1NGWB

Chimeric affinity matured fab 7g12 complexed with mesoporphyrin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords Mature Metal Chelatase Catalytic Antibody, Light chain
total genus 39
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngwB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngwB02
2VXTL 4QRTB 5E2VL 3MBEB 5KAQF 2KZWA 1CDGA 1SEQH 1QBAA 2IGFL 3BI9X 4S1SL 3UYRL 2IH1A 1SEBA 3MV7B 1XGTA 2Y07L 3ZTJG 3MLZH 3RDTD 5L2JA 3CK0H 5K9QG 4WFGE 3MV01 4DZBB 5B3JE 3QDME 2BZDA 2MFNA 5BRZA 4YHLL 3O3AB 4U1SA 3H9SD 1KCSL 5C70A 2VL5A 3PWJA 3ARDB 1AC6A 5D71L 5EC2A 4Z0XB 3V5DA 4DGIH 5BQ7A 5IT2H 4GRWF 1WLHA 5MEPB 1PW3A 3HI1A 5F7KC 4Y0GA 5E00A 4X8JA 5FGCE 2NY0D 1U3HA 1Q1JH 1YEHH 2XA8L 1A3RH 1ZV5A 2IF7A 4XPTH 4RFEB 1D5BB 2HTKC 4KTDL 3KPSA 3FZUC 5GPRA 3DRQA 4M6MH 4PLOB 1IKFH 2MCPH 4PJFB 3HC0A 3QWQB 5FK9A 2QQNL 3T0EA 5KSBE 4XCYA 4WDIA 1TJIL 4QRQB 5KSUB 2IBGA 1IQWL 43CAB 3QUKA 3LEVL 2AJVL 1FAIH 1RJYB 1JGEB 1HILB 3LRSA 5DMJB 3OG4B 3C5ZC 4DUVA 1AD9B 1K2DA 5A16A 3LQMA 3BOVA 5DHXB 2XNAA 4A6YA 3S37X 1PG7L 1KFAL 1Q1JL 4Y4KC 1T5XB 1KCUH 4GSDH 5ADOL 4NFBA 1BLNB 2HRLA 1U8LA 1Q38A 1U2CA 5ICZA 1G7LB 4YWGH 3PGFL 1BM3L 3PQYB 2H9GB 1LP9B 5MERB 2BY0A 2NY6B 1CLOL 1BVKB 2WQRA 1CZ8H 1MCDA 3TEUA 1UJ3B 4XP6H 3QFJB 2R0ZH 1U8JB 1EBAA 2AK4B 3W9EB 1RK0B 2ZKHL 5E7BA 3V5HB 5I66B 3P9LB 3EZJB 1ZVSB 1CR9H 4WU5B 2ORBH 3P9MB 4ODUA 1C5CL 3SKMB 4KMTL 3W0WB 1CICA 4M93B 1FH5H 3QDJB 1S8DB 1NJ9A 1UH4A 5C7XH 3SO5A 3IDXH 3QEGH 4LEXH 5IBTH 5CEYB 4LP5A 1PKQA 3TWCL 4KVCL 4OB5H 6CGTA 1NMAL 3RY6C 3KLDA 3MV9A 3QIUD 3HR5B 5L0QC 1B4JH 3BQUA 4XVJL 1JUFB 3UTSE 4GAFB 3LN4A 2AKRB 1ERNA 3GB7B 4Y19B 4PV9B 4J12A 2BSED 3DRTA 4OF3A 3C6LA 5DJ2B 4TSBH 1O7VA 5J9PA 1JTPA 2WIMA 4YR6A 1Q9LA 3KDMA 3KLHC 3NIFE 2QTEA 2NY4D 3H9SE 3QPXH 3CX2A 2XWBA 3GK8L 1JGUL 4P4RA 1QFPA 4HGMA 5T1KA 4GKOA 1PD6A 3VCLB 2R56H 5EORH 5D1XD 1N6UA 4HULB 1CFBA 2NX5A 3U48A 4AENB 1MIEL 3RTQB 3SE9H 1P84K 4AIZB 5D70H 4M4RA 1QKZL 2NR6C 5JW3L 2PYEB 3VFOB 4RWYL 3QQ9C 4LSSH 3SDCA 2ZNXA 1CXHA 2W07A 5LWYL 1P7QB 2GCYA 3BZ4B 5F9WB 1TJHH 5EOTB 4NWTH 5AG8A 3BP6A 4DKFL 3RX8A 1OAKL 1FGNH 1MEXH 3EOAB 4JRXB 5BJTB 5JIHA 4XTRD 1HKLH 1TZGL 2OJEB 4JRYB 1Q72H 1FC2D 2VQTA 5CJQL 3MLWH 4BQBA 1IAIH 2MJWA 4ZUWA 2Q76B 5EU4A 3G6JE 3KPNB 3KPOB 4WWKB 2YN5A 3SO3B 5BS0A 5F7DB 4S1DC 4FTVA 3WKML 1KT2A 1S78C 2D0FA 4LHUB 1MJ8H 1S78D 1IAIM 2X2YA 1U91B 2R1YB 5IF0A 2VDQL 5M95B 2L0DA 5HYJD 3NA9H 3P4MB 4PJIF 5CJ8A 3D69A 2WIIB 2UY7A 4GMTH 1GYAA 2X41A 3RUGA 2RFXA 1BREA 4E41A 2BHUA 3OB8A 1ZHLB 1A6UH 1BOGA 2GSGA 1CZ8L 1NCUA 3MBXL 4M6NL 5GGVH 3EYVA 3WS3A 2NR6D 3IDMB 3MRIA 5C08D 3TC9A 5EH1A 2Z4QA 2QQLL 4WI4A 3P0YH 5IFJB 4QRRD 5JMRA 4WWID 1IJ9A 2BRRH 5T3XD 4MLSA 1T66C 4HWBA 3VRJB 3ZLQC 3GSOB 2AJVH 3M1BA 4WW2F 3VXUB 3LD8C 1CT8A 3GSWA 5IK3B 3D85A 1RUAH 5FYKH 3WO4B 3WNPA 4HWUA 3KLAA 1IC5H 1G9NH 3QI9A 4LHUG 1AKJB 1TPXC 1V3JA 2AK1H 5I71C 4XRCB 1EX0A 1GOFA 1IKFL 4WWKC 5E6IC 3K2MC 2JKXA 5BXFB 1MCIA 3PWVB 4BK5A 3TO4D 4Z7OF 5IHZA 4JFZL 3H9ZA 3QJFA 5AYUL 1A7PL 2BSRA 2GCYB 3BZ4A 3JVGA 4TUKH 1I9IH 1BD2B 1J5OH 1F42A 1EHLL 3EOBB 4OT1L 1E4XH 1OAUL 2DQEL 4JRXA 5BJTA 1RU9L 5BS0E 4IRJB 5I1JH 1NBVL 4H1LG 4MQTB 4D0CA 1UA6L 4XNZC 4FTVE 4NFDA 4A6YL 1PBYA 1JV5A 2X1XR 4WI8A 2VDNL 2VH5L 4WWKA 3MV11 1C7SA 3O4OC 1NMCC 1XF4A 4Z7UB 2VAJA 1IAOB 3GGWB 1NDMA 2HJFB 1UVQB 1TTUA 2DQUH 2HLAA 4C54A 4CVZB 3B5TA 2DQEH 3WJLC 2AV1B 5D1QC 3U2SA 3H3BC 4WO4B 2OR8A 3VFPB 4G9DA 4IDJL 5IBUB 4CJ0A 4F2MA 2HAZA 1F4AA 4TVSa 4QNPF 3OKKA 4NJ9H 5IOPA 1LNUB 5J89A 3S37H 4UOW0 5C6TL 5D7JB 3SE3C 1DLFL 5DEFB 4ZUVB 2A6JA 2P46B 2ZP0T 3RBGA 1Q0XL 4P3CH 3H9SB 2C7UA 3IDMA 1FFNB 1AO7E 3EJZC 3DVFA 1IKNA 4X6FA 1YJDL 5I0ZA 2V7NA 4PJAA 4YXKH 5BZDB 2I26N 3QDJA 1BBJA 1U9KA 5D7SH 5J6HB 2YUXA 3MMEA 2H9GA 1MQKL 1UXSA 4TULL 1FNAA 5JO5B 1QLEL 4M48H 5DUPH 5GJTH 3LKRB 3GSOA 2VLJE 4MA3B 3UTQA 1PYWB 2GTZA 3VXUA 5E9DD 3RNQA 3WFDH 1H0DB 3TH3T 3BKYH 4X5WA 3OKDB 1FC1A 1YNLH 4IRZH 2PKDA 1YMHA 3DVGA 4OF6A 4N0UE 1IM3B 3AROA 4ZOEA 5FYJL 7CGTA 1U8HA 1PLGH 3RAJH 3Q1SH 3QDGD 1F3DH 3ARGC 2X70A 3N9GL 1MUJA 2WBJB 4JFFB 3SGJC 2FRGP 4D9RE 4RFNB 3BEVA 4ISVA 2BRRL 1DBMH 4F3FA 3KPTA 1LVEA 2D7TH 1KC5H 1MFEH 3CSYB 2WWKO 3I9GH 3K81A 1A7NH 3UZEA 3WJLA 1GIGL 4OKVB 2APBA 1U8OA 2UWEF 3LKNB 4GAJL 5KVDL 3QRGH 4X4MA 1UKTA 1I4FA 1QEWB 4G9FB 5GS0D 4X7EC 1CU4L 2O5XL 4KJYB 1SJEB 3LQAL 1IMHC 3G5ZA 1VFUA 3HNTL 4O58H 1S3KL 1IGML 2F8XC 1DBML 4PJEE 1R5VB 4ZO8A 2FHBA 2F54D 3QDHA 1ACZA 5F7DA 4HAFA 1WIOA 2A9MH 3P4NB 3I6LD 4G5ZL 2DQIH 1AJ7H 4QHNB 2PO6B 3IF1B 4S2SB 3S8WA 5DLML 1IZKA 2W59A 3UTTB 2IPKA 3BWAA 1LE5B 4OLVH 2A77H 1A7BA 3DUSA 4U3XA 4MSWB 4G8IA 4LSRL 1CFTB 2ARJQ 2Q3ZA 4JKKA 1ZGLP 4P9HH 3DO3A 3S88L 1KTRL 1QG3A 1EHXA 1BQHA 1FNGB 4XCNA 4XTRC 4OT1H 5HDQL 5BVPL 1ZVYA 2DQFA 1HHGA 5C09A 3V7AE 5IMLB 4NT6B 1OTTC 1W2KT 1FJ1B 2EXYC 1KLFA 4PJHE 5E6IB 1J8HE 1YPZA 4IDLA 3QCUL 4FTVB 2X70B 1OARL 2YSSA 2YPKA 2J8UA 5TDNB 3TN0B 4QXWA 4LL9A 4K2UH 2N56A 2V6HA 4WTZA 4PS4H 1RIHH 4P23B 1T1ZA 1AXSA 2W65A 3VXQA 3QPXL 4JRYA 3CMOH 2NTSP 2PYEE 4EVNB 1PSKH 1FZKA 1L6XA 4YBLC 