1NGWB

Chimeric affinity matured fab 7g12 complexed with mesoporphyrin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
216
structure length
216
Chain Sequence
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKYNEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Mature Metal Chelatase Catalytic Antibody, Light chain
publication title Structural evidence for substrate strain in antibody catalysis
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 39
structure length 216
sequence length 216
chains with identical sequence H
ec nomenclature
pdb deposition date 2002-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngwB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ngwB02
1WIUA 4UZGA 3AS3A 4IEFB 3T4AA 1AR2A 3AREB 3KPRA 4POZD 2PYEE 1BVKB 4L3EA 3MXWL 5F1OB 1T4KB 4G5ZH 1JK8A 1FAIH 2AJ3B 3BKCH 4GSDL 4DN4L 3DX8B 2VDRH 4MD0A 3GMPA 4JKWA 4JY6B 4P4RA 2XWJB 1FO0A 3LKQB 3W11C 3VFGH 4KRPD 4Q7DA 4UIKL 1Q1JH 4CMMB 4RFEB 4HWBA 5FO8B 3WIIL 1JZ4A 2Y9RT 3OV6A 3QI9B 3FQXB 25C8L 1MCRA 4OGZA 3QHFL 4QOKD 1FC2D 4OGAC 2IF7A 2GITB 4Q6IB 4KV5E 4FQHA 5GS3A 12E8H 1OWWA 3R06A 2CLZA 3CSGA 4HKBA 5JDSB 4D8PA 4NZDA 4ENED 4J3OC 4MGXA 1FN4A 1ONQB 3VMPA 5I9QC 2AXFA 4LMQI 3MV8E 4MAYA 4U6HB 5C6TL 3CPLA 3SKUD 3V0AC 4KV5F 4Y19E 2BC4A 3DRQA 2GW5A 3PWPD 3IDXH 1JP5A 1E4KC 1TJGL 4PJ5A 4ZUUA 5I1LB 2X4PA 4G43B 4U1HB 5AWNH 4EBQH 1CFSA 4HWBL 1D6VH 5HPMB 4BZ2H 4S2SA 2FO4A 2R0LL 3JTTA 4C4KT 3C2SA 3MCG1 2IFFH 4DEPC 2FSEB 3BD5A 4YBQD 3IDIB 1KUMA 1IILE 2NY0B 3U9UA 3RTQB 2WK2A 5CEYB 2XZCL 3P2TA 3PWLA 2VXUL 4CKVX 4YHOL 5IR1A 1YMMD 4Q9QH 3GMRA 1DBJH 4WTZA 3PHQA 4KKLD 5C08B 4JLRB 5DJAA 2BDNL 4MQSB 3ULVF 3MUGB 2H32A 5C2BH 3RWJB 2F58H 4F3FB 5I9QB 3RGVA 4MCZA 4PYGA 1NAKH 2A77L 5CEXB 1JPSH 3QXDB 3UEZA 1AQDB 1FL3B 1CLOL 1LO5A 2A6DB 3GSUB 1J0YA 1G7MB 3BWAB 1H3TA 3E8UL 2V2TB 4AEHL 2EO9A 3SCMD 1XGQA 2VOTA 1T83C 4AT6A 5LQBH 4LU5H 1RZ8B 5CKGA 2OL3B 1X4YA 4DEPB 4K2UL 4RISH 5GGRY 2X4SA 4TQEH 4CL7A 1WWWX 1P2CA 2PYFB 5CGYD 4S1DC 4YHIB 3L3DA 4GKZB 2F5BL 1G6VK 3DVIA 3QDMB 5DC4B 1D5XA 3ZE1E 3H9SD 3CDGB 3WL9B 5D1ZA 4HUVA 1L9NA 1FV1A 3U9PH 5BOPA 1C5DB 3EDFA 4Y8DC 5I1AB 2VL5A 1T0MA 2X9WA 2IQ9H 5JZ7C 4XVJL 4K94H 1DN0A 1MEXH 2EKJA 3LPFA 5I1DA 1E6OH 3CSYB 5I71C 4L1HA 2VLRA 1K8DB 4P2OD 5TFSL 3O9WB 3ZE1F 5DVKA 3TFKC 1FRGL 3BH9B 1I85A 4PJAB 2I9TA 5E70A 4I3RL 3TO4C 3ZZ1A 3P4MB 4WW1A 1L6ZA 4K23H 1D5MB 1RJLB 3TC9A 3L7FB 4EQ3A 4RGNC 5ERWA 4E41E 3Q6GL 4CADB 3DOSA 3S3PA 1G7LB 3FOLA 4OJFL 5L88H 1C16B 1U41A 2AQ1A 5L7XH 2ZOKA 5FIEA 3C8HA 3HS0B 2C26A 5A40E 5H2BA 2CRZA 4RAHA 5DHYB 4Y7MA 2OBGA 3VRIB 2DL9A 1JRHI 3BP6B 4X6CB 5FCUL 4XGZA 1P7KA 3RNQA 1FVEB 5DO2D 2VLJB 1RIHL 3VI3E 1UWEL 1OF2B 1T1YB 2UV3A 3LRSA 5F9AC 2DMCA 4Z76B 1IQDB 2ZCHH 4X6DE 2M2DA 1DBBH 3FFCA 1B0WA 4EVNA 4FP8L 4M00A 2O26U 4P57B 3SBWA 5CP7B 5GS2D 2OP4L 1R5WA 3LKNB 4Y4HD 4G7VL 5KSBA 4PJHA 2KKQA 3QDJA 4QGTA 5C09B 1BQHG 2YEZB 1G7HA 4XWGH 2JLLA 3NZHH 4IRZH 3W9DA 4RGNB 1TCMA 4JG1L 1EXUB 5FA4A 5AAWA 4X6DF 1S7TB 2V5MA 3SE9L 3VFNA 1LO4L 1NEUA 4P2RD 3WNPA 2C3GA 3ME0A 5E8NA 2VDLL 3BEWB 4GKSA 1KELH 4N8VG 1SBSL 3TBVA 3E6HB 3TVMA 4O02L 3LQZA 3O0RH 2VUYA 4ODXB 3REWA 1ED3A 1U93A 1TCRA 3NBNA 5JA9A 1MHEB 2EDFA 4PG9B 5J6GB 5MEQB 1JRHL 3OL2A 3QEUB 4RMRA 4K7PX 5EBMA 3R4DA 4U1SA 3QZWA 4JFXA 3HB3C 5IVXB 2EDQA 2IH1A 4N0CD 5EC1A 5JUEL 3W39A 3ZTNL 4BSVA 1Z9OA 3HKFA 1GC1H 2GYSA 2VISA 1KCUL 3BZDA 2QLVB 3EOAB 3MV11 4GXUM 3PWUA 1AC6A 3HCVB 3BPCA 5DJ0B 2X05A 4MJID 4EDWH 3QUYA 5IK3B 1J10A 1UXWB 3VWKA 4ACPA 5EUKB 1LE5B 4FFWC 5B8CC 3ECBB 3LVEA 2FGWL 1RZGA 2UWEA 3EJZC 5C0CD 1A1OB 3FZUC 5JOFA 1M7DA 5DQ9A 3K8KA 3U46A 3OPZL 5I76B 4K3DH 2R56H 4KQ4L 1DQDH 3WJLC 4B41A 1F4YL 3C6LB 5HJ3B 5I1GH 5BVJA 4XH2B 3DVNA 4BQ9A 3T0WA 4LLVA 4X9BA 2ADJA 5IFAH 3JV0A 1UYWH 5FF6B 3B6SA 2CDEB 3O2VH 5HXMA 2AKRA 2IGFH 2H8PB 5DR5L 5JA8B 3PNWA 2A6KA 3NAAL 4PJBB 4M9OA 1AY1H 2QL1A 1KLGB 3OHXA 4Q9RL 1BQLH 2B2XL 1KNOA 3EDEA 4O2EA 1CXIA 4WWKC 5C6PB 1LNUA 4MZ2A 1TJHL 1M71B 3R1GL 4XAWH 1MLCB 4OUUA 2Z93B 3IRPX 2QTEA 3L6FA 4YC2B 3S5LB 5HI3D 1S7VA 1U3YA 4B50A 5I1EL 4F7PA 5ID0B 2GY5A 2PXYD 2FO1A 2Y25A 3T4YB 2WBKA 4NQCB 1PYWB 4LCUB 3MUJA 5F44A 4PJXB 1T3FA 2X09A 2JJTA 2WLYA 3L5XL 1MWAH 1KGCD 5I66B 5I0ZA 1XF5A 3EOTL 2OR7A 1WWCA 4DK6A 3U4AA 4R4BA 3GHBH 3HE7D 5HYQB 1A5FL 3UP1A 3T0BA 5CD3B 3B8YA 4YDKL 1BBDH 1ZEAH 2CIKA 5CCKL 4WWKB 4YE4H 3SDDC 4M9PA 3UAJC 1HE7A 5GS0H 2ICWA 3QNYB 4OLWL 2LV4A 4AM0A 1FQ9C 1EEZB 4YUEL 3MLVH 2ITCB 4LARH 2A74A 3ZDXE 3P9MA 4ZOCA 1FBIH 1CT8A 1DQQB 4M3KB 2J8HA 1IC5H 1AE6L 2WP3O 1UVQA 4QTIL 1KJMB 2Y6SC 1QEWB 4M7JL 5DEZA 4FABL 1EJOH 4AYFA 3W9EA 1DL7H 4D0BA 5DFTA 3W5MA 5D72L 3VJ6A 5IQ7H 4HKJB 4KRPC 4UT9H 3Q6FA 4E0RA 2FIRT 3DHMA 4PB9L 3RZCD 3ZDXF 1KT2A 2HKHH 5EZJB 2APWA 5D2NE 3EZ8A 3VRLE 4EN3D 4KZDH 3O2WH 2V2WB 3OKLA 2DBJA 2R4SH 3SDDB 4A6YL 3P4OB 3DI3B 2AEPL 1NLDL 1CWVA 4HKXB 4PG2C 2K3TA 1SMOA 4ENEC 2AJYL 4ODHH 1FIGH 3U83A 1FFRA 1VPOL 2VDNL 4YO0A 4MD5A 3VA2C 4X4MA 4DVRL 1U8PB 3QIBD 3EYUL 4I2XA 3X11B 1YNLL 1XF1A 2B8OT 3GUTA 1HHKB 4RX4A 2NXYD 3CVHH 1QBAA 1JWSA 3RKDC 2SEBA 5JW3L 4KRPB 3FN9A 3KR3H 3PGDB 1NFIA 3GNML 