1NHRA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 141
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA02
3CNTA 3CN8A 3KLJA 1RYIA 1DOEA 1KSSA 1H84A 1OJ9A 2YLWA 3UKAA 4CBQA 5BRTA 3DMEA 1CHUA 1K0JA 1TDNA 1KNPA 4U8PA 2VQBA 3NLCA 1H81A 2XVFA 2OLOA 4YSZA 3VR8A 5IPYA 2Q6UA 4C3YA 2VZ2A 2BABA 4EM4A 2WDRA 1NG4A 1E6EA 1XANA 3IC9A 4H4RA 3K7TA 1L9EA 1Q1RA 2ARDA 4HA6A 2YVJA 1EL9A 4H4XA 3BNUA 4H4PA 4Y4MA 1NEKA 1ZKQA 5U1OA 3I3LA 2R4JA 3Q6JA 3UOZA 2C76A 5HXIA 4O5UA 3AWIA 2WBAA 3B6DA 2V5ZA 2JB2A 3CPIG 5L46A 3SFEA 4AOXA 1XDIA 2XYOA 2WQYA 3EANA 5JCMA 2XFNA 2C70A 2UZZA 3BHKA 3BI5A 3FPZA 4H2QA 2WDQA 2YR6A 4BV6A 3LADA 2GMJA 4Y4LA 3C4AA 5CKUA 1IUWA 3VQRA 4EMIA 4U8MA 2BC1A 4UDRA 1IUSA 4DGKA 2Q0LA 4YSXA 1GRAA 1BGJA 3DGHA 3NGCX 4H4ZA 1JRXA 4B67A 1E1MA 4CNKA 2R0CA 1H7XA 4UDQA 1RSGA 1IUTA 2BCGG 4Z24A 3GYIA 2YM1A 4O5QA 1O95A 2OAMA 2I0ZA 3FG2P 1GREA 2WP5A 2C3DA 2XVIA 2B76A 1VQWA 3LOVA 2EQ6A 1NHSA 2B7RA 3O0HA 1PHHA 1Y56B 1X31B 4U8JA 4FK1C 2APGA 1S2YA 3BI4A 3CPHG 3UOVA 3BI2A 2XFPA 1TYPA 3VR9A 2JKCA 2YLTA 1ZX9A 2O9ZA 3ALLA 2FBWA 1PXBA 2IIDA 2ACZA 2DKIA 3VRAA 3G5RA 5IQ1A 4WX1A 1MO9A 3OC4A 1IJHA 2Y6RA 4GUVA 4X9MA 2YVGA 4CNJA 1IUUA 2BA9A 5HY5A 1QO8A 1GESA 5HHFA 3AXBA 4LIIA 3NIXA 3QSSA 3UTHA 4GCMA 3FMWA 1EL7A 3L1RA 4K5RA 1SEZA 1GTEA 2YG3A 1M6IA 3E1TA 3AYLA 3NH3X 4YXDA 1NHQA 3GSIA 5BULA 1B37A 2VVLA 4Z2RA 1DNCA 1FL2A 4AP3A 4C5OA 4DSGA 2XVJA 4XXGA 4PAAA 4AOSA 1LQUA 2WESA 1ZOVA 3CGEA 1LPFA 1V59A 3K30A 3AECA 3ICRA 2V3BA 3QVPA 3GD4A 2A8XA 1CJ3A 3UOXA 1KNRA 5U25A 4AT2A 1E1NA 2Q7VA 1NPXA 2BACA 3URHA 5KVIA 5EBKA 3C4NA 1B8SA 4OPCA 2IVEA 3QVRA 4U8NA 1Y56A 2GV8A 1OJAA 3GDNA 2BCPA 4K8DA 3KA7A 3SQPA 1LV0A 1GRFA 2TPRA 1H82A 4I58A 4D04A 1JNZA 2E4GA 4J56A 1PBBA 4RSLA 2JAEA 3KD9A 1YQZA 5EB5A 3AD8B 3NK2X 1H6VA 4GDEA 1GOSA 4H2PA 5FS8A 4YTPA 2C3CA 1AOGA 4K22A 3IHMA 1TDKA 3ATQA 1P2HA 2WDVA 1EBDA 3AEAA 3AEBA 1PDHA 2WP6A 4N9XA 4GF7A 2R4EA 1JU2A 4JY3A 3RNMA 1QLBA 4B66A 2AAQA 4CCQA 5KOWA 2XVEA 4B1BA 3KKJA 2ZZBA 3VRBA 2ZZ0A 3CGBA 2WEUA 3VRDB 4USQA 3BNMA 1PBCA 2BK5A 4ECHA 3CNSA 3CIRA 3FBSA 5FMHA 1NHRA 3FIMB 4APNA 2FJBA 2XLRA 2JB1A 3M13A 4DNAA 3NYFA 5KXJA 4H7UA 4YSHA 2YLSA 3QFAA 1GEUA 4XWRA 4EIQA 4J33A 3NTDA 3S5WA 3UTEA 4P9SA 3AE2A 4H50A 2YLRA 1LVLA 3RP8A 1CJ4A 1DXLA 5FS9A 2A87A 1FECA 4H4UA 2H89A 2GVCA 1ONFA 2OLNA 3NK1X 3Q9TA 2VVMA 2R0GA 2XLUA 2GR2A 2X8HA 4AT0A 1JRYA 3NKSA 1TDOA 3DJEA 2YG5A 1K0IA 3AD9B 4OVIA 2GR0A 1D5TA 1OJCA 1GT8A 2JB3A 3CNJA 3DK9A 2GAHB 3AYIA 3NRNA 1F3PA 4EQWA 1VDCA 1PBFA 2RGHA 4KPRA 1KF6A 2XLSA 4H2RA 4J36A 1YY5A 1ZK7A 1ZMDA 3L8KA 2YR4A 1Y0PA 4K2XA 1COYA 