5BZWA 2DLIA 2FX7H 3Q0HA 4ZSOE 1FQ9C 4NO5B 4ZO7A 4KY1H 4LLDA 4YHKH 5CMAB 5IV2B 1SM3H 5KSVB 3ARRA 2Q20A 12E8H 5DQDL 3VGAC 2HLAB 5DUBA 3FN9A 1WWBX 1GZPA 1KIPB 2IFGA 3DV6B 5ESAB 1SMAA 4YDIL 2HT3C 4P2YA 2VIRB 1I3RA 1YN6A 3WS6C 1AJ7L 1G6RH 3U4EB 1T2XA 1OGTB 3UJTL 3M1BB 4LVNB 1CGTA 1JZ6A 3OKKB 5IOPB 1KBGL 5DJCB 3N1PC 2ZPKH 2VXSL 4M6OH 4JJ5B 3HNVH 3MLXH 4K8RD 2JTDA 5EC1B 2H8PA 3PWVA 4OFIA 4QF1A 4K3HA 2YPLE 5KVGH 1MI5D 1AGDA 4TRPH 5CILH 1EERB 1J1XH 1OTUC 2YD6A 1ZT7A 2EDFA 1GGIL 3OGOE 5D7JA 2NY7H 3QUMA 5JPNB 4RMQA 1FAKT 2DBLH 1T3FA 3IDYC 3SDYH 3S9DB 1YYML 4OM0H 4KJWD 1HSAA 4FQLH 1KC5L 4NPYA 2YEZB 4LNRB 4F9PC 4XP1H 1RUKL 3SE9L 4HWBL 1BD2A 1ZVHA 5T3ZD 2Y7QB 1UGNA 3UTOA 4W70A 3P0VH 5MP6L 2EYSB 2VZVA 4FXGB 5FA3A 1S7TB 5DJAB 4EDWL 4WEBH 1A7RL 5IESH 4Z9KB 4GKSA 4XC1H 4G8EA 4X98B 4G8GB 1CE6A 1OP9A 4FG6D 1XGRA 1U36A 1Z9MA 3GGWA 2VERN 5J1AB 2QL1A 1G1YA 5F1IA 5FYLL 5TDPB 2BMKB 3RJQB 4AZ8A 1QD0A 1NLDH 1KXQE 2NZ9C 1J87A 4OUUB 4FA8A 5C8JA 1P7KA 4R4BB 2DQGH 2WP3O 2VL5B 3X14A 4G9DB 5E2TH 5IKCA 2OSLB 3JZ7A 1H3WM 4F58H 1ZSDB 4F3FB 2IPUG 4PJHF 1U6AL 2I27N 4CU7A 4R7NB 1YJDH 2PF6A 2IADA 2YK1L 4ZUVA 1XR8A 1RJZA 3OKNB 3MOAL 3R0MA 3QQ3B 5HHXL 3PWUB 4Y16A 4NKIH 3VRLF 4DEPB 4HJGA 4UT6L 3D85D 3BX7C 5J1TC 4YDLB 3H9HA 4NO3A 3EYOB 4PBWD 4G7YL 3VRIA 3V6OE 2P42B 3EOTL 1CFVH 4U6YA 3ILQC 1CD1B 2XN9B 1OGAE 1RJYA 3L5XH 2XY1A 1U8QA 4PJHB 3W9DB 4UTBL 1DFBH 1D5MA 1MQ8A 1GL4B 4MHHG 3F7RA 3K4ZA 4QWWD 4PY7A 4JRXD 2IEPA 1OT2A 1QRND 1P5UA 3MA9H 2YA0A 3IF1A 5AAWA 4X4YB 1K6QH 2XYCA 5I6XC 4AEEA 3F7VA 2YMXH 4YDJA 3S3JA 4LASL 4Z8FL 4P5TB 5M94B 2PYED 1KCUL 3MNVB 1JZ7A 3RY6A 1XCQB 1I7RA 2YSSB 1ZS8B 4NKQB 4CJ1A 5JR1L 3P73B 3ARGD 3NTCH 1F4XH 1ZHBB 5I66A 2E9JA 1N8ZA 3PNWA 5JQ6H 4JREB 1UKSA 4TRPL 1U8MB 4P5TD 4ODVL 4Z0BL 3MRNB 4AH2A 2YZ8A 4DGVL 3CVIL 4ZPVB 1UM6L 5DJ6A 3U0WH 3UO1H 4HUUA 1IEHA 2KUTA 3PDOA 4O2FA 2WMPA 4GLRI 3IAGC 4P23C 4LSQL 5C0GB 5ICYA 4LPTA 5IHLB 3VFNB 4KROD 4N5ED 1PG7H 2IH3B 3IFOA 2IPUK 2AEPH 4Y4HC 1KB5H 5D6CB 3NMEA 1JF1B 4YC2B 4MB5A 4PD4J 1G7JA 4LRNH 1JMZA 5L88H 4APQC 2H1PL 4I0KA 1CDJA 1AGBB 1T0MB 2EKSB 4KH2A 3HCVB 1H3UA 1SYVB 3TNNB 4MCYA 5E6IA 1Q0YL 2CK0L 3NH7L 1QLRA 4KRPD 4IMLB 4TQEL 1S5HB 2UWEA 5CZKA 2H6PA 1IGFH 5AAMA 1C08B 2X4UB 1F11B 4ZO9A 1FYTA 1VGKB 4NNXA 2ENSA 2D0GA 4WNQB 3HKFA 4PLKD 2Y6SD 2I25N 5HDBF 5I9QB 4K8RC 3AB0C 5E2UL 1T7YA 4I3RL 1EEZA 4A6YB 1MFCL 2CDEA 5GJSL 4O2EB 4LSVL 3H7LA 4RRPG 4XX1E 2IG2H 3JV6A 2AJ3B 3QUZB 3BH9B 2AK4D 1ZLVH 1GOGA 5DTFA 1TJHL 1DN0B 3BP6B 3SPVB 3G9AB 4HPOL 2X4TB 5LG1A 4RWYH 5I74B 1NEZB 1Z3GH 3T4YA 2IJ0C 4GW5A 3QUMB 3QDMA 4RX4D 3OAZK 4PJEF 3P4LA 5D71H 4HHAA 4LSRH 1A1NA 4Y89A 5ETUA 3T3PE 4P9MH 4LLVA 1FCCA 2A83A 1YEJL 3EDJA 1JPSL 2ED9A 4G8GA 4LCCB 1Y18B 4L3AA 4UTBH 1I1YB 3GJFK 3MLSL 1L7IH 1QO3B 3FQUB 2IAMD 1LDSA 3MRBB 3MLZL 4N8CL 4OCRL 1C1EL 3CC5B 3X14B 5IKCB 1I1RA 1YEGL 4E0RA 4QYOB 5IW1A 5IJVB 1Z0NA 4O2CB 1HSBA 4OCWL 3T0EE 2JB6A 2A0LC 3BKJH 3D0VA 1M6OB 4HT1L 4KUZH 5F1IB 5KBNC 1MIEH 2X7LA 2EIEA 2ZOLA 1S7RB 4H1LA 1RJZB 3OKNA 3TP4A 1FYTE 1BFVL 4KKAC 3RPIB 5BV7H 5IB3B 2A77L 3ULUE 4X5XA 1INDH 1AIFA 3TWCH 2Y36L 2VLRD 5FM5M 1NDGB 1BEYH 1YECH 3HLAB 4Q6YA 3QH3A 3DMMA 4XPGH 2OTUB 1MFAH 5DT1L 5DD0L 5AUMB 4MJID 2FEDD 1FDLL 3SGJA 1R3LB 3ZKXB 2F19H 2QKIA 1LO0L 4MD4B 4K3JL 3MV7D 2EYRB 4YHIA 3HE7C 1GC1H 4XGZA 5E9DE 1FL5A 2VXUL 4EEEA 2EDWA 5IESL 3L3GA 1Z5LA 2OJZL 4OUOA 1AI1L 4N5UA 2WV3A 5IVZB 3MRLA 4N1CA 1TZIA 3S35L 4P4KC 1H5BC 3SDCD 5DO2C 5F7EH 1I9RL 4QRPA 1MFCH 3LVEA 3ME0A 4M43H 1ZT1B 4FQXA 5C0AB 4HJ0C 4MAYC 2C4FU 2X5PA 4M1CC 1ZLUH 1GAFL 3U9UA 3BYTA 3SDDC 2VDLL 1KJMB 4LSQH 3U7WL 3HUJE 3WIIH 5DURD 2P4AB 1LMKA 2G2RA 4ZXBB 5ABDE 1QBMH 4LPWA 1WTGT 3HN3A 1XF5B 3LEVH 5F88A 1E4KA 1QO3A 5GGQH 5FIEA 32C2A 4MAUL 4XPAH 2AXFA 4XT1C 3GMLB 5K59E 1T89C 4X80H 3NABH 4HKJA 5EIIB 3BP7A 2ATPB 5FYJH 5HVGB 4U7SA 3WXVH 2O5ZL 4OCLC 1H3TA 2Q6WA 1MHHA 3V4UL 2D4DA 4OM1H 4U1KB 1J7VR 4NKMA 2FIRT 3CZFB 3QXWA 4C4KO 4I5BA 3VCLA 4KZEL 3BPCB 3UBXG 3TBTA 1UJ3C 4PJIE 4ZTPH 1OT1A 5JXED 5FKAA 1QA9A 3DXAA 1G0XA 2NX5B 3TNMA 2IMNA 3QAZB 2OTPA 5ISZD 4Y4KA 1NDGA 3MMEB 3HNSH 4HWEH 2KDGA 4KQ3L 3WFHB 3H0TA 5FM8A 1DE4B 5KVMC 5JIPA 1KN2L 3MYZA 5IROC 5SWZB 4OZIE 4NN6B 1CK0L 3KPRD 1BD2D 4OZGF 5L8KB 3ULSA 4HLZG 3ZSSA 3FQXA 1CXKA 5HHVH 3WKNA 3HI5H 2GK0B 2CKBL 1P4IH 2GUOA 3RWCB 4WO4D 3LH2L 1OSZB 4Q9RH 2B5IB 2H32A 4RGMB 5CGTA 5I1GH 4X7DC 4M5ZH 3B3IA 4O2EA 3NCEB 1KENL 4MAYA 4NHCL 4ZPVA 4ZFFB 5CINH 4Y19D 3CFKB 4HUXA 5I1HH 2VSCA 3BN9C 2Z92B 3G5XB 4PJBA 4MZ3A 4P2QB 2X44D 3VH8B 2CH8A 4JM2C 1U42A 2VZ1A 3NACL 1PGRB 3MRFA 4MS8D 5ANMB 2OZ4H 4M7JH 2FH6A 2DAVA 3X3FL 3K8KA 1CYGA 4UDTA 3INUL 4OF0A 4WU7A 4NT6A 2B1HL 1FO0L 3EAKA 1XF2B 5A1AA 3I6GA 1G7QA 1E4XL 5E99H 3NZ8A 3L3IA 4JRYE 5DZOA 4ODHL 1Z9SA 3NVQA 4UUJB 3QO1B 1DN0A 4MCYB 4R4FL 4M8VA 4S1SH 3AMKA 1AXSB 1F2QA 2K1MA 5IFJA 4YFDB 1NFDE 5HYJB 5FDYA 1R0AL 4PJIA 3B2VL 3O45A 4Z6AT 4P5KB 2FZ3B 5D8JL 1T83C 1ONQA 4HUMB 4CBPA 1E6OL 2FIKB 5C6WH 4TVPD 4WHYH 2AJUL 3GMOB 4UILH 5F9WC 1HH6B 1E6JH 2I07A 1X6NA 1PEZA 3VXPA 1A1OB 1M1SA 4FZ8L 3RPIA 5BXFA 