VABB 3O9WD 1F2XK 5GSRA 5HGGS 4M61B 3KLHD 2B4CC 5A3ID 1S9XA 4K3JL 4LSSL 4WI2A 3SOBH 1IEBB 4ELKB 3K7UA 1Z9OA 4P3DA 4QNPE 1G0XA 4JPVL 5CLTA 1NFIA 3OJ2C 4JFFE 9CGTA 4JZNB 4DCQB 5GISL 3ZT7A 4RIRB 1BPVA 2HP4A 3DHMA 1ZA6B 2OR9H 4G9FA 4JDVB 1IKFL 1U3ZA 3EDEA 4ZO6A 5EO9B 4LSQL 2DQHH 1WEJL 1BJ1H 3GM8A 3VG9B 4K7PH 5IVNA 5F1KC 1BX2A 2D7TH 2VDQL 4EJ1C 2VQTA 4QHNA 3VFWA 2W9DH 2NXZD 4ZPVB 5AZ2H 4XTRD 4YXLL 3F12B 4ZO8A 1G0YR 4GRWH 1K8DB 3I6LE 4CGTA 2MCPH 3ZTNH 2ESVA 5DD5H 3QISA 4FRWA 1ITCA 1PSKH 3ULUL 5DJDA 4B50A 4P59H 4U6YB 2C7UB 4YAQA 4QXTB 1XT5A 4R7DA 1BF2A 1DDHA 5JXED 4XBEH 4OJFH 1V7NH 1XIWD 1H15A 4NRZB 3WS6A 1F90L 5ISZB 1W0VA 3QJHA 3Q5TA 4DVBA 5ILTH 3OKNA 2FX9L 4ZFZB 2FJGB 1FFNB 3FRPA 3DX7B 1MSPA 3MQIA 2EKSB 1OB1A 3BQUB 4LSUL 2XY1A 1HDMB 3O6KL 3F7YA 1C5BL 2OP4L 1F58H 2AJYH 3B6SA 4LCUA 2VAAB 2H32H 1GZPB 1YEDB 3TNMB 4Z7QE 4C54A 3GHEH 3FB5B 3MRLA 4Q7DA 5HVWA 2GJ6A 1FYHB 1OAYL 4ZD3L 3QSKB 2ZPKL 4NO5B 4W6XB 3VXTB 5FB8B 3AS0A 4JDZB 3UJTH 3BRGC 2NY5L 4R0LB 4I3SH 4Q0XH 3QB7C 3RIAF 1II4E 4EXPX 1RJZA 3ROOA 3EO9H 4KUCD 2YD8A 1YUHA 1I7UB 2IH1A 3SE3C 4NWTH 2HG5B 3AB0C 4I4WB 4JFDD 5ABDE 3GIZH 2YEZB 4YFDB 2CO7B 4HS8H 5GGQL 1M7DA 4XCYA 4DUVA 3TPKA 1KCKA 4ZXBB 4LSRL 3L7FA 1RV6X 5MP6L 4Y0GA 5L8JB 4O58L 1DQDH 2GQHA 4GSDH 2V5YA 3VXRA 4EUPB 3IKKA 2CGRL 3L3DB 4GFTB 1MY7A 1CDCA 1FLRH 3NFPB 1T1WB 5DMYA 3VD5A 4C4KO 3QFJE 2P47B 4PYHA 4BK4A 3RFZC 4Y4HC 3WXVL 4G8GB 1E4WH 4Y4KC 3M8OH 1Q72L 4WW2A 4WI7A 2X4TA 4D0DB 2G9HB 2VLKD 3KPTA 4XP1L 5BV7H 1XGQA 3LN9A 1JPSL 1EK3A 3HZMA 3F58L 4OF7A 2VOTA 5HYEA 3TC9A 4NM4L 4OAWA 2AK4E 2MMXA 3JWDL 4E42B 4NSKB 1SEQL 4OCRH 3QUZA 1CXLA 5BVPH 3VWJC 5C71A 2DQCH 3K4DA 2OMBA 5IB4A 1EEQA 3P4NB 2CUHA 4U05A 2BMKA 4TSBH 5HYJD 2CKNA 2VXSH 3I9GH 4HBCH 3TN0B 2YPVL 4QEGA 4NZRL 4MD0B 1J87A 1Q9OA 4HUVB 2VZ3A 1MCCA 4Z7OF 4DGIH 2XKSA 3CU1A 4KK8C 2P5WD 4XZUA 3MC0A 1EO5A 1FL6A 5EC1A 4J3XA 1P6AB 5DGQA 5F8RC 5JPMB 5C0AA 4EQ3A 4JFZL 5D6CA 2RGSA 3HNSH 5IHBA 3WDJA 4PJEA 1F02I 3WYRA 4WTXA 1CXHA 1MFBH 4Z95H 4ZQKB 2HJLB 3VFPB 1N0XH 4G9FE 5EO0B 4LDOB 1KCUL 3QUXB 1JIBA 5D7LA 3BW9A 2YKLH 4KHTH 5DA4A 4OLYH 4QHLA 2CD0A 3JTSB 3S3PA 3LRSA 2P1YA 1LEGB 3DECA 3T09A 5CZKA 5CKGA 2XWTA 4UUJA 3O11B 3FO9B 4XWOD 3OL2A 2WNGA 1OGAB 3P9MA 5DRNB 3WHE1 2QADB 3RWEB 1PQZB 3CPLA 3EOBA 3ALPA 1P7KB 1JZ7A 2VL4A 4QY8B 4G6ML 3MGOA 2BSTA 2ESVE 2DF3A 3KVQA 1BFOA 1DQLL 1QBMH 2P8LA 4GBXB 3U82B 4YIQB 3D3VA 2X6MA 2EDRA 5C6PB 5D93C 2Y9RT 5DD3L 2NW3B 5TE4H 3GMNA 1L0QA 4YX2L 3UTTB 4LVHB 4WFFE 1T4KB 3RGVB 4YE4H 1VPOL 4JRXD 2R29H 3VI3E 1QKZH 5DMJB 2ZUQC 3PUCA 2IBZY 5DYOA 5FM5M 1SYVA 2VLLB 2YBRB 3S9DB 3GMLB 5CBEA 4MQSB 1NBVH 1Z6JT 4M62L 4O9HL 2JK5B 4M7ZC 4J7RA 5ITFB 3QXDB 3NABL 3ILQC 3EYUL 4HUXA 2N4IA 2WV3A 1WJ3A 2D7QA 3QPQD 3CC5A 4KJQC 1GAFH 1FNFA 4LVOB 5IT2H 3P0VL 1UWEL 4U6TA 4F7PA 2W07A 2D7PA 4JKWA 3U7WL 4KZEL 3AGVA 3OX8B 3K2UL 2G75B 3DX6B 1OAUH 2ZOLB 3O3EA 5GGTA 4K71C 3WFEH 4PGZA 3DV6A 2FZ3A 2PO6D 4HULB 3IRZA 4LPUA 1AO7B 3H9HB 4HX1B 4GRWF 3W39B 1EDQA 1BBJA 4FOMA 2NXYD 4PJAF 3UTOA 3SQOH 3GJFH 3MGAA 5EU6A 4JY6B 3DVGB 3GSNB 3B2UD 4IBLT 4LPCA 3GI9H 3UTQA 2VDNH 2E8ZA 3VXRE 4IRSA 3EZ8A 2GI7A 2OX5A 1ED3A 3MRBA 3GMOB 5JW4R 3RWFB 1PDKA 4WO4B 5DJXB 4Y5XB 2XICA 2NX5B 3ZKMC 3FT4B 3HE7C 5BS0A 4YXKL 1TNMA 4ZAKC 1TZIB 4WI6A 1JGVH 4UB0L 4I18C 4DOHB 3QDAA 5CZXC 3OXSB 1BFVL 1MCWW 4UTAH 1MH5B 3Q6GH 3ARFC 3JSSA 4KRPD 1DANT 5DRWB 5B3JF 4MA7H 1KSRA 2FATH 3TH2T 1L0XA 2IANB 1U6AL 1KJ2A 2WIIB 3FQWB 1RZ8B 4OCSH 3NN8B 5J6GA 4UT9L 2DTSA 3WFBH 4NGHH 15C8H 1OP5K 1WC7B 2XN9D 4PGEA 3TJEL 4PJGA 5IG7A 1NC2A 1NEZB 2BNUA 2Y5EA 1S9WA 1TVHB 3PWNB 2MCG1 4XXDA 2H9GA 1CICA 3KR3H 4PJFF 1RD6A 1M7XA 5D71L 5I1CL 3RUGF 1I9IH 3TJHD 5I74C 4LLUA 4RDQF 3SGJC 2BNQB 1CD1A 3R0MA 5J12C 3BOVA 4PP2A 2FEDC 3QIBB 1ZSDA 5E2UH 3VXUD 3UZQA 3VRIB 4MNQB 3FT2B 4WNQA 2F54D 3FOMB 2ERJB 4RSVA 5C0AE 3GSQA 4KKAC 3RAJH 3CSPA 3LKOA 3O4LA 4MWFA 3S88L 1RJLA 4ODUB 4PJEE 5C08B 2PTUA 4OLXL 5MEOA 1JZ2A 1HI6B 4PRPB 1TETH 4PJ9A 3PWVA 1KCSH 4YHKH 5D7LE 5TDOA 3V7MA 1XF1A 5TH2A 4MS8D 2QJDA 3FHQA 5HYSB 3MFFB 3SCMA 4YNYB 2VDLL 3CFJB 4PJIF 5I9QB 1KPRA 5AAWA 1CE1L 2OSLB 1QLFA 1R6VA 4JANB 4TVSa 1Q9LA 4YFLF 4FTVA 5C0IB 3I6GB 4I0KA 3G5ZA 5JDSA 4F9LC 3T2NL 4P2OC 4OFPA 4P57B 3MLWL 1AJ7H 2M2DA 5HI3C 4WU7A 1S9KC 2DM4A 1HK6A 3L3JB 4ENEC 2GITB 3QRGH 5F7UA 1UWXK 2BOCA 4PJBA 1FFPA 1T0MA 2GSGA 5TQ2L 1MVUB 2CDFA 2F58L 4XCEA 2VQUA 2DM7A 4OQTH 2PR4H 3CLEH 2YUVA 3TA3C 4ODWA 2HFEA 2X4RB 4M43L 1CGYA 2OBGA 2FR4A 5EO1A 4P5TC 3KDMB 3DI2B 1ZS8B 2Y36L 5E8DL 3ZKQD 1GC1L 3FB7B 3L3OA 4X98B 5GRZA 4DFHA 4MHHG 1NBYB 1T2QH 3BPOC 3BMVA 1S3KL 1EX0A 4G7YL 3V0VB 3W0WA 5IEKB 1FIGL 2OTWA 3BKYL 4JHAH 5ENWB 4HUUA 4LLVA 1JRHH 5CMAB 1ZVSA 2GK0A 1HINL 1X5AA 2Z4QA 3GBML 1A02N 2X7LB 2R56L 3QDGA 2GHWB 3VXPA 