2GR1A 3JSKA 1DOCA 3DK8A 4X4JA 4ICYA 4C77A 3ITJA 2YLZA 4U8KA 5M0ZA 2YQUA 4OPLA 2FJEA 1KFYA 3CGCA 3UP4A 3LZWA 4TLZA 1YQ3A 3ADAB 5FS7A 5KRQA 1GRGA 4DSHA 1E39A 3AEDA 3ICSA 2QA2A 2B9YA 2V6OA 4A5LA 3GWFA 4U2SA 2X3NA 2RABA 2BXRA 4JQ9A 1CJCA 4BJZA 3AEFA 5EB4A 4EMWA 2IVDA 4K7ZA 4LU6A 3PS9A 1L9DA 1NENA 3AEGA 3IF9A 3UOYA 2VRLA 3IWAA 1D4DA 1H83A 4LA1A 4ZN0A 3AEEA 2C72A 3DA1A 2NPXA 5GSNA 4U8LA 4WCTA 2GR3A 3I6DA 4A79A 4ADWA 3DJDA 1GALA 1Z6LA 2WETA 1GRBA 2WS3A 1REOA 1PJ6A 4Y4NA 3DGZA 5CQFA 4OPDA 2TMDA 2WHDA 1S2QA 3QJ4A 1PXCA 4TM3A 4A6NB 1GSNA 1VG0A 3AYJA 4YKGA 5C3JA 1TDEA 2B7SA 5C2TA 2EQ9A 2EQ8A 1E1KA 3AB1A 4IA5A 2BS3A 4H4WA 1KSUA 2FJAA 2GQFA 3IHGA 5JCLA 2CVJA 1DJQA 2GF3A 4TM4A 1S3EA 2ZZCA 2OA1A 3V3OA 4OPUA 2ZBWA 3QSMA 3DH9A 4JY2A 2R9ZA 1ELIA 2E1MA 2XVHA 4RG4A 1BZLA 3GYJA 3T37A 4Z2TA 3NYCA 3P9UA 3KVEA 2J3NA 4M52A 4BJYA 3EPTA 3UP5A 2WP9A 4NZHA 3NK0X 2JBVA 3DJJA 1GRHA 4H4TA 2C65A 1DOBA 1JNRA 1TYTA 3P4PA 1GRTA 1P2EA 2W0HA 4B65A 1JRZA 2XDOA 3AE4A 5FS6A 4X9NA 2WOIA 2WPFA 2B9XA 4UDPA 2EQ7A 3C96A 3AE9A 3H8IA 2BYBA 3NNEA 4ZCDA 1XHCA 3S61A 1F6MA 1MXTA 2XCGA 1XPQA 2Y6QA 3NHOX 5KVHA 4TM1A 4OPTA 3R9UA 2C75A 5U63A 1FCDA 1NG3A 4C3XA 4H4SA 3DJGX 3LJPA 4EQRA 4U8IA 4RG3A 3ALMA 2JK6A 2YLXA 3UKHA 3II4A 2WU2A 4A6NA 4BK1A 3GRSA 1CC4A 3QSEA 4MJWA 1BF3A 1FOHA 5KWFA 3UTFA 3SFDA 5JCIA 3AE5A 4Z25A 4GR1A 1CJ2A 1E7PA 1GV4A 3P4SA 1NDAA 3ICTA 3ZYXA 1CBOA 4IV9A 5LV9A 2BS2A 1DODA 1ZP0A 3P1WA 3ALJA 3LZXA 1K4QA 2YG6A 4YWOA 3H4KA 5GRTA 2QA1A 3HZLA 1L0VA 2X50A 1B4VA 1VG9A 3K7MX 2WOVA 1CC2A 4I59A 2OALA 4Z26A 2X8GA 1VRQB 1F8RA 1ZOYA 5M10A 4A7AA 4EQSA 3UTGA 4E0VA 4B69A 4BK2A 4UP3A 3NTAA 3PVCA 5JCKA 2RGJA 1PJ7A 5BUKA 1H86A 2Z5XA 1GTHA 4OPIA 5KOXA 2XFQA 4JNAA 2YG7A 4Z2UA 4D03A 3CNDA 4NEVA 4ZCCA 2CULA 3M12A 2HQMA 4FK1A 4NEWA 2BK4A 1HYUA 2R46A 2AR8A 4K5SA 3G5QA 1CL0A 3UKQA 1JEHA 1D7LA 3UCLA 2WOWA 3UKKA 2X99A 2QCUA 1D7YA 1PN0A 1BWCA 1Q1WA 2WPEA 3KPFA 4A65A 3AE1A 1L9CA 3EF6A 1TRBA 4B64A 1PXAA 1EL8A 1RP0A 2GQWA 3M0OA 4HB9A 2E5VA 3K7QX 1O94A 4YSYA 2FJDA 2Z5YA 1E1LA 1TDFA 2GMHA 4OCGA 4YTMA 2YR5A 5DBJA 1FEAA 4H4YA 2C64A 4H2NA 4FDCB 2AQJA 1N4VA 1GNDA 2GB0A 2VRMA 3AD7B 1CF3A 1OJTA 1PBEA 1FEBA 5J7XA 3EAOA 4Z44A 2GRTA 2B9WA 4NTDA 1IUVA 4TLXA 2H88A 4GDPA 4J31A 5BVAA 1PJ5A 2GEWA 4CCRA 3NN6X 2BS4A 2A89A 3GMBA 1LTXR 1LQTA 4NTCA 3CGDA 4H4QA 3GWDA 4PABA 4B63A 3AE6A 3RP6A 4JNQA 3B3RA 1CC6A 3GMCA 2VQ7A 2C7GA 1JOAA 1GPEA 4A99A 4EQXA 1F8WA 1N4WA 4U2TA 1MOKA 2NVKX 2YVFA 3LXDA 4EM3A 4CY8A 1W4XA 3BHFA 1N4UA 1D4CA 1N1PA 1PS9A 3CNPA 1LJ1A 5TR3A 4FX9A 4EIPA 5IQ4A 4IA6A 3AE7A 2YM2A 1KDGA 3REDA 1QJDA 3G5SA 