3OB0H 1AY1L 1IBGL 1G7HA 5TQ0H 4XPBL 4AMKH 2D7TL 5EWIH 4WFFD 3ZT7A 5J6HA 4PJXF 4XMLL 4XBGB 1LK2A 2Q86A 3TA3A 2C1OB 4DZ8A 1J12A 1VPOH 2VR9A 4ZFGH 2X7LB 4GG6F 3ABZA 4OD3H 5DMIH 1FVCA 1D6EB 2V2XB 3G6JF 4C83B 1A6VH 4ZFOL 3KPSD 5FGSA 4N8VB 5D1ZB 5JDSB 4L8SA 4KRNA 1IBGH 3VFWA 4BKLA 3VFRA 5HHMD 4LHUD 5B8CB 3FFDA 3IVKA 3GUTB 1S3KH 1OB1A 5ILTH 3HMXA 2OR9L 2DDQL 43CAA 3MJ8A 1EJOL 3V0VB 4XP4L 5MHSD 3LN9A 2B1HH 1UEMA 5KSBF 4H8WL 1ND0A 2CLZA 1VPOL 4JLRA 2ADFL 1FL5B 4K7PY 3I6GB 1IGCH 4R4FH 1A64A 3QIUB 3TZVC 3G9VA 7FABL 5FHBH 2C1PB 1AGCB 4U6VH 1WEJL 3DBXA 4OLZL 2M2DA 5DYOB 1I9JH 3WIHH 2H2SD 5D7SL 3NPZB 2AV7B 4Z7WA 3RDTB 1ONQB 1AO7A 1UWEH 4Z78B 5CZXD 4HDIB 4D9LL 5J13C 1NAMB 1EDQA 2MPAH 5J1SC 4JZNA 1HQRA 1P4LA 4X99A 3RRQA 2J88L 4PV8A 2XICA 4CL7A 5IHUH 1OARH 2UY6A 4DEPC 1BBDH 3C9NA 4JM4H 4UIKH 1QRKA 1OP5K 2ZJSH 3TGXA 1IC7H 4PV9A 1S8DA 5FKPA 3F7YA 1D5ZB 1CGVA 2KL6A 2Z35A 1EVTC 5DK2A 5T3XH 4YXHH 2DWEB 3ARZA 1I9JL 3PHOA 1KYOJ 4IIQA 4M48L 4AT6A 1N5AB 3RVVC 4DWHA 4JFFA 4XVJH 2YD2A 2ZCKH 3V2AR 1W72H 3VDBA 5C0JB 4WUUD 1RMFH 2WBWB 1XR8B 4YXKL 3VFTB 4OCXL 5DD3H 4PJ5D 4RMTA 3FB5B 5ACMA 2CDGA 1NGZA 3WFBH 5DRWB 1E4XI 2EE3A 1LO2H 2DI8A 4K7FB 4HFWA 2NNAA 3JUYA 3ULVC 4XP4H 2A38A 1R5IB 4I0CC 2FO4A 4MCZB 4U6HB 5E9DB 1T80A 2I9LB 5GRUH 4OTXH 5IVOA 3WD5L 4POYA 4X4ME 5CEXB 5AYUH 1VHPA 2HMID 3WIHL 4H20L 2W0KA 1VCAA 2XXMB 2OTWB 1F6LL 3MRFB 1UEYA 1KPRA 3S34H 1XGRB 4JN2A 1WFUA 3PV6B 3QXUA 2VLKB 4WVRA 4J2XA 4POZD 1EH9A 3MREB 2FATL 2AJYH 3UP1A 4OD3L 1MAML 4HWZA 2OL3B 3GBML 1YEEL 2XPGB 5C0AE 3SKMA 3VXSE 4HBCL 5BO1L 5I15L 3DXAB 5ICXB 2IC2A 1W72B 3E8UL 4OZHE 5D7JC 3GRWA 1N26A 2ZUQC 3LIZH 3T77B 4S0TD 3P0YL 5IF0B 1KTLB 4YQXL 4GRLB 3MUGA 5DC4B 3F12A 3GMNA 2PO6D 5K33A 4NC2B 3GHEL 5EC2B 3V5DB 4B0MM 1CBVH 4JZNB 2BCKB 4V1DD 1JUFA 4AM0B 2XY2A 3CD4A 4URTB 3LMJH 4HXAH 3UTZA 4LDLB 1CVSC 4LLMA 1IC5L 1S7XA 1YECL 4KHXL 2WUBL 5DS8A 3D25B 3TPKA 3VXPB 2Y36H 3L3JB 4FNLH 5EULV 2WUCL 1K4DA 2EH8H 1N5AA 5HGGS 1IM9B 1CXEA 2NYYC 1MVUA 2R2EB 1BWWA 4K3DL 1MOEA 5D5MF 4BSWB 5CGMA 1TCMA 1XIWC 1UB5A 4P2OA 3UTTE 4MD0B 4IRJD 5JZ7D 2ZUUA 1U58A 4QRPD 4GMSH 2HTKD 3OF6A 4FQXD 4YDJB 3VFGL 1YN7A 2I5YL 2DTMH 5D7KE 2VAAA 3KAAA 3O6KH 4XC3L 5EUKB 1ODAA 4PJXB 4NRXB 3VGBA 3CMGA 3ZKMC 5JA8B 1RZGA 1FIEA 4P59H 3C87A 3FTGB 1PZ5A 1LE9B 1V7ML 4Z7OE 2EYSA 3RA7H 2YD1A 4IDJH 4PJAF 1CGSL 2D2OA 1UZ8A 4X8XA 1OGTA 3HRPA 5ALBH 3O6LL 4LLQA 4P2QE 3SGDH 2DM7A 4XRCA 5EORL 2B4CH 3GJFH 4LCCC 4FQJL 3TO4A 1EO7A 5EZLA 4OQTH 3ES6A 4PG9B 2B7DT 2EDQA 1HI6B 1FN4B 2P24B 4YFEA 3O6KL 2NY1C 4WI3A 3ULUF 5IQ7L 1GCFA 4RRPA 1RZFH 3C60D 4XCCL 4U6XA 1CF8L 3ULVH 4WHDA 5HYSG 1S7UA 3NIDF 3PIQB 2XZZA 5B38A 5FA4B 1LO5A 3EYSH 2OK0L 2EKSA 4DAGL 4YBQC 4XWGH 4ONHB 3RWDB 3RZWA 4FABH 4BH7A 3O2DL 5FEBA 3VXRB 4PJ8B 3CFDA 1J0YA 2GIYA 3MJ9A 3IVKB 2NLJA 3RUGF 2A1WL 4F2MB 3RDTA 4KDTA 3LMJL 5MP6H 1I3GL 5IJVA 3MGOB 4XCEB 3ZKSD 1QBML 1ZT4A 2WM0A 4DCQB 1OLZA 2V2XA 3EYUH 3ZTNL 1DEEA 3VD7A 3WE6A 2FJGB 5DD5H 1II4E 3QEUB 5GGUA 5C0EB 5L9DH 4AEHH 2BJML 2FR4B 1HQ4A 1KELH 4MS8C 2NTFB 3ROLB 2DWEA 1XR9B 4G6AC 3SO3C 1BJ1H 4I18B 5EO0A 1U3HD 3BN9D 1KCRH 2AK1L 3EDDA 3RVXD 3N1MC 4P2RB 1JYVA 3LPWA 2EYRA 4LFHD 4IRSA 3X13B 3S34L 3WN5B 3BPLB 1EZVX 1P84J 1HH9B 1CVRA 5GGRY 4LQFH 3AU1B 3VWJC 4P5TA 3JV5A 4K3JH 2BNUA 4HGWA 3V7MA 2XPGA 2EDLA 3L5IA 1JNLH 3BD5A 5E4EC 4PB9L 4I0PA 5ERWA 1FNSH 4M7KL 5DQ9B 1TPXB 4JREC 3VD4A 1I1AB 5TFSH 8FABA 3P11L 5HI5C 1DQMH 3W0WE 4GLRH 3O2DH 5F44A 5EZJA 4PV8B 1C5DB 3AREC 3IJSA 4HIEA 2P8PB 4GXUN 1AXTL 1YNKH 3D18A 3K7UA 3LPFA 2V2WB 5FCUH 5JDJA 3SCMB 2HKHL 2GSIA 4BZ1L 4UOW1 1SYVA 4ZTOH 3TNNA 1MCKA 5TF1H 1NCWL 4OIBA 5E6ID 3UYRH 3DV4A 3RWEB 5LGHH 3OJVC 1XGQB 4Y4FA 5DT1H 2VB5A 1EEYA 1LP9F 3MXVH 5I1DA 1BFOA 2IBZY 2VZTA 5HVFB 1ZT4B 3LB6C 4HC1A 3ZHDA 1A0QH 3QIBA 4WNQA 3GSWB 5EOQH 3ARUA 4MXQC 4BSVB 2BP3A 1R3JA 3MRMB 4GS7C 1CICD 4AJ0A 2XN9E 4R3SB 4XNUH 5C0NC 4L8SC 2P8MB 4DAGH 1WF5A 5DRZA 4WHCA 1BQLH 4I9WD 4M62H 4XNXL 1OW0C 3ROLA 4JFXB 1AR2A 2P8LB 4OBRA 1K4DB 4Y5YC 2CXKA 2W0FB 4EUPH 1A3QA 3W81A 4PR5B 5DI8B 1I1AC 3S3SA 3CLEL 2X1OA 2FGZA 3BIKA 1A14H 4LGSB 3LKNA 4LHQB 3ELAT 1JV5B 5FO8B 4Q97A 3T3MF 1NQBA 3VGHA 3HE6A 1B9ZA 1BFSA 4EN3D 4NQCB 1NANH 2BVOA 4OAWA 3BH9A 1OWWA 3W0WA 3TVMA 1OF2B 3QEHB 4EI5A 3PJSB 2C4FT 1TZHB 1SJEA 2LAAA 2VLJD 2ESVB 3DETD 5GS0L 4KVNH 1XAUA 2VZSA 3FO1A 5FO7A 4DTGL 3F62A 5ALCH 3C6SA 1B0GA 3TLRA 5KN5A 4KZDH 5FA4A 1TVDA 1E4KC 1WTLA 4JFFD 5E8EA 3C60B 3GB7A 2A0LD 2WINB 4JFDA 4MQ7A 1NUGA 3OG6B 2NY2B 4NSKA 2ZSWA 4FN0A 3MO1B 3QDGB 4M1DH 5D1ZD 2VAAB 1JGDB 2X05A 3QUZA 4LPUA 2CIIB 4PJXA 1F4YH 2WAHA 2NLJB 3EYQD 5F3HA 2JCCF 1CN4A 4P4KA 4PP1C 1JE6A 1WAAE 1G6RL 3MGAA 1HHGB 2XZCH 1M71B 4JPWH 3RWDA 3W2DL 2FJFB 5C0CA 1EBPA 3WE6B 5IBLC 5ESQB 1T5XA 2EICA 2HG5A 1I85C 4JPIB 4PJFA 5EUKA 4CU8A 3PHQB 3EHBD 3QFJD 5CUSH 3LAFA 1RFDH 2H2PD 3MBEA 2D7OA 2XA3A 3SKNA 5B39A 1MUJB 2X4QB 4P0DA 3DROB 3MROB 5IFAL 2P5WB 2WANA 5TH2A 5FA3B 3SOBL 1AXIB 4MD5A 4ZAKB 4J4PD 1NAMH 3BGMB 4KWUA 4R4ND 3WNLA 1X5GA 1LHZA 4HZLB 4G6KL 1MVFA 1TJGH 5EU7C 1BLNA 3L3GB 4GAGL 4OAWB 3BFOA 3FFDB 