1A6WL 1SBSL 1UM6H 4PR5A 2ADIA 4KAQH 4JFQB 2EH8L 4DN4L 5ID1B 1KEMH 1QD0A 5CZVL 4MD5A 3HNVH 1LE9B 4RAUA 5F9DC 4P2QD 4U3XA 2D3VA 4P23C 2ITDB 5CEYA 4M3KB 1XR9A 2Z91B 4NC1E 4YZFE 5BMFL 5F9JB 3NIFF 4JN1H 4NQED 4NKDB 3RU8L 3OKDB 3TWCH 1I3RB 2PXYA 4NDMB 5EU6E 1AXTH 3MV7E 1IQWH 1A5FH 1K5NB 1A22B 4WHDA 4XP5H 2MOVA 4HD9A 4OI7A 3P2TA 4I0PA 4HFWB 4PRBB 2IQAB 1RIHH 1G9MC 3KXFB 5L2JB 3UJIL 2VN4A 5BS0E 4K8RH 1I3UA 1PG7W 2AXFA 1CFNA 1C7SA 4R7NA 5CBAA 5I71C 1SJEA 5FYKD 4GXVH 4G8FB 5BJTA 4QNPF 5FXCH 1DBBL 4APQD 1B0RA 1T2JA 4MJ5B 1QVOB 4QRRB 4U0QB 1FNGB 1YMHB 2MPAL 1YNTA 2DYPB 5CJ5A 2P8PB 4HS6A 3GK8H 4OBSA 1DVFD 4EN3C 3HRZA 4Z18A 3RIFF 4KJYB 2J2ZA 4HEME 3FKUS 4PJGE 5D1QD 2A77H 3T77B 1JN6B 4X8JA 3EYVA 2AJZA 1XF4B 5T3ZH 3EYSH 3W5NA 2VDPL 2CMRL 5DD6A 2AV7B 2VITA 3FO1B 4HXAL 4OKVA 5DZLA 1HSAB 3K8MA 5MENB 1I9JH 2BRRL 3NBNA 1FPTL 1HEZA 1U8QB 1MHCB 2R69H 1SVCP 5FO7A 3AXLB 3ZYJA 1Q0XH 2B20A 1ES0A 3O4LE 3DXAA 4QOKD 4YO0A 4OBRA 4NUJB 3FMGL 5C0FB 1SY6L 5FYKU 1BQHB 5DT1L 2JJTA 5DC9B 3C6LD 3T2OA 1NLBH 4M1DH 5IVZA 3WNKA 4TUJB 1BEYH 3FL7A 3FQNB 3RQ3A 1RZGB 5I1DB 5MEQA 4GRWB 2O5XL 2ZCLL 5I8EB 2DWEB 4PJAB 4PG2C 1RUKH 3VXSB 1FO0A 4OD1L 3WUWG 3S37X 4NQCA 3L3HA 4HKZA 3FQRA 2EE9A 1RVFH 4A6YL 5B4MC 1JNHA 4PBXA 1UEYA 2CRMA 1YYMH 1WIUA 4FTVE 5F1NA 2VR5A 3VW3L 1WTLA 2XZCH 4KJWC 4XBGA 1P4IH 4Y16A 2EDEA 5CINH 5HHNA 1MFDH 5CKAA 1L9MA 4FP8L 5GQBA 4Z9KB 1ZK9A 3T08A 1N6QL 2VSDA 1HCFX 4TNVF 3O2VL 1BLNA 1AGEB 2HRPL 3BO8B 4PJBE 5FIEA 1B4JL 2IFFL 4L8SB 5HHMB 2ZCHL 4XNMB 1OGTA 3CIQA 4HK3J 4Z7VB 1EERB 1RUQL 1C1EH 2HN7A 4P4KA 3L6FA 3MA7A 2H32B 2P5EA 4WFGD 1DLHB 4OLZH 1G7IB 2DLFH 5DSCA 4P2CG 4J3VA 1H5BC 4L9LC 2HJFA 3DMMC 1Z2KA 5D2LF 2IPUK 4YHML 4L3CA 5T3XH 3W0WE 1BGXH 4P2RB 1TJHL 4PJFB 4HWZA 3HI5L 3RUGB 4POUB 1LK2B 4U1NB 1Q0YH 5K33A 2IG2L 1QQDB 3QDGE 2YPLB 3MLZH 4LARH 5JIHA 5CD5D 3PE9A 4OZGA 4F80A 3I2CH 2VLJB 3T0AA 1J1XH 5E2TH 5IFAL 1MIML 2A83A 2Z31D 3JZ7A 3PXJA 1EUTA 1DQMH 5IBTH 4NOBA 2NY1B 3KPPA 1T0PB 1AP2A 3QIUB 4OIIH 1LO4H 3VD4A 1C8PA 4QCIA 1GIGL 2OL3H 4I2XA 4MDIA 3HC0A 1YEKL 3IYLW 3T0XA 3BZ4B 1U3HD 4LSPH 4PJIB 1C5DA 4S1QH 3GMQB 1QRND 5DZNA 5AYQA 4KZDH 3DSFL 2EEAA 4Y2DB 2OYPA 5BO1H 4GAJH 2VXVL 3RVTC 2A1WL 1EJOL 1RURL 2H8PA 1IMHC 3GIVA 5BV7B 4R4BA 1LD9B 4V2BA 2FX8L 3DLQR 4LP4A 3RWHB 1KBGL 3KLSA 5FGCB 4HKJA 5KVFH 1CZ8H 5IJKA 2C4FU 2UY7A 5IWLC 4P9MH 1A7PH 2IADB 3OGCA 4FMFA 4GRLD 1HHKB 2EXWC 3BD5A 5MERB 1RZFH 1IGTB 1J5OH 3OHXA 4EUPG 5I75C 3K46A 1W0YT 4NO3A 3ZHDA 2IPUG 5ICXB 5F21B 5JIPA 1DBKH 3D18B 2QTEA 4DEPB 4M6NH 2AJVL 4LU5L 2YOCA 3QAZC 3VXNB 2D2OA 2X41A 2W9LA 1I9RH 5HHVH 3IDGA 5J1AB 5E8OA 1IQDA 4G43A 4WFED 3HUJF 1R0AH 3LHPH 4O2EB 5JIKA 4HW6A 5IF0B 1AFVH 2C3GA 3BSZL 4JCMA 2P24A 5E6IB 1YJDH 4AENB 4JE4B 2HT2C 1EAJA 1FVEB 5GS1B 5D96B 2X42A 2D7MA 3WLWD 3DXAE 5F1IB 3L95B 3TO2B 1LILA 1VSCA 3OF6A 3THML 2H2PC 4L3ED 1EEYA 4HIIB 1DQJA 3GMPA 4ERSH 5ADOL 2UYLA 1WAAF 3VGHA 2V7HB 3OKOB 1D7FA 3FAWA 2OJZH 1NBQA 3C2AH 3CMOH 3MJ9A 3D5OF 1WV7T 1FVDB 5T1LB 4X6EB 3HE6B 5F1SA 3VWKC 2EYRA 3CVHL 5T1KA 3MUGB 1U93A 4JO4L 4NQCE 1P7QA 2BJML 4JZOB 5CSZA 3CFCH 3M17B 4TQEL 3PV6A 1OF2B 2QBWA 4YHOL 3T8XA 4ZPTA 4XHJD 2CKBA 4ZUSA 4HQQL 5GS0H 2AABL 1Z3GL 2EZ0C 4NP4H 4RNRB 4ORGA 3I84A 2VDKL 2E7HA 3RWJB 2VKXA 3STLA 1B4RA 5EZJB 1T3FA 1UVQB 3LN4B 1INEL 3PHQB 3PQYA 4NPYA 1J1PL 4PRNA 4YDKL 2FD6H 4PJ7A 2IF7A 2DBLL 3X14A 2P5EE 4MNGA 4S1RL 4OD3H 4M7JH 2W0FB 1RPQA 1R24B 2C26A 5ACZA 4F58L 4JQVC 3B8SA 4ZXBD 2B2XL 3HMXL 2BFVH 3JTTB 4OLWH 1SYSB 4D9QE 4WJ5B 1YEEH 2A73B 3MODL 5ACLA 2EXYC 4FMKA 2P8MB 1RK1A 5IJVA 5FCUH 1U8HA 3N06B 2ZJSH 2QQLH 3U1SH 3ULVD 2V2WA 3UBXG 3BJ91 1TCMA 1XF3B 1B6DA 2WBWB 3R0NA 4G8GD 3UPRB 4OZGE 1PGRB 5EPMB 2X4NB 5HDLA 3V4VH 1K4CB 1N2RA 1S7SA 3GJFB 1CFVH 5EBMB 4WY7L 4OM1L 2NY3B 5LKNA 3DYOA 1F11A 2BHYA 3LQAL 4I2XE 1MCOH 4BFGA 3ARBC 4G6JH 5B39B 4XMLL 1Q8MA 3ALWA 3BKMH 4E9LA 3H6JA 1BZ7B 1ZKAA 1FBIL 1FE8L 2NY4B 1KNOB 5D8JL 1I1AD 4GMTH 3E3QC 5T5FH 3TN0D 1CLZL 43CAB 3QEHB 2K3TA 2FJFB 2YD5A 4OGZA 4HFUL 5DTFB 4TUKH 3RIAK 2EDDA 5C09A 1ZLWH 3VFSA 2YMXL 4Q9CA 1Q9KA 1R3IL 4MMZC 4WHYH 4KVNH 1K3ZA 3NIGE 4DAGH 2WBJC 3QPXL 1IC5H 1VENA 4S1SL 4YBLC 3NFNB 1MCEA 1T80A 2FB4L 2CIKB 2R2CA 4MB4A 4XBPB 5ICZB 3UDWA 1JFQH 3LB6C 5BRZB 3NIDF 1M05A 1RZ7H 3QULB 3EW3B 4JR9H 5C0JB 1IM9D 3QUXD 4C58B 3O2DA 1HNGA 4HUWB 5D2LB 3PGDA 3ULVL 2XQYK 1MRFL 4XVJL 4PLNC 4GW5A 3CX5J 1IE5A 2QADD 3WIFB 1E28B 1JHKH 1I8IA 2Y7QA 3T0DA 5EU3A 3B3IA 3BDBA 1CK0L 4XVSL 1FFOA 3P9LB 2XYCA 4GBXD 5IIEA 1KENL 2H6PA 5E08L 2XQBL 1G6VK 3UTTD 3TVMB 4AT6B 3BEWB 5IB2B 1NEZG 2B0SL 1MJ8H 3RGVD 4PLJC 1MQKL 5IHZB 1E0OB 2F5BL 1Y6NR 1BOYA 3O9WA 3P30L 3QXAB 1LO2H 4PY8I 1G7MA 2HT3C 2WLYA 4UQ2B 5EOCJ 1JWSB 1WISA 5ERWA 2GJZA 4U7SA 4WV1A 1JGLH 1RU9H 5CS7A 2J4WH 5DUPL 4NO0D 1JHTB 