3O2DL 4J8RA 4M4RA 5B39G 3ARDD 1SJEB 3M45A 1S7RA 3P11L 5EG6C 2EXYD 5D9SA 1IM9A 3QDGD 4QOKB 3OZ9H 3BD3A 4NZTL 5IMKB 1Y6KR 4UDTB 4GRWH 2FRGP 4YBQC 1UQSB 2V7NA 5HGDA 2BFVL 4Y16A 2ZNWA 1U8JB 1L0QA 1WIOA 1BM3L 1M1SA 3O6FC 4HH9B 1TMCB 3RQ3A 4KKLC 3ARXA 5BZDB 2R4RL 5JOPD 2N7BA 4N0RA 2Q6WA 1NBQA 2FWOB 5KANI 5LXGH 3TESA 3CZFA 3V9FA 2GJ6A 4PLJC 4HIHA 3PWPB 4Z0XB 3PV7A 2KPNA 3GDBA 1FH5H 4OZ4B 1T04B 3SCMC 4DW2L 4G3YL 3N1GC 4WUKL 1M4KA 1K3IA 2BNRE 5E5MB 3D69B 2R39A 1MRCL 4ZOAA 1WIPA 3U36A 3LDBB 3OX8A 5F9WC 4TNWF 4H1LG 1CDCA 3G5XB 5BV7C 3AS1A 1NKRA 3O6FB 4H1LH 4PY7A 1YMMB 3V4UL 4XMKH 1MJJB 3TIEB 2ERJB 3FT2B 2BVYA 2Z35B 3JWDC 2R2BA 4N90D 1QUNA 3PV6A 4GW5B 2JELH 2PO6C 1C08A 1MRDL 4ZFFA 3L3KB 2K7PA 3UTPD 1JHLH 1INEH 1HHGA 3GBNH 4YHPB 1JNNL 1YPZA 43C9A 1TVBA 2HT3C 3PIQB 1FNSL 4LPCA 4HIIA 1TTFA 5L2JA 3SCMB 3WN5C 1U42A 4NM8H 3QFJD 4FQJL 2A9NH 1CICD 5F9WB 5BO1H 1T20B 4U05A 4URTB 2G75A 3LHPL 2HLAB 2OQJB 3P0VL 3U0TA 4WFHE 1BVLA 3SDAA 5IMMA 1RJYA 4LCCB 1B2WH 4LSRH 5BV7B 2ZZUT 2DD8L 3WEXB 2W1NA 5EH1A 1K8IA 3I2CH 4JRYE 4M61B 5C0RL 3ARFA 1CL7I 1ERNA 2ARJQ 4DGVL 1CFBA 1DVFA 3MXVH 4D9QE 2P4AB 2C4XA 2DQFA 5MHSD 5HDQH 1EIBA 1I7ZB 2PO6B 4GUPB 5HGGS 1G9NL 1AC0A 1WBXA 3H9SB 4RQQB 5T5NG 4JGMA 4JHWL 1H3WM 1TFHA 1KCVL 3QHZH 3WN5B 1A21A 4HKZB 4YNYA 2G5BA 4CDGC 4ELKA 3DX6A 2WINA 1QG3A 1PY4A 4P2QA 3QUXC 5AZEL 4JM2A 4P2OB 4QYOB 4X7SL 2ARJB 4CRPA 4OI9A 1CR9H 4Y4HC 1G7PB 5F3HB 3SE3C 1JGUH 3OWEA 2RCSL 1YECH 4NCC1 5DHXB 3BQUD 4PD4K 1FZOB 1XIWD 4QKXB 4E42A 3RL2A 2NR6C 1YQVH 4M5ZH 2NY6D 3L3IA 3Q1SL 1CL7L 5D70L 4AL8L 3O4LD 1YYLH 3VGGA 3O11A 4HZLB 1RZFL 3K4DA 3IDGB 3SGEI 3VFOB 5ALBH 5DJ6A 1WICA 1OP5H 3R8BB 1R24B 2DOCA 4UINH 3CXDH 2GTWA 4KJPD 5MERA 3BKJL 3Q2CA 3BH8B 2Y5TA 4N0CC 1UA6H 1NANI 1S7XB 1JNLL 1H3GA 1KEMH 3IJYA 4KXZH 2OI9C 3UDWC 3O3EA 4LF3B 4Y4HB 2G2RA 3BDXA 4MQTB 4PJEE 5F71A 1XF3A 3HI5H 2CO6B 1DZBA 4HFUL 1MFCL 4F7MB 4U2YA 4FXKA 4U1KA 4P2RB 1YEEL 3KDMB 1V7NL 3KJ6L 4GRWE 4J4PD 1NQBA 4NN5C 3BEVB 2FATH 4XNYH 1NBYB 2XKUA 2P5WE 3NACL 5KSAA 1NC4D 1MY5A 3K4AA 4KI5D 4EI5A 2A73B 4PJ9C 2YPVH 4PJEF 3MLRL 5D6DA 5IFJA 2GK0A 4NO0D 1GXEA 2F15A 2H1PL 4GRMA 4JJHA 2AS5M 1IBGL 2A6IA 2W65B 5HYJE 1JGLL 2YUZA 3N85H 4Z9KB 2AK1L 4GRWF 5HVFB 3TYFA 3BE1L 1CBVL 1A1MA 4NNYB 2ESVE 2OI9B 3QCUH 1EMTH 4KPHH 4M7KH 2XQYG 1OTTD 3C8KA 4MJIB 1NFDA 3QO0A 2Q8AL 1U58A 3UROR 1S78D 4LP4A 5DK0A 3PHOB 4YDLC 5H94A 3BUTA 4JE4B 2NX5D 4QF1A 4DFIA 3VXRD 1WVZA 4MS8D 1J5OL 5ADPH 5DC9B 3MRIA 5HI3C 5C0CB 5HGAB 2OTUA 4RFOL 3V5KA 2PXYC 4PD4J 3DARA 3C08H 4L29A 2H26B 1QBLL 2D03H 3PJSA 4HUXA 1HEZA 1EO7A 1KIPB 4N1HB 2HG5A 4U1JB 3RJQB 4PS4L 2Q7YA 4HXAL 5HGHA 43CAB 1F00I 4FTVE 4QRPA 2IBZY 1G1CA 3MYJA 4LSQL 3V4VL 3VW3L 1SYVB 3NIGE 4HT1L 5BS0A 3TNMA 2ZUYA 2OSLA 1AXSB 4HK0B 4JQXA 2XY1A 3GSQA 4XPTL 5CGMA 3ORJA 5FA3B 4MXQC 4HUNB 4YPJA 2J1KA 3DROA 2BMKA 4NQVB 4F9LC 2EDBA 5EWIH 3BSZH 4L4VD 1MCKA 2ID5A 3O3AA 3EYFB 3WDIA 2PXYB 4HQQL 5TGBA 2AJXL 3NIGF 3PGCB 4K8RC 5IBLD 3ARGC 1KLUA 1T2QH 4XCCH 4J1UA 4OLEA 5E2UH 1KB5H 1U8KA 2BX5A 2IBBA 5IB2B 4Y1AE 4JFFE 1QSZA 1XGYH 2ADFH 4ODWA 4O51A 5GGTL 5HSFA 4PRDA 3H42L 3IVKB 4IJ3C 4JPWL 4AEFA 1HHHB 1WTLA 5SWZD 5D7JC 1CFNA 1NEZA 3DBXB 1GL4B 2ARWA 1C5CL 3EJJX 2C7UB 2YWYA 3C09B 4U31A 3WJJC 1F13A 4QRRA 3O45A 1NCWL 5K9KA 3QIBC 4IIQA 4LSPH 4NQDB 4ZYKA 1MJ8H 3P0YH 2W9DL 3CSPA 3DX7A 3VGHA 3QAZC 4LLAA 5T5NF 2PTTA 4QCIB 2C3HA 3BHBB 5T1DH 3BZFB 1J8HA 4NQEE 3MMEB 1XF4B 2HRLA 4V1DA 3TV3H 3ARWA 3MRGA 3NPSB 3QUMH 3RZCB 5I8CB 3REVB 4HW6A 1MFNA 5J1AB 3T1FA 4PRAA 4EN3B 3V5DB 2X4TB 5E9DA 2B1AL 4OZHE 7FABH 5FB8A 4HGWB 4MNGB 2J8UA 4YXLL 4KK8D 1SVCP 1IEBA 1UWGL 3UTTA 4YIQA 3BP4B 4GT7A 4XVUC 1W0VB 2HFFB 4LSTL 4XCFH 4N0UB 1E4XI 4KY1L 2HTKD 3QIBB 4OZHF 4XNQB 3BGFB 4JZJA 2CDFA 1HILB 2CGRL 4P3DA 2XN9D 2X4RB 4WJ5B 2CQVA 2NXYB 3CIQA 3TYGH 4FZEH 3OXSA 5A3ID 1N0XH 5T3ZL 1B4JL 4WW2C 3GIVA 2EIZA 1BEYH 4UT7L 3PF2A 3ARDB 3AS2A 2APVA 2ICCA 1AR1D 1DBAH 1WWAX 1P5VA 4JKKA 1NCDH 3LMJH 3QDGB 2E27L 3NABL 1DLHA 5TQ2H 1NGWA 1NJ9A 3VXME 4CVUA 4LSDA 3RWGB 2WUCL 2YUVA 1CTNA 1F3JA 1BD2A 2OZ4H 3VE0B 4ODTL 4NO5A 5BOZG 1BF2A 1F5WA 4KDTC 3QH3A 5LWYL 4HDIA 2FJGA 3D0LB 3TJEL 3HRPA 4OD2A 4XNXL 1ZHBA 4CUCA 4LDEB 4F33B 1KJVA 2DBLL 3FOMA 4D0CA 5LGHL 5FECA 1B9ZA 1E4XL 5GRUL 3OXRA 2VZTA 4MXWL 1S7UA 4WW2B 5HD8C 3BMWA 4YBHA 1ZVHA 3SKMB 5FYKU 3U6RB 5LBSH 2NZIA 4ODUA 1MHCA 3AMLA 1CICC 1IAIH 5I17B 5D1QA 1AQKL 3ZE2E 3QCVH 1I1FB 3MRQA 4GLRI 5DEGA 4AH2B 4PJ8C 3GJEB 5E94B 3GMOA 3D2UD 1MLBA 3GKWL 5GGSA 2ORBH 1YEDA 1IAKB 2EC9U 2Q3AA 5T3XE 2VDML 3LPWA 3HUJE 1BLNA 1NH6A 1DTUA 2VIRA 4EDXA 4U6XA 3ZE2F 4QHMA 4LVHC 1VKXB 2HJLB 5A1AA 3D1MC 2EYSA 2ZG2A 4P23A 4PR5B 3ZHDA 3GSVB 3G5ZB 3IGAB 1KG0A 3BPLB 3QFJB 3MNZB 3NFSH 1MSPA 5GJSH 1CICB 1I3GH 4WNQB 4M7LH 3GRWL 3B3IB 3D85A 3HUJF 1OM3L 4MXVE 4X98B 1S7SA 4I0PD 3SKJH 1A2YB 1P4IL 1K6QH 3BQUC 4G6KH 4G9FD 4PJ8B 3OR6A 3LRHA 1XIWC 1IGCL 1RULL 1WC7B 3QNZA 3C8DA 5ETUB 3D18A 2CLVA 1LP9B 2D7NA 4UILH 4PRPE 4YHKL 3L3HA 2R69H 5FOBA 3UYRL 2VUOA 2F5AL 4PJCB 1EUUA 3O3BA 2NW3B 1A22B 4MXVF 5IESH 1NUDA 4W68A 2XY2A 2CIIB 4OLYL 2FNBA 3BT2L 5JW4M 4LVHB 1X5GA 1F6FB 4L9LC 