1LDPL 4LF3B 4Z7VB 4FQIL 3VFUB 1HHHB 1IE5A 4J1UB 5IG7A 4U33A 3I3BA 3V6ZB 1WSST 1I1CA 4P46D 2ZUTA 4YHOL 3JXAA 4WUKL 3IAPA 5IIEB 3QI9D 3MACL 4IM8A 4S1QL 3HTLX 1QBLH 5HDBE 1KTKE 3KXFA 3MRPB 4PS4L 2RBLA 3SE8L 5K9KA 5CEZL 1K6QL 3O11B 5C3LD 1DJSA 3CFCH 2NXZB 3X3GH 1AHWC 1CICB 5E6YA 3TYGH 4FHBD 5IJKC 1MJUH 4K3EH 2ATPA 1ZOXA 4N5EC 4RDQG 2LE9A 3MRLB 3HRZA 4X6CF 4HG4J 4HG4K 5CJOH 3EW3B 3MJ7A 3DJ9A 3VXRE 3VXME 1JGLL 2PTTA 35C8L 1HXYA 1OGAD 3BESR 3U83A 3RQ3A 1RVFL 1D5MB 3W5MA 1F97A 1TDQA 1LQSR 4Y16D 5FECB 4F7TB 5GRVL 3RTQC 3Q2CA 2IFFH 3IFLL 4UQ3B 2OI9B 3PQYA 4U3CA 5DJDA 1T21A 1YPZB 3F5WB 1Q9LB 3KDMB 5JIIA 1HHIB 2PN5A 2AXHA 3MXVL 4JFXA 2OR9H 3HUJA 3OPZL 2HKFH 2YUVA 3QPQC 4RA0C 2E6QA 5ID1A 4MXVF 5E2TL 1J8HA 5I1EL 1IGIL 4N0RA 5FUOL 4HS6A 3L5WA 1NGZB 3QRFM 2UUDH 5DURB 3CH8A 4LNVA 4DKEL 4JZJA 3JTTB 5EPMB 3OKEB 3DGCR 3E2HC 4APQA 1Q9KA 4DKDC 4JO2L 3GEWB 2FO4B 2DN7A 4GRMB 4XC1L 2XRAL 1NGYA 3VFPA 4HUUB 5CEXA 3A6BH 1U3YA 4G9FE 2BSTA 3VMPA 3VXSA 1NH6A 3RZCC 3KR3L 2CR6A 1VFBB 2XG5A 4I48A 1B0GB 1MCSA 1T1XA 1CE1H 2J6EH 5F8RC 2C5DC 5EBLB 1W8NA 5F7YC 4WY7H 2N1KA 1RUPH 4N90D 1YEIL 1CDHA 3P4MA 3D3VB 2P5ED 4ONGH 3BKYL 3KYMB 4IEFB 5D72H 1QYGH 1C08A 5EWIL 3TA3D 3A67H 4X7SL 5JPNA 1H5BB 3INUH 3ARQA 1ZLWH 4JVPA 4OCYL 3GSRA 2IALA 2HVKB 1A1MA 1BJMA 1NCTA 4YH6A 2BVYA 5JNYB 4U1GC 4KTEL 5CEZH 5CLWA 2HWZL 3R1GL 1ZGLB 2Z31D 3UAJD 4MYWB 3EOBA 5DVNA 5DFWH 4L8DA 3UTSD 4KK9D 5GS3A 3DOSA 5IB2B 3FO1B 1A7OL 5FYJU 4HJJL 1FO0B 3HZYA 3OR6B 4X7SH 5CJOL 4X6CE 3TO2A 3VWKD 2I9TB 5I71B 3JV6B 5I1CL 3E6HA 4XP9H 1MWAA 5MEOB 3PGCB 4WCYH 4NQVA 1R3IH 3WYRA 3FFCD 3HZVA 1OTUD 3C08H 4QRSB 3WFCH 4GRLA 1QR1B 1YEIH 1PZ5B 1WISA 2CUMA 3GMPB 4G80B 2F5AL 4NZRH 3SOBH 1LE9A 3LRGA 3IDGB 1UADC 3ARDC 1J18A 3MRJA 4UBDC 1ZXQA 2A74B 4Y4FC 1KENH 5C0IA 3JWDC 5E8EB 4OGZA 1VFOA 1CLCA 2MNUA 4GUPB 2NY3C 3MRIB 4L29B 1GGCH 3BO8A 2FJHA 1N59B 1ES0B 1NC4D 1FFNA 3BQUC 3FB6B 4NQXA 4OKDA 4N0YH 4P9HL 5IVNA 2AV7A 3IKCA 4LIQH 1YEFH 2HT3D 2R69L 4F15C 1SMOA 4OI7A 2D3VA 4F7EA 2DKSA 1OB1B 1JFQH 2DBJA 4JO2H 2E8YA 3OKLA 3VG0L 3SBWC 3RNQB 4GMSL 4GAYB 5ACZB 4PG2C 2YXFA 2HVKA 5J56B 4NQCD 5IR1A 2YBRA 5DRWA 1GSMA 5IGXH 3VD3A 4UU9A 3NFPA 4QHKJ 5IMKA 5DFVC 2EKJA 1FVDA 4I4WB 1AH1A 1MI5E 4V1DB 4WDIB 3HLAA 2ID5A 4LSPH 4WHTA 2EDRA 4U2ZA 3MJ7B 4DN4H 2VN4A 3HC3H 1NFIA 3QUKB 5BW7A 3TVMD 4EI5D 1JNNH 1CDUA 3HZYB 1CU4H 3HPJB 1MAJA 2VXUH 1SHMA 5D7LE 2BDNH 2HJFA 4HIHA 5AD0A 1YQ2A 1PQZA 1WZ1H 3DIFB 4XMLH 5CIPA 5ACLA 3FCTB 1UWGL 4OIAA 4XNQA 2R9HC 3UPAA 2KZ1B 3PWLA 3MSPA 4H0GA 3U30B 3GMRA 3UC0H 1T1WB 4LSTL 2OP4H 2DLFL 1FO0H 5IEKA 1FZJA 2Q7YB 1S7VB 1BOYA 3GMLA 1BZ9B 4KI5C 4Q2ZA 5A3IC 5JHLH 4IRSB 4PY8I 4H0IA 5FUCC 3I02A 4C56B 3CFCL 4FFYL 4NGHH 1Q0XH 4P3CL 3CFJB 3MYJA 3ZHKA 3RGVB 3IDIB 2EE6A 4JJ5A 4Q58C 3SCMC 1T1XB 1KOAA 3E2HB 3DSFH 5I8OL 4QCIA 4UZGA 2E27L 5FHAL 4NN7B 1A4KB 4C59B 5GGRB 2NXYD 4FQCL 4MHHI 4PB0H 2C3XA 2HFTA 3FMGL 3NCJL 1G9MH 5BV7B 3B9KB 3BIAX 3B6SA 4I48B 2V9QA 4J3SA 2CLVB 1E4WH 4M7JL 3WFCL 3LN4B 5JXEA 1MREL 3UYPA 2G60L 4BQ6A 2DWDB 2GUOB 5IBUG 2DQDL 3NAAH 4E5XB 3F5WA 1EVUA 4WW1B 5SWSD 2E7MA 5EIQA 1DLFH 3P2TA 1EGJH 2PCPA 5IVZA 3ARFA 4LSSL 4ZG1A 4PLJC 1DQLL 2HN7A 1YEKL 4Z7NF 5EO0B 3O41B 1T1YB 4PRIA 2J8UB 4JANA 1RFDL 2WLYA 2F5BL 2ZOKB 2H26B 1J05B 3KYKL 4BSWA 4MMXC 5FB8B 1NMAH 4R90H 1P4IL 2R15A 4JM4L 1RZ7L 2P43B 5KOVC 1V8HA 1V7NH 2B2XL 5JMOC 4UOJA 2ICEA 2E7HA 4X6DE 3U9PH 2CGRL 3WDIA 4LLDB 1ED3A 4U3HA 5D1XB 4UT9L 4N8VG 1MHEA 2CDFB 2H3NA 3I84A 2VLRB 3OAYK 3OKMB 5EZLB 1EPFA 3PGCA 1I1AA 3G6JA 5T3ZE 3EOAA 4NM4L 3TFKC 1T04A 4MXWH 1YYMH 1TQBC 1MIML 1VFBA 4OZHB 3FO0H 4IIQC 3QEQE 1WBYB 3IJYA 4F9LC 2VNCA 1YNTB 1FAIL 2V2WA 2GY7B 1T7VA 5D7LD 4ODTL 3E6FB 1XGPA 5EBLA 3WXVL 1KELL 2NY3B 2VLKD 4RBPH 3S6CA 3B8YA 3KPSB 3RUGE 4JQIL 1VSCA 3CDCA 3BP5B 3V52L 2D7NA 2ADGA 4PJ9B 3QUXD 1AIFB 5GGQL 4OIIH 2DDQH 4OJFH 1E27B 3U79A 1MJJB 1ACYH 4JFDE 4WFFE 5A2JH 2XA8H 4NP4L 1ZGLA 3O6FB 3TBSA 5DWUL 1DBKL 2F19L 4K94H 2Y25A 5I1AB 3BAEL 4A2MA 2DD8L 5F7LB 1MI5B 4GQ9L 3RVUC 1D5BA 4HAGA 4ODBD 1QP1A 2QQNH 4M43L 1M7DB 3LZFH 3L3HA 3L3KA 1FCGA 5I19L 1DQQB 3MRKB 4HX1B 2Y4SA 3MV8A 1EEUA 2J12B 1SYSB 3KYOB 3BZEB 3HS0B 3OGCB 1G0YR 1P9MC 5A3ID 3SDAD 1H3PL 5C0CE 5F3HB 5FUOH 4EVNA 3MCKB 4ODWB 5E5UB 4PJDE 5GXBB 5MHSE 1X9QA 4HK0B 4FXGA 3V5KA 5F7HA 2QSTA 4BK4A 3U9UB 4GXVL 3BEWA 5HI3D 3NFPB 5IMKB 1L7IL 5MENA 3SJVB 2MSPA 1G7LA 4GUPA 4KAQH 4OV5A 1U91A 1KPUB 5ICYB 1R3KB 1FPTL 1ZHNB 2IBBA 5EO1A 4F37F 3C5JB 1N6QH 5DZLA 5FFLA 5HDQH 5HYEA 3G5VA 4KUZL 4CGTA 1FG9C 2ZG1A 4W6YB 1FNEB 3ARPA 4KHTL 4JKWA 3BPNC 2YRZA 4P2QD 1BAFL 1RZFL 4XMPL 2H8PB 5IG7B 1Z6JT 4ALAH 3LZFL 3U2SB 3AXLA 1S7QA 5C07D 4GW4A 1FYTB 2B5IC 4JCMA 4RGMC 4TN9A 3GSUB 4M7ZB 4UV4H 4DZ8B 3OWEA 1QACA 3C09C 1VENA 1BWMA 3G04B 1F3JA 3B83A 4PJAE 1ZWIA 3KLAB 5TQ2L 3DO7B 1TVBA 5I30L 5KS9E 2LV4A 1FG2B 4NCDA 4IMKA 3QA3A 3GHBH 3WFEL 3BJLA 1JF5A 4XPHL 4YR6B 2X89D 3L1OH 4NZTL 3H7BA 3OX8A 1HHKB 1C12B 2Z91B 3MX0A 1XCQA 2I5YH 1QRNB 3G6DL 4MJIE 1FZJB 2EZ0D 4GS7B 5SX4H 1ZGLM 4N0CC 4O4YH 4ACPA 3WL9A 4K23H 3LHPH 4LLVB 4X9GA 4EBQL 4KMTH 