4G8EB 4PB9H 2FEEI 1FZJB 1GHFH 2I60L 3O2WL 1KLGB 5ETUA 4CU6A 4MAYB 5TQ0H 2BZDA 5LCVH 4V2CB 1G84A 1LO0L 4IOIB 4HMCA 1DE4B 3V4PH 2AEPL 1QEWB 4CW1B 1A6ZB 5KVDH 4W6WB 1PKQA 2FLRT 1UJ3A 4Y88A 5HYSG 1YYLL 1F3DH 2CRYA 4POYA 1XR8B 3BGMA 4YWGL 1RUAH 5I66A 3PQYE 1JNJA 1RMFH 1QACA 4PJ7E 2C5DC 4MNGE 2HTKC 4XPAL 5H35A 1S7TA 1S78D 1AO7D 2B5IC 4XVTL 3UPCA 4WEMB 2PTTA 2HRLA 2XQYG 2VDRL 4LCCA 1K9TA 2JJVA 1I8MA 4HJJL 2HFGH 3P73B 3JV0A 1HSBA 3U2SA 5JXEA 1A6AA 4IMKC 1XIWA 2GT9B 1NMCB 4PP1C 5KVEH 4RFOL 1U8OB 3HPJA 3CXDH 3W81A 4LGRB 3HUJB 2GFBB 4F33B 5AZEH 3BRDA 4JJ5B 4WO4D 4HXBH 5DHXB 3G5VB 4U0RB 2Y23A 1I1YB 3BISA 1NGXB 5I8CA 3DRQB 3Q1SH 1ZMYA 2ZCKL 1YNKL 4Y4FB 3RVUD 5B38B 2PYFB 5D6DC 4NJ9L 3IXTB 5I76B 4K3EL 3V9FA 1NGZA 1U8PB 5HGAB 4EI5B 4QWWD 5FAAA 4JO1H 3DX8B 4ISVB 2IAND 3T3PE 1NBZA 1VFBA 2X89D 5FYJD 4M1GH 5DR5H 1WWBX 1RJCA 3H9YA 2ATPB 3TO4D 4UV4L 3KYKH 1ZANH 2YRZA 2W1NA 1IILE 3VMPA 4PJGF 2EIZB 2R9HD 3B9VA 2V9TA 3N9GL 4G9DB 1MAJA 2XZZA 1KPVB 4JG0L 4HZLA 3SGEI 5EBGA 2CR6A 4LLDB 1A9EA 2R2HB 3V2AR 4AG4H 5C09E 4E41A 1M1SA 3MLTA 1T04B 1NL0L 1N6UA 3CDGA 3EO1B 4MNQD 4HCRH 4ONFL 3ARDA 4ZFFA 2GCYB 3AAZA 5IP4A 1J88A 1CLYH 4IHOA 4D9LH 5DMIL 2VWEE 3MA9H 2Z92A 4JKKA 2GKIA 4KRMB 2EICA 1Q1JH 3QI9D 5DJ6A 1WWAX 2JB6B 4PRPD 3RJDA 5I1GL 1PKOA 3VDAA 4JLRB 3OAUL 4MD4B 3QEGH 3TLRA 3BKCL 4FZ8L 3REVA 1XMWA 4DGVL 3GEWB 3JWNC 3W9DB 4P49A 5FYJU 3VRLF 1AD9B 3D9AL 5AYUH 5EZLB 4X6FA 5DO2C 2OJEB 1WT5A 5CD3A 4CNIB 1WCBB 5KVGL 4GO6B 3DURA 5I1JL 4G6KH 1KPUB 2ATKB 1JK8A 3LSOA 3SKMB 1EHXA 1UH2A 5F3HB 3VH8B 4ZTPL 4PRHD 4G7VH 5JW3L 3HTLX 4R96B 1IGYB 4V1DB 5EC2A 1QSEA 3MFGB 5C0NC 5HY9B 4X7SH 4XAKE 4Q2ZB 5JNYA 2BOBA 2X70B 1FZMB 1I4FA 4IS6B 4OCMC 1QBLL 4Q74A 1IKNA 1HOCB 1I1FB 2BVQA 2P5WA 4LGPB 3W9EB 4RMUA 3SKOB 5FV2A 1TJIH 3GDBA 2JIXB 1Y0LA 2J5LC 1K6QH 1XCQA 2AGJH 5CP3A 1BZ9A 5HDOA 4MA1B 3RPIB 4X0KB 5D7JC 4K3DL 4CDGC 1NGQL 4QTIL 1U91A 3CCHA 1INQA 2H1PH 4U6VH 1RI8A 6FABL 4BFEA 1BQHG 4MHHI 3IJSA 2BNRB 3BDYL 3CFDA 2Y6SC 4NO2A 3SKUD 3A6CH 2AJXL 4JREC 4UINH 3D6GA 4FFVC 5EZOL 4FQLH 5GGSA 5IBUB 1PKQE 2ADGA 1N64L 1T2XA 1X5GA 2YUXA 4P5MA 1P7HL 3UJJH 3QHZH 2KDGA 2XA8L 2E3VA 3BP4B 3MACL 5I1EH 4XNZB 1P84K 2QSTA 4X6DA 3OZ9L 2R1XB 2X4SB 1ONQA 3ARRA 1AGBA 4KTEH 4P9HL 5C0CA 3MUZ1 1U8JA 4HWUA 2DQIL 2ORBL 2ADFH 2CLZB 5DHYA 5F7YC 4WDIA 3QUYC 3ZTJG 4HIJB 1G6RA 1MNUL 5IR1B 1TTUA 4U3HA 3B9KC 3IETA 4JRXA 4LEXL 5KSUA 3TIEB 4WEBH 1I1RA 4AIZB 4GAYB 4KQ3L 3JVGA 1MCJA 3KXFD 3P11H 5EOQH 4GG6A 3O8XB 4DZ8A 3FO0H 4WWKB 4JY4A 1ZV5A 4KHXH 3TESA 4K23L 1IL1B 4WTZG 5AEAA 1GPOL 2OL3B 4YHIA 4W6YB 5JLZB 3AREB 5GS3A 2XG4A 1NDMA 4I0CC 4JO2H 4NBXB 4QRRD 3RVWC 3NAAH 3G5XA 5HYIA 3QZWB 4FQXA 3FT3A 1R5IA 4K9EL 4OCWH 5INCB 1B88A 4HV8A 1A1MB 1T22A 3HAEH 4ODSL 3GB7A 5D9SA 2E9WA 5DD1H 5JHLH 3D69A 3U83A 1W72A 2M1KA 4NNYB 3NGBB 3SDYL 2X1WL 3U4EA 2FJHA 1S7RB 5FK9A 1K3IA 4PS4H 5DK0A 1PY4A 1AKJB 5MEND 2PO6A 4MX7B 1A7RH 1W0WA 2QV2A 2F8XC 4E41E 2XZAH 4LGSB 4TVPE 4DJMA 3FFCA 4Y4KA 5BVJA 3QNYB 2DM2A 1NJ9B 4NHUB 3SKJL 4F9PC 4LPYA 4LLYA 1PYWB 1KCRL 4M3JA 5FHBL 1FL3A 3CXHK 1LEIA 2B4CL 1UKTA 5EZIL 4AEIH 1T03H 1RIVL 3B43A 3P77B 1NCCH 1L4IA 3FQTB 1NCWL 1D5BB 1I8LA 1FRGH 3RVXC 3H3PL 4UU9A 2Q8AH 3RNQB 4UIMA 3QQ3A 5TDPA 3GRWH 1ZEAH 2VISB 4ZUUA 3ULSB 3VXSD 3UC0L 2ZKHL 3D0VB 4OZFA 2YD1A 1ACZA 3NFSL 2NLJB 3LQZB 3U30C 4X5WB 3K8KA 2NYYC 4XGZA 3M1BA 2NTFB 4GLRH 3QDMB 1U3YA 3D0LA 1QFWH 4CAGA 1FNEB 1U2CA 4LEOB 32C2B 1G9NC 3Q6FB 5HJ3A 2XN9A 5TFSL 2ILLA 4PREB 2AEQL 4K3JH 2OK0L 4C56B 4LSSH 4H25B 5H2BB 3C60B 1QSEE 3C5SB 5HHMD 2VDML 1R3LA 2O26U 4U1KB 1UZ6E 2FWOA 4QGYA 3O81A 4HLJA 1ADQA 5GISH 1YEFL 1HQRA 2P5WE 3C09C 4ODVL 1P84J 5A2LH 3QWOA 3TZVC 3ARSA 1ZGLP 3MRJB 1G7JB 1IKFH 2LTQC 1BVKA 1OW0C 2A0LC 4LSQH 1HHHA 2EEDA 4Y4HD 1WEJH 2WLZA 4P2RD 4U7KA 3TBWA 1ZE3C 4BKLA 4J8RA 1CQYA 1CDGA 1KN2L 2VDQH 5A16A 1S7WA 3MRFB 3MR9B 2Q87A 2YPLD 3GJFK 5F70A 4YXLH 2E27L 2ZP0T 3B9AA 3HB3D 1MCSA 5IESL 1KB5A 2VLJD 4Y5YB 1CT8B 1JJUA 2Z35A 4TPRL 3ULUH 1TQBC 2J8UB 4O00A 1EAPA 1UGNA 4X6DE 4LPVA 1WBZB 5E5MB 2I9LA 4XNXL 1JYWA 1H3VA 2DWDA 4O51B 3VWJD 5C0CE 2NY1D 5DVKA 2Q76B 3V6ZB 3PWPB 3QIUD 3ZE2E 2IAMB 5EBWB 5IB5A 5CSGA 1PBYA 1F90H 4Y8DC 4YDVB 2VKWA 1YDPA 5IV2B 3RTQB 5J4MA 2FX9H 5CEZD 2FSEA 3C5JB 4YR6A 1FYTD 4LSUH 5TGBA 3S8WA 2BVYA 4JRXE 3O6KH 5DJ2A 1F6AB 1C5BH 2OP4H 1FJ1A 4XMPL 1LNUA 4YHPA 3MJ7B 4PGDB 4GG6E 2SEBB 1CL7I 2H3NB 1H0DB 1P6FA 4XXCA 5JHDB 3D85B 2WUCL 1KTDA 1F4XL 3DVNA 1PX4A 4XRCA 1OAYH 4ZD3H 4GUPB 2ZPKH 3KPMB 1YMMB 3LMJL 2Q1EA 4Z78A 1MCFA 4MDJA 2NY5H 3ZSTA 3V5HA 3CFEA 3LDBB 2I9TA 2A9NH 3X12B 5IFJB 1EJ6A 1AE6L 1JL8A 2J6EA 4P3WA 3MNZA 4EIZC 1KTLA 4O2CA 2DKSA 5EUOF 2COQA 2EDJA 3DYPA 3DTXB 3GGWA 4L5FL 1DCLA 4LVNB 4AJ0A 1MCHA 3LV3B 1RFDL 3H0TA 1T1ZA 4YK4C 5DJ8B 4I48A 5GGQH 