3LB8A 3ISHA 3NT6A 3NG7X 3GRTA 2V60A 3D1CA 2BK3A 2Q0KA 2VVLG 2YWLA 1OJDA 2QAEA 3AE3A 1BKWA 2PHHA 3UKFA 3GDPA 4KX6A 2WPCA 3NN0X 1YQ4A 1GXFA 2V3AA 1F8SA 2XLPA 3F8DA 3DK4A 4JDRA 2GAGB 2GH5A 3H8LA 1H7WA 4IVOB 4BK3A 2C66A 2CFYA 4TM0A 4USRA 1B5QA 3KU9A 1D4EA 2YG4A 4J34A 4U8OA 4YT0A 1NHPA 2WU5A 3AE8A 2C73A 4XWZA 4Z43A 1IUXA 5HYMA 4GRTA 2X8CA 1GETA 1NAAA 2R45A 3COXA 3RHAA 3RP7A 1O5WA 2XLTA 3UKLA 2RGOA 4REKA 1ZY8A 3CPJG 1S3BA 2R0PA 4EMJA 3D8XA 3SM8A 3ZDNA 4C74A 1EL5A 3PO7A 4IVMB 1Q9IA 3V3NA 4J57A 3P4QA 1K0LA 1ZDLA 4NTEA 3ATRA 4OPGA 3UKPA 1GERA 2DKHA 2BXSA 5J60A 2BC0A 5ER0A 1DJNA 1PBDA 2C67A 3P4RA 2V61A 4B68A 2CDUA 4JN9A 3OZ2A 4CY6A 1M64A 2PYXA 4A9WA 1ZMCA 3QFBA 5JCNA 4AP1A 4U2LA 4H4VA 4BURA 3V76A 4YTNA 3SGLA 3ABVA 3GD3A 4CRTA 1BGNA 3NYEA 3F8PA 3WE0A 2VOUA 1YKJA 2YAUA 4YKFA 4J2WA 2F5ZA 3F8RA 2XFUA 1UKVG 3CTYA 5EOWA 2XFOA
chains in the Genus database with same CATH superfamily
3KLJA 1RYIA 4CBQA 1OJ9A 3UKAA 1CHUA 2XVFA 3VR8A 2BABA 3L5OA 1MUCA 1E6EA 1XANA 3K7TA 1L9EA 4HA6A 2YVJA 1EL9A 3T0KA 4H4PA 4Y4MA 3AWIA 2WBAA 3B6DA 2JB2A 5L46A 3SFEA 3SZWA 3FPZA 3SYIA 1IUSA 2DW6A 1JRXA 4B67A 4CNKA 1IUTA 2OAMA 2I0ZA 2WP5A 2C3DA 3LOVA 2EQ6A 3MKCA 4HYRA 2YLTA 2O9ZA 3CB3A 1KCZA 4WX1A 1MO9A 3AMZA 3VCCA 1SJAA 3H7VA 1GESA 5HHFA 3NIXA 1SEZA 2YG3A 5BULA 2OO6A 4Z2RA 1MRAA 4AOSA 3SZCA 3V3WA 3PG6A 3K30A 2HXUA 2XH7A 3AECA 3QVPA 3SN4A 1YEYA 1MNSA 3MUCA 5U25A 4AT2A 1NPXA 5KVIA 3T9PA 3C4NA 1B8SA 1XS2A 1OJAA 2BCPA 4K8DA 1LV0A 1ONEA 2PODA 1PBBA 4G6GA 3KD9A 1YQZA 2XH2A 3AD8B 3NK2X 1GOSA 2C3CA 1AOGA 4K22A 1PDZA 1L8PA 3RNMA 4KWSA 3OPSA 2C4CA 2ZZBA 4A35A 3VRBA 2ZZ0A 3TWBA 3NVWB 5FMHA 3DDMA 4TVYA 1FHVA 1GEUA 3S5WA 1LVLA 3D9XA 2A87A 1ONFA 3NK1X 1R6WA 2VVMA 2R0GA 2XLUA 2GR2A 1TDOA 3DJEA 2GR0A 3TJIA 1GT8A 4ZA0A 3NRNA 4H2RA 4KPRA 3I6EA 2XLSA 5BUKA 1ZMDA 2GR1A 1DOCA 1P43A 2FJEA 1KFYA 3DEQA 4TLZA 4IP4A 4DYEA 4Z17A 3ES8A 4DSHA 3ICSA 2B9YA 3N4FA 2V6OA 5EB4A 4K7ZA 1L9DA 3IF9A 4GISA 4FI4A 3T2ZA 1F9CA 4LA1A 4ZN0A 5GSNA 1NELA 4U8LA 3I6DA 1Z6LA 4OPDA 1S2QA 4A6NB 1VG0A 5C3JA 4YKGA 1XPYA 2PP1A 3SN0A 5C2TA 4DWDA 2CVJA 3TQPA 3QSMA 3DH9A 3GYJA 5FJTA 3OW1A 3RR1A 2WP9A 1BQGA 4H2HA 3DJJA 2OLAA 2C65A 1DOBA 4IHCA 2BRAA 1P2EA 3FCPA 3DIPA 2WOIA 4UDPA 3H8IA 4ZCDA 2XCGA 1MDRA 4TM1A 5U63A 4EQRA 4U8IA 2GDQA 4MJWA 1FOHA 3UTFA 4Z25A 4GR1A 3P4SA 1NDAA 3PFRA 3ZYXA 1DODA 3T6CA 1K4QA 2YG6A 5GRTA 3HZLA 5BOFA 4A3RA 1B4VA 2WOVA 1CC2A 2O56A 2GGIA 4A7AA 4E0VA 1FFVC 3HYVA 3I4KA 4OPIA 1E9IA 2YG7A 4NEVA 2HQMA 2R46A 4K5SA 1TKKA 3QLDA 3UKQA 2AKZA 1JEHA 1D7YA 3KPFA 3AE1A 4HPNA 4H4YA 2C64A 1OJTA 4G7FA 5FJOA 3R10A 