2W1NA 3BAEH 2CDGB 1BMGA 4KC3B 5EU3B 3BEWB 3DIFA 4MB3A 5JTWA 4JG0L 4PJBE 4YK4B 1ZEAH 4P2RE 1IGFL 3RWGA 2PCPB 2FEEL 2BFVL 4JGMA 3D2UA 4UT9H 3NZ8B 5I19H 3V6ZA 1P4BL 1X5ZA 3RJDA 2O5ZH 1OF2A 5C0DB 4RGND 4KHXH 3QEQB 1EAJA 3UAJC 1WT5A 3D9AH 4Y2DC 1NGWB 1EEYB 4HDIA 3FOMB 4LSPL 4KKLD 3GMQA 4XP1L 4FQLL 4U0RC 4TUJA 5DD5L 5DJ8A 2VDLH 5GJTL 3I85A 2H2SC 1GAFH 1RZIA 3O2WH 1W8OA 2WINA 4H5SB 4JFDB 3WJJC 4NQSB 4PJEA 1LO2L 1GHFL 3BSZL 5BO1H 1MREH 1DQTA 1CD1A 2XN9A 5IUSA 2ATKB 2UV3A 3O6ML 4J3WA 3I75A 5FO7B 2NX5E 3U36B 1TFHA 5IM7A 4OGAD 5K9JH 5L9DL 2VN7A 4UIMB 5GGTL 2HP4A 1TVBB 1HDMA 1MCOH 3UJJL 4P9HC 4KPHL 5SWZE 2FX7L 1I8IA 2AJZB 4DW2L 25C8H 2F53B 5C0CD 1MCBA 4HKXA 4YHML 4D9QD 2N7BA 5D1XA 5F70A 5FUZH 5J3HD 5DK0A 3DYPA 3QHFL 5ITBL 1EO5A 1TZHA 4K7PH 2J88H 3O9WD 3TIEB 4Z8FH 4NNXB 4OFVA 1C16A 5EN2B 5I8CA 4KXZI 1DQJB 3CLEH 4IRJA 3SJVE 1U8NB 1QZ1A 1XFPA 1BECA 2J8UE 4NM8H 3DI3B 3QI9B 4NN5B 3ARFC 3C6SB 2BNQD 3MLVH 2J7LA 2ZUYA 4Y4KD 5DHYA 1BGXH 3L5XL 3OBAA 5B21A 5DHVH 1TNMA 2IAMB 4YHPB 3C5ZD 3DHJA 7FABH 4RAUB 2GYSA 1NCBH 1UWGH 1WCQA 4YZFE 1TCRB 3NAAL 5FYLH 4F57H 4JDTH 1NCAH 1I8KB 5CWSB 3GBNH 3QDMB 3RY4A 1RV6X 1BIHA 3N06B 3CC5A 2V5MA 3VGDA 1E28A 4JAMB 5DC9B 5GZOD 4OFPA 2NQCA 4FQJH 1WFOA 4HZLA 4OFKA 3FZUD 3DX8B 4G6JL 3MC0A 5FUCE 3ROOA 5F7NC 3KR3H 4H5SA 1NC2D 5T1LD 4P57B 3BPOC 4ZS6D 5FGCB 4QY8B 5KG9A 1G7PB 5I17B 1FRGH 4IOFD 4DN3L 4O5LL 1SYSA 4CMMB 3ARDA 5D72L 4GJTB 1R5WA 1A9BB 4QHLB 2XZAL 3QDGE 3ARFD 3ULSB 4PJFE 5DMGC 5AUMA 1HSBB 4KV5F 2XV6B 5E95B 1A7RH 4I3RH 4HC1L 1AD9A 4X5WB 5FV1L 3KNBA 4LSTH 4DFIA 4X6FB 1JNLL 4LPYA 1D9KA 5MI0C 3FB6A 5J3HC 1O7SA 4I3SH 3OV6A 5TDOB 1O5DT 1UXSB 4NQTA 1JTOA 5HHPB 4N1EA 3AS1A 3CU1A 4FNLL 1KJ3H 4NJAL 4EIZC 4KROB 2CK0H 3KHQA 3LQAH 2GW5A 5BZWB 5CCKH 3VG0H 1ZANH 2WK2A 3FB8A 3FKUS 4NQDB 4YDIH 4V2BA 1NCAL 4W6WB 3S3PA 3GIZL 3GBMH 1A6TA 2P5WE 4R4NC 4L4TE 4WV1B 5C2UB 1PVHA 4I4WA 1ORSB 1QSED 5CP3A 3V4PL 1XR9A 2VE6B 1MLCB 1TQCB 5IB1A 1U92B 5D7LA 3LIZL 1A3LL 4XBPA 4LRIA 2XOTA 4JDVB 4XZUB 4QYOA 3UTTD 5HYIA 4IRSD 4XP5L 4WW2C 5E5RB 3QDJE 1MAMH 3K4DA 5HGDA 5T5NF 5IFHH 3GK8H 4NKMB 3DRQB 3GBNL 3FQWA 5CP7A 3RIFK 3HMWL 4P46B 4LLUB 4R90L 1SY6H 3AS3A 5FYKU 1CFNA 4LGPB 4U6VL 2JE8A 3QNYA 3L95B 4HIIA 2XT1B 2NY0B 2JIXB 4FQIH 1VFAB 5HBBA 1WBZB 3LQZB 3QWRA 2UVEA 4ZAKD 4XBEL 3WHE0 4JVWA 4P2OB 1TJGL 2DICA 3KNBB 2FSEA 3FHAA 3LS5L 3VJ6A 3GI9L 2P5EB 1IAMA 2XWJB 5JPMB 4NZUH 5E2WL 4WCYL 2YD9A 4GKNA 4OZFB 4Z95L 4P5MA 3S37L 4L4VE 1W0WA 1EJOH 5DUML 3SCMD 2AJXH 1CFTA 1NLBL 3MJ8B 3DETC 4WTXA 2AQ2A 2W0FA 5CSZA 2HLFC 1RUML 1JWUA 2PYFB 3QIBC 3WL9B 4EUPB 1DCLA 5IW6B 4PR5A 1INQB 1V7MH 3QWOA 4Y5XA 2Y06H 4O58L 3CCHA 1EMTH 4HEPG 2EDYA 4RMVA 3SY0A 2X09A 3MOAH 5FHBL 5EOCL 1A5FL 4RA3A 3ZDZE 2CO7B 2R4RL 5DZNA 4FFWC 1E4WL 3L3IB 4JO3H 1CLZH 1QSFE 2YD3A 4P2QA 5A2LH 1KLUA 4U1MA 4EXPX 4TVPE 3NZHL 1S5IH 3VXQB 5FB8A 3OJDB 4Y5XC 5DMKA 1KFAH 4Z7NE 3OXRB 4GW1A 5C0BE 2EDOA 5BRZE 1D5XA 3CFJA 3MYJB 4IHOB 1JRHL 5IB5A 1U3HB 5KSVA 1H5BA 1TJIH 3BKCL 3D0LB 3GMOA 2IAMC 3MFFA 2J5LC 1R24A 4JGUA 1CFQA 2F54A 4L9LC 2PUQT 1RUAL 3CDYA 3EYFA 4EOWH 5GS0H 5C08E 4U1NA 3HC3L 4FZEL 2ARJA 4L4JA 4Y4FB 3NCCB 3O45B 4G80A 5C09E 3QNYB 3K4AA 5T1KB 4J6RL 2BOBA 1OW0A 3VRJA 4GFTB 5IB2A 4R3SA 3D3VE 4YAQB 2CUIA 1TXKA 5CBEB 3GJFB 5HHNA 4WHYG 3SDAC 3RI5K 3BQUD 3O8XC 4M6NH 4TSAH 2B4CC 3N1QC 5D1ZA 5JDSA 5GZNC 3SKJL 1DR9A 1M7XA 4JKPH 3VFRB 1OAKH 3IKCB 3IAQA 4XPHH 2AW2A 4M1GH 2D9CA 3U6RA 1LO4H 3W5NA 5I73C 2OJZH 4LDEB 3VFSB 1A9BA 1UM4H 4KHTH 5A43C 3TA3B 4R96B 1SBSL 3U82B 2GJZA 4PGEA 2BXZA 2MQ0A 3CCHB 4IRZL 2P5WD 4H20H 2Y6SC 2X4QA 1YEGH 3D85B 1IC4H 1JZ4A 4RISL 5FF6A 3OPZH 3D39D 5C0IB 3VWJD 1U3ZA 5T1MA 1HH9A 5E99L 4UU9B 3RVWC 1F58L 4F7MA 4ODXA 1MFBH 2NX5D 5TE6H 4Q9BA 5TDPA 3GUTA 3OTTA 1CK0H 2D4FA 2F74A 4JM2F 3VFUA 4I13B 3MBED 4P5KA 2Z9TA 4XBPB 2FYYB 3C2SA 3PUCA 1PJ9A 3K46A 4WI6A 4K7PL 5CINL 1BFTA 4MDIA 4MVBC 4IHOA 3WO3B 4ETYA 2XN9D 5D5MB 1SJVA 1WWWX 5GGTA 1G9EA 3CLFL 5TE4L 1KB9J 5DDHB 1ZLSH 2DMBA 3IS1X 3C8DA 3FQNB 2IPTL 2VDKH 5BS0D 1CXIA 1OAYH 3HMWH 4J1UA 3DBXB 4YXLL 3BP4B 4U1NB 4IRSC 4FTVD 1UXWA 2WNGA 4P46A 1R3KA 1S7VA 4KJPC 3R1GH 5DFTA 1D6VL 5BZDA 2F15A 1I8MB 1EAPB 5E2WH 3O3BB 1AO7B 4RFOH 5E1AA 2X1QA 3C09B 3TA3C 4KJPD 2B39A 4E9LA 5C07E 4QGYA 1HQRB 1P4LB 1YQVH 4X99B 2A6IA 5F9AC 3RL1B 2VLJB 5FOJA 4EN3B 5HHVL 5J06A 1XT5A 4I77H 5CIPB 1JWSA 4FMKA 3QCTH 1OP3H 1P5VA 4F7PB 1T21B 4JO1H 4G6FB 4JFHE 1OSPH 3U0PB 3ULUH 5I1KL 1CLYH 1SJHB 4PRID 2DYPD 3HR6A 1XEDA 2DYPB 3L7FA 5JHDE 4U0QB 5DRXA 4ZDHA 2COQA 1P53A 3BDXA 1RIVH 2OJEA 5AZ2H 3QWOB 4IS6B 4JQVA 3U1SL 4D3CL 2GAZA 3IKKA 3D48R 3T0EC 4XI5D 3KPNA 4DJMA 4F9PA 2Q8AL 3T3PF 2F8VA 1HN1A 3S97C 1QSEB 1L4IA 3SDXA 3EFDH 1U8PB 3HNTH 4PJ8D 5C0BB 3TVMB 4EI5B 5JOPE 2I9LA 2AVGA 3QG6A 1G1CA 3IXTA 5EIVA 2B1AL 1JL8A 4HIJA 5GGVL 3NIGE 3ZKMD 2F58H 2R23A 1WFNA 1ORQA 5DJZA 2GQHA 1MHCB 4NQDD 5GRXG 4HXBL 2JCCA 2ZSVA 1S7SA 1WBZA 4NWTL 4HH8A 3CUPA 1EUUA 5JW4M 1X5XA 4XWOD 3O3EA 4ZD3H 5GZOC 1ZA6B 1AHWA 3AXLB 3DVIA 3VE0B 3EJJX 5DC0A 2J2ZA 4WGWB 1KLUB 3AMLA 4U1MB 4KKCD 3CNKA 2EDTA 2DJ4A 4JFEB 