3EFFB 4P2QA 1CGXA 3H7LA 3EOAB 4HS8L 5MP6H 4NQEA 4KV5E 4O58H 2OXGA 1IGMH 3FHAA 4LLMA 2CDGB 3FFCE 2GTZA 5E6ID 2MQCA 1F00I 2CGRH 4CMHC 3LCYA 1UB6B 4H1LH 4OQ1A 3LZFL 1KGCD 3QJFB 1UWGH 3MGTA 3FN0L 5GIRA 1NGYA 5B39G 1N4XL 3ZE0E 3BN9C 5HD8C 3SO5A 3CNKA 5BXFA 1Q72H 2AXJA 3CU7A 5CEZL 4JZJA 2VZOA 4R97C 3M8OL 4M93B 4XP1H 4QXUL 1JPSH 3F58H 5F1OB 3VJ6A 2YK1L 1A4JA 5T1LD 3HE6D 5L2KB 4NM4H 1U2HA 4LRIA 3JWDH 3DUSB 1CVRA 4N1HB 4WFHE 4APQA 1RZIB 1SEQH 5L0QB 1PD6A 5ANMB 1NCDL 4MAUH 1R5WB 4DN3L 5GZOD 5GGRB 2I26N 3HS0A 4HHAB 3V5DB 2WUBL 1CFTB 4LSVL 4YHYB 2B7DT 1GYAA 2XWJB 2FBOJ 2YPVH 2PNDA 2XN9E 4LRNL 4AL8L 4NZRH 2DBJA 4ZSOA 5A40E 3TCLB 1B6UA 5I17B 3TFKC 3WIHA 5KSVB 2ADJB 1AHWA 3DV4B 4QF1B 4XCCH 1I75A 2OTPA 1ORQB 2AERT 4RQQA 4GG8A 5HYQB 4JFZH 2X4OA 2CLRB 4AIXA 3EYQD 4NZTL 3VCLA 4N0UB 4KI5D 2JLLA 3BH9A 3T4YB 3NPSB 4MSWA 1XGUB 1MFBL 3FOLA 1KCUH 3ZKMD 1U8NA 4QOKA 4ETQA 4YGVA 4KUZL 4Q6IB 3C6LA 3NACL 4IDLA 2RFXB 2DJSA 4XH2B 1D9KB 5CZXD 2DQTL 2EO9A 3DBXB 4D8PB 1FIEA 3SDCC 3MBXL 2P7TB 1HHJA 1A6PA 4FQJL 4PIRF 1N5AB 4G6MH 3HCVB 3HI1A 5CJOL 5KVMC 3DX9A 1UG9A 2PW2A 1DQLH 4LHQB 1ZHNA 5CIPA 5DD3H 2QR0B 2V7NB 2HVJA 1I7RB 1WZ1L 4KMQA 2P42B 5GRVL 4MNHB 4YX2H 1OWWA 1P4LB 1MCKA 2NY3D 2VXTL 1LHZA 1VPOH 4QRTB 2A6KA 4WRLA 3IXAA 2EDTA 2R1WA 2EYSA 2EYTB 4WGWB 3RHWK 4WUUD 3IDIB 1SMAA 4NUGL 3BPCA 4YE4L 3PV7A 2FEDD 3WD5L 4N90D 1JMZA 3LOWA 1VGKA 3KNBB 4KKAD 2IALA 3WS6C 2GAZB 1OWRM 4JPIA 3MLXH 1X7QA 4M62H 4O9HH 3QUML 1MCLA 3VRJA 2PYEB 3NABH 4UT6L 3T0EB 3EYUH 4X7EC 4AH2A 3PJSA 1IZJA 4PG9B 5F3BB 4YDLC 3CX2A 3P0VH 5IM7B 1UWEH 4KKLD 5BRZD 1UZ8B 3U7WH 4KZEH 4PY7B 3QQ9C 4NKMB 5I1AA 2V17L 5C0BA 1DSFL 5GGSY 2XFXA 2JJUA 3K2UH 4PLKC 3BZFB 5HI5C 2PCPB 3E2HB 5C9JA 5INDA 3QEUB 5DMKB 3DGCR 3QUKB 2Z31A 4HH8A 5I2IA 2PN5A 4P2QE 4FXKB 1QLRB 1QPPA 1F4YH 5HI3D 3U9UB 1X4YA 3H3BC 4MA8H 2VR9A 3MLSL 4ENED 4NQEE 5I18L 2NNAB 5FUZL 2OR7A 1HHIA 3SGDI 2EIDA 3AS1A 3KPRB 3TA3D 1YA5A 4UDTB 1U3HA 3HZKA 3MCLL 3OSKA 3VFNA 1QRNA 2P43B 5DA0B 4ZDHA 3TVMD 4YXKH 5DEGA 4P5TD 1U3JA 2OI9C 4UB0H 1AGDB 3IJYB 3ROLA 2DQUL 2PTVA 1IAIL 1L6XA 2VABA 4HZAA 3B9DA 5EDXA 1BFVH 2P46B 4PRDB 4PJDF 3ZKNC 2BRQA 5JOFB 1CGTA 5HGDB 3D48R 4YH6A 1IEBA 4ELKA 3U0WL 5FYKE 1U6AH 1KN4L 3GKZA 1WCQA 4WW2C 3RI5F 2NZIA 4HGMA 4UT9H 1L0YA 3KWWB 4JZNA 4DCQA 1AI1L 1BD2D 1DN2A 1JNNL 4RIRA 3TJEH 3PWJB 1JZ3A 3ZO0A 4MAYD 1ZA6A 3LD8B 4WI5A 4JDVA 2W0PA 5D71H 5EO9A 4P23D 5I1CH 4RAVB 4DK6A 3GI8L 4KTDL 4ZSOE 1Q94B 3KR3L 3QUZC 1X44A 5DC4B 1G7HB 2Q3ZA 5J3HC 1X4ZA 5F7WC 5DWUL 4H20L 4RGOL 4ZPVA 2YXFA 4UQ3B 3F12A 5ALBL 3IFPB 1K8DA 4NQTA 2BSED 3S88H 3T04D 3TIDB 4RMWA 5EUOB 3K4AA 4OLXH 4XPBL 5KN5B 4M5YL 5DRXB 4U6YA 2C7UA 3TT3L 2UWEF 1DEDA 4QXTA 1E6JL 3JV4A 4QOKE 4N9OB 3MMEB 2XWBB 4LAJH 1CVSC 2OR8A 2WINB 2VDLH 4NRZA 5ISZA 2WSKA 1CE1H 4PJHB 1A3LL 4ZFZA 2FJGA 1FFNA 3DX7A 4TSCH 1UCTA 2EKSA 3BQUA 4JFPB 1QR4A 4LIQE 1HDMA 5DQJB 4P46B 1X5LA 3K74B 4EN3D 5DLML 3T2NH 2VAAA 3CFKB 1HYRC 3MLWH 4OF8A 1MI5B 4M6OL 3SDDB 1KEGL 1QSVA 1GZPA 4S1DD 4EI5D 1YEDA 1CS6A 3TNMA 2D0HA 2MQ0A 2R4RL 3FB5A 1CE6B 5TQ2H 4NO5A 1H5BA 3VXTA 5FB8A 1S5HB 1FN4B 3DMMA 4JDZA 4JAMB 4LQFL 4R0LA 3FO2B 1OAXL 2CSPA 4M43H 2JJSA 3EAKA 4Z7NE 2OTUB 3VFMB 2DRUA 4FQ2L 3OB0H 3VFGL 5D4QA 2Y36H 5E8DH 4C55A 1GC1H 2HT4D 4KUCF 1I7UA 2HG5A 1S3KH 2HH0H 3DROB 4G7YH 4WFGE 4I4WA 5HSFA 1U9KA 2YEZA 3KYNA 4G5ZL 3BKYH 4HIHB 3RJQB 3L5HA 1WBYB 5HXMA 2Z8VC 4ZXBA 3EDKA 5FKAB 4HUNB 1HINH 3HAEB 3GBMH 2R56H 1FSKC 2Y5TB 1A6WH 1SBSH 3RX7A 3WJJA 1G9ML 4EUPA 5T3ZD 2XA3A 3L3DA 2EH8H 4DN4H 3DVIA 2VDOL 5CZVH 5C0BE 4U1IB 2VLRB 4N0RA 3HC3L 3NFPA 1T1WA 2CLVB 1NC4B 5C70A 4G8GA 4EIGB 5BMFH 3NCYS 1MHEB 3M07A 1J05B 4KJWD 3ARTA 3RU8H 4D0DA 2G9HA 1TNNA 4PBWD 1IC7L 3O4OB 2YHGA 1R3HB 2KBGA 3G6JB 4ZUVB 4NC1C 3QZWG 4QYOB 5C07D 5ECJE 4E42A 4NSKA 1TJGL 2FLBT 4KPHL 5IWLA 3OWEA 1WLHA 1CR9L 3LIZL 3LPWA 3UJIH 1QRNE 5D2NB 3IDYC 3P4NA 4D0BB 4CJ0A 2VZSA 3ZYIA 4WI3A 1JWMB 4V1DD 3TN0A 5E1HB 3EDFA 5D1XB 2XPGB 4MD0A 4IRSC 1DBBH 1NH6A 1W2KT 1UZ6F 1CDBA 4HUVA 5SWSB 3WO4C 4YHLL 1FNHA 2CXKA 2MPAH 3L9RA 3WV0A 5B8CC 5JPMA 1CFQB 1MOEA 4LNVA 2VERN 4Y1AB 2QHRL 2VAJA 4KK9C 4ZQKA 2HJLA 3VFPA 4G6AC 1GZQB 2VDPH 5EO0A 2CRZA 1VFOA 1YY9C 2BNRD 2CMRH 3QUXA 2XOTA 4ONHB 6CGTA 4HXAH 4GW1B 1MCDA 3JUYA 3VGEA 3ARZA 1JGEB 1R5VB 3S5LB 2BRRH 1LEGA 1FPTH 2K7PA 3O11A 4MJID 3FO9A 1I9JL 3MZTA 3GO1L 5DRNA 1OGAA 4WFEE 5LGKA 1CD8A 1M6OA 1PQZA 3RWEA 5T3XD 2LFGA 1X5ZA 5E0QA 1CICC 1P7KA 4WIQA 4CMMB 3FMGH 1SY6H 5DT1H 4CVZA 4GBXA 4OUOA 4YIQA 5H94B 2NW3A 3BEVB 2J8OA 3UTTA 3T3MF 3DOSA 2O5XH 3CVIL 4MJ6B 4KKCC 2ZCLH 3GMRB 1T4KA 3RGVA 4MXQC 3WS3B 5ISZE 1TDQA 4UAOB 3T65B 4OD1H 5BCAA 4OCNC 3WCYA 4HWBL 4X9IA 4YLQT 4A6YH 1HKLL 4NN7C 1KYOK 4PJ9C 3S37H 4QRQB 1DTUA 1KJMB 1KIUA 1QFPA 2M8XA 5I30L 3VW3H 4WWKD 