3D47A 5BVAA 4J31A 3CXBA 3GMBA 3GWDA 3AE6A 4JNQA 2VQ7A 1GPEA 3AM9A 3LXDA 2NVKX 4EM3A 1N4UA 5IQ4A 4MGGA 3REDA 3LB8A 4KT2A 2PCEA 3NG7X 5JRBA 2GSHA 2BK3A 2YWLA 3GO2A 2WPCA 4KPLA 1YQ4A 2V3AA 2PTXA 1H7WA 3SZFA 4USRA 1TE6A 5FJUA 1D4EA 4J34A 4GAVA 4YT0A 1NU5A 5HYMA 2OVLA 3RRAA 1GETA 4DX3A 2PA6A 3SN1A 3UKLA 2RGOA 3VA8A 3D8XA 3T4WA 4EMJA 3ATRA 2BXSA 3RCYA 2C67A 2CDUA 1ZMCA 4KEMA 4U2LA 4H4VA 4BURA 3SGLA 3WE0A 1YKJA 2YAUA 2GGGA 4IL0A 1UKVG 3CTYA 3R25A 1H84A 1KNPA 4U8PA 3NLCA 4YSZA 2OLOA 2VZ2A 4EM4A 4J3ZA 4H4RA 4H4XA 1ZKQA 2R4JA 3Q6JA 2C76A 3ETRB 4AOXA 1XDIA 2WQYA 2XFNA 3BHKA 2UZZA 2WDQA 2YR6A 1W6TA 3K1GA 3LADA 4J1OA 1FHUA 5CKUA 2BC1A 4DGKA 2PTZA 2Q0LA 4IL2A 3NGCX 1E1MA 2PS2A 2YM1A 3B97A 2XVIA 3RGTA 1EBHA 3BJSA 1NHSA 2APGA 3DFHA 1S2YA 1KKRA 4E5TA 2IIDA 2DKIA 3VRAA 4CNJA 1IJHA 2Y6RA 4X9MA 4GIRA 3UTHA 3FMWA 1EL7A 1R0MA 1GTEA 1FO4A 1FIQB 1M6IA 3AYLA 4JHMA 3NH3X 3GSIA 1B37A 5IDZA 4DSGA 3V4BA 2WESA 1ZOVA 1V59A 2V3BA 2A8XA 1CJ3A 3NS1B 1KNRA 2Q7VA 2IVEA 4U8NA 3GDNA 2QJMA 3KA7A 2TPRA 1N63C 2E4GA 1WYGA 3BOXA 2JAEA 1H6VA 1JROA 4GDEA 1TDKA 1EBDA 4HCDA 3AEAA 3AEBA 1PDHA 1JU2A 3KKJA 2HZGA 3IK4A 4G9KA 2WEUA 2FYMA 5KMPA 2XLRA 3P93A 3NYFA 5KXJA 2YLSA 4XWRA 4H19A 3AE2A 4H50A 1RVKA 2W55A 2YLRA 3CYJA 1CJ4A 4H4UA 2ONEA 3Q9TA 2X8HA 1JRYA 3NVZB 3NKSA 3RO6A 2YG5A 3AN1A 1OJCA 2JB3A 3CNJA 4P9SA 3AYIA 1PBFA 3T2YA 1ZK7A 4DHGA 4K2XA 2OZ8A 3JSKA 3B9JB 3KUMA 4ICYA 2YLZA 2YQUA 3ENLA 5FS7A 4H1ZA 1GRGA 3GD6A 3AEDA 3GC2A 4A5LA 2POZA 2X3NA 2BXRA 4JQ9A 4BJZA 1N5XA 1H83A 2PP0A 3DA1A 2NPXA 2E3TA 1STZA 3HRDC 1GALA 2WS3A 3OZYA 4Y4NA 5J04A 3QJ4A 1GSNA 1TDEA 4IA5A 2PU0A 4E4UA 3AB1A 1KSUA 1N5WC 4YWSA 3IHGA 1DJQA 6ENLA 4TM4A 4ZCWA 3V3OA 1ELIA 2XVHA 3T2KA 3P9UA 1ZXIC 3EPTA 4NZHA 1GRHA 4H4TA 1JNRA 3P4PA 4B65A 1JRZA 3R07C 3MWCA 2WPFA 2EQ7A 3DERA 3C96A 3AE9A 1XHCA 1XPQA 2Y6QA 3NHOX 5KVHA 2QVHA 4OPTA 2PU1A 2C75A 4GAPA 1NG3A 3N4EA 3LJPA 4RG3A 3ALMA 2XSXA 3CMMA 3V5FA 3UKHA 4A6NA 3EKGA 1CC4A 3QSEA 5KWFA 2FKPA 5JCIA 1E7PA 1GV4A 4NNJA 3A7RA 3NO1A 2PPGA 4YWOA 2QA1A 2X8GA 1VQZA 3T8QA 3S47A 5JCKA 2RGJA 1JDFA 4GYPA 2Z5XA 4JNAA 3NVYB 4D03A 2CULA 1SJCA 4FK1A 4NEWA 2BK4A 3UCLA 5ENLA 2X99A 2QCUA 4HB9A 1RP0A 2Z5YA 1TDFA 2ZC8A 2GMHA 4OCGA 5DBJA 1H2IA 3UJ2A 3EAOA 1VDVA 3SSZA 3HYWA 3NN6X 2BS4A 2A89A 3R1ZA 1SJDA 3I6TA 3RP6A 3GMCA 4HN8A 4U2TA 1PS9A 3UCDA 1LJ1A 4FX9A 4IA6A 3SX6A 3ISHA 3D1CA 3FVDA 1OJDA 3ZVIA 3T31A 3H8AA 3NN0X 3MQTA 4IZGA 4IVOB 4JDRA 3DG7A 4XWZA 2C73A 3TTEA 4A6GA 4GRTA 1NAAA 3COXA 3NXLA 1ELSA 4REKA 1ZY8A 4E4FA 4IVMB 1Q9IA 3P4QA 1K0LA 1ZDLA 4NTEA 3UKPA 5J60A 1DJNA 3P4RA 4JN9A 1M64A 2PYXA 