4JQVC 2R0LL 4LMQE 3L3JA 2Q6WB 2CQVA 4A2LA 4I18C 1VFAA 1FL3B 3OMZA 4QEGA 2VUOA 3IFLH 1H3GA 5C0RH 2LU3A 5DGRA 5CBAB 2JLLA 4HFWB 1P69B 3MLRL 4S2SA 2HJLB 3MRRA 3VWJB 4NKIL 4PJDB 1CXFA 5JQHC 1E27A 1SJHA 1QRNA 5TDNA 5F3BA 5LGJB 3U6RB 5I2IA 1J0JA 3UJIH 4R97C 3WNNA 4NDMB 3N1FC 2G60H 3SPVA 2AI0H 4HWNA 5C0RL 3V4VL 3FQXB 1VKXB 1BZ7A 3IGAB 3ARYA 4F58L 1JGUH 1FFOA 1YNTA 3RWGB 3NCJH 1A1MB 3O8XB 2AABL 1RK1B 1IAOA 1C7TA 5MEND 3BZEA 3MFFB 4JY6A 4DZBA 4KQ4H 3KS0H 3STZA 3QIBD 4YHOH 5HYQB 2B20A 2HT4D 1ZHNA 4P59L 5KANG 1MFDL 3QUYD 2HFEA 3KYNB 1FZKB 4HHAB 2JIXD 1B88A 1QOKA 4GAGH 4JFQA 3EDKA 4KVCH 4OB5L 5CJXC 4GT7A 4WEUD 1TVHB 3MZTA 1NFDA 5TF1L 5TGBA 3QEGL 4LEXL 3CSGA 3TH2T 4A6YH 1S7RA 1DBAH 4UNUA 2DQGL 4UQ2A 4I1NB 5F6HJ 3PABB 3FFCA 3NCYS 3H0TB 1OWRM 3CVHA 3V6BR 1QFWL 1NCNA 2P44B 1M05B 3KXFE 2VXVH 4MJ5B 4J6RH 5JOPD 1FGVH 1KSRA 3Q5YA 1LEIB 4K3DH 3VFSA 1EEQA 2JJSA 3BPNB 4G6FD 3S5LB 3QQ4B 1PYWA 2GTZB 4TVPH 3T0AA 4HZAA 3MRCB 5HGAB 4RAHA 1ADQA 6FABL 5DJYA 2VLJA 1P4BH 4PJDA 1UACH 3TT1H 4MMZC 5I17A 2VXSH 4M6OL 2FX9L 2HH0H 2C3VA 5FYJD 1OAQH 3RNKB 3GHEH 1U8IB 1XH3B 1OL0A 3O4LD 2C1OA 3U0PA 5EO1B 2Y5TA 3PQYE 4YHIB 1HYSD 2NY5H 2F5AH 3RIAF 1T20B 4NO5A 3V5HA 1AR1C 4PREB 3C08L 3JVGC 2DM3A 4CRPA 4WU5A 2NW3A 1MJ7H 1FVDB 1Y6KR 5FYJE 1V7NL 2ZCHH 3ARVA 3UTPD 1MFDH 5B22A 5C6PB 1AFVH 4JFPA 4EQ3A 3QUMH 3H3KA 4NRZA 3MRQB 5DD0H 3ALXA 3FFCE 4Z0BH 1CTOA 2H45A 4JN1L 3RL2B 1MF2L 1BEYL 4DGIL 2DJSA 3DUHA 4K8RH 2PNDA 2BOCA 3CUPB 4GKZB 2UYLA 1CIUA 3T2NL 5D2NC 3BT2L 3MNWA 5E7FA 3ZE1F 4XWGL 4Z7WF 4NQSA 3BE1L 1KEML 2F5BH 4HS3B 3E0GA 5BVPH 2R29H 1ORQB 5DGQA 5DMYA 2ENYA 3D39E 4DVBB 4Z78A 4CUCA 4PBVC 5ALBL 2R0WH 5FM4A 1K8IB 3JV4A 4JM2A 3T0BA 2E27H 3DMMD 5FHAH 1T22B 3DSFL 1FPTH 1HSAB 4MJIA 4NQEB 1KGCD 1R3JB 3MRMA 5C07B 1UM4L 3H9HB 2AJZA 4NO3B 3UBXB 4YBLB 1F00I 5I8KL 3VWJA 2DI7A 3GM0A 1DL7H 1BFOB 1S9XB 1N6VA 4AIOA 2QR0B 3QXAA 3CFKA 3O9WA 5I75C 4UIMA 5D96B 4LBEA 4MNQA 2RCSL 1YPZE 2QSQA 5GISH 3AM8C 4JKLA 3B5HA 4KJQD 4LDOB 4PREA 1EGJL 4I3GA 3AU1A 4PTUA 1DBBL 4WU7B 3B8SA 5DRZB 3EZ8A 1DEDA 3KVQA 3OB0K 4LF3A 3AAZA 4JFYB 2JJWA 4AY0A 2ADFH 5EOQL 1U6AH 1AHWB 3QRGL 4JY6B 3R4DA 3MOBL 4LHJB 1CE1L 5GSVA 4WFEE 2XZQH 3DXAE 2VQ1A 2FECI 4Z5RA 4HPYL 3TH4T 2P8PA 1ACYL 3QIWC 1UJTA 3PQYD 4HWBH 3S98A 1VDGA 3TCLB 3U1SH 4ZQKB 3N85L 3ILPB 1AGBA 3MOBH 4MQ7B 2AXGA 4JFEA 2D7PA 1ES0A 2R1YA 5E08L 1KCRL 5CWSA 3TFKD 4HKZA 3CVHB 1OD9A 2XG4A 4WW2A 4XXCC 5DMKB 5ID0A 1XGYH 4PJCA 3RKDD 3BW9A 3IRPX 1JFQL 1OVZA 1GGYA 3SN6N 5DQDH 4GAJH 2GJ6E 4S11A 3MJ9H 4KGLA 3S7GA 4N9GA 4FZ8H 3NZHH 1JMXA 4P4KB 3NCFB 5GISL 5D2NA 5LBSH 1GGCL 4OZFH 3KPRA 4NUGL 5FYLE 1F5WA 2CMRL 2ZSWB 3EYUL 1FFOB 1EEZB 5KZCB 4BQ9A 3A6CL 4IMLA 1D9KD 4RNRA 4KKLC 2IANA 1IGYB 1KIQA 4HKBB 4OD1H 4YBQD 1R5WB 4BH8A 5IBLD 3T3ME 1KJVA 5D7KD 3GRWL 4ZXBC 1ZHBA 5T5FL 4X6DF 3IU4L 4PLJD 3CXHJ 3ZKXC 4PYGA 1KPRB 1IFHH 4NN7C 1BD2E 5F1OB 2ZG3A 2Q76A 3V5KB 1KN4L 5EB9A 1NGXA 1Q8MA 4OTXL 5KZCD 1CGXA 5ETUB 1YN7B 2Z8VC 1ED3B 1DSFL 3MODL 4FQ1L 4ORGA 4R8WH 4PGCA 5AWNH 5MENB 4G43A 3OGCA 4POUB 4HJ0D 5ISZB 2C1PA 1RIUH 4NBZB 2ADIB 4FXKB 2R4RH 2BY3A 2VH5H 4PY8J 1IL1A 4WFGD 3KYNA 3MR9B 2ZNWA 4KTEH 1FFRA 2VDPH 3VXNA 4W4OA 5FUZL 4LLQB 5IHBA 1FFPB 3FMGH 1EFQA 1EHLH 3L7EB 1A6TB 3HC4L 4LLMB 3MRCA 5IQ9A 2JB6B 5DEFA 4HJJH 1ORSA 2XTJE 3LKPB 3QDGA 4WUUE 4H1LB 3QQ3A 5I8OH 3FRPG 3HI5L 3VXRD 3GSNB 4WW2B 4J3TA 3N0PB 1DUZA 3MLUH 1LEIA 3EYOA 5EG6C 4DVRH 4LLYB 2DQDH 1JZ5A 4CVXA 2JK5A 3QJHB 2MPAL 4NRZB 4P3DB 4XCFH 4Q9QH 2DLTA 5TE7H 1VEOA 3VWKA 2DIAA 1FNLA 1NEUA 1F4YL 1U58B 2F9BT 5E5MA 4AEIL 3DX7B 1JRHI 2OQJA 4UAOB 1GIGH 1CL7H 1YMHB 4AEFA 4RNRB 4F8TA 4WI7A 5C07A 5FKPB 4X9FA 1JYWA 4NRXA 4ZUTB 3IFNH 3ARFB 2J4WL 3QH3B 1IFHL 1SVZA 1B4RA 1KXVC 1A7QH 1A9EB 4MA3A 5GRJL 4D0DB 3REVA 3FTGA 4GW5B 4LCUB 2Y5TB 2VWEC 2WBJA 2DKMA 2QKIB 4MXQD 3LQZA 1BX2A 1PLGL 3HAEH 4MNQB 5ADPH 1VB9A 2XRAH 5BCAA 4BZYA 3M07A 1N64H 4BFIB 1IM3A 3QUYA 3E6HB 2R2BB 5F96L 5GGUB 4NUGH 2FBOJ 2CJUL 2DB8A 1ZTXH 1BF2A 5IGXL 1NCCH 1JI2A 4HFUL 4YX2L 4OM0L 1AE6L 2BSSA 2JJVA 3HMXL 2RIKA 4C57C 2APWA 1H8SA 2FYYA 3QZWG 4L4TB 3MLWL 4KI1A 4QHUA 4K71B 5F7EL 2VITB 2IMMA 2DIJA 1YUHB 1GPOL 1T03L 3BPLC 3OAUH 3DGGB 4NZDA 4UMGA 5E08H 1YEEH 5ADPL 15C8H 1GGBL 4N90E 2OL3A 4LCIL 2DJUA 2G5RA 5LWYH 1G7JB 3QUXB 4NJAH 4YPGA 4X5XB 3QG7H 3R0NA 4XNMA 9CGTA 5FKAB 1G7IB 5T1KD 3MV9E 1IILE 4DFHA 2JK5B 1SQ2N 3QJHA 1EIBA 4HUNB 3MUGB 3RWHB 3JWDL 2J1KA 3MGOA 4XCEA 3OXSB 3Q1SL 3QUZC 5KVFH 1A6ZA 1M4KA 5IM7B 1G7MA 3RZCB 2NY6C 2ZUXA 4M9OA 2JJTC 2UVFA 1HKLL 1TZGH 3TCLA 4PJ7B 5AG9A 2Y5EA 1IGJB 4BYHA 3NACH 2DQHH 4JHAH 2J8UF 4Q9QL 4ELME 3WFDL 3C6LC 2CD0A 1IAKA 3B2UC 2ARJB 2M1KA 3B3IB 2P7TB 4LVHC 4Q6IC 4JGJA 3VA2C 1HWGB 1AXTH 4FQQB 3KYMA 3BE1H 3HZMA 4BFGA 1BHGA 4H0HB 2DTSA 4M7LT 4AQ1B 3ZT5A 4G6JH 3WDHA 2OXGA 4CAGA 4BSVA 2G9HA 1T6WA 4Z5RB 3MV7A 4M7KH 5ISZE 2Q8BL 3OKEA 5C6TH 3MRRB 1MNUH 4EI6B 1JK8A 3VFMA 3UZQA 3K1DA 3HE7A 3MRHB 1RURL 2HTLD 4GH7B 4L1DA 4U1IA 3PXHA 4FXKA 4XMKL 2PTUA 4MDJA 3WSQH 3S4SB 3B9KD 4OLXL 3MRGB 3BWUC 4WUUB 3G6AB 2EXWC 5C08A 5C2BH 5HYJE 1XGYL 3VG9B 