2VLLA 4LASL 2YBRA 5D1ZB 3SCMC 3GMLA 5KOVC 1CD0A 3ARED 4FP8H 4L4JA 3RBGA 3HR5B 4MXVE 2JK5A 1N6QH 3EJYC 4ELMF 4X5LA 1KTKE 1EGJL 3O2VH 5ITFA 3QXDA 5SV4A 5HI4C 1ZLWK 3IAPA 4N8CL 4LSTL 1B4JH 5JMOC 4PJDB 1KG0B 2IFFH 4YPGB 2ZCHH 4RA3A 4F7EB 4Q9RL 4OD2B 1RUQH 4LDEB 1U58B 3LS5L 3GKWL 2A6DB 2BY1A 1FNAA 2C1PA 3OX8A 5E4EB 1OP5H 3FCTB 2FDBP 1JNLL 2G75A 3DX6A 3RWGB 3ARGB 5K9JL 2ZOLA 3S3SA 3ECBB 4YHMH 1AKJD 3EKCA 3VXMB 4MA3B 1AO7A 3WFDL 3H9HA 4HX1A 1TJHH 3WFHB 1EXUB 3HI5H 1ZLUH 5C7XH 4MVBC 3WE6B 3ZDZF 1F42A 2UVFA 4JY6A 2X4QB 3DVGA 3GSNA 2ZNXA 3TP4A 4QTHB 2IG2H 2H41A 2R23B 5LVEA 3ZE0F 5I15L 3H9ZA 1K4DB 3G04B 3BGFC 5IFAH 3RWFA 1A3QA 1MIMH 4WO4A 5DJXA 4Y5XA 2NX5A 3FT4A 3STZB 3IFLL 4G8GE 8CGTA 4HIXL 4P2YA 3N1GC 1TZIA 4I5BB 1DQML 2UWEB 3ISWA 4FQPA 4BJLA 1P2CB 3VFVB 3BYYA 4YFLI 4LLWB 4OFYD 1GIGH 3OXSA 1XCTB 2AJ3B 5FYLL 1E4XL 1MH5A 4H1LB 1YEKH 1T1XB 5L9DL 1L7IL 2CK0L 3RVVD 3QIWB 2IANA 3QDMD 2WIIA 2X89A 4NQSB 3FQWA 1RZ8A 4ZG1A 3DSFH 12E8L 1BP3B 5GJSL 1MJ7L 3ZDYE 3BZEB 5EOTB 3NN8A 4N8PA 2VXVH 1HHGB 1EJOH 1RURH 2A1WH 1WC7A 3CFBB 2PXYC 5F9OL 2FX8H 5IMKB 1NEZA 2XTJB 1KBGH 1TVHA 3C5ZC 3PWNA 4C56D 2BSSB 1RULL 3C60D 3U48A 5HGBB 2LVCA 3Q48A 4I0PC 2BNQA 1QSFB 5CILH 1D5ZB 2EXYD 3CZJA 1FAKT 4J23A 3QIBA 5F6IC 3VRIA 4MNQA 3FT2A 5DK3A 5HVFB 4JY5L 3FOMA 2FNBA 3GZKA 4MMXC 4RGNB 1UCBL 4ZOBA 4F57L 4DGYL 1CG9B 5I16B 3G6AB 1JGUL 5FFLA 5HGHB 5C08A 2AJVH 4LU5H 5MI0B 2IMNA 2YC1B 5M7QA 4UILL 1HI6A 4PRPA 2YR3A 2Y07L 4JFDB 1A0QL 2EE3A 5E2WL 4LL9A 5HYSA 3MFFA 1T20B 1LEKB 4YNYA 4NYLB 2C3WA 3CFJA 3HG1D 3BSZH 2HLFC 5IHUL 1V7ML 1J9CT 2OSLA 1OGAE 3KLAB 1OQXA 4JANA 5LQBL 5C0IA 3I6GA 4NN6C 3EUUA 5DEFB 5GRWA 4E0RB 2EC8A 3PWPD 4R7DB 3SKNB 4I13B 3THMH 2WP3O 5IW6B 1ND0B 3ALXA 5GRXG 5KAQF 4P57A 5KG9B 2IAMD 4QRUB 3O3UN 5ADOH 1WITA 1MLBB 2L7UA 1BZQK 3CMGA 1DN0B 3RTQD 3L3JA 2GITA 5KBNC 3UTTE 2LE9A 2BSRB 43C9B 1EFQA 2VLKB 1VKXB 3OKNB 1MVUA 1AR1C 3QXTA 3CVHH 2JJTC 5FM5O 4GXUN 2WBJD 4JO4H 4F7CB 5IB1B 2X4RA 3LKNB 2BJMH 4HJ0C 2OZ4A 3RWDB 2DQJL 4TQEH 4OZIF 4ACPA 3LB6D 3KDMA 1ZS8A 5JHDD 1N6VA 3D85D 2BVPB 3QNXB 3FB7A 4YHOH 3CFCL 1S5IL 4X98A 4HQQH 1NBYA 3BVNB 2GJ6B 3V0VA 1WFNA 2AABH 1Z3GH 5IEKA 3BP7B 1S7VB 4GXUM 4R4FL 3WNPA 5HYJB 5ENWA 2VDKH 4NP4L 5CMAA 3BPNB 1HH6B 2Y06L 4JRWA 5DMGD 4M00A 2X7LA 2A6JB 4GKZB 3FQUB 1INEH 1N26A 4Y16C 2XRAL 1CD9B 1J1PH 4YDKH 3OKMB 2DBLH 4JFQA 5IW1B 4NNPL 1VA9A 5DEZA 5ID1A 4RBPK 3ZSSA 1LE9A 4N8VG 4DZBB 2NCMA 3GFUA 3UTSD 4F58H 2ITDA 2B2XH 3HMXH 4QRSB 3R8QA 2Z91A 3WNNA 5F9JA 4KDWA 4F15B 3PWLB 3TBVB 3UTPD 3MODH 1AO7E 2H26B 4P4KC 3IGAB 3GBNL 3U79A 1WZKA 4PLJD 5F71A 3OKDA 1I3RA 4NDMA 4OV6F 4NHCL 2APVA 3ETBF 3V6BR 1AGFB 3X13A 2V6HA 1K5NA 4GKSB 2WWKO 8FABB 2QSCL 3X17A 4D0CB 1P9MA 3ZL4L 3KPOA 4HFWA 4PRBA 2IQAA 2NZ9C 3H8NA 3IDMB 3KXFA 3R06B 1KELL 4OZHF 5L2JA 2NX5E 3L7EB 3NMEA 1EUUA 4O5LL 2L4OA 4XNQB 4WUKL 4WY7H 5C9KA 4LCWB 5CUSL 4OM1H 3IF1B 4DOHE 4G8FA 1R3JB 3LQAH 5EBLB 4XC3L 1QVOA 4QRRA 1FNGA 1YMHA 3QG6B 1TMCB 2DYPA 4XMLH 2P8PA 2IANE 1OD7A 4LDLB 5FM8A 5FYJE 1FBIH 1FE8H 3JV5A 1F4WL 2LABA 3EBAA 5D8JH 4KJYA 3TT1L 1JF5A 1FG2B 2BMKB 1CLZH 3EGSB 4FG6C 3S6CA 2KZ1B 2HTKD 3T77A 1JN6A 4HFUH 1XF4A 3LPFA 2YMXH 4YHZL 2IPTL 2AV7A 1GGBL 3FO1A 4BH7B 4ELMB 1ZAGA 1R3IH 2X2YA 3LPGA 1HSAA 1P4BL 2BNQE 1JV5B 2B39A 3QPXH 4JM2B 4U1LB 1KC5L 1MAKA 4S1SH 4KROC 2FB4H 3PF2A 4MNQE 1U8QA 1MHCA 4U6HB 2UUDK 3D1MC 3AXLA 1ZLVK 4HSQA 4PYGA 1P5VA 3QWRD 1T83A 2F8VA 5IJKC 2FYYB 4GS7C 3SN6N 1UB5B 4NUJA 2P48B 5C0FA 1V3LA 2CO6B 4NCDA 5GRJL 1BQHA 5C08E 4YBHA 3KJ6H 3IB4A 4WHTB 2IQ9L 4QHLB 4XI5C 4PRPE 3L3KB 3ULVH 3CD4A 1D9KD 1OT2A 4TUJA 3CH8A 3FQNA 2GIYA 4XVJH 1RZGA 2F9BT 3PHOA 5I1DA 1L6ZA 2HTLC 4ODTH 1TENA 1J18A 5I8EA 2EDWA 2DWEA 4J6RL 4PJAA 1XEDA 1J0ZA 1I8KB 4DKDC 1CK0H 4XVSH 3VXSA 1KENH 4YQXL 1BFOB 2GSIB 1JZ4A 5CJXA 3D3VB 1JHLL 1A21A 5E08H 2XQBH 5I1HL 4LOUC 5LG1A 1MWAL 1QFUL 1H9VA 4RISL 1KIQB 2B0SH 1S9YB 5E9DB 1MQKH 2J7LA 2F5BH 2CKBH 3BIAX 2Q3AA 3P30H 3E6HB 1AGEA 3BO8A 1Z0NA 1XGPB 1LO2L 2XKNB 3QO0B 4L8SA 4XNMA 1U8MB 1T7WA 4WVRA 1SYVB 4RA0C 2H32A 5CGYD 4F37F 5DUPH 5C8JB 1PJ9A 2ARJB 1DLHA 2I60H 3O2WH 4C4KT 4G42B 1G7IA 2J4WL 2X9YA 4BQ6A 4DVRL 2PYED 2JTDA 3MLPA 4I77L 3T0ED 1RUML 1T7VA 1LO0H 2NY6C 2AEPH 2VQ1B 3BWUC 4M8QB 4P2RA 5EUKB 3HFML 4PJFA 4JCLA 5DHVH 4UBDD 3RUGA 3GMMB 3C08L 1JRHI 4U1NA 1YYLH 1EZVX 3BDXA 4YWGH 1N59B 4Z7OE 1QQDA 2YPLA 3VXUB 3C8DA 2FH8A 5J9PB 4R2GC 2VXUL 3GSRB 5D70L 2F54B 4Y5VB 4XPAH 4LCIL 4XVTH 3QNZB 1TQCC 3INUL 1IC4L 2ICWJ 3V0AC 2VDRH 2G60L 2GUOB 1OQOA 4MZ2A 4JKLA 3BESR 4JG1L 4HJJH 1BBJB 2YS4A 3ZHKA 4BSVB 5SV3A 3QIUA 3QT2A 4RFOH 4HLZG 4RMTA 4XPFL 4J3TA 1VGEL 3KPRD 4GMSL 1WFTA 3BZ4A 2BY0A 4PJIA 3L1OL 2DMBA 3GMQA 4OI9A 2NY0B 2DS4A 2H2SD 2ZCKH 1YNKH 4Y2DA 4MYWB 1AGCB 3LN5B 1UT9A 1QO3B 1NPUA 