3QFBA 3N6HA 4AP1A 3V76A 3OTRA 4CRTA 3EUB3 3NYEA 2XH0A 4J2WA 3F8RA 5EOWA 2XFOA 3CNTA 1DOEA 3DMEA 5KMSA 1TDNA 2OPJA 2VQBA 5IPYA 1OEPA 3OP2A 2WDRA 3IC9A 4DN1A 1Q1RA 2ARDA 3Q45A 3PK7A 5HXIA 4H2QA 3EANA 3UJRA 2PMQA 4BV6A 2OZ3A 4U8MA 2QJNA 3NZGA 1BGJA 3RITA 4G8TA 3HW2A 2GGHA 4UDQA 1RSGA 3ES7A 2B76A 1VQWA 5HY5A 1Y56B 4G73A 3BI4A 3CPHG 3UOVA 1TYPA 3VR9A 3GY1A 1EC9A 1ZX9A 3JW7A 2FBWA 1PXBA 4DXKA 4GUVA 2YVGA 2BA9A 3D46A 3AXBA 2QQ6A 4GCMA 4K5RA 3TJ4A 4GGHA 2OKTA 3JVAA 3E1TA 1NHQA 3CK5A 2E5AA 1DNCA 1FL2A 2QJJA 2XVJA 4PAAA 1LQUA 3THUA 1LPFA 3R0KA 3QTPA 3ICRA 3GD4A 2AL1A 2W3SA 1E1NA 4M0XA 2BACA 5FJRA 3URHA 5EBKA 4OPCA 1X2HA 2GV8A 3SQPA 1GRFA 1H82A 4I58A 4D04A 1SB3B 4H2PA 5FS8A 4YTPA 3QKEA 4GGBA 4HNLA 4N9XA 2MNRA 4GF7A 2R4EA 4JY3A 4B66A 2AAQA 4CCQA 2I5QA 5KOWA 2XVEA 3CGBA 3VRDB 3BSMA 2BK5A 2QDDA 3CIRA 1NHRA 2FJBA 2JB1A 3M13A 4DNAA 3QFAA 2W3RA 3NTDA 1DXLA 5FS9A 1FECA 2H89A 2GVCA 1EC7A 3AD9B 4X2PA 1D5TA 3FV9A 2GAHB 1F3PA 1VDCA 2RGHA 4J36A 1KF6A 3ZVHA 1YY5A 3L8KA 1Y0PA 1COYA 4MMWA 3H70A 3ITJA 4U8KA 5M0ZA 2PTWA 3CGCA 3LZWA 3HYXA 3ADAB 3NVVB 3R11A 1E39A 5G5GB 3GWFA 4U2SA 1DTNA 2GL5A 2IVDA 3PS9A 3ZLHA 1NENA 1SJBA 3ZLFA 3CXOA 1S7MA 3MY9A 3AEEA 3P0WA 3S5SA 4WCTA 2WETA 7ENLA 1REOA 1FFUC 3DGZA 2TMDA 4TM3A 2OFJA 2EQ9A 3DG6A 3FYYA 4K1WA 2EQ8A 1E1KA 4H4WA 4K8GA 2FJAA 2GQFA 2GF3A 1KN0A 1X2GA 2OA1A 4OPUA 2OQYA 4RG4A 2E1MA 3T37A 3KVEA 4M52A 2RDXA 3QPEA 2JBVA 3STPA 1TYTA 4E6MA 4II2A 2W0HA 1EC8A 3ZVHB 3AE4A 2QDEA 2B9XA 1F6MA 1MXTA 3ZLGA 1FCDA 2CHRA 4BK1A 3Q4DA 3VCNA 3GRSA 3DG3A 1BF3A 3SFDA 1PDYA 2MUCA 3AE5A 1CBOA 2AL2A 5LV9A 3P1WA 3ALJA 2X50A 3PWIA 3K7MX 1VG9A 4I59A 2PP3A 2P3ZA 3SJNA 1VRQB 1ZOYA 5M10A 4EQSA 3UTGA 4B69A 3PVCA 3VC6A 1GTHA 3CNDA 3UGVA 4ZOHB 2AR8A 1BKHA 1CL0A 1D7LA 2XGZA 1Q1WA 4A65A 3EF6A 1TRBA 3M0OA 4FP1A 3K7QX 1O94A 4YSYA 2HXTA 1E1LA 4YTMA 2YR5A 2VRMA 1GNDA 3FXGA 1FEBA 2P88A 5J7XA 4Z44A 3UJFA 2B9WA 4NTDA 1IUVA 2PTYA 3CT2A 2H88A 4TLXA 4CCRA 3UCCA 1LQTA 4NTCA 4PABA 3B3RA 1CC6A 2C7GA 1JOAA 3FJ4A 4EQXA 1N4WA 1MOKA 3BHFA 3CNPA 3QN3A 4EIPA 2AL2B 3NT6A 3GRTA 2V60A 2Q0KA 2QAEA 3AE3A 2PHHA 2ZADA 3U9IA 1JCTA 3GDPA 3UJSA 3IJQA 1F8SA 2XLPA 4A79A 3DK4A 3H8LA 2PGEA 2C66A 3V5CA 4IP5A 3VFCA 3KU9A 2YG4A 4Z43A 1IUXA 2R45A 3RHAA 1JPDX 1S3BA 3EEZA 3SM8A 4C74A 3SY4A 5KNLA 2BC0A 3TW9A 4CY6A 3OZ2A 4A9WA 2P8BA 5JCNA 3DESA 3ABVA 2VOUA 1RM6B 4EWJA 2XFUA 2OX4A 3CN8A 1KSSA 2YLWA 5BRTA 1K0JA 2XH4A 1H81A 2W54A 2Q6UA 4C3YA 1NG4A 3JZUA 3BNUA 1NEKA 5U1OA 3I3LA 3UOZA 4O5UA 2V5ZA 3MZNA 3CPIG 2XYOA 4M6UA 5JCMA 3BI5A 2C70A 2GMJA 4Y4LA 3C4AA 1IUWA 3VQRA 4EMIA 4UDRA 3KPKA 4YSXA 