1HH9B 3TBTB 4JO4L 2E9IA 4NO3A 1OTSD 2YA2A 5I8EB 3QIWA 3HG1B 4AEIH 4OD3L 1Z9LA 3X12A 3ARUA 3RWCB 5FGCB 2OK0L 5J12C 1MFAH 3GZKA 4EOWL 4EKXA 2YS4A 4NCDA 4R96B 4U2ZA 5F89B 1CGXA 3MUHL 2D7TH 3LKRA 5C07A 4HLZG 3CUPB 3DXAA 4M48L 3IS1X 4RGMC 5FGSA 3IETB 4YDVB 3SKNB 1MFEL 3BQUB 2CO7B 4UB0H 5BQ7A 1XIWB 4M6AA 1A9EA 5E8OB 1C5BH 5F7NC 5FYKH 1R6VA 4FFYH 4HLZH 4PBXA 5L0QB 4KVCL 2X4OB 4NKOA 4Q2ZB 3QEHB 4LHUA 3RWIA 5HHVH 4XI5D 4OD1H 3UYPA 3GI8H 4RSVA 4XHJD 1KFAL 1MVUA 1WFOA 5BMFL 1Q72H 4HGKC 4RAVB 4PV9A 3ULVL 4Z7NE 3E3QC 1JHTA 1A6VH 4G9DA 2DTML 1HXYB 4L9LB 2HAZA 3IFNH 5CBAA 5EORH 1IQWH 2UZIH 3ZO0A 3QJFB 3PWVA 4OLXL 3WD5H 1A14H 4D3CL 3NCYS 4NQXA 3QWRD 5T3ZD 4RBPH 2V17H 2K7QA 5IF0B 4X4XA 1EA9C 5D1XD 3ULUD 4Z7NF 5J89A 2OMBA 4M02A 3BVNB 5BJTB 2G60H 4IRSD 4RGMB 3UPAA 4EUPB 2EEDA 4OLVL 1JWMB 2WV3A 4P46A 3FO2A 1OTUD 2W9LA 1AGCA 4J7RA 4MLIA 5EU3B 2A83A 5JR1H 5MP6L 3QIUA 2NY4D 3UYOD 3ZDYE 2D4DA 1NC4B 2W0FB 1SEBB 4NNXB 3V0WL 5IB5A 2NTSP 2VDPH 4PJFE 2VQ1B 5IIEA 1K5NA 4MWFB 3TIDA 2HH0H 3CCHA 3L1OL 4C55A 3X13A 4TYUA 1IKNC 3WBDA 4NHUB 3O6KH 4MNQD 3ZDYF 1TENA 1ZTXH 3FTGB 1WUNT 1JFQL 2IWGA 1UKQA 2FD6H 3PQYA 1LO0H 2P8LB 4PJFF 1NCAL 4JN2B 1RURH 2VXSH 2VR5A 3HMWL 5FHAL 2NX5B 4DN3H 1DP0A 2FX9L 4TUOA 3VXRB 3WLBB 3CH8A 3VFRB 1OSZA 3H9ZA 5CJ8A 3F5WB 5DC0A 1VFAB 4OKDA 4NJ9H 4X6DA 1ZT1A 2XKSA 4APQD 2BRRL 4YGVA 1H0DB 5IBLC 5ICYB 3BGMA 3S4SB 1V8HA 4XP6H 5C0DB 5M7QA 3K8MA 2ATKA 3KPSD 5FO9A 1TETH 4AY0A 3VXSE 5B3JF 4UI2A 3IF1A 4WFGE 2OL3H 3HMXA 3HNVL 3GHEH 3FB6A 3RWFA 4FN0A 1ULVA 4DKFH 2R1YB 1UACH 3O3DA 2XNAA 2EKSB 3HFMH 2PYED 2CKBB 3LKOA 1AH1A 1C1EH 5DSCB 3O4OC 3FQNA 4OZGA 2XG4A 3H3PL 3C5SB 4TSCL 4TNWK 1JPTH 1YNKH 2YUWA 3SGKC 3KLHC 5CSGA 1U3HC 4NRZA 2MQCA 4PRIA 2FJFB 5IJKC 2J8OA 3JV5A 4G5ZL 1FAIL 3BKCL 5HYSA 3OQ3B 2VDRL 4UUJB 1NAMB 4R7DB 5JXAL 4WENB 5DUMH 5E5UB 2W0KA 2KDGA 3HAEH 4P9HC 1IGFH 4LRIA 2VDKH 5DRWB 5DTFA 3BN9C 4W6YB 3VFGL 2PCPA 3HMXL 3CFDB 1Q1JL 1P9MC 2F54E 3VG0H 4P0DA 1R0AH 4WFFE 4YBLC 1ZHKB 3MJ9A 2C1OA 3T08A 4ZFGH 4CBPA 1QHPA 4OUOA 4LCIH 3LN5A 4F2MB 4JFYA 5SWZB 2NZ9D 12E8L 4PRNA 5ANME 4KK8C 3O4OB 3BX7C 4IMKC 3BPOB 3X14A 3MV8D 3OJVC 3VXPB 2A0LD 3RUGE 4O2FA 3DYOA 4Y19D 3VD9A 4JFED 5FK9A 1U3HB 1BBJA 5I30H 4I5BA 4GW1B 2VITB 3QCTH 1FAKT 1DANU 5FYKE 2GJZA 3ULVD 3IDXL 4JFQA 2AJZA 5AWNL 1MAMH 4P5TA 2YPLD 3T0VA 5DVOA 1D6VL 2RAMA 5AAMA 4YBLB 1T6WA 3NCBB 4ZNCD 2YSSA 2DLTA 1MPAH 5FDWB 1DR9A 3EYOA 2YD3A 2XOTA 3LEYH 4KJWC 5KVEH 5DDHA 5FYLH 3PWJA 5EBWB 5T1KD 4Q9QL 1DBJL 1VEPA 1YEHH 5ESVB 1KJ2A 3PGFH 5C2BL 4YAQB 4BQ6A 2F58L 3AXLB 3L3GA 4Y4FD 3L5HA 1JGEA 5EU6A 1NAKL 1SEQL 4UV4L 3SDXB 1JPSL 3KNBB 4U7SA 3B5TA 2XN9B 2DB8A 3H3BC 4OFPA 4JPIB 4G8GD 1CYGA 4BFIA 1CS6A 1SYSA 3S36H 3GEWB 2ZUVA 3EO0B 1F6AB 3QQ3A 4FQPA 5LQBL 3TN0C 1JMXA 4M8QA 5HHOB 3EFFA 2IFGA 1A7PH 3WMSA 3FO1A 1MUJB 4RISL 3GMQB 1BECA 2BSSB 2QQKH 4M43H 1JF1B 2JCCB 3TBSA 1EHNA 4NGHL 4Y5YC 4Z7VB 1U95A 4KKAC 3CU7A 3QQ9C 1KACB 5C08E 1UEYA 2WBJD 2O5ZL 4NDMB 5C0ND 3KPNA 4XCNB 3MGOB 3QRFM 1N8ZB 1NGYA 3U9PL 1TNNA 4YGAB 5D2NA 3EKCA 4ONOA 5DD5H 3HTLX 4L3CB 4UOW0 4X9GA 1MI5D 1LO3H 2IQ9L 1SHMA 1T5WA 4K94L 4MJ6A 4Z6AT 2Z31C 2YWZA 1E6OL 5FUZL 4E41D 3CFBA 4HS6B 2BERA 3MUY1 3S5LG 3T0ED 2MFNA 1BJ1H 2ICWJ 4K23L 5F7YC 3D2UB 1I1AC 2R23B 4JQVC 3NA9H 3RVTC 5ESQB 3T65B 2PUQT 3IDJB 5T33H 1UWXH 1FJ1B 2COQA 5I2IA 5L88L 5L7XL 1OARL 2Q20A 3V95A 5J7CC 1J1XH 5L6YH 2VXVH 3QDME 5B8CA 4OCRH 1OTSC 4KKBD 4N8VA 2CR3A 4KK6C 4ODVH 4Y4KD 1XF2A 3QO1B 4FQQB 4HJGA 1FE8H 4R3SA 1AJ7H 5JPNB 5DI8A 1ZGLM 1DBBL 4LPUA 2Z31B 1JE6A 2QQLH 1FFNB 1OL0A 4XMPH 3LV3B 4I0PB 2AV7A 3VFMB 4DUWA 1EFXA 3PXJA 4MAYD 2AABH 4G9FB 4KC3B 5EOCL 5B4MC 4XWGL 3VXNA 4IRZL 1HYSD 5INCB 2BNQA 4KVNH 4UU9A 4ZFZB 4PJ5D 5EA0H 3MX0A 3P73A 1DEEA 4PJAE 3BW9B 4GQ9H 4XHJC 1KELL 2E7CA 1F11B 3O0RL 1AGDB 4KI1A 2P48B 4E5XB 2ILLA 2BNRA 1A4KB 5I15H 1PFCA 2XZQH 3LEVL 5IEKA 4GG6B 5ENWB 4HK3N 2Y07H 5KBNC 3I6LD 2X4NB 3MFFA 4C59B 2D0FA 5F9JA 3CC5B 2EC8A 4MA7H 2QSQA 5F72S 4PJAF 3W0WB 3AAZA 5L9DL 4X6CE 5D1XC 5D5MB 5F1KC 5E2WH 3ULUC 3HZYB 2VLJE 2F9BT 4AIOA 1GC1L 4NZJA 2YD9A 4X5WA 3QFDB 4B53A 1EEUA 3RGVD 1U6AL 1WT5C 4HMEA 3P30L 3KXFB 2HRPH 3WHXB 4EDWL 1QP1A 3S35X 6FABH 2LQRA 1A7NL 4JRXB 3WUWB 1OTUC 2FECI 3I02B 5C09E 2IMNA 4X6CF 4XBEH 8FABB 5F7EH 1CE1L 4RGNE 4K3DL 2R56L 4EIZC 1DQDL 4ODBD 4ORGA 3F6IA 1W72H 5JOEA 5I1GL 4XCYA 5JORB 2Y5EA 1U8HA 5IFAL 4NKQB 4QXGH 1I3RA 4OF7A 1UYWL 3O2VL 2IBGA 3KYAA 3CXHK 1MY7A 4NWTH 2Z9TA 5D1XB 4Q9CA 3FT3A 1JN6B 1W8OA 1EEYA 2J6EA 2R2HB 4I3SH 4M03A 3KPLA 4NC2B 4UAOC 1AY1L 1I8MA 3Q5OA 5ESAA 1BQLL 4IRSB 2Y7QA 5IVXE 1A7QL 5EBLA 2DJ4A 2R9HD 3EAKA 3EGSA 3C5ZD 2W0PA 2VZ1A 4XAWL 3MR9B 1XGRB 3WNKA 2GTZA 3DETD 4ZS6C 3U48A 1D5ZB 5J9PB 5CINH 4FOMA 2NY4B 2ITDA 3MGTB 4XPBH 4X8XA 3QA3B 1WZ1H 5DA4A 1T1WB 2E6PA 5IVXF 1ETZA 2NTFB 1KTLB 4HFWA 3MCKA 1XZ0A 1K4DA 2GUOB 1MWAL 2VSDA 4MCYB 3DO7A 4W6XB 4ZQKA 1OP5K 3GMMB 1NCBH 3VFSB 1T7VA 1W8NA 1PX3A 3FO9B 3GHBL 4U1MB 4NIKB 4MNQB 4X6EA 3HC0A 3IAQA 1GGCH 1JZ2A 3KYOA 5D2LA 4KAQH 3FB5A 1UZ6E 3LN4A 1ORSB 1CU4H 5F7FA 1DCLA 3SQBA 1BBDL 1ZEAL 3ZE0E 5CEZH 3QWOA 1G7JA 1RY7B 32C2B 4YE4L 1QLFB 4PJBE 