1MRFH 4ODXB 1OAXH 2PO6A 3C8KA 3W2DH 4N8PA 1FH5L 5IB3A 4G8FB 4QY8A 4J3OC 1KJ3L 1T5WB 4Z7UF 3TV3L 4MA7L 1V3KA 2R0KH 1JP5A 1I9IL 3T0DA 3RDTC 5B38B 4R96A 4ELMA 5LBSL 1N3NA 5D9SB 4QRRE 5KN5B 2GK0A 4RDQF 2P49B 1HWHB 2FD6H 1CGWA 2XZQL 1MCRA 2ZCHL 3OKLB 4XB7A 3OR7A 4LAQH 2VSDA 5I18L 1MY5A 5T1LA 15C8L 5IJKA 4FQ2H 1KACB 1D6EA 3GFUA 2GJ6B 3T65B 4C83A 5LVEA 2DQCL 4Z7QE 1HYRC 3X11A 1T03H 1INDL 5IR1B 1G7PA 2WWMD 3P4OB 3QULB 4HKBA 1X6LA 3LDBC 5C0EA 4JANB 1U8KA 3L6FA 4HCRA 3OF6D 4JG0H 1Z2KA 1FGVL 5KS9A 5EZIL 2QADD 4DN3H 2Y7QA 5HHOD 1HIML 3DUUA 3QR2A 1BZ7B 5TF0A 2V17L 3HPLA 3KPMA 1ZTXL 4LCUA 2DYPA 4IRJC 2SEBA 3CDGA 3MGTA 3ZYOA 3O3UN 2CKBB 1XIWD 4OLUL 4GAYA 5EBGA 5ACZA 5D1QA 3S96A 1MFNA 2FGWL 3NGBC 1KCSH 4BKLB 1D3CA 3LKSB 3MLSH 1JPTL 3OJMB 5HPOA 2APXA 4DTGH 1ZLWK 5HHPA 1L9MA 3LN5B 3V6OC 5HVHC 4XVTH 4LVOC 3KLSA 3JWNC 4Z7VE 2Q3AA 4XNZB 4JFED 3X13A 2VQUA 5E1AB 2VZ3A 4HLZH 1I7UA 4OCMC 1F8TH 1MHCA 4NQDA 3UEZA 3DPBA 4L3EA 5B4MC 3DGGA 2WSKA 5CLTA 1ZLVK 3C60A 4ELKA 2XFXA 3QDJD 2AQ1A 3MLVL 2I07B 4XCCH 1UWXH 1QSEA 4DQOL 2GFBB 2AI0L 3Q6FB 3QI9C 4NN5C 1ETZB 1KB5B 1OAZL 3SE8H 3Q48A 3SDAB 1N5YH 1LK2B 4PJGE 4KDTC 1J1OL 4NKOB 1QKZH 5I1AA 5JW3H 4RISH 1GZQB 3BHBB 4M03A 4OCRH 4BZ1H 5T1LB 2HMIC 4TQEH 1F90H 3RWCA 1YY9D 2W9DL 2MMXA 3LCYA 3VD5A 5JHDA 1KG0B 1CTNA 2XWJA 4WEBL 3C6LB 5DJ2A 4FFYH 2VXQL 3F7VB 4Q7DA 1J0HA 1JPTH 3F7YB 3TJEH 1CLOH 4H26A 3UTQB 4PRIB 5KTEH 3CH1A 1CWVA 5CSZB 2NY5L 4YHZL 4LRIC 1CI5A 3Q3GB 2JB5H 4PB9H 3QP3A 1LD9A 2YRLA 1C5CH 4JPKL 3KHOA 3S5LG 2EDJA 4LKCA 4XX1G 2GT9A 2YPLD 5FYKD 4OV6F 4Z7VA 2EIDA 1M7IB 2BERA 4MNQE 1ROWA 2XKSA 4OZ4A 2BDNL 3UPRB 1DQML 4FZEH 1IQWH 3WBDA 1KTDA 1ZA6A 3VW3H 4LHUA 1J1XL 3BGAA 2B1AH 1MJ7L 4RIRA 1LDPH 1A4JB 1W72A 3MRHA 3V8CA 4L4TD 2IQ9H 4ETQB 4KGJA 3W11D 3RGHA 2YA2A 4Y8AA 1U8OB 3MREA 4YWGL 2EZ0C 3TF7C 2QSCH 2EXYD 1OP3K 5CP7B 3RX7A 2JELL 3MZGB 1TVHA 3EJYC 5ICXA 2Z8SA 1T4KB 2YN3A 2AGJL 3SKOA 2Z4QB 2HT4C 4ZYKA 1CIDA 3I6LE 4NKOA 3HHRB 4EKXA 3LOWA 3W39B 3THMH 1HXYB 4F33A 3B6SB 5C0JA 2BJMH 4LIQL 3ARBC 3EKCA 3QBTB 4GMTL 4JFEE 3H8NA 1MH5B 2JELH 3IGAA 4NM4H 3TYFA 5TGBB 4B53A 2DM2A 1FNFA 2G9HB 3EIFA 2QSCL 1U2HA 2B8OT 3OR7B 3BUYB 4UQ3A 3KPQA 4HPYH 5BVJB 2WP3T 3D25A 1D5IH 1X5FA 1IQDB 1R5IA 4AYFA 5JW4N 2BC4B 1DQQA 1I85A 1RIVL 3TN0D 2JB5L 4JFOA 4FQQA 1QSZA 3PHQA 3RY5A 1EHAA 2C3VB 4O4YL 4X0KA 2YMXL 1FORH 3NFSL 2YD7A 1IAIL 3JTSA 4FQPA 4NZUL 1INQA 3G6DH 2JJSC 4GBXD 1EA9C 2BOBB 2FHCA 1S9VB 2EEDA 3O4LA 4U1LA 1BQUA 1TQCC 3KYKH 1G6RB 1JWMA 5FXCH 5TH2B 1F6AA 1ZLSL 1HHJB 4QOKD 3L3KB 1F90L 1F8TL 2VLRA 1KTDB 1G0DA 1QFUH 3FT3A 4FQCH 4PB0L 3HS0A 2KKQA 4TOYH 1HHHA 4JHAL 3EO1A 5HI3C 5F9DC 3ULVE 2W65B 4UI2A 1MLCA 5GS2D 4BQ8A 3QNXB 4L8DB 3EGSB 2P5WA 3WNOA 3IDUA 1D5XB 2MOVA 2YWZA 5T3ZL 4QHKI 4ODSL 2Y9RT 1X5HA 2R0LH 3TO2B 2I9TA 4H25B 2CUHA 1HNFA 1R3HB 3ARED 4OCSL 4Z7WE 4TOYL 5JHLL 1RULH 2AXGB 1IGMH 3ZKND 3FQWB 2WW8A 2UZXB 4PRNA 3GIVA 5SWQB 3C9NB 4FRWA 1WAAA 3FQRB 1U3JA 1MVUB 2DBLL 1J1PL 2R2EA 2AEIT 5DRNB 4HK3N 1KCLA 4Z0XA 4F9LA 3SKJH 3DVNB 5EFIA 3KXFB 3MRPA 1L0QA 3EJZD 5D2NB 5IBTL 1K8IA 3JV4B 1G9ML 4XI5C 2CDEB 2PW2A 4JQXA 4LLWB 3KJ4C 3S35X 4XVSL 4QRRB 1MFEL 1N59A 3PDDA 5ESVA 2GFBA 1BQSA 4D0BA 4FMFA 4WENB 3HNVL 4QF1B 1FVEB 1U8LB 2Q1EA 4JY5L 3RVXC 5ICZB 1CBVL 4LLYA 3MFGB 1U3HC 1HHIA 4ENEC 1L7TH 5HJ3B 5FO9B 3QO0A 1C12A 1RZJL 2CIKB 5D2LB 3QFJA 3BEVB 2X4RA 4V1DE 4LBEB 4EUPA 4OF5A 5INCA 3E8UH 5EBMB 4ODTH 3DX7A 3GKWH 1CL7I 3P11H 4ORZC 4JO1L 4LU5H 4HQQH 3O4OB 4NNPL 2K7QA 4HS8L 2QSVA 2KQNA 1FNSL 3V95A 3JTTA 4GQ9H 3O0RH 1W0VA 5HYSA 3WSQL 5GHWH 3HUJB 1IL1B 1NL0L 1UH2A 4K94L 1QQDA 4ZNCD 3GMPA 3PP4L 3DTXA 3UXFA 4PUBH 1ZT1A 5C0AA 2FL5A 1E28B 4MJ4A 4QTHB 4NOFA 3TT1L 5D5MA 1CE6B 1KJMA 5SX4I 3L7EA 5L2KD 5BMFL 2ZSVB 5KSAB 4JZJB 2FATH 4MNHB 2QADB 3B4NA 3NIGF 2XQBH 2J8OA 2LU7A 3HE6C 2GJ6D 3PDGA 1LEKA 1AQKH 4KRPB 4OZGB 3U0TB 5L2KA 4R26L 3Q5OA 2WQ8A 4OGYL 1CFQB 2F54B 3QG6B 4KTDH 2VKXA 1Q9WB 3FO0L 3IDYB 5D6DC 1T4KA 5DQJA 4CVXB 4UV7L 5DJZB 3ZDYE 5F9JA 4LPXA 1R3LA 3I3EA 1IM9A 1JHKL 4B5EA 5T3XL 3QXVA 4LASH 1MJUL 3JUZA 4GBXC 3VGFA 4D9QE 1X5AA 5HHOA 4ERSL 4YO0B 3WJJA 4OZIB 3O3EB 5FM5O 4NQED 4M6AA 3TNMB 3KGRA 3I50L 3UTTA 3SQOH 2DQIL 3HG1B 5I1CH 2VMFA 4O51A 3KS0J 1DE4A 4I2XB 2P5EE 3VG9C 1MHPH 2P8LA 2IANB 4PLNC 2WBJC 3HAEB 4P4RB 3IJHA 5CGYD 3I2CH 3LEXA 1DQDH 3AS2A 2WWKT 5T5FH 3HFML 4KI5D 4PRIE 2EO9A 1G6RA 1JHLH 4OD1L 1M7IA 4OI9A 1CF8H 5ANME 3ULVL 3RTQA 1A6WL 5JZ7C 1QVOB 1FV1B 3ECBB 5HGBB 4MAYB 3L9RA 2EIZA 5F71A 3O41A 1KIRA 4NC0B 4U05A 4HKJB 5E03A 1WJ3A 1EFXD 4KKAD 5EOTA 4R8WL 5AWNL 5SWSB 4OLZH 1LEGA 4HFUH 4HV8B 4TNVF 2A6KA 1NUNB 1NLDL 1J5OL 2WIIA 3NFNA 4YZFF 3IDGA 5IEHA 1CGSH 3UROR 1MH5A 4UDUB 3V4UH 4L8CA 1T7WA 2FO1A 2AXJA 2R2CA 3QEHA 5MEOA 1B3JA 3QEQD 1GGBH 2ZWLT 4P57A 1IVLA 3RWEA 2VTFA 5L6YH 5HHOE 5D2NE 5T1DL 5LXGL 2W9EH 2OZ4A 3FQRA 5JHDD 4X0KB 3GZKA 1TQBB 2X1WL 3KPSE 1EAPA 3RUGB 3VXNB 3RZCA 3NN8B 1NFKA 4GRWE 2PR4L 5GHWL 1DUYA 2P5EA 1GC1C 3A6BL 1A6VL 2UWEE 4HLJA 2CJUH 4EQ2A 2O5XH 3LKPA 4E5XA 5JXAH 1T3FB 2OQJB 1Y0LB 2L7JA 4HXBH 1N7MH 4NQXB 1ZANL 4QHMB 