1GRAA 3SXIA 3DGHA 4H4ZA 2R0CA 1H7XA 2BCGG 4Z24A 4GYPC 3GYIA 4O5QA 1O95A 3FG2P 1GREA 4GFIA 1KKOA 2B7RA 3O0HA 1PHHA 4U8JA 1X31B 4FK1C 3BI2A 2XFPA 3IJLA 3HPFA 2JKCA 3ALLA 2ACZA 3G5RA 5IQ1A 2PGWA 3OC4A 1IUUA 1V97A 1QO8A 4LIIA 3QSSA 4MKSA 3L1RA 5KMQA 4YXDA 2VVLA 3MSYA 4AP3A 4C5OA 4XXGA 2QGYA 3CGEA 3UOXA 3IJIA 3A7UA 3SQSA 2OQHA 3QVRA 1Y56A 2NQLA 5KMRA 1JNZA 3SR6B 4J56A 4RSLA 5EB5A 4Z1YA 3IHMA 3ATQA 1P2HA 4TVWA 2WDVA 2WP6A 1QLBA 4B1BA 1N61C 1KD0A 4G6HA 4USQA 3BNMA 3DGBA 1PBCA 4HNCA 4ECHA 3CNSA 3FBSA 3FIMB 2P0IA 2OG9A 4APNA 1IYXA 4YSHA 4H83A 4E8GA 4EIQA 4JN7A 4J33A 3UTEA 3RP8A 1N62C 3P3BA 4GMEA 2OLNA 3TOYA 3VDGA 4AT0A 1K0IA 4OVIA 3DK9A 1WUFA 4EQWA 1L0VA 2YR4A 4ENLA 3TCSA 3DK8A 4X4JA 3SBFA 4C77A 4OPLA 3UXKA 3UP4A 1YQ3A 3NFUA 5KRQA 2QA2A 3T14A 3PWGA 2RABA 3GYXA 1CJCA 3U4FA 3AEFA 4EMWA 4LU6A 5EU9A 3AEGA 3UOYA 2OZTA 2VRLA 3IWAA 4IT1A 1D4DA 5BOEA 2C72A 2GGEA 2GR3A 3VC5A 4ADWA 3DJDA 1GRBA 2GGJA 4HCHA 1PJ6A 5CQFA 2WHDA 1PXCA 3A7AA 3AYJA 2B7SA 2PSNA 2BS3A 2AKMA 4K2SA 5JCLA 4NWZA 1S3EA 2ZZCA 2ZBWA 4JY2A 2R9ZA 1BZLA 4Z2TA 3NYCA 5FJPA 2J3NA 3TWAA 4BJYA 3UP5A 4ROPA 3NK0X 3CAWA 1GRTA 2XDOA 1P48A 5FS6A 4X9NA 2BYBA 3NNEA 2DW7A 3S61A 3OZMA 3R9UA 4C3XA 4H4SA 3DJGX 2JK6A 2YLXA 2P8CA 3II4A 2WU2A 1CJ2A 3ICTA 3DFYA 4IV9A 2BS2A 1ZP0A 3LZXA 3H4KA 2OALA 4Z26A 1F8RA 4BK2A 4UP3A 3NTAA 1PJ7A 1TZZA 1H86A 5KOXA 3SZ0A 2XFQA 4Z2UA 3M12A 1HYUA 3H12A 3G5QA 1JPMA 2WOWA 3UKKA 1PN0A 1BWCA 2WPEA 1L9CA 4II3A 4B64A 4HCLA 1PXAA 1EL8A 2GQWA 2E5VA 2FJDA 1JRPA 1FEAA 4H2NA 4FDCB 2AQJA 3AD7B 1N4VA 2GB0A 1CF3A 1PBEA 1EBGA 2GRTA 4GDPA 3UJEA 1PJ5A 3NRZB 2GEWA 1LTXR 4JN8A 3CGDA 4H4QA 4B63A 4A99A 1F8WA 2YVFA 4CY8A 3N6JA 1W4XA 1D4CA 1N1PA 5TR3A 3AE7A 2YM2A 1KDGA 1QJDA 3G5SA 1WUEA 4F4RA 2BRYA 2VVLG 1T3QC 1BKWA 3UKFA 4KX6A 3R0UA 1GXFA 3F8DA 2GAGB 2GH5A 4BK3A 2CFYA 4TM0A 1B5QA 4U8OA 1NHPA 2WU5A 3AE8A 3UXLA 2X8CA 3RP7A 1O5WA 2XLTA 3CPJG 2R0PA 3ZDNA 1EL5A 3PO7A 4G74A 3V3NA 4J57A 4OPGA 5G5HB 1GERA 2DKHA 5ER0A 1PBDA 4B68A 2V61A 1ECQA 4YTNA 3GD3A 1BGNA 3F8PA 2HNEA 4YKFA 1MDLA 2F5ZA 1N60C 4H7UA 4ZCCA
chains in the Genus database with same CATH topology
3CNTA 3CN8A 3KLJA 1RYIA 1DOEA 1KSSA 1H84A 1OJ9A 2YLWA 3UKAA 4CBQA 5BRTA 3DMEA 1CHUA 5KMSA 1K0JA 1TDNA 1KNPA 4U8PA 2VQBA 3NLCA 1H81A 2XVFA 2OLOA 4YSZA 3VR8A 5IPYA 2Q6UA 4C3YA 2VZ2A 2BABA 4EM4A 3L5OA 1NG4A 1E6EA 2WDRA 1XANA 3IC9A 4H4RA 3K7TA 1L9EA 1Q1RA 2ARDA 4HA6A 2YVJA 1EL9A 3T0KA 4H4XA 3BNUA 4H4PA 4Y4MA 1NEKA 1ZKQA 5U1OA 3I3LA 2R4JA 3Q6JA 3UOZA 2C76A 5HXIA 4O5UA 3AWIA 2WBAA 3B6DA 2V5ZA 2JB2A 3CPIG 5L46A 3SFEA 4AOXA 1XDIA 2XYOA 3SZWA 2WQYA 