3DUSB 4R90H 5GS0L 4ONHB 4PP2A 1DUZB 3KJ4C 1QNZL 3MLVL 4GRLA 4HJJH 4LARL 1Q9OA 3MODH 1RMFH 2FBJH 4S1QH 3DURA 4IOIB 1IC5L 4PTUA 1LEGB 1UZ6F 3FT4A 3O8XD 1JBJA 5ITFB 4KH2A 4HBCL 3B2VL 2EYTA 3ZE0F 4NRYA 5HDOA 5DQJA 1DL7L 3D39D 5IQ7L 4XC1H 4UT9L 3KPSB 4NQCE 3MJ8A 3QUZD 2P8MB 4PJEA 5BRZA 1L7IH 2JIXB 4PJXE 4QY8B 3JXAA 1BIIB 1IGIH 2HKHL 1Y0LB 1J05A 5KG9B 2CPCA 1CDHA 3OF6D 4ZSOB 2HJFB 5BV7H 3O2WL 5F7LB 4LLMA 5B39A 5EUOB 3TVMD 2R4SL 2J3SA 4DZ8B 1ZHNA 1HDMA 3S97C 5IB4B 1MCEA 3MRBA 3JWDH 1N6UA 1MAJA 4QO1A 4DVBA 1OB1B 2VLLA 1CXFA 1TTGA 2FH8A 3C5JB 4PJXF 4ODHL 1FIGL 1PX4A 2EECA 4ZAKC 2XQYK 1ZLSH 4KDWA 5B21A 1UH2A 5JPMA 4M8VA 4NYLA 4N9GB 4KQ3L 1OCWH 2D31A 2KUTA 3P9WB 2VYRE 3KR3L 4ESKA 1T22A 5D96C 5JW5B 4WUUB 3VWKD 2DYPA 2KBGA 3H7LA 2LTQC 2UYLB 1RU9H 5JDJA 4BH7B 1T21B 3SKOA 3F7YB 5IMOA 3P40A 3P9LB 4U1IA 2CDGB 2YMXH 1UM5L 3RI5F 1FSKC 3BWUC 5SWSB 2P44B 4LLQA 3WIHA 3QG6B 1RJZA 1GGUA 2DQEH 5TDNA 4JREB 3OGCB 5LXGL 3G6AB 3EO1B 1HXMA 3QUKA 2HLFC 5DUPH 4ZUTB 3TA3C 4AIXA 2WW8A 5DJDB 5ICZB 1FH5L 2YPLB 4XHQA 2R8SH 4AQOA 3INUL 3ARZA 4XZUA 3GSNA 1N64H 3H3KA 5GS2H 3TZVA 4DKEH 4G8EB 3U7WH 2X1PA 2DIJA 3M1BA 4LEOB 4QOKE 5BW7A 5T1KB 1LDPH 3ILPB 1FSKB 1DSFH 2BRQA 4XMKL 3DWTA 4ZUSB 1RZJC 4MLSA 3HNSH 2OLDA 3MRDB 3GMLB 4Y4FB 2IANA 5GRJL 5E2TH 2JJSC 2JELL 2XIDA 4XTRC 3RVWD 4PJIB 2AJUH 2DQTH 1JF5A 1JHLL 4JFFA 3GBNL 3TA3B 3OKEB 4G8GB 4OBSA 4MD4A 3RZWA 3GSNL 3JUYA 4IDLA 2QKIB 4WFHD 1CXKA 3PWPE 1KCRH 2ATPA 3EYSH 3MRRA 2A9NL 5E6ID 4F7EA 5BO1L 3MNVA 5D71H 3OMZA 3GSXB 5HTSA 3GSWB 2P43B 3FB7B 3PL6A 4LSRL 1B2WL 1BFSA 3ETBF 1U8QB 3QB7C 4OFYA 2VQTA 3I2CL 2AI0H 4HHAA 4ZDHA 2AXJA 4G80B 5GS0D 4JZNA 4CNIB 4Z7WB 1VHPA 3MXVL 2V9TA 4LAJH 1F8TH 3RU8H 4UIMA 4XPFH 1QSVA 5E7FA 5TE6H 2XTJC 1YMME 3EIFA 2P7TB 5HDQL 5CEZE 4AQ1B 2Z8VC 1F4HA 2FX7H 2AEQH 3QRGH 2Y06H 3PABB 3UTQA 4BUGA 5ICXA 1Q9LB 1LILA 3QHZL 1MI5B 1TZHA 4H5SA 3T3ME 2B4CC 4KXZI 4IOFD 3T4AB 1TLKA 3M17A 5DHVA 3KPRB 1FPTH 4DUVA 1CR9L 5ADOH 1JK8B 3T0EB 1JGUL 2HVKA 4MAYC 1ZVYA 1YECL 1Z9MA 4MD0B 3GMPB 4WV1A 4P4RB 5DFVD 4M6OH 4ZXBD 1FO0B 4M5ZL 5J4MA 5JMRA 3O6MH 4DTGH 3TT1H 3T3MF 4ALAH 1HHIB 4O5LH 1I8KA 1YYLL 4KTDH 5TQ0L 3U82B 1IM9D 1BQUA 4NZUL 3MRFA 5ALBL 1KCLA 3Q5TA 1JNHB 2AXGA 4FQHB 4Y4KB 3MNWA 4UINL 1AD9A 3R06B 2CLZB 3CXDL 3H9SE 3VXMA 3HPJA 1R5IA 2B0SH 5FGRA 3CLEH 1M6OA 1BFTA 2OTPA 1UA6L 3RWEB 4RZCA 4C4KO 3ZDZE 3WFDH 4GS7C 2C3VA 3S96A 2AXFB 5KSVA 4MAYB 3EOBA 3HI5L 3CPLB 1A6ZA 3D25A 1IEAB 3DRQB 2P5WD 4PJ5B 4ZUUB 2X4PB 3U7YH 1Q38A 4NUJA 1CFSB 4OF0A 1Q0YH 1RZIA 5MEPB 4PRHD 2FATL 4IMLA 2CSPA 4XNYL 2YPVL 1LWRA 3QXAA 4YLQT 1TZGL 1FFPA 4YR6B 2ZOLA 3U9UB 2BOCA 2ESVD 3PWLB 5IR1B 4LGPB 2JB6A 3F12A 3MLWH 2BOBA 3N85L 3CFCH 3FRPA 2AP2A 3PHQB 5IHZA 4P99A 4PLKD 5M94B 4ZPVA 2H32B 4GS7B 3VI4E 3ARGA 3QCUL 4YFLI 1XMWA 1EMTL 2VH5H 4KPHL 1KTRL 3RGVB 4BKLA 3TNNA 3GB7A 5DMGC 4YEFA 4Z8FL 4LCYA 2AAVA 3OAUH 5D1ZC 3ALPA 1LO5B 5DMIH 4MA1C 9CGTA 1BOGB 3UCRA 3DETC 2Z4QB 5ADPL 1TJIH 2X89A 3QT2A 1XGQB 2AV1A 2XWTA 3STZA 3C08L 2GSIA 4P2RE 5GJTL 1HSBA 4HIJB 4HWEH 5A2JH 4HSQA 2NY5L 2DMKA 1I85C 2X4SB 4MNHA 3GIZL 3EHBD 4FTVD 4ZFOB 1P2CB 3OKMB 4H0GA 3ARFD 5HI4C 2B39A 1N59A 5BXFA 4MA3A 3TH3T 1ZA3B 4F37K 4WI5A 4OSUH 3LSOA 4PRPA 3X3GL 2EDWA 4NKDB 3K74B 1UC6A 3MROB 5D1ZB 4HUVB 3C5ZB 1FV1B 3RIFK 4MJIE 1G9MH 4EJ1C 2VL5B 3G9VA 5EWIL 3BSZL 4PUBH 5FGBA 1JWUA 1DN0B 4HPYH 5I1DB 4NM4H 2G5RA 3D5OF 2VLRB 3SBWC 3CJJA 5C0CE 1T2QL 2FR4A 1A6WH 1N3NA 4XCCL 2I9TB 5E2UL 4BA8A 3IKKA 1S8DA 1KB5L 4HS3A 4L8DB 4D2NA 4TOYH 3U0PA 1QYGH 4LMQE 4ZO8A 1XGYL 2W9EH 2ADFL 4LOUD 4YEEA 1MELA 2P24B 2CK0L 4GBXD 1LEIB 4GG8A 2HT2C 3FOLB 3TVMC 4JFDA 2BNUA 5EOTA 5H2BB 3K2UH 1UADC 4ZNEA 1QFOA 4XGZB 1MOEA 5GZOD 1P7KB 2GEEA 1AGFA 2BHUA 1EFQA 3MLSH 3LRSB 2F8VA 4HJ0D 3SPVA 3IFOB 3FFCB 4KGLA 4LSPL 2N7AA 3RA7H 4EVNB 2F8OA 2J12B 3O8XB 1SJVA 1MJ8L 5C0BA 1R5WB 3KPPB 3D39B 5KSBB 1FZMA 3KLAA 1EX0A 5GS1A 3QUYC 3GGWA 5T1DL 3QUZB 1G7HB 3VWKC 1PKQA 2LU4A 3W9DB 1CDIA 3QUML 2IQAA 2FZ3A 3ZMRA 4QRTA 5FA4B 1KGCE 2VN7A 4KKCD 2V9RA 3VFNB 5E8NB 4GKSB 1CZ8L 2PN5A 5EO9A 7FABL 1ACYL 3AUVA 3TVMB 5LG1A 3LQZB 5J3HD 1U8IB 5KSAD 4DKAA 3REWB 1U93B 2OJZH 2OXGA 3HLAA 1KPUB 2Z91A 3UBXI 4L5FL 1NUGA 1I1YA 4LKCA 4XCFL 3QZWB 5I8KL 3EUUA 3WO3B 1NBVH 3W39B 5EC1B 2LU7A 4JY4A 4BSVB 2LFGA 2QHRH 1I7TA 4KJQD 3OKOA 2VISB 4ERSH 3TYGL 1AFVH 4FZEL 3BPCB 1N0XL 2HN7B 4OV6F 4ZTOH 1BEYL 2OXHA 1YEIH 3VWKB 5CILH 5JMOC 1IAII 4M1CC 1DBAL 2GFBA 4OM0H 3V52H 1NCDL 4AENA 2UWEB 1WZMA 5TQ2L 5CKAA 3DI2B 3PUCA 5IT2L 1ZSDB 1IGMH 4HV8A 1C12A 4LSVL 5TJWK 3ZKSD 2JJTC 1A0QH 5BVJB 4HGMA 2DAVA 3DVNB 2P8PA 2CXKA 4MNGE 2ADJB 5HYEA 3B6SB 2AKRB 4M3JA 5EU4B 3PNWB 2A6KB 4K55A 1I75A 3RVWC 5GGVH 5DVNA 5KVFH 4N0UE 4J3VA 4QRPD 3TGXA 2HWZH 2YC1A 4O2EB 5BS0D 5LBSL 2D7PA 5CJQH 4EUPG 1FNEA 4OUUB 3WIFB 4OGYL 3WSQH 1IAIL 1QZ1A 2DLIA 3BISA 5ILTH 5E5RB 1OSPH 1CIDA 4EUPH 3T8XB 2ZKHH 1FL6A 4F7PB 2X9XA 4GQPH 3QSKB 4X7DC 3QDGE 5KVGH 2C1PB 1CFQA 1T3FB 5E0QA 1CLYH 2YD5A 5FKPA 2ORBL 1XF5B 4IOSD 5GISL 1VGKA 2XZAH 4H26A 5C9JA 2JTDA 4QRQA 5JOPE 3P77A 2F54A 1P7QD 1CG9A 2NY3C 4UNVA 4OFVA 1U8MB 1YJDC 2CIKB 2F8XC 2YXFA 2YD1A 3GJFA 