2NY3D 4WY7L 1FYHB 5KVDH 1GH7A 3SGEI 4HH9B 3BKJL 5KVGL 5HXMA 3O6FA 1T83A 4JCLA 4G8GD 1VKXA 1U8NA 3ZL4H 4Y4FD 4BSJA 5IK3A 5LAXA 1GC1L 2ZUWA 2GITB 1BX2B 4M7LH 5HPMA 4XPFL 3FRPA 1WC7B 3HPJA 5C0CB 3IXAB 3P9LA 4R2GC 5IQ9B 4NNYA 4XPGL 4ENED 5J1AA 2AJ3A 4CDHA 2R2BA 5TDOA 1JZ8A 1U8KB 3L6FB 3QIWB 4ZFGL 5HYQA 5MEQB 4CVZA 1T0NB 2CO6B 5B39B 4Y5VB 4MWFA 1UZ6F 3OJDA 2QQKH 3DUUB 4O02L 3BRFA 3M8OL 3K2UH 5MENE 2GEEA 5INCB 5EZOL 4OZGE 4Y4HD 4HMEA 4QTHA 4HMCA 4RAVA 4XMKH 1U93B 1OAUH 4XNXH 5D70L 5DMGD 2VDOH 3MLXL 5IB4B 4TTGA 1HH6A 2XTLA 2XKNB 4JEGB 3KJ6H 3FCTA 4KI5E 2ZPKL 3IDIA 4I9WE 4WV1C 3TBVB 3PABA 1CD0A 4YGAB 3P77B 2JCCE 2VE6A 3CMOL 1T2QH 1T5WA 1I3UA 4ZS6C 5GGRA 3U4BL 3BIBX 4PJ5B 2X42A 3VA6A 4AT6B 4U6YB 1LNUA 1NAMA 1FL3A 1K9TA 5DEZA 4F57L 2CIKA 1R3IL 4ELKB 5KJRH 1G9NC 4G7VL 1QPXA 2PXYC 1QHOA 2CLVA 1K3ZA 1Y0LA 1PZUB 3VXMB 1T22A 5HSFA 3TT3L 3MRKA 2ZKHH 3I50H 5K9JL 3WIHA 4HIXL 5KS9B 3BT2H 3PE9A 3TYGL 4XXDA 1W0WB 1K4CA 3C60C 5GJSH 5IHUL 3U4AA 3PGFH 5CJBA 2FX8H 4OZHF 1WGOA 2H26A 3MPCA 2CLZB 1Z0MA 4L3CA 3BZFB 1YUHA 3S96B 2OTWA 1QRNE 4MJIB 4GKNB 1EHNA 3R06A 3QHTC 5SWSE 4F7MB 3PWPD 4DKAA 5JOFB 3TN0C 4Y5VA 5E8DL 5CSBA 3H7BB 2EIZB 3OX8B 5D7IF 3AREA 1G7IA 4JDVA 4QRPB 2X9WA 2XZCL 1CXLA 1UG9A 5DQJB 4XXCA 1I9RH 5DD6A 1FNEA 1KJ2H 3UTPE 2EXWD 4CN1A 2APVA 2BFVH 1JTTA 5TPWL 2VLMD 3T04D 5CD5D 1U8MA 3QPQD 3QNZB 3WXWL 5GGSA 4LSDA 1AE6H 5C1MB 4G5ZH 4YUEL 3SDXF 2HTLC 3WLWD 2K7PA 5SV3A 1VGEL 1I1FA 3PWNB 4GOSA 4JHWH 1MCWW 2GJJA 3ILPA 4PRHA 5HD8C 4KKBC 4Y7MA 3FQTA 1PG7X 1JN6A 1LEGB 1N64L 4HV8A 3D3VD 3L95A 5IWLA 4NC1E 4GG8A 4MSWA 1OQXA 3ARBB 4BUGA 3GMQB 4BELD 2OL3L 3RL1A 2G75B 1P1ZB 3W11C 3MCLL 4I0PC 5DJ8B 5SV4A 5CKAA 4JY5H 3QXTA 4KMQA 2NNAB 4PRPE 3MNZB 4K9EC 4RGOL 3DYOA 2IGFH 4QXTA 5DSCA 4XNYH 3T1FB 1RAMA 3O9WC 5SWZA 5JW4R 3Q5TA 4UB0L 4ELMB 4X6DA 5SWSA 4KDWA 1UB5B 2BY2A 4OD2B 2NY6D 2APFA 2ADJB 4NO0D 4PGEB 1HDMB 3CZJA 4I2XE 3L1OL 4N9GB 1AI1H 5I8KH 1A6WH 4J7RA 2LABA 3AY4C 1UZ8B 4KXZH 3ZE2E 5AYQA 4JFYA 2A83B 1R0AH 2BRQA 1NGQL 5IV2A 4M5ZL 5C0DA 1WCBA 2EYTB 3RA7L 3CDFA 3WIFA 4HIJB 3WN5C 4LCWE 2F74B 4J3XA 1T0NA 1DL7L 5HHXH 2YD5A 3BISA 2MKLC 4EDWH 3LEYH 2DQUL 3T0WA 3ULVD 3IXAA 5E4EB 2HFFB 1KN2H 3D1MC 4G6KH 4X9IA 2AERT 5F97E 2VC2H 3D0VB 3DWTA 2XFXB 3DI2B 4ORGB 3PWNA 1I1FB 2BNQB 3EHBC 3T0VA 3O3AA 5C7XL 1KPUA 4LAJH 1QFUL 1XZ0A 1P7HL 5FV2A 4RMRA 3QHFH 1BF8A 5EOCJ 3GNML 2UYLB 4WWKD 1JVKA 4O9HH 3VDAA 4P48A 3VXOA 1U41A 3IRZA 5I1GL 1BQHG 4GW4B 1KEGL 5J0BA 1X3DA 2RB8A 3DMMB 1DVFC 5MEPA 4MLIA 3ULVF 1EUTA 3ULUC 2WUCH 3GJEB 1KJ2L 3QZWB 5IB4A 3GJFA 3VXSD 4KTYA 3EYQC 1F3JB 4YEEA 4RQQB 4HUVB 5E2UH 3VXRA 2VABA 5D1ZC 4J8RB 4QXTB 3MTRA 4I0PD 5DSCB 2UUDK 2YBRB 2AQ3A 2VZOA 2YEZA 1AGDB 3UBXA 1I8MA 4MJ6B 3QIWA 3TBWA 3TIDB 2AJSL 3ZYZA 5I8CB 1QFWH 4GSDL 4HPOH 1HHKA 5HDOA 1GZQA 3BHBA 4OLEA 5I74C 3IETA 1EO8H 3GBLA 5HD8D 3L3OB 3W9EA 1IZJA 4OGYH 2DQJH 3QA3B 1FBIL 3PL6D 4GRWH 1A6UL 3UDWC 3WLWC 1D9KB 4ZS7L 3QFJE 5F93C 3TBVA 4M8QA 2YHGA 4NQDE 2BMKA 4WTWA 1SM3L 4GBXB 2WWMC 4UTAL 1UJ3A 5FO9A 2WBJD 1TITA 3K8MA 3EGSA 1LO3H 4R4BA 5LKNA 2BNRE 3EFFB 2ZUVA 4CN6A 4L4TA 2NXYB 3CIQA 4B7IA 1U95A 3HAEG 4PJ8C 4ETQA 2IQ9L 4U1GB 4ONHA 5AZEL 3UCRA 3V0WH 1B0WA 2DKUA 3P77A 4EUPG 3PWLB 3FFCB 1AP2B 3RP1A 3GKWL 2AXFB 2H32H 5H35B 4HJGB 5C0ND 2R2HB 3AC0A 2VXQH 3GKZA 4ZOBA 2MTPA 1S9KC 2VXVL 3S5LA 3VWKB 1NKRA 2ATKA 4PJCB 2JCCB 4BM7A 2AJSH 4DCQA 2YUZA 4H1LH 4JR9L 3K2UL 1MJ8L 4PGDA 3TM6A 2R8SL 5JLZB 3HE6D 4EN3A 4CVWA 3D39B 5D2LF 4X6BA 4PY7B 1Q9OB 4PGBB 4YNYB 1I3VA 2FR4A 5INDA 2NY5C 2OCFD 4C55A 2BVQA 3HG1D 4N0FB 5CJQH 3QSKB 1NC4A 3WS6A 4D0DA 1JPSH 2E5EA 4NQEE 3VFOA 3PHOB 2IPTH 2VDKL 3NTCL 5EUOE 1ZS8A 2Y07H 4XPFH 2Q7NA 3O6FC 2X89A 1C16B 5FYKE 2V7HA 3BGFB 3QIBB 1E0OB 3CLFH 3EYSL 2C26A 3OQ3B 1T20A 1TLKA 2X4SB 4Y4HB 5TE4H 4L8BB 1JPGB 4O9HL 1JBJA 1F4WL 3PP3K 1AGEB 3QUYB 4NWUH 1RZ8A 2X4OB 5EZIH 3BUYA 5DA0B 1QYGL 4PJBF 2X10A 2WLZA 4QOKA 2BNRA 2DQHL 3KPOA 3QHZL 3ALPA 4X5LA 1A0QL 1QQDB 4UB0H 2DRUA 1TCRA 1AGFA 1HXMA 3C6LD 4JM2D 4X6DB 4Z77A 3K8LA 4D8PB 3DV6A 4X6CA 2ZUQB 4PJGF 4HXAL 1JN6B 2DQTL 5C0GA 2ESVA 2E6PA 3MR9A 4Y5XB 1B6DA 4JY4B 5L7XL 3T09A 4G6MH 4KI5F 4P2CG 4S10A 2ORBL 4OZHA 1D7FA 2YOCA 4IBLT 1VGEH 4LMQI 2FIKA 1NGQH 3MRNA 3LSOA 4R2GD 4WO4C 1I7ZB 4LPCA 1A4KA 1MCLA 4MNQD 3DV4B 2YR3A 2AEQL 1JNJA 5A2FA 4JKPL 4LQ1A 1JGDA 4S1RH 1T04B 1DUZB 3RWJB 4YIQB 1FSKB 1EFXB 3JTSB 5D7IA 1B2WL 4BA8A 5C08B 4XNYL 1CD9B 4PGDB 3ZKNC 3WNKA 1RSFA 4UDUA 2XXCB 2GHWB 4D9RD 4RGOH 1XGPB 1YJDC 4BQCA 5GRWA 2P8MA 3WXWH 1FVCB 4UILL 2R0KL 4JO3L 4L9LB 3JSSA 3TV3H 4F8QA 3CAFA 2HN7B 1I3GH 3TO4C 2F58L 4JQIH 1BBJB 1KULA 4ZPTA 1CDBA 1ZA3A 4QOKE 5C0FB 1K8DA 5L88L 1OSPL 3QO0B 1O0VA 3Q6GH 4NO0B 3RVTD 4GQPH 1P2CA 1MI5A 3QCTL 2CKBA 4YDLC 4N8VA 3RPKA 4QWWC 2FHFA 2NY1D 5ESQA 4J8RA 1KIRB 3WLBA 1XZ0B 4LARH 1HXMB 1I1YA 3SKNB 3VI4E 4PJFF 5GSVB 1UKQA 4QRTA 3OAZH 3MCKA 2OSLA 1ND0B 1ADQL 5IEHB 1FSKC 5J4MA 2VITA 1QBLL 5EU6D 2V9RA 1X4YA 5SX5K 5DF0A 5EA0L 3VRLE 3O6LH 2IAND 1KN4H 4NQUA 2ED7A 1A6AA 5LGKA 4WUKH 3RGVA 1EV2E 5F7WC 3EYFB 4UT6H 3LD8B 4OZGA 5MEQA 4UNVA 5ID0B