3EANA 5JCMA 2XFNA 2C70A 2UZZA 3BHKA 3BI5A 3FPZA 4H2QA 2WDQA 2YR6A 4BV6A 3LADA 2GMJA 4Y4LA 3C4AA 3SYIA 5CKUA 1IUWA 3VQRA 4EMIA 4U8MA 2BC1A 4UDRA 1IUSA 3KPKA 4DGKA 2Q0LA 4YSXA 1GRAA 3SXIA 1BGJA 3DGHA 3NGCX 4H4ZA 1JRXA 4B67A 1E1MA 4CNKA 2R0CA 1H7XA 4UDQA 1RSGA 1IUTA 2BCGG 4Z24A 3GYIA 2YM1A 4O5QA 1O95A 2OAMA 2I0ZA 3FG2P 1GREA 2WP5A 2C3DA 2XVIA 2B76A 1VQWA 3LOVA 2EQ6A 1NHSA 2B7RA 3O0HA 1PHHA 1Y56B 1X31B 4G73A 4FK1C 4U8JA 2APGA 1S2YA 3BI4A 3CPHG 3UOVA 3BI2A 2XFPA 1TYPA 3VR9A 2JKCA 2YLTA 1ZX9A 2O9ZA 3ALLA 2FBWA 1PXBA 2IIDA 2ACZA 2DKIA 3VRAA 3G5RA 5IQ1A 4WX1A 1MO9A 3OC4A 1IJHA 2Y6RA 4GUVA 4X9MA 2YVGA 4CNJA 1IUUA 2BA9A 5HY5A 1QO8A 1GESA 5HHFA 3AXBA 4LIIA 3NIXA 3QSSA 3UTHA 4GCMA 3FMWA 1EL7A 3L1RA 4K5RA 1SEZA 1GTEA 2YG3A 1M6IA 5KMQA 3E1TA 3AYLA 3NH3X 4YXDA 1NHQA 3GSIA 5BULA 1B37A 2VVLA 4Z2RA 1DNCA 1FL2A 4AP3A 4C5OA 4DSGA 2XVJA 4XXGA 4PAAA 4AOSA 1LQUA 2WESA 3SZCA 1ZOVA 3CGEA 1LPFA 1V59A 3PG6A 3K30A 3AECA 3ICRA 2V3BA 3QVPA 3GD4A 2A8XA 1CJ3A 3UOXA 1KNRA 5U25A 4AT2A 1E1NA 2Q7VA 1NPXA 2BACA 3URHA 5KVIA 5EBKA 3C4NA 1B8SA 4OPCA 2IVEA 3QVRA 4U8NA 1Y56A 2GV8A 1OJAA 3GDNA 2BCPA 4K8DA 3KA7A 3SQPA 1LV0A 1GRFA 2TPRA 1H82A 4I58A 4D04A 1JNZA 5KMRA 2E4GA 4J56A 1PBBA 4RSLA 2JAEA 4G6GA 3KD9A 1YQZA 5EB5A 3AD8B 3NK2X 1H6VA 4GDEA 1GOSA 4H2PA 5FS8A 4YTPA 2C3CA 1AOGA 4K22A 3IHMA 1TDKA 3ATQA 1P2HA 2WDVA 1EBDA 3AEAA 3AEBA 1PDHA 2WP6A 4N9XA 4GF7A 2R4EA 1JU2A 4JY3A 3RNMA 1QLBA 4B66A 2AAQA 4CCQA 5KOWA 2XVEA 2C4CA 4B1BA 3KKJA 2ZZBA 3VRBA 2ZZ0A 3CGBA 4G9KA 2WEUA 3VRDB 4G6HA 4USQA 3BNMA 1PBCA 2BK5A 4ECHA 3CNSA 3CIRA 3FBSA 5KMPA 5FMHA 1NHRA 3FIMB 4APNA 2FJBA 2XLRA 2JB1A 3M13A 4DNAA 3NYFA 5KXJA 4H7UA 4YSHA 2YLSA 3QFAA 1GEUA 4XWRA 4EIQA 4J33A 3NTDA 3S5WA 3UTEA 4P9SA 3AE2A 4H50A 2YLRA 1LVLA 3RP8A 1CJ4A 1DXLA 3D9XA 5FS9A 1FECA 4H4UA 2A87A 2H89A 2GVCA 1ONFA 2OLNA 3NK1X 3Q9TA 2VVMA 2R0GA 2XLUA 2GR2A 2X8HA 4AT0A 1JRYA 3NKSA 1TDOA 3DJEA 2YG5A 1K0IA 3AD9B 4OVIA 2GR0A 1D5TA 1OJCA 1GT8A 2JB3A 3CNJA 3DK9A 2GAHB 3AYIA 3NRNA 1F3PA 4EQWA 1VDCA 1PBFA 2RGHA 4KPRA 1KF6A 2XLSA 4H2RA 4J36A 1YY5A 1ZK7A 1ZMDA 3L8KA 2YR4A 1Y0PA 4K2XA 1COYA 2GR1A 3JSKA 1DOCA 3DK8A 4X4JA 4ICYA 4C77A 3ITJA 2YLZA 4U8KA 5M0ZA 2YQUA 4OPLA 2FJEA 1KFYA 3CGCA 3UP4A 3LZWA 3HYXA 4TLZA 1YQ3A 3ADAB 5FS7A 5KRQA 1GRGA 4DSHA 1E39A 3AEDA 3ICSA 2QA2A 2B9YA 2V6OA 4A5LA 3GWFA 4U2SA 2X3NA 3T14A 2RABA 2BXRA 4JQ9A 3GYXA 1CJCA 4BJZA 3AEFA 5EB4A 4EMWA 2IVDA 4K7ZA 4LU6A 3PS9A 1L9DA 1NENA 3AEGA 3IF9A 3UOYA 3T2ZA 2VRLA 3IWAA 1S7MA 1D4DA 1H83A 4LA1A 4ZN0A 3AEEA 2C72A 3T2YA 3DA1A 2NPXA 5GSNA 4U8LA 4WCTA 2GR3A 3I6DA 4A79A 4ADWA 3DJDA 