2ICWB 5E6YA 1WITA 5CUSH 5DURD 1AHWA 5K9QG 5ANMA 3NFSL 5GJSL 3GK8H 4X7TA 4M7LL 2A74B 3P9MB 3RUGA 1CT8B 4QGYA 5HBBA 3SKJL 3HI1A 1RVFL 2PTUA 3UXFA 1K6QL 1UB5A 1UVQB 2IAMD 4G6KL 3DVGA 3WFZA 3W9EB 4D0BB 5KANG 4UILL 4NP4H 4OF5A 2M8XA 3MLXH 5HHMB 4V1DD 2R69L 1BVKA 3S4SG 2R0KH 4KRNA 4PTTB 3NIDE 4JFPA 1UCTA 4R2GD 4WW2F 1KT2B 5IESL 4JY6A 1U8OA 4U0QB 1FZKA 2X7LA 5BZWB 4N90E 4U33A 5D7KD 1FFQA 4Y16C 3STBA 4AEIL 2J5LC 4RMSA 3UTTD 3UTPE 5FO8A 3HC4H 1MFAL 2PETA 5C0JB 3NIDF 4K7FA 2GITA 2D7TL 2CKBH 4YO0B 2XV6B 3QFJE 4FMKA 2DQUH 1RSFA 2N56A 5I19H 4I2XB 1C5BL 5FYKL 5IEHA 3FAXA 5JDSA 4FFYL 3WFEH 3GUTB 2I5YH 4ZXBB 5HHVL 1JWSB 4OD1L 1NFIB 3GI8L 4J8RB 1J9CT 1Q72L 1QFHA 2XG5A 5D9SB 1IM9B 1EO8H 1O7VA 5J56B 1LP9E 3EYQC 4K7PY 5MHSE 1YMHA 4NC1C 3IFNL 3NCCB 4PJCE 4R7NA 2V7NB 3VDCA 1U91A 2YA1A 1IQWL 2UZIL 5HGDB 3CVHB 4Y16B 2J5LB 4DZBA 5DZNA 3WD5L 1A14L 2IMMA 2D7OA 3IFPA 2V17L 3OKKA 5LAXA 4DGYH 1EHXA 4WHYH 1NDMA 3HG1E 4ZO7A 4UMGA 4RMTA 3H7BB 2Q6WB 2L0DA 1LP9F 5FGCE 2FIKB 4LVNB 1QA9B 4G6AD 2XWBA 1WBYA 3CZFB 2PF6A 4PJCF 2GJ6B 1JZ8A 1G9NC 1GZPA 3IU3A 2H2PC 3V7MA 1W0YT 1CDBA 4MZ3A 4KROC 1UB6A 3FKUS 5CEXA 2R0WH 3OX8B 1UWXK 3J7HA 3QXDA 4R0LB 1GGBH 5D1QD 1FL3A 2QADD 2VDPL 4NWUH 3SDAC 3ARVA 3SGKA 1GGIH 4ORZC 4PY7B 1H3VA 2HH0L 3ARFC 2D0HA 2Q86A 5EIVA 1DVFC 4FQ2H 4OAWB 2OL3A 2VDOH 3O6KL 1ZTXL 2R2BB 3PV6B 3WV0A 1RK0B 2FD6L 1C08B 4X6BA 4OCYH 5EIIB 1LO0L 1RQ5A 5EOQH 4ZTPH 4MA8H 4QTHA 4RMQA 2VXSL 1IARB 4YHIA 1HHGB 5EN2A 3HRZA 5HHPA 1YPZB 43C9B 5BVPH 4DN3L 3DUUA 4KUCD 3ZSTA 4HIIB 1U3ZA 5GGUA 5L2JB 2Q3ZA 1TQBC 4OLZL 1R3IH 4KROB 3WS3A 3WL9A 4G6FD 4NJ9L 4OCWH 5IHBA 3D85D 4JM2C 4OQTA 1XGTB 1Y18A 1ZT7A 1YY9C 3B5GA 1BVLB 5IMMB 4RGOH 4XP6L 3E3QE 4KI5E 3WKML 1TETL 5DRZA 3KPQA 1TQCC 3ARFB 4TTDC 2OL3L 3L7EA 3GHEL 4PJDA 2AERT 3O9WA 3Q5YA 1D6EB 3H0TA 4DKFL 1HYRC 1UACL 4PJAA 3S88H 3KG5A 3HFML 2EO1A 1C1EL 2ZUXA 5IKCA 1AXTH 2DI8A 1EAPB 5DA0B 1YNKL 2ZSWA 3QIWD 5F1NA 1BPVA 1G7LA 3VGDA 3TO2B 4HJ0C 2X1OA 2G5BB 4ELKB 3DX6B 2WINB 4BH8B 5KAQG 1JTPA 2NX5E 2Q76A 5DUML 3VXRE 4JM2B 2HVJB 4NOFA 5C07D 1BJ1J 1IGFL 2VDKL 1FVEA 2EZ0C 2MQ3A 2VLJA 1A9BB 1OF2A 1KN2H 5MI0B 3FRUB 1IQDA 2FGZA 4P2YA 4E42B 3T0DA 3VG0L 1R0AL 4Z18A 2WWKO 1I9JL 4XP5H 5GIRA 4LHQB 4ZFGL 2RHEA 3EJYD 3L3IB 4N5ED 4LCIL 4MJ2A 5ISZA 5B38A 3O11B 1FCGA 4XNUH 1RUKH 1SJHA 4N1EA 3VXUA 4EI5C 1PQZB 5EO1A 5D6DC 2LU3A 1KEGH 1J0KA 3RWHA 5IBUB 1EXUA 4RWHA 2AEWA 3ARED 3BEWA 5ID1A 3T3PE 1FYTA 3MACH 4M6NH 5E4EB 5HY9A 2Y5TB 2HTLD 2W91A 4KJQC 1EVTC 3IJYB 4X0KA 4YHYC 3ZKMD 4L4VE 4QHKI 5MEQA 3UTSD 4FG6C 4WU7A 1E27A 2G2RB 1MAML 1XF3B 4Y5YA 2ADGB 5J13B 2JJWA 4I18C 4P46D 5KSUA 3T3PF 4OKVA 1T2XA 1BZ9A 2RBLA 1CVSC 3QIUD 1RI8A 1SY6H 5DJ0A 3VXTB 3OJ2C 4F57H 3LEYL 5KSAB 5KVEL 2NYYC 5IK3A 3NPZB 1UXWA 4EI5B 5FYLL 3VFWA 5IFJB 2VLMD 2XA8H 4M1GL 1YEHL 5CSZB 3N50A 5ACLA 4GRMB 4BFBD 5SWZE 3PGFL 4DOHB 4NN7C 3UC0H 2Z8WC 1BFOA 5EZIH 2C9AA 5E08H 4X8JA 3BDYH 3BESR 4RA3A 3QXUA 1QHOA 4X4YA 1A1MB 4HAGA 3W11D 3BKMH 4XH2A 5CHNA 2QBWA 3WO4B 3JWNC 4NT6B 1U58B 3S36L 5DK0B 3CSBA 2OR8A 4JQXC 4S1SH 1YN6B 1TNMA 2APTA 2NXZD 4PJBA 3WUWG 1BHGA 4QF1B 4OGAD 1A7PL 3MRIB 4KKNA 4XNMA 1R3JA 2OTUB 5I75C 4M5YH 4ZG1A 3QPXH 4N1CA 3V5KB 1AXIB 2QQKL 4JKPH 4L3AA 3UJTH 1DBMH 4TULH 1T03H 1OWRM 3PJSB 1HEZB 2Z93A 4FFZH 3S5LA 3T09A 2HG5B 4NN7B 2UUDK 5CBEB 1CF8L 1HHJA 2Q7YB 4O4YH 5HGHB 1KJ3H 4UNUA 2AJSH 2OS7A 1MF2H 4AIZA 5CLWA 4QRPB 3MYJB 3HZMB 3NCFB 5DD5L 3SDXE 1AP2A 5BS0B 3TNMB 2OSLB 3ULUH 1FZJB 1LO3L 2AK4A 2XN9E 4N0FA 3GSQB 1D5BA 2ADIB 1UEMA 3VGEA 4PREA 4LQ1A 5E99H 4HWNA 3DROB 2BMKB 3V6ZA 5KVDH 1JYWA 1WZLA 3JSSA 4PRID 3MV9D 5I75B 3O3AB 4IIQC 5TGBB 4PGJA 1IT9H 3QNYA 4G6MH 5HHOE 2R15A 3OGOE 1EEZA 3SDXF 3NA9L 1ZMYA 1N0LA 3JVGA 1AO7D 2ITCA 2H45A 4J1UB 1U8KB 4X7EC 5EDXA 5T33L 4MVBC 1PG7H 2JCCE 4R2GC 1G6RH 4LLYA 4ODWB 1KJMA 4O51B 1J1XL 5TE7H 5DS8A 1P7QB 2RFXA 4PRDB 4Z7VE 5L6YL 1U92A 3LH2H 4OCRL 5TDOB 4HKJA 4ODVL 4L1DA 3DECA 1CFNB 1FE8L 1AJ7L 1NEZB 5DURB 1F02I 4K3JH 4QWWC 4M62H 2JCCF 2QQLL 1MQKH 2YHGA 4F7TA 5E8EA 3OKDB 3VXOA 5K9KB 3TBWA 4FQIH 4Z7VF 4XVTH 2AABL 2IAMB 4JZJC 5F8QC 3T2QA 2X44D 4S1DD 2PKDA 4KZEH 4D9RD 4KVNL 5EA0L 3MUZ1 4PGDA 4F8TA 4P5TD 1XGPA 5TF1L 4V1DB 4X7CC 4GQ9L 4R26H 3MRGB 2EDOA 4R2GB 2WIIB 4Y8AA 3NN8A 5JO5A 3MLZL 3T1FB 4PRAB 3X11A 3RY6C 3VMNA 1VFBA 5I15L 2XZQL 2Y07L 5JHDA 2W60B 4KHXH 2J8UB 1CDYA 4HCRH 4TVPH 4QNPE 1XH3B 3UTTB 2BVQA 4MA7L 4YIQB 4HC1H 1G7IA 2A1WH 5FUCE 1F3DH 5E2WL 4XC3H 1KIUA 5F88A 2YRZA 1EGJH 3TFKD 4PP1C 1UQSA 3IDNB 3TJHD 5EU6D 3TO4D 2HRPL 6FABL 4JZJB 2CDFB 4R4ND 3BAEL 4P3DB 5AEAA 5FYLD 1XCTA 4QNPF 3OXSB 2HJKB 4PGCA 3GIVB 2EIZB 1LO2H 4G9FE 4JHAH 2FWOA 4XBEL 2I60H 2W07A 5F7EL 1QLRA 4WEBH 3PWPA 4WCYH 3MLUH 1NJ9B 1NGWB 1W72L 4WDIA 5D7LD 3VFPA 1YEFH 1T04A 1ZWIA 4P4KA 5DRNA 1G7QA 1LD9A 3KLDA 4NO5B 4NWTL 4GG6E 2FJGB 1BFVH 1TPXB 3G5XA 1FFOB 1EHLL 2FLBT 4HUUA 1KJVB 5FM4A 3W0WE 3FOMB 4D0CB 4TSAH 5FECB 1AIFA 5D5ME 3ZYZA 1T66C 1YMMA 1JZ7A 3OXRB 1G9EA 2DMBA 4P23C 2Z35A 3KXFE 5CINL 4O00A 1VEMA 1S7WB 1RUMH 4D94A 2VE6A 4JRXE 4XPBL 3UBXB 4ODUB 1MHCB 3L3KA 1WZ1L 4HG4K 4GXVH 5D1QB 3BYTA 1QBML 2QADB 5D5MF 4NBZB 4NKMB 