3PGCB 3ZE1F 3RX8A 3KXFE 3L5JA 4K3EH 1LD9A 2Q7NA 5D7JD 1NDGB 4XPHL 3RWHA 3KPNB 2C4FT 4XB8A 1KJ3L 5JW4Q 1A3RL 3SE4A 2IADA 4FFVD 3HAEG 5EFIB 2FIRT 4QRRE 3RZCB 1MCBA 1MIEL 4UV4H 3JBG7 5IBLD 1HHKA 1HIML 1CLOL 1PG7X 3OMZA 1IGTA 4NN5B 3I6KB 5IG7B 5M95B 4JG0H 1PG7L 3WL9B 1CF8L 1C5CL 2MTPA 4OZIB 5ICXA 5JW5B 3MROB 1SMOA 4EXKA 1OP9A 3VXNA 3FONB 4LLUB 5CFHA 1NL0H 1ITBB 4ONFH 1J0YA 4MJ2A 5J1AA 4O2EA 4U31A 4WNQB 4Z77B 1HXYB 3QUYD 5IF0A 1Z5LB 3AROA 4J12A 5DMIH 5F6HI 5E1AB 5E6IA 2YZ8A 4L8DA 4RWYL 4AENA 5GSVB 1FVEA 5GS1A 5I1GH 4KK6C 2PW1B 3O6FB 2OM5A 1AY1L 3OAUH 1T1YB 3QEQB 5F1IA 3L95A 4OIBA 3TO2A 3MJ8B 3BKCH 4BH8B 4FZ8H 3W2DL 4DGVH 1Z9MA 2VWEC 4HIIA 1QSZA 3D9AH 3HR6A 3UDWC 3OKOA 3QDJB 1MCPL 4GRWE 5KVGH 3RVWD 1RZKC 3AVEA 1D5IL 4M1CD 4PJAE 1FVDA 5T1LA 4X6EA 5I1JH 3HE6A 3MSPA 4P46D 1HZHL 4RGMC 3VXSE 5J11C 1KB9J 2O61B 1WVZA 3MUGA 1EBAA 4JZOA 1MI5D 3SDDD 3M17A 3E6FB 3O45B 4OGAC 1OF2A 4H8WC 5E6YA 4OZHB 5JW3H 2NR6C 4BSWB 4JFED 3U0TB 4S11A 4A6YB 5J6HB 4X7SL 1QBLH 1ZVYA 3RWJA 3VGAB 5EZJA 4J2XA 2JCCB 2YSSB 5HHME 1UVQA 1DJSA 3LN4A 4O2FB 4Z76B 2ZOKB 3PHQA 4MCYB 4OCLC 5B3JE 1FCGA 4N5ED 3L3OB 1TJIL 1DVFB 1C08B 4K3DH 5HHOB 1SJHB 3O9WC 1NGQH 1RHHB 4QTIH 5A3IC 6FABH 5MHSD 5I1LB 3JTTA 1M71A 5D1QB 3BDYH 1SYSA 2AJXH 4CN1A 4WJ5A 2A73A 3QFDB 2P8MA 2DI7A 5J1TC 4P2RE 5EZOH 4WV1C 4PJFE 3RY4A 3A6CL 3MOQA 1N64H 4L8BB 1IAOB 4UINL 5FGSA 3RUGE 2FECI 4JFXB 1GGIL 3MACH 2VLRD 4CUCA 2YPLE 4S0SD 1NC4D 3BFOA 3OZ9H 1XF3A 3ULVF 3UPRA 4P9HH 2UV3A 2R2EB 5EPMA 1UJ3C 3OGOE 2X4NA 5KSAB 2DQIH 2ORBH 3R4DA 3MUY1 3GJFA 4KQ4L 5BQ7B 5EBMA 4YDIL 2NXZC 5D7KD 1NAML 3EYOB 1MNUH 3B5GA 4RZCB 4LVEA 4PJ8B 4LEXH 1MVFA 5LJYH 3P4OB 2DLHA 4KQ3H 3BHBB 5B39A 3ZYOA 4LCCC 4PJIE 1MJJB 1BZ7A 2ZUUA 3OKEB 4YC2B 3P11L 5JXEC 5EOQL 4MQXD 4GW4B 1KNOA 5I0DA 4K23H 3TZVD 1XIWC 1GPOH 43CAA 1CLCA 2A0LD 2P4AB 2FJFA 4KHXL 4P5KB 5DTFA 5SWSD 5FGCE 4IRZL 1MAML 3O3BB 3AU1B 5MEPB 1TPXC 3WIIL 3BD3A 4K9EH 1SM3L 1JI2A 2YZ1A 3BH8B 3NAAL 4RX4D 4M6ML 4HMDA 4ODSH 3MXWL 5I8KL 2W38A 3NFNA 1UXWB 2CIKA 3MYJB 4XBPA 5ICZA 5BRZA 3QULA 3J7HA 4ZFOL 3K1DA 5C0JA 5CGMA 3SDYH 4C59B 2VITB 1WQVT 3SO3C 4HUWA 3I02B 1IM3B 5D2LA 4LHUG 5K59F 4U1GB 4OFDA 3EOTH 3KHQA 4NWUH 3WIFA 1E28A 2X1OA 2D7NA 4H1LG 1NUFA 4GH7B 1KCRH 1EZVY 3DPBA 2Q7YB 1G9NL 1FORL 1C12B 5FHBH 4PGJA 3P9LA 1ERNA 1IGJB 1K2DA 2B4CH 3DVFA 4IOFC 1S7XB 5T5NG 4N0FB 3IT8D 5FUOL 3V6FB 1RIVH 1KGCE 1T7XA 5A2FA 1NCWH 1SJVA 4PFEA 4QHKJ 3TVMA 3H3PH 4AT6A 3BEWA 5IB2A 1NCCL 3HMWL 3OJVC 4WI8A 5IHZA 3ULUD 1J11A 3KHOA 3UC0H 2BHZA 3QXAA 2ZKHH 4QKXB 5E8EB 5CWSB 3QCUL 1ZEAL 3K4ZA 3NFSH 4UQ2A 1HH9B 1JWSA 1X5XA 4K55A 4PRIB 1AXSB 5D1ZD 3VD3A 2X4PB 1JHTA 4G8EA 1FZJA 5TFSH 1NUNB 4DKFL 1KLGA 1WT5C 2NY2B 4MAYA 2AEQH 5KSBF 2OK0H 2FO4B 4OQTA 5FO9A 4IOIA 3ELAT 2VDMH 3CVHB 4Z0XB 1QEWA 4CW1A 1A6ZA 1K8IB 3WXWH 2MSPA 3WUWB 4ZOAA 2VN7A 3FRUB 3CDYA 1JGDB 3WHE0 1YEFH 5EH1A 1XR8A 35C8L 5AD0B 3ARPA 4ODVH 5TPWL 5EORL 3ARGD 3S36X 4GRLB 5D7IB 3UMTA 4X9FA 3S36L 3VXMD 5F7DB 1JWUB 3BN9D 3SDCA 4FFWD 4KI5E 1IKNC 1KN2H 1A1OB 3P73A 1JE6A 5KOMC 3CH1B 1KLUB 4K7PY 1UM4L 1QOKA 2E27H 2GT9A 1U8OA 3QFJD 5IESH 3HUJA 2GFBA 4F33A 3IDJB 1JBJA 4TPRH 1G6RH 4JJ5A 3UYRL 3G5VA 5LAXB 1AIFB 1I1YA 1NGXA 5DFTA 3DRQA 4XNXH 3IFNH 3U46A 4Y4FA 4LHUD 3GUTB 5B38A 2PYFA 4I1NB 1Q9WB 1K85A 3IXTA 4OM0L 5GGVL 1U8PA 5HGAA 2AK4D 4L3EB 5GJTL 4EI5A 1A14L 1LP9F 4XWOC 1IGIL 1WAAA 2K1MA 3DX8A 4X99B 3QIWD 4ISVA 5T1MB 3WDHA 2G2RB 2XG5A 3A6BL 1ACYL 3ZTJH 1RZJC 2VLMD 2MKLC 2ATPA 1MHHB 4XMPH 2DKMA 5SX5K 4JGMA 2IBBA 1UEMA 3I50L 4N90E 2XTJD 4G9DA 3L3IB 5EIQA 1KPVA 4HC1L 2DLIA 3K1KC 2WUCH 1JPFB 5ESAB 4DKAA 1F4XH 1GH7A 3HKFA 4LLDA 4MJ4A 3MLVL 4X4XB 3LMJH 2R39A 1QSFD 4KMTL 3JVGC 1OARL 3QH3B 1T04A 3EO1A 5E2VL 4TNWK 3WN5B 1AE6H 2GCYA 4RGND 3WKML 3SPVA 3PDOA 5GGUB 2A9NL 4L5FH 4G9FD 4IM8A 1NFDF 5GS2D 4N0YL 1RFDH 5BRZE 5HDBF 2JB6A 1U42A 2VH5L 2N1KA 4FQXC 4JLRA 4MD4A 2C3XA 1P1ZB 5E5UB 2Y4SA 3MOAL 3UTZB 3W9DA 4OKDA 4P0DA 2XTLA 1AD9A 5D2LE 4IMLB 5F9WC 5EZLA 4Y8AA 2AQ3A 2ESVD 1OLZA 1IGML 2OJEA 5CSBA 4YHNB 3MBEB 4CNIA 1WCBA 4G80B 1UA6L 4HIEB 1IGCL 1V8HA 3LZFH 4HKXB 3FN0H 4GQ9L 1KPUA 1N4XH 3SDXF 3SKMA 2PO6C 5F3HA 3ZKXC 1EHLL 1UWGL 3HZYB 1O7SA 3VH8A 1O7VA 5DUML 5C0DB 5CEZH 4WFFD 1DQJB 3LEYL 1NLDL 2NXYC 4QXUH 1QHOA 5H8DA 4R96A 3B2UC 4Z0BL 4M9OA 3RDTB 1IGYA 2YK1H 4V1DA 4NQVB 5HY9A 1EVTC 4Q2ZA 1FVCB 2X70A 2HMID 3MRQB 4KVCL 3OG6B 4IS6A 2DJUA 1HOCA 1NCDH 5F7HA 1I1FA 3MRCA 2AXHA 3W9EA 4DN3H 1I8LC 3SKOA 4TTGA 3VD9A 1VFUA 2JIXA 3OB0K 1DBJL 2DAVA 4MAUL 2A74B 2WUBH 5HI5D 4LSVH 3RPIA 4X0KA 4Q9QL 2CKBB 2GJ6D 1YY8B 4LRNH 4AL8H 5A2KH 4M8VA 5EIIB 3X3FL 3WFCL 1I1AB 4K07A 3LQMA 3PABB 5GHWL 4KRPC 4NKOB 2BNRA 4HG4J 3SY0B 1MCNA 3L5IA 1PAMA 2MNUA 3ME0A 4XCCL 3PQYB 4ODXB 1I7ZB 4PJ7B 3K81A 1X4XA 3BP4A 