1GALA 1Z6LA 2WETA 1GRBA 2WS3A 1REOA 1PJ6A 4Y4NA 3DGZA 5CQFA 4OPDA 2TMDA 2WHDA 1S2QA 3QJ4A 1PXCA 4TM3A 4A6NB 1GSNA 1VG0A 3AYJA 4YKGA 5C3JA 1TDEA 2B7SA 5C2TA 2EQ9A 2EQ8A 1E1KA 3AB1A 4IA5A 2BS3A 4H4WA 1KSUA 2FJAA 2GQFA 3IHGA 5JCLA 2CVJA 1DJQA 2GF3A 4NWZA 1KN0A 2ZZCA 1S3EA 2OA1A 4TM4A 3V3OA 4OPUA 2ZBWA 3QSMA 3DH9A 4JY2A 2R9ZA 1ELIA 2E1MA 2XVHA 4RG4A 1BZLA 3GYJA 3T37A 4Z2TA 3NYCA 3T2KA 3P9UA 3KVEA 2J3NA 4M52A 4BJYA 3EPTA 3UP5A 2WP9A 4NZHA 3NK0X 2JBVA 3DJJA 1GRHA 4H4TA 2C65A 1DOBA 1JNRA 1TYTA 2BRAA 3P4PA 1GRTA 4II2A 1P2EA 2W0HA 4B65A 1JRZA 2XDOA 3AE4A 5FS6A 4X9NA 2WOIA 2WPFA 2B9XA 4UDPA 2EQ7A 3C96A 3AE9A 3H8IA 2BYBA 3NNEA 4ZCDA 1XHCA 3S61A 1F6MA 1MXTA 2XCGA 1XPQA 2Y6QA 3NHOX 5KVHA 4TM1A 4OPTA 3R9UA 2C75A 5U63A 1FCDA 4GAPA 1NG3A 4C3XA 4H4SA 3DJGX 3LJPA 4EQRA 4U8IA 4RG3A 3ALMA 2JK6A 2YLXA 3CMMA 3UKHA 3II4A 2WU2A 4A6NA 4BK1A 3GRSA 1CC4A 3QSEA 4MJWA 1BF3A 1FOHA 5KWFA 3UTFA 3SFDA 5JCIA 3AE5A 4Z25A 4GR1A 1CJ2A 1E7PA 1GV4A 3P4SA 1NDAA 3ICTA 3ZYXA 1CBOA 4IV9A 4NNJA 2BS2A 1DODA 1ZP0A 3P1WA 3ALJA 5LV9A 3LZXA 1K4QA 2YG6A 4YWOA 3H4KA 5GRTA 2QA1A 3HZLA 1L0VA 2X50A 1B4VA 1VG9A 3K7MX 2WOVA 1CC2A 4I59A 2OALA 4Z26A 2X8GA 1VRQB 1F8RA 1ZOYA 5M10A 4A7AA 4EQSA 3UTGA 4E0VA 4B69A 4BK2A 4UP3A 3NTAA 3PVCA 5JCKA 2RGJA 1PJ7A 3HYVA 5BUKA 1H86A 2Z5XA 1GTHA 4OPIA 5KOXA 3SZ0A 2XFQA 4JNAA 2YG7A 4Z2UA 4D03A 3CNDA 4NEVA 4ZCCA 2CULA 3M12A 2HQMA 4FK1A 4NEWA 2BK4A 1HYUA 2R46A 2AR8A 4K5SA 3G5QA 1CL0A 3UKQA 1JEHA 1D7LA 3UCLA 2WOWA 3UKKA 2X99A 2QCUA 1D7YA 1PN0A 1BWCA 1Q1WA 2WPEA 3KPFA 4A65A 3AE1A 1L9CA 3EF6A 1TRBA 4II3A 4B64A 1PXAA 1EL8A 1RP0A 2GQWA 3M0OA 4HB9A 2E5VA 3K7QX 1O94A 4YSYA 2FJDA 2Z5YA 1E1LA 1TDFA 2GMHA 4OCGA 4YTMA 2YR5A 5DBJA 1FEAA 1H2IA 4H4YA 2C64A 4H2NA 4FDCB 2AQJA 1N4VA 1GNDA 2GB0A 2VRMA 3AD7B 1CF3A 1OJTA 1PBEA 1FEBA 5J7XA 3EAOA 4Z44A 2GRTA 2B9WA 4NTDA 1IUVA 4TLXA 2H88A 4GDPA 3HYWA 4J31A 5BVAA 1PJ5A 2GEWA 4CCRA 3NN6X 2BS4A 2A89A 3GMBA 1LTXR 1LQTA 4NTCA 3CGDA 4H4QA 3GWDA 4PABA 4B63A 3AE6A 3RP6A 4JNQA 3B3RA 1CC6A 3GMCA 2VQ7A 2C7GA 1JOAA 1GPEA 4A99A 4EQXA 1F8WA 1N4WA 4U2TA 1MOKA 2NVKX 2YVFA 3LXDA 4EM3A 4CY8A 1W4XA 3BHFA 1N4UA 1D4CA 1N1PA 1PS9A 3CNPA 1LJ1A 5TR3A 4FX9A 4EIPA 5IQ4A 4IA6A 3AE7A 2YM2A 1KDGA 3REDA 1QJDA 3G5SA 3SX6A 3LB8A 3ISHA 3NT6A 3NG7X 5JRBA 3GRTA 2BRYA 2V60A 3D1CA 2BK3A 2Q0KA 2VVLG 2YWLA 1OJDA 2QAEA 3AE3A 3T31A 1BKWA 2PHHA 3UKFA 3GDPA 4KX6A 2WPCA 3NN0X 1YQ4A 1GXFA 2V3AA 1F8SA 2XLPA 3F8DA 3DK4A 4JDRA 2GAGB 2GH5A 3H8LA 1H7WA 4IVOB 3SZFA 4BK3A 2C66A 2CFYA 4TM0A 4USRA 1B5QA 3KU9A 1D4EA 2YG4A 4J34A 4U8OA 4GAVA 4YT0A 1NHPA 2WU5A 3AE8A 2C73A 4XWZA 4