4PRBA 1NGQL 1TZIA 3SGJA 5DEGB 3VGAC 3HB3D 3BZEA 1NCBL 5SX4I 3WFBL 4I9WE 3OAYH 5AG8A 2BVTA 2JJUA 5E8DH 1A6TA 5GGSB 1YEDB 1GGCL 1CGSH 1DLFH 5KJRH 2ICEA 4KAQL 5T3ZE 4YFEA 4LCCA 3V6OE 1BLNB 1CU4L 4EDXB 4U6XB 3LZFH 5CEZL 3ULUE 2YXMA 4QHMB 4R90L 5AYQA 4AJ0A 1MH5A 4FFWD 3WE6B 3E2HC 4JFZL 4P23B 3U2SA 4YK4B 3QIWC 4HJJL 3EJZD 3MODL 1ADQH 2OX5A 3FFDA 4WI9A 2FBJL 2DM2A 1X5JA 4S1QL 4QHUB 4CU8A 1NUFA 3C2AL 1VFOA 5FKAB 3QXWA 4RQQA 1JGDA 3D85B 2Q87A 2NY7H 3ULUF 1S7SB 1MREL 4XAKD 2ZUWA 4XC1L 3UJIH 1FORH 3OR6B 4HKZA 3EO9L 3MBXL 3MSPA 1L7IL 4K71C 1EERB 3C60C 2NNAA 4IS6B 3B2UC 5TF0A 3D3VD 5FYJD 5T5FH 1IGIL 4QYOA 4P2OA 2ARJA 3L3HB 5BV7L 4U1LB 5F3HA 1PZ5A 3O3BB 2F74B 1LVEA 1RZJH 2VB5A 4MNQE 2BXYA 4YJZL 3JWDL 5DGRA 3E2HB 3TP4A 4NO3B 3BIAX 3QIWB 3X12B 2EDEA 1IRAY 1ZLSL 4HZLA 4RMWA 2YA0A 3IDGA 1JJUA 5DF0A 1OCWL 5C07B 4UTAH 3DXAB 4P5MA 4DCQA 4JN1H 2X40A 2H2SC 4P46C 4K71B 1WF5A 4HG4J 4Y2OA 1QQDA 4LHUB 1CFVL 3RWIB 4JAMA 1RU9L 3KPSE 4Z7UA 1NMCC 1J86A 1MVUB 1LHZA 4PV9B 1JHTB 1FO0H 4UTBL 3UAJD 5IW1A 3LY6A 4ZSOE 4RIRA 5A16B 2F53A 2BSRA 4B5EA 5EUOE 5CBAB 1AI1H 3KDMA 4HWBH 3PWVB 2CH8A 5DJ8B 4NQXB 1NBYA 1KBGH 4X4XB 2DQEL 3RP1A 3TLRA 2Z8SA 2VRAA 2QSVA 3BXNA 2Y6SD 2X70B 5IVZA 1GIGL 2X4QA 4PGEB 5DUPL 3UTSB 3MLYH 3WNNA 2XZCH 4JFOB 2R8SL 1JTTA 2B4CH 4UQ2B 2W65A 3GMNA 4LCWD 5EUOF 1GJIA 5GGVY 1N64L 4P46B 3FO2B 4H0HB 1LK3L 5CFHA 1AGCB 1BF8A 2NXZC 4JKMA 4XMLH 4DKEL 5IB3A 4C54A 3U7WL 1IM3A 4NNYA 3QIUB 1GSMA 4CVXB 4WUUE 4JDZB 2BP3A 3N06B 3LAFA 1GPOH 4LLDB 5IB5B 1LDPL 4XP9L 3GBMH 4ELMA 3PP4H 3E8UH 5JQHC 5GRVK 5IIEB 3AM8A 3TIDB 4HS8H 4H0IA 5TDPA 5E2TL 1YDPB 5SV3A 1NCTA 2JE8A 3X13B 1WCQA 1P4LB 3G6JB 5SWSE 4WTZG 4JFEE 1UZ8A 2ED7A 2WWMC 4K2UH 4X9FA 3VRJB 1P84K 4R97C 3RKDD 1KIPA 3PQYB 4J3UA 1EH9A 1HQ4A 3ULVE 1FVCA 3MZTA 1A7BA 1KCRL 2H32H 3SDCA 4XP1L 2NXZB 3EYSL 3VWJC 1F3RB 43CAA 5DQDH 2YPLE 2I9LA 1OSZB 3O6FD 1ZT1B 4X99B 5IHLB 2MNUA 5CEZD 4LRIC 1XCQA 5FA3A 4U1GC 3L3JA 2E9BA 3ARPA 4I13B 4U3XA 1F8TL 4K3HA 5FO9B 5TE6L 4IRJA 3EYFA 5BCAA 3HN3A 3IF1B 1J0ZA 3M8OH 4MHHG 5K9OA 1VEOA 2FX7L 4PLJD 2AEQL 3C87A 3FB6B 3QRGL 4DGIH 2Y06L 5J1SC 1FRGH 1PW3A 1E6JH 3LKOB 3FQNB 4OZGB 4PJIE 5IB2A 2DIAA 1NCCH 3HE7A 1Z2KA 1OGAA 4G8GE 4NFCA 3NCEB 1V3JA 4NRZB 1FPTL 4PRIB 2LE9A 3MV9B 5ADOL 1MQ8A 1YEKH 1RZ7H 5HYSB 4G8IB 3PP3H 4L8SC 3SN6N 1BAFH 3SQOH 3KYNB 3DBXA 1RPQA 2NW2A 1M05A 3SGDH 2C7UA 2APFA 1AO7B 4PJIF 1JPST 4U1GB 5DTFB 4P5TC 5LKNA 3DHJA 1X4ZA 3O6ML 2W38A 1UG9A 2PCPB 4QHNA 1KPVA 2ZUQC 3TT1L 3EZJB 4DTGL 4ALAL 4O5LL 4KTDL 2MPAL 3NFPA 2PO6D 3JTSA 5CMAA 2WNGA 2VXTL 4Z7WE 2C1OB 1R5VA 3HAEB 1BZQK 2HT3D 4JFYB 1VACA 1A7OH 3RZCA 3X14B 1QVOA 2B0SL 4LPTA 3CLEL 4EQ2A 4FFVC 3BP5B 4NJAL 1XAUA 1OGTA 4Y2DA 3D0VB 2X4TA 3PDOB 1BBJB 3WFDL 4Z7WF 4I5BB 1MI5E 3TJHC 4HGWA 5ITBH 1HWGB 1JZ5A 4AEEA 1QFUH 2GJZB 3Q0HA 4R4NC 3KPRE 5KW9H 5I1HH 4JFQB 1NC2D 3T0EE 3KLSA 4P5TB 2GSGB 4U1NA 3C6SA 1Q0YL 3GM0A 1UM6H 1J0JA 1MCQA 2NLJB 4L4TA 3TZVD 1X7QA 4XNQA 2I24N 3UMTA 5EU5A 4NHCH 2YSSB 4WJ5A 1VADA 4HUMB 5HYIA 5FM8A 3EYOB 4UOJA 1MCOL 4MQ7A 4PY8J 3BZ4A 1QFWH 1MFDH 3ARDA 4C56A 3PWJB 3ESUF 3MLWL 4LPVA 3CFCL 3QUXD 4AZ8A 1KJ2B 3QDGA 5I71B 4JPVH 2CRIA 3L3GB 4Z77B 1HN1A 2Q1EA 2VH5L 3OPZH 3QZWG 1JCKA 5EU6B 3TO4B 4KQ4H 2WBWB 3G08B 3VE0A 3OAUL 1CDJA 2NR6D 5DMIL 5JLZB 3B83A 5A2LH 5D2NC 2MKLC 3D0LA 4G42A 4BFIB 1TJIL 4JVWA 4F33A 2EE2A 5DWUL 2LAAA 4PJ5E 3Q3GA 3S98A 4CJ0A 2VNCA 4HMCA 4M8QB 4H20H 3EFFB 2CK2A 3KWWA 1QSED 3QHTC 4HWEL 3FO1B 2GCYA 4OB5H 5D7LB 2H6PA 2MTPA 1OY3B 3TPKA 4D9LH 3V8OA 4P59L 1DQJB 4DWHA 1I1RA 1P4BH 3SKMA 4XNZC 1U3JA 2HYMA 3R1GH 3TBSB 1Q8MA 3I6LE 4FZ8H 5CP3A 3CFJA 3IXAA 4OF3A 4POUB 1U95B 4Y5VA 2RGSA 3GJEA 5F70A 5IP4A 3KPNB 1FNAA 5E8PB 3VFTB 1H8SA 3BIKA 1G9ML 3I9GH 4QLRA 4PUBL 3G5YA 1T5WB 4MJ6B 1J11A 4HPYL 4PJ9D 2AXHA 4NM4L 2VN4A 3CFBB 3LB6C 1QRND 5E2VH 4YDKH 4PR5A 2V7HB 5CCKH 3G5ZA 2G9HA 4I0KA 4GAYA 3P4NA 1PAMA 4XNZB 1JUFA 1QYGL 1ZK9A 1CDGA 3F7VB 1DJSA 2W0LA 2RJMA 4XWOD 1JHKH 4LNRA 5I2IB 4U4BA 1HOCB 1AE6H 2A6JA 4ZODA 1SVZA 1GH7A 4PY8I 3K2UL 2BJMH 2VABB 1R3HA 1WC7A 5K33A 5B8CB 5IV2A 5D72H 1ZLWH 3MLSL 1XF2B 4PJCA 4PB9H 4R3SB 5CIPA 4ZUWA 5DI8B 2XPGA 1FHGA 3RA7L 1U0QA 2E6JA 3N9GH 1A3LH 5D7IA 3KAAA 2NY1C 1WAAE 2AV7B 3TBTA 3ZKNC 3VXNB 2AEPH 3CDCA 1NLDH 2VLRE 2FHCA 4R8WH 2BNQB 3D3VB 3EYVA 4UU9B 5FHBH 3BP7B 3P73B 4UV7H 1F2QA 3CUPA 1VPOH 4HPOH 3IETA 4D0DA 4YDVA 3HE6A 1AGEA 1WAAF 3GO1H 3CZJA 2OJZL 4A6YA 3QEHA 5DLMH 5IEKB 1GZQA 4MXQD 1MAKA 3MFFB 4ZUVA 4BSJA 2M1KA 3NOIA 3O4LA 3P11H 4RAVA 5DJ2A 1NBVL 4NQDD 3F7PC 2NY1B 2WSKA 1HK6A 4X5WB 4ERSL 4K8RD 2Y36H 1YJDH 3ARGD 5E1AA 3FFCE 5F1SA 3MRNA 3DRTA 4ZTOL 1YEIL 3O2DA 1EZVX 5CILL 4E9LA 1YUHB 4OM0L 3G9AB 3N0PB 3V52L 4P3CH 3D39E 4OV5A 5KSBE 2WQ8A 4S11A 4WHDA 1X5AA 2X89D 1WTGT 3BVNA 1KXTB 2GAZA 1UGNA 3B9EA 5FXCH 5D7JD 2L4OA 4I4WA 1TTUA 4EUPA 1IGML 1PSKH 3DMMC 4ORGB 1A0QL 1S9WB 2YZ1A 4XCYB 1U8HB 1WLHA 5KSBF 1I3RB 1LMKA 1UH4A 1NC4A 2W0FA 4I48B 4I0CC 3FT3B 2FLRT 4NNXA 1EJ6A 4NO0A 1I8MB 1KPRA 3ARQA 1QBBA 4R4FH 2Y7QB 2NCMA 3A6BH 2XTLA 5GSRA 2HWZL 1W72B 4LCWB 5DRXA 3EGSB 5CJQL 1NKOA 2DWEA 2GTZB 4GRLC 3WSQL 5ILTL 5K9QI 5CD5D 1NDGB 1OSPL 2ITDB 5F7MC 1MRDH 1NCUA 2P8LA 1MNUH 1SM3H 1QR1B 1L0YA 1LGVA 2UWEE 5KVGL 4HFWB 4XVUD 3PDGA 3MCKB 1CLYL 1ZKAA 1XZ0B 3WLBA 1F4XL 3DO7B 1KSRA 1GOFA 4ZQKB 2ZWLT 2XZAL 3BJLA 3IDMA 4IBLT 5SWQA 2YPKA 4HWZA 4J12A 3IKCA 5GHWH 3HI6H 3F5WA 2GQHA 2QHLA 4X6EB 2P49B 4JDTH 5D2LB 3FB5B 3S4SA 5J11C 3LN4B 2UWEF 4OFIA 1JIBA 4JFDD 2DLFH 1RIVL 5C6WH 1KC5H 3QWOB 1G7JB 2DL2A 5CUSL 1CGYA 3TEUA 5GGRA 3DNKA 4BM7A 3GK8L 4X9HA 1P5UA 1YN7A 3O41A 1G9NH 4PTUB 1B4RA 5C0BD 3DV6A 2EYTB 2DS4A 4NP4L 5A2IH 3MLXL 4L4VA 2R0KL 1IC4H 3L95A 5FAAA 5BRZB 1Q9WA 1NAMA 3MLTA 4R7DA 2BY3A 1J05B 4IDJH 4RMVA 4LLMB 5J1TC 3FQWA 5HD8D 1ZHNB 1HDMB 3S8WA 4OZIA 1PLGH 3HC4L 3MRBB 1F58H 4JQIH 3TT3H 1ZHKA 4DVBB 2VLLB 4QRSA 3V4PH 5C0FA 4LSSH 4QEGA 1Y6MR 2CKBL 4F2MA 4UBDC 2V2XA 4MJ5A 5SWZA 5JPMB 1IGYB 4PJ8D 2YD2A 4WIQA 1OQXA 3WFEL 5D4QA 3PDDA 4UT6H 5I1CL 1RHHA 5A43C 4WEUD 1T22B 3KPOA 1NAML 5MENA 1FIEA 3TZVC 1EHAA 2DYPB 2HFGH 3ELAT 1EO8L 3DYPA 5HHME 1G0YR 3V0VB 3BFOA 3SKOB 3D87B 1UKSA 3S34H 4Y0GA 3HG1D 1F97A 4LEXH 4U1IB 5BW7C 1F4WH 3S6CA 1FGNH 3NFNA 5C0IA 2O61B 3CU1A 4DGYL 1WFUA 4PJ7B 1HNGA 5IBUG 2B7DT 4GKNA 3WFCH 1CN4A 2BY0A 3NACH 1RJZB 5C0AD 4X5XB 1ZVSA 4ZO6A 1HXMB 2ENYA 5DJCB 1NC2B 4Y5XA 1KV3A 4X4ME 3H6JA 5CJBA 2Q8BH 2FJHA 4MB3A 5I18H 2L7UA 3DIFA 4XZUB 1O0VA 1QLEH 4I2XE 4OF8A 3VH8B 4HUKB 3TZVB 2JF1A 2R0WL 1KXVC 1GGBL 5K9JH 1LDSA 4JPIA 1HZHH 2E7HA 4NWUL 3PL6C 1GGIL 3M1BB 1ZLVH 1NMBH 2X4UB 2WANA 4W4OA 1UT9A 2EH7H 2CMRH 3SJVD 3QUXB 2WWKT 5E2JA 3WDJA 4FQ2L 3EDJA 2VDOL 2I27N 3WNLA 2IANB 2R2EA 4LDOB 5JQ6H 2E8ZA 2BSSA 1II4E 2DKMA 4OCYL 1N4XH 1P1ZB 4N68A 1MHHA 5EOQL 4ZTPL 3OB0H 5C8JB 1QBLH 2QJDA 3UZVB 5BVPL 4MD4B 3VCLA 4QT5B 4Z7VA 3NCMA 5C0EB 2ENSA 1R3IL 2GJ6E 1A3RH 5HI5C 1UENA 4HXAH 3MRRB 1RHFA 4I1NB 2P5EA 4F7EB 4OCWL 3S37L 1QSEB 4IHOA 4XCNA 3MGOA 4JANB 5F9OH 4PRHE 3F7RA 5E03A 3PL6B 3V4VH 4RGOL 1JVKA 4WV1C 4JO2H 1KTDA 2APXA 4HHAB 4ZDHB 4JZNB 4NC1E 4HF5H 5E1HB 2CRMA 3OG6B 5GZNC 1UM4H 4HS6A 3G04B 3HR5A 4UIMB 4XWOC 3H9YA 2CKNA 4L8CB 1TDQA 4LAQH 3S88L 1QSFA 4BK5A 1AXTL 1H5BC 2R23A 4I18A 3UTQB 4JRWA 1MIEH 3T65A 4O58H 5ICXB 1FJ1A 5HHXH 4NN5B 3TPUB 1Q9KA 1QPXA 2GIYA 2VLKA 1QACA 4H5SB 1YPZE 1IC1A 2KH2B 4PJ9B 5KS9A 4M1DL 3M17B 1L4IA 4M6MH 5DHVB 1N6QH 4PYHA 1QRNB 3O81A 2BVOB 1KN2L 4WV1B 1E4WH 5JPNA 2ZSVB 4YHMH 4JPKL 4XP5L 4C83A 4XPHL 1YPZF 5GGTA 1I8KB 3PWNA 4XNUL 1YYMH 4FQCH 4YDLB 3MRFB 2GT9A 1KEGL 3CMOH 1LQSR 4H8WL 1IGTA 3MNWB 1BZ7A 1AD9B 2NY5C 1RK1A 3MACL 5H8DA 4M6NL 4WEMB 4LGSB 4F80A 1AGDA 4MB5A 5F6HJ 5KVMC 1M6OB 1NEZG 3K46A 4HXBH 1NL0L 4LLUA 4U6YA 2C3VB 1FNHA 4GG6A 5ENWA 3S96B 3N1PC 5KSVB 3CFKA 5TH2A 4FQXA 1B0GA 2HKFH 3CC5A 1RZKH 1A6ZB 3D25B 4NUJB 2I26N 2BSED 3NZ8A 3OSKA 3OAYK 3O3UN 4KY1H 4DAGH 5J8OA 1SY6L 4IMLB 4MAUH 2H9GB 3I50H 2HFEB 4F57L 4OCMC 3K80A 3DLQR 3AU1A 4G7YH 4NQUA 3QXAB 2XA8L 1BVZA 1FFPB 3CFIC 3CDYA 1G0XA 2Y1VA 4HX1A 4JM2F 3KLHD 1YY8A 2ZOLB 1U3HD 1F3DJ 2Z92A 3TWCH 4CJ1A 3UC0L 3I6GB 3G5VB 3RDTC 1P6AB 8FABA 5E08L 4CGTA 4K3EH 3BDYL 5IHZB 3I6KA 5K59E 1JPGB 4JZOB 4ZPVB 3CH1A 4N8CH 3ARGB 1XT5A 2C4FU 3BN9D 3GB7B 2NY2C 1EBPA 4RMUA 3RVXC 5EC2A 4LCYB 3V6OA 4NRXA 4ODTH 2DF3A 4GAGH 1OAQH 5LWYH 3GI9L 3MRLA 1U2HA 1KB9K 5CD5C 4WU5B 4OCSH 4IJ3B 5IMLA 5FGBC 2RR3A 2DBLH 4IRSA 5K59F 4M5YL 3QPXL 5D7JB 2AV1B 2XWTB 3STZB 2GSIB 4JKPL 4DQOH 3UJTL 1DBML 4TULL 1T03L 4OZFA 5KN5B 4NO2A 5J9PA 4FFZL 1OPGL 5C71A 4NSKA 4NFBA 3SY0A 4OF6A 4O4YL 3FO0L 1N59B 1PJ9A 5BXFB 2HT4C 4MA3B 2EDLA 2NTFA 3QAZB 4BQCA 1KJ3L 4DOHE 1NLBH 2AJSL 1MF2L 3IAGC 1R3KB 5L2KA 4H88L 4PRPB 1V7MH 5J6HA 2NY2B 3IDYC 5DK2B 3GMMA 2M26A 3ULUL 3FO9A 3BYYA 4U1MA 1L9MA 1NGZA 2IADB 5DEFA 5E99L 3JV4B 5HHOD 5KVDL 3RY6A 2J88H 2IH3A 1ROWA 2UY7A 2VAJA 5ACZA 3DPBA 1JWUB 3QR2A 4KJWD 4O2CB 3UBXG 4RFNC 4ONHA 1IT9L 4G6ML 3IU4H 2X2YA 1MCFA 2FR4B 1N3NB 2QR0A 5GS1C 1KIQA 1S8DB 4HS3B 2LAGB 1PG7L 3U0PB 4IOIA 3QEQA 1R3LA 4JEGB 4APQA 5F96H 4GG8B 4RCAA 3T77A 3LH2L 5ISZD 4JFDB 3CLFH 5ALCH 1X3DA 3W81A 3IDYB 1AGBA 2A9MH 2P8MA 1RULH 1A4JB 3H9HB 2ZP0T 4QY8A 3TN0D 2EIDA 4QRPE 4M62L 1Y0LA 5KG9A 5FFLA 1MQKL 1AGFB 2XRAL 2X1WL 3GRWA 1FYTD 5BS0E 1AD0A 2QEJA 3RX7A 3SPVB 5IWLA 2PYEA 1K2DB 3BT2H 4RFNB 1GCFA 5C0BB 5T1LA 3AB0C 4RNRA 4JKLA 1KB9J 2DQGH 1T1XB 1FZMB 1LE9A 1K85A 1JV5A 4OD3H 5GS1B 3GGWB 1M7IB 4R26L 1PKQB 4KKAD 2NPLX 3QQ9D 1CFTB 2IQAB 4TRPH 3P0GB 2PTVA 5EO9B 4M48H 3CDFA 3QEGL 4HCRL 1XEDA 4TVPL 4WTXA 5IG7B 2CRYA 3HLAB 3E6FA 5EULV 4HC1L 4HUWA 2Z31D 2A1WL 3MRPB 4XC3L 4LKCB 5E95B 4YFLF 3VDBA 2UYLA 4LP5A 3W5NA 4BH7A 2BSTB 4P9MH 1KFAH 1EGJL 3F7YA 3FHAA 2YKLL 4NKIH 2CDGA 4YX2H 3OKOB 3MV8A 4GAJH 1I1AD 1OT1A 3RVTD 4Y19A 4JFEA 1LO2L 4QHLA 4LBEB 3J8F7 4FXGB 2XFXA 1IAIM 2GFBB 2I60L 1CD8A 1KIRB 3RL1A 3EO1A 4WEBL 1QO3A 4AENB 4KUZH 4LHUG 4MX7A 4WCYL 4V1DE 2YRLA 3MLUL 5C0GA 1QOKA 4KK6D 4M7LT 5I1KH 1OAKL 4JDVA 1YEFL 5GSVB 4ETYA 3KS0J 4Z5RB 4X5LA 2DQJH 4HV8B 3W0WD 5IB1A 1C12B 4J23A 4MMXC 5D7KE 1PY9A 2P8PB 1D9KC 1MVFA 4LL9A 2J8UE 3I75A 5L8LB 1BFVL 4CVWA 4HIXH 3UTTE 4KMTH 5C0AB 3KXFD 4TSAL 2EIEA 4U6VH 5B4MD 1H3PL 4JRXD 4WTWA 3OKYA 3C60A 1Z5LB 3PP3K 3V6FA 3FQUA 2FCBA 5IJVB 2I25N 2X6MA 1XR9A 1RUML 1X5HA 