2A9ML 4NZTH 3BMWA 1ODAA 2Z8WC 2R1XA 1C16B 2X4SA 4HH9B 4IIQB 4PRAB 5F89A 2P49B 3TJHC 1YN7B 5DHVB 2BERA 1IM9B 4KUZH 3NACH 4C83B 5LWYL 3OKYA 2L0DA 2CLZA 2DQTH 5IFHL 2ZG2A 4OLEA 3MBXH 3PL6B 2VE6B 4HIJA 4TSAL 5IR1A 4FQJH 4R90L 5A2JH 3HUJE 3JV6B 3TIEA 5CJOH 4AIZA 4GAYA 3TNNB 1S9VB 2OCFD 5F44A 4N0CD 5J06A 5J0BA 3BPLC 5IB3A 3CDFA 1WZ1H 3O8XA 4MS8C 2VZTA 3QXWA 4LCWD 4X4YB 1IL1A 2VXTH 2OL3A 3VGFA 5JLZA 3AREA 4G3YH 5HPMB 1OOAA 2FBJL 2N56A 2W0LA 4NUGH 4ZFGL 1WAAE 3QZWA 3WD5H 4WTWA 3SDAB 5INCA 3UBXB 3LEXB 3Q0HA 1A1MA 1BAFL 5HVHC 3X11B 4K3HA 3HC4L 4U4BA 2VNCA 4ZNEA 1JF6A 1JUFB 3WEXB 3I75B 1YEIL 4NNYA 3IS1X 4L3AA 4RFNC 2NW2B 3QUMH 4XNYL 1Q38A 4NO0B 3MLXL 2F8OA 4TTDD 1S7RA 4UT6H 1QFWM 2J12B 2CJUL 3ESUF 1BWMA 3C2SA 1AKJA 1TZHB 4MX7A 5KSBB 1JYVA 1U8KB 4JM2D 5C0AD 2PKDA 2FL5B 3OTTA 2PETA 1DBAL 1XGYL 1F8TL 2J88L 3G5YB 3QNYA 1NJ9A 4NHUA 3UCRA 2V17H 4XXCC 3VGDA 1DSFH 1T6VN 4BFIB 1PYWA 3F6LA 1P5UA 3T1FB 5T3ZE 1A4KB 2VIRB 3P77A 1DQQB 3FQTA 3PGDB 3IFOB 1D5BA 3WO3B 2RHEA 3HLAB 5JQHC 1DP0A 3RNQA 1IARB 3MLSH 5KAQG 1F4YL 5I18H 5FV1L 5DQDL 1NGWB 2VISA 5FUZH 3ULSA 4YUEL 4MA8L 1EMTL 3BGAA 2I25N 3D0VA 3MV7A 4XWGL 3GM0A 1LO3L 4F2MB 2NLJA 3LQZA 3KYOB 4X5WA 4PBVC 1F97A 4XAWL 3D3VD 3ET9F 4U7MA 3MCLH 3JWOC 2NTFA 3QDMA 3VXOB 4HGWB 1FNEA 2EH7L 3V4UL 2HWZL 5B8CA 5E9DD 4LEOA 32C2A 2DQUH 1IAIH 2BVTA 1RY7B 1D5XB 4PREA 5GGVY 5JUEL 2JE8A 4C56A 1G7MB 4H25A 3C60A 4V1DE 5F96L 5H2BA 3C5SA 3U0WH 1LP9B 1MREL 1SJXA 1MFAL 3FFDB 4Z7VF 1KN4H 1MHPL 4U1KA 1NCNA 4JZJC 5CP7A 5ADPL 1QBBA 4MCZB 5HVGB 5J13B 1AI1H 3UAJD 1IRAY 1JNNH 1BQLL 1YECL 1BIIB 3TO4B 3MRJA 1G7JA 5ETUB 2EDOA 3H2WA 4CVXB 4LRIC 3GI8H 1F5WA 1XH3B 4APQC 3OAZK 4KTDH 2APWA 1H3XA 4KK5C 2BNRE 4AEFA 3MRHB 4ZUTB 1ZLUK 5IGXL 5DWUH 4MQ7A 3MRFA 3MR9A 4H20H 4RGOH 3TH3T 4OB5L 5FCSH 1IVLA 5ALBH 3IU4L 4Y5YA 4L4TB 4IRJB 1CT8A 2IEPA 3QA3B 3KJ4B 3TBTB 2J8UA 3VMOA 2EDKA 4XPBH 2RJMA 2Z0BA 1WBZA 1NFDB 3EYFB 4M5YH 1AHWC 5E5MA 5T3XE 4URTB 3NIDE 4O51A 3TT3H 3QI9B 1E6JH 2HKFL 2Q76A 3V6ZA 3PWPA 5ACMA 5EU6D 5SWZB 1YQVL 2DMCA 2IAMA 5E4IA 5EBWA 2GTWB 4YDVA 2EDLA 5IV2A 3RTQA 5I73B 1A3LH 2CDEB 3OJMB 3C5JA 2NY0D 1OAZL 4PPTA 5BS0D 3K8LA 4TSCL 1QA9B 4EZMA 3C6LC 5DLMH 3MJ7A 4JFYB 1UH4A 3SDXB 4M6OH 4PGDA 1KEGH 5KANG 2SEBA 2H3NA 1H0DA 1BFTA 2R4RH 2VB5A 4Z5RB 3D85A 5JHDA 1GXEA 4G6AD 3T0BA 1YY9D 4F37K 4GUPA 4PRHB 3KPMA 4IJ3B 1YMMA 1WBXB 1VFBB 4M7LL 2K7QA 5JMRA 3RZCD 1QZ1A 3S96B 4LQFH 1OAXH 5EG6C 4LNRA 4Z7WB 3X12A 5IFJA 2I07B 4FQ2H 1OTSD 4RFEB 3UP1A 3VFGH 2DIJA 3MRPB 3DTXA 4ZNEE 5FO8B 3BD4A 1CICD 3LV3A 4UZGA 3LKSB 2RIKA 3KPLB 2Q86B 4G5ZH 2N7BA 5DJ8A 4K7FB 2HH0L 2RAMA 2NY7L 3EFFA 4F7TB 5DJCB 5GGTL 1KJVB 3ARDB 3EOAA 1KTRL 2IPKB 3TYFB 3QQ4B 2CDGA 3O4LD 1G9MH 3LH2L 4FABH 5I6XB 4U6XB 1NAKL 2VDOH 3HC3H 1UB6A 2DJ4A 3O6FD 4X7CC 3QJFA 1OY3B 2VL5B 3QEQD 2WMPA 3X3GL 3MRIB 3U7YL 3VA6A 2AV1B 4HGKC 4P4RB 1L9NA 1S7UB 2CXGA 3SCMD 3QDJD 1IC7H 4U1MB 4L8CB 4PJXF 1SQ2N 5HI4D 1FGNL 5FF6A 3EFDL 5L2KA 3C5ZA 3DO7B 3DUSA 1IFHL 5JORB 5CCKL 1RZIA 3CK0L 5ANMA 1TJGH 1FGVL 2Z31C 5E56A 1FZOB 4KPHH 4X9GA 2G5BB 1CR9H 5FHAL 2AXGB 3LIZH 3TF7C 1FLTX 4GLRI 3QDME 1KJ2L 5HBBA 1E4KA 5GGRA 1QFWI 1Z0MA 3V52H 4HHAA 3V5DA 1CFTA 4K94C 4NKIL 4I9WE 4JRYA 2XWJA 2R0KL 2KKQA 2VR4A 3TCLA 5I17A 4FQIL 5KSVA 1S7QB 2ADJA 1RK0B 3DV4A 4QF1A 4YHLH 1U3HC 5E94A 4C56E 5ESQB 5BW7C 2DDQL 4ONGL 1ORQA 3FN3A 1XGRB 3UO1L 5HYQA 1QHPA 4MLSA 2QHRH 4FXGB 1HYSD 5HHOD 1WWWX 2CLRA 1U8IB 3IDXL 1UYWL 3UXFA 1RHFA 4N0UA 1EEZB 4KI5F 4F7MB 4YEFA 1U91B 2ED8A 1INQB 3QWRA 3V6OA 4KTYA 3NPZB 2RCSL 2GJJA 3CFDB 1KACB 4P99A 5DVLA 2YD4A 3BP6B 4POZD 4Q6IA 3QDGD 1MUJB 2RFXA 4XH2A 3RWCA 1D9KA 3DBXA 4KRLB 4X7TB 3GO1H 4D8PA 1HCVA 2P7TA 3RNKB 5ESVB 1DUZA 1N5AA 3PIQB 3HCVA 2ICEB 1WF5A 3CZFB 1JYNA 1AD0B 1ZLSH 2J8UE 1Y6MR 5KSAD 3VG9C 1ZT1B 4JFHE 2QR0A 2V7NA 1I7RA 3WJLA 2PXYD 4MNHA 4HPYL 3PWPE 2UZIL 1P4LA 2D03H 3CVIH 2ZWLT 2R1YB 4PJ8D 4BQCA 1G6RB 4QRTA 4NNXB 2EYTA 3VRLE 3IDIA 4HWBH 1T5XB 1HKLH 5IQ9B 3WLWC 2R0LL 5KJRL 3MOBL 3KNBA 5I30H 5ID0B 1BF8A 1VADB 3S37L 25C8L 4LASH 2GAZA 5CAYB 1UXSA 4TULH 4YHIB 3TCXA 5C1MB 4ZODA 1EGJH 5JHDE 2PYEA 2BCKB 3T0EA 3BQUC 4LSTH 4N8CH 3AB0B 4PG9A 1YMME 5F3BA 4Q9RH 3LS5H 3GKWH 2ZSWB 1UZ8A 4PY7A 4NKMA 2R8SL 3BX7C 3C8HA 4E5XB 4R3SB 3BZFA 3KGRA 1JNLH 4QXGL 2PCPA 5AUMB 4ZTOH 3DETC 5K9JH 5DJYB 4BUGA 3HPLB 4LKXB 4FQ1L 4YBQD 4EDXB 3QEUA 5DMKA 3WFDH 4HCRA 1KT2B 3QUKA 3IVKA 4R0LC 1F6LL 1ZT4B 4FXKA 2AI0L 1QLRA 2JJSC 4Y4HB 4Y4KB 3U9UA 4OV5B 4J3OC 3HNTL 3UTPE 4D9RE 4H26B 3MLUL 3NCYP 5C7XL 5IQ7L 3AM8A 5AWNL 2NNAA 2E7CA 5LGJB 4OIAA 5I15H 3BXNB 1HILB 3F7VA 1PFCA 5JPNB 3KPRA 4UDTA 1D6EB 4ZXBC 1GCFA 4Q97A 3QDHA 5FDWB 4HJ0D 3IFLH 4HIXH 1E27B 3P40A 2ICES 3VWJB 1AGDA 3IJYA 3WJJC 3CSYB 3BUYB 4PRDA 4RMVA 5FYLH 1E4XH 4X4ZA 5JOFA 5HGDA 4NQCD 