2AK4D 1AHWC 2J8UF 2VWEE 5DJXA 4PJIA 4GXVL 4I9WD 4CVZA 4CMHC 1JFQH 2ZCLL 2D9QB 5D8JL 1V3LA 1FL6B 3T2NH 5T1MB 2CLRA 1HINH 1NCAH 2ZJSH 5J12B 4W81A 2DM3A 1CFQB 2V5TA 3SJVB 2FX9H 4N0YL 5E8DL 4L8BA 1CGSL 1DLFL 5KJRL 4H26B 3FB7A 4LDLB 3UO1H 5C9JB 4QRQB 3P77B 3ZLQC 2DQIH 4CNIA 2O5YL 3MOAH 4Z7WA 5EO0B 1CLCA 1HSAA 1ADQL 3GJFB 1F4AA 3KYMB 1X5LA 1AHWB 3QI9C 2EC9T 4F15C 2WBJA 3R8QA 5DYOB 3PABA 4X83A 4Q6IC 1ZS8B 2YK1H 3SE4A 2JK5B 3UJIL 1DN2A 1MCPH 1FORL 3DVGB 3SE8H 2B5IC 4LLWA 4TSCH 5DVLA 3MCLH 5T5FL 1U9KA 4WHCA 4K9EC 4E41A 3CAFA 4G6JH 4BQ8A 2HMIC 4JFPB 3T0EA 2IPTL 3FMGH 5JXAH 1RZJL 1U8OB 4RRPG 1FZKB 2H3NA 2X7LB 2YBRA 2DQHH 2AJVH 2FX8H 3MA7A 3MREA 4XPAH 4ZS6D 5B3JE 5JHDD 3HMXH 4YHNB 1HHIA 5DD6A 1T1ZA 1A3QA 4F15B 4TNVK 4PJGB 4K7FB 1HCVA 5JW4R 3TH4T 1JNHA 1CGWA 3T0AA 1ORQA 4UTAL 4Y4KA 2NY0C 3RTQC 4JN1L 1H15B 5HYSG 3U4BL 5IEHB 2JIXD 2B5IB 1REIA 4TVPD 5J0BA 3RWEA 5F3BA 1U36A 1WBZA 4PLOB 1FC1A 2BHZA 5DJYA 4KUCF 5DZLA 1FO0L 1IEAA 4H25A 1YMHB 3VWJA 1JGVH 4R7NB 4MSWA 1U91B 1AI1L 2EXWC 3HAEG 5HGBA 4DZBB 5MEPA 2CJUH 4P4KD 3MJ9H 3C9NA 3IFPB 2DIBA 3MV7D 3OKKB 1KBGL 5LAXB 1NGXA 1NDMB 2YRPA 4YR6A 1NPUA 4Z78A 3MLYL 5CAYB 1NBZB 3HZVB 3S36X 3WHE1 1DBKH 5AYUH 2XWBB 1WBYB 3VD5A 4F7CA 3JWOC 1OAZH 2B4CL 4BYHA 4WUUD 5MEOA 1GZPB 2D7QA 3IU3B 3HNTH 5C07E 15C8H 4XMLL 2BVEA 3DXAE 4KK5C 2EDTA 3X17A 3TH2T 3QULA 4UV4H 1SEQH 1UB6B 2JKXA 1A6PA 1GPOL 2EDHA 3F6LA 2WZPD 3B9KA 1BOGA 3GBML 3PP4L 5SWSD 1G84A 2Z4QA 4Y89A 4ZAKD 1KN4H 3EW3B 4HS8L 4WI8A 2N1KA 1ZLWK 5EU7E 4L8SA 2MKWA 4XX1G 2Q86B 5I74C 4MHHI 4OM1H 1ZLUH 3O9WC 4HIJA 1J8KA 3VGBA 4EBQL 4F37F 4X6BB 4ZFOA 3FQRA 1KJ2H 4BZ2L 4QTHB 3OKMA 5EN2B 3HRZB 2DWDB 4NGHH 4YHZH 5HHPB 3JUZA 4LKXB 3UTSE 3DUUB 5DQDL 1ZA3A 5GGUB 3RIFF 2IFFL 4BFGA 5DD0H 4EXKA 2FL5A 3SGDI 3WS3B 3BUYA 2O5ZH 4NKDA 4KWUA 3MROA 4GMTH 3C5ZA 1Y18B 5DUBA 3B9DA 1MIMH 1ZT7B 3QYCA 2R1XB 3L3OB 1WAAA 1S9XA 5FYJU 5DRZB 3ARBA 3KPQB 2VLME 3M8OL 3LS4H 1CD1B 3L7EB 3RNKA 5FUZH 4PJDB 5I74B 1CGVA 3ZL4H 2HLFD 3TA3D 4DGIL 4NBYB 3H0TB 3MYZA 4ZFOL 2MHAB 4KHTH 1E6JL 4WY7H 5F1IB 4L8DA 1B90A 3G6JE 5IKCB 4LGRB 3WXWH 1PVHA 1NCCL 3ULSA 35C8H 4LU5L 2ZSWB 2P24A 3PQYE 3DV4A 1LEIA 5F1NB 4HULB 5CLTA 3BPNC 1YEKL 3CFEB 3MJ7B 1OARH 1K9TA 1RZ7L 4LRNH 4TQEL 1YA5A 2Q76B 1BAFL 4XBPB 3SQOL 1ZGLP 2FHBA 3G6JF 2DRUA 1ND0A 1YQ2A 1BREA 1I7UA 3IXTB 3ET9F 1OHQA 3IFOA 4XRCA 2A2QT 4OCLC 3O8XA 4XTRD 5GIRB 5F7DA 1S3KH 3KPPA 1QFWI 3D39A 5ISZB 5B38B 3MZGB 2IPKA 1SJHB 5EB9A 5EOCH 3VXUB 5HHNA 3QUZA 4AG4H 5EFIA 1A7OL 1JYNA 5EO1B 3VI3F 1XFPA 4ZOEA 2F53D 3RWHB 3TN0B 1MEXL 3OF6A 3CNKA 3KPRD 5ID1B 1FYTB 4L3ED 3BPNB 4OZGE 5HY9B 1U8IA 2XXCB 5ITBL 3MRHA 1UKTA 1QFUL 4U6TA 3CVIH 1GVIA 1KPUA 4X0KB 3LEVH 1T89A 4PRIE 1S5HB 3C6LC 3DGGA 5I1HL 5KW9L 3MV9E 4WU7B 4TN9A 1E27B 1DDHA 1Q0XH 5HDLA 4Y5YB 2MMXA 1FLRH 3IRZA 3RPIB 3T2PA 1BQHA 1W0WB 2XTJD 4MMZC 1N2RB 1A1NA 3EBAA 1UM6L 5L9DH 5KSUB 2EDRA 4OKVB 1AO7E 4OZGF 1BZ9B 4NHCL 1Y6NR 3NTCH 1DANT 1U6AH 2HN7A 3P30H 1ES0A 1QFWL 1HH6B 1MFDL 2B1HH 5DMKB 3HC3H 3LN9A 1A7NH 5FYJH 2ZCHL 2VZOA 3VFWB 5JHLH 3U1SH 4YC2C 1DE4B 4JPVL 1ZGLB 1BFOB 3S3JA 2VAAA 1CE1H 1YEJH 4N5UA 3IJHA 4X8JB 1TVHA 1ZSDA 4NPYB 3NZHL 3QPQD 4X4YB 1I1AB 3IB4A 4NQSA 2DLHA 5CHNB 2BVPA 2RB8A 3F65A 3UJJH 1X9QA 4OT1H 1FGVH 5EU4A 4D9RE 2VJXA 3SDCD 1B0RA 4FS0A 4H20L 2X1XR 3WUZA 4XNMB 1R3JB 2I07A 4OB5L 1A7QH 4D9LL 4POYA 2V5RA 5IQ9B 4HAFA 3BO8A 1P4BL 4YQXH 2E7LA 5EBGA 3BI9X 2YUXA 3WIFA 3JVGC 4FZ8L 1UXSA 3EFDH 3FN0H 3T8XA 4IRJD 4XX1E 1HHJB 1FNFA 4NCC2 4LHJB 2C1PA 1LK2A 2ZPKH 2W59A 3MA9H 4AIZB 2W92A 2D0GA 5EU6E 4K7PH 1NMAH 3I9GL 1AP2B 4TSBH 5KTEH 1UJ3A 2J6EH 1IL1A 2AK4B 4N0FB 5INDA 1D5BB 5FYLE 2VZSA 4PREB 1LEKB 4FRWA 1OGAD 3T1WA 3V6ZB 3LD8C 2ICWI 1WCBA 4PIRF 5HPOA 5E2VL 1FNGB 4N8PA 5EPMB 5JIHA 1U8MA 1PD6A 1CK0H 1MWAA 1IAMA 5HYFA 5IM7A 2OMNA 2IGFL 5E6IA 1XGUA 1QNZH 2XICA 4JM4H 2X5PA 5D7LE 4LIQH 4JRYA 4POZC 4DJMA 3KHQA 3LRGA 5I1IH 1JHKL 3DTXB 1YC7A 4LLYB 5DMGD 2BJML 4MB4A 4HBCH 3B2VH 4XCEB 4XXDA 5E24E 5DS8B 2RFXB 5D1ZD 1U92B 1WV7T 4TUJB 1CTOA 1RD6A 2FECL 4WHTA 3FB8A 1IAOA 1J7VR 1HKLH 4PTTA 2J4WH 5C70A 3QISA 5E00A 4EI6A 2EDXA 2Y72A 3HPLA 1VGEH 3HZKA 5IBTH 1T5XB 3N9GL 4LFHD 3SEPA 1G6RB 1A3LL 2VLRD 1AKJA 4FQLH 4Y2DD 3FL7A 3DMMA 3LD8B 4PGBB 2E8YA 1H8OA 5BZWA 5IOPA 4F7TB 5E8EB 1QKZH 3VXOB 3TBWB 3OR7A 2IG2H 3LKSA 1ZOXA 4R8WL 5C0JA 4PGDB 3LQAC 5FHBL 5HI4D 4UAOB 1ZLVK 1IJ9A 3U0WH 1XGPB 5IFHH 5AG9A 4UV7L 4Q0XH 3OKNA 3VFUB 3VRLF 3QJHA 4HPOL 4JG0H 4L4TD 3NN8B 4XPGH 5JO5B 4KQ3H 3GO1L 2PW1B 4ZXBA 1VFBB 3MRKA 5DLML 2DM7A 3ISWA 5JHDB 1I9IH 4L4JA 3OB0K 1FBIL 1OP3H 4P4KC 4C56D 4EIGB 3RHWF 1EAJA 2BVQB 4Z7OE 3FFCD 1G7IB 1FL5B 3LDBC 5F88B 4JJ5A 1MCWW 1EJOL 3CK0H 2Y36L 1YJDL 1JTOA 3L5WA 4V2CB 3QDJD 1FCCA 3CVHA 4U7MA 1UM5H 2V6HA 3CX5K 4LPWA 1P69B 2WAHA 1XCTB 4JFHD 4P3CL 5SX4H 2ERJC 4XAKE 3WXVH 4Z7OF 4PGCB 5LVEA 4KZDL 3H7BA 5HDBE 2HT2D 1M7XA 2PR4H 2FIKA 1QA9A 1HI6A 4MDIA 3RAJH 2BNQE 3D3VE 1A6UH 1QLRB 5FYJE 3CXHJ 1IZKA 4KRLB 4J3TA 2P5WA 3VXQB 1PSKL 2UUDH 1NGPH 3KJ4B 4WDIB 4FNLH 3VFPB 3STLB 3SGJC 2BCKA 3INUH 5SX5H 3GSOB 1ZWIB 4P4KB 4PRHA 1G7QB 4TUKH 1LD9B 5DRNB 4F8QA 4GW4A 3MV7B 3G6DH