5L9DH 1L7IH 2CK0H 3ULVC 4JQXA 5L2KE 5D72L 1WSST 4PRID 1KF9B 3NCBB 1JTOA 5GZNC 12E8H 5GJSH 1MJ7H 5ANME 3UYPA 3KWWA 4Y16D 1FYTB 1XAUA 3GSXB 2CIIB 1INDL 5F9OH 1FNLA 3PWJA 1U95B 2NY2D 3TPUB 1RULH 5DFVD 4BQ8A 4JRYE 4RAVA 2UY6A 4LSDA 1Q94A 1Y18B 4P4KD 1G7HA 3GSWB 5CILL 4JY5H 4NQDB 4FQQB 4L4VB 4UQ3A 1UCBH 3IFPA 4F57H 3ARXA 3TN0C 4DGYH 2WQRA 1JGUH 4D9QD 3TIDA 5EUOA 1U36A 1HHHB 4N0UE 5DRXA 2V9RA 4UILH 2IH3B 3V6OE 4HEPG 2R0WL 2Y07H 1A0QH 5E2WH 3MMEA 5DF0A 2XWBA 2AP2A 1MRDL 2WINA 5D93B 5JZ7D 2W9EL 1UKQA 5DJ0B 5IHUH 1V7MH 4PJHA 5LQBH 4JFPA 2CPCA 3QUXC 4KDTA 2XNAB 5DQJA 4P46A 3REWB 4U1JB 3N0PB 2ZUQB 3QR2A 2DKUA 3CFKA 1MI5A 2LU3A 3NVQA 4Y19B 2AKRB 4Y2OA 2QADC 2WZPD 1EHAA 1CE6A 5E99L 4PJXB 3CX5K 3VD7A 3A67L 4M7ZB 4GBXC 1S5HA 1FN4A 4JAMA 2CH8A 3FO2A 1UACL 2OTUA 2D0FA 4XVUC 2DQJH 5JO5B 3VFMA 5AG8A 5DS8B 1BQUA 4BUHA 3FJTA 3MV11 4LVHC 1S5IH 1GJIA 3QCTL 3RGVC 1CU4L 3RHWF 3DROA 1ZGLB 5H37H 2LU4A 4YDJB 1WWCA 1OSZB 4R4FH 4HIHA 2BY3A 1WBYA 2PYEE 3PNWB 3T0EE 4XI5D 2Y06H 4K71B 5FKAA 3HAEA 1ZXQA 2XIDA 5C6WH 4TN9A 2XRAH 2Y5TA 4X9HA 4UDUB 1DQTA 4NNPH 3ARWA 3QUMB 2VLRA 2CLVA 1NC4A 3DYMA 4JDTL 4LVOC 3B5HA 1MHEA 4DUWA 1J05A 5ICYB 1ZWIB 2YD9A 3C8KB 3GBNH 1JPTL 4A2MA 4Z8FL 3HE7B 3VG0L 4WU5B 1R3HA 3IDNB 4NHCH 3MBED 4ZAKB 2GTZB 3G6JA 4I18B 3TYGL 4PJCF 4ZUVA 2F74A 2CQVA 4PTTB 2QSCH 1X5FA 4QYOA 3OR7B 3RWIB 3ZL4H 1S78C 2VMFA 4N9GB 2KQMA 3ARFB 3OF6D 3KPRE 1KELH 2GW5A 5D2NA 3MLYL 3VFUB 4G6FB 4D0BA 4O5LH 3GRWA 5E8PB 4NM8H 1I3GL 1JWMA 4WUKH 3RDTD 5CUSH 4OFVA 1JPGB 5D1XA 2XPGA 4OZ4B 2NY6D 2UVEA 4XC3H 5SWSA 4WO4C 4Y5XC 2FHFA 3NZHL 1HQ4B 5L8LB 1G7PB 2EDHA 1CFQA 2IGFL 3AY4A 4WUUB 5I74B 2EDXA 3FN9A 1F4WH 3RVUC 5J12B 3VFRB 1UJTA 4Y1AA 3TT1H 2BVOB 2EC9U 5JDJA 4GJTB 5I1IL 4GQPH 1KCVL 1GZQA 4YHZH 2IPTH 3R1GL 1I85A 1GGBH 3GBLA 4ONHA 4QXWA 2F19L 2YPKB 4GW1A 1P4BH 1A7OL 1VHPA 1JGEA 3PQYD 3UZVB 1R5VA 3S5LA 4J3UA 1KC5H 2F53B 3I3DA 5EU7E 2R9HC 4KC3B 4OT1L 4MXWH 4CU8A 2UZXB 5EA0L 2KZWA 4CMMA 4HUKB 4NQXB 5EWIL 5GRJH 5EUOE 1VACB 4YGVB 2IQ9H 3QIBC 1BHGA 3HA0A 5H94A 5F7EL 3KJ6L 5C3LD 1YEGL 2ERJC 2V5RA 4MJ6A 3PL6D 4P2OB 1BVLB 4J6RH 1S8DB 2QSVA 2YUWA 3GMRA 1B3JA 3WS3A 4UV7L 1IBGL 4ODTL 3MCG1 3T65A 4HMEA 4PJHE 3Q3GA 4YQXH 3MJ9L 3OPZL 2DTML 1NMAL 1JHLH 3H3KA 4QRQA 1KJMA 3IDUA 1LE5B 1D3CA 5I1HH 2AK1L 4B0MM 1MWAH 1QFUH 3TA3B 5FOBB 5D1ZA 1MCRA 4RISH 1JMXA 1JTTA 1MI5E 5I9QC 3HR5A 4LPTA 4P5TB 4P9HC 1GGUA 3U4BL 3DJ9A 3KPSB 2DL2A 2CKBL 3BPOB 4PJDA 3SDAD 1KG0A 5K9OB 2EEBA 1IJ9A 4YPGA 4F7EA 4U33A 1F45A 4OD2A 5I19H 1T5WB 3T2QA 1U58A 2A6DA 3NCMA 3RBSA 1RUPL 1CFSB 5I1KL 3QP3A 3ZT6A 5C0RL 3FCTA 4TUOB 4DVRH 4FN0A 3RWGA 3ARGA 4I77H 1RUMH 1BD2B 4KK6D 4F3FA 3ECBA 1ZT7A 3LAFA 1SHMA 4X80L 3UROR 3VXMA 4MA3A 1B2WL 1A2YB 3MRKB 3HFMH 5MHSE 4P23B 1EXUA 3D2UB 3C08H 4X4MA 3WE6A 3H42L 2X4QA 4QTHA 4LP5A 3FQXB 2X1PA 5D7SL 2VXUH 2R23A 5D70H 1ZHLB 4XCFL 4TOYL 1K4DA 3G04A 3G9VA 3GNMH 4LCIH 4NJAL 2B1AL 2VLRE 3INUH 3STBA 1FFQA 1IC4H 1A9BB 2G60H 4S2SA 3STZA 4JG1H 4I5BA 3WLBB 2UWEA 1TVBB 4HK3N 1P2CA 2A6IB 3VFVA 3RL1B 4LLWA 1XCTA 2E7MA 2AJ3A 4XPFH 3TBSB 3OKLB 4H1LA 5JXAL 1VGEH 3IAQA 1T1XA 4GMSH 5D7KE 5I71B 1V5JA 3G6JE 3KYAA 3L1OH 3MRGB 3QIWA 1HXMB 4M7LT 4NQSA 1YPZF 2APFA 4NC2B 4R26L 1OL0A 1FL5B 3BZEA 5EOTA 3ARVA 4JHZA 1HHGA 2MHAB 3BE1L 3CFBA 3RKDD 1TTFA 4AYFA 5D2NE 4XPHH 5IMKA 4ZUWB 3T4AB 4XAKD 4EN3B 1HE7A 2C3VB 2BSSA 1BQSA 4ZYKB 1DBML 1KJ3H 5HGBA 1A3RH 1P9MC 2XV6B 4X6CF 1QSFA 1D5ZA 5SWSE 4AY0A 1MIEH 1OM3L 1HIMH 1CLOH 4BYHA 2Q20A 4AZ8A 1M7IB 3GJEB 4EBQL 1PG7H 1CF8H 4J4PD 1C5CH 4Y1AE 3G08B 3O3DB 1CG9A 5I16A 3G6AA 4M6AA 4YGAB 4UNVA 3O3AB 5HGHA 4PV9B 3WNLA 2YC1A 1AQDB 2W65B 1RZKL 4JFDA 3LVEA 1IEAB 3S98A 1N5YL 2JB5L 3O2DL 1T20A 1LEKA 4O02H 2DQFB 4NRYB 4NYLA 4FZEL 1MELA 3FZUC 4IRJD 4L4TD 5EOCL 1W8NA 3W11D 2APTA 2J8UF 3KLAA 4RWYH 4H8WL 1G7LA 3CUPB 2DIBA 1XF5B 4RBPH 1AY1H 5DEFA 4E0RA 2QQKL 4XMKL 3SKNA 3JV4B 4U1SB 5SWZD 5IW6A 3W2DH 5I8OL 1ND0A 5CEXB 2APXA 5KG9A 2C1OB 4QRUA 5ITBL 2E7BA 1MLBA 4LMQI 1DN0A 5GRYA 4ZS6D 5JOPD 2BSRA 2JELL 43C9A 1MCPH 4HT1L 2VLKA 1VKXA 1T83C 2R4SL 5DC0A 1T21B 1D5IH 4G8IB 4PTUA 3SJVB 4OLUL 3QCVL 2QKIB 3ULUE 1DUYB 1HZHH 3LRHA 5TF1L 3SGKA 4PJCB 5IB1A 4KKBC 4F7CA 3LKNA 4EVNB 3G6DL 5IMLB 2D0GA 5C07B 3RWDA 5T33L 2R0ZH 4XC1L 4CN4A 3QNXA 2BVPA 4IOSD 3F62A 1KOAA 3BVNA 3CGTA 2QLVB 5E7FA 4S10A 5KANI 1DLFL 3BP7A 3EHBD 5IVXF 1S7VA 5HYJA 4R8WL 1H5BB 4L9LB 5CJXC 3DMMB 1V3JA 1HH6A 5L7XL 2IJ0C 4PJDE 3HZVB 2A6JA 4GKZA 4KKNA 3FQUA 1ZHBB 3OKMA 4I3GA 3FB8B 2WANA 5IW1A 3P3YA 1CBVL 4QRPB 3KYNB 1BBDL 4DQOL 4DZBA 4IOFD 4E41D 5DRZB 4QRSA 1KIPB 1N8ZB 3NZ8B 4OUUB 4TVPD 1OP3H 2BC4B 1T66C 4HPOL 3ARDD 3PWLA 4L8SC 3TBVA 5EU5B 1BJ8A 3HI6L 3VXME 2H26A 1QTYT 3IGAA 3KYMB 2D7OA 1E4JA 4R4NC 2Q6WB 4P48A 4X4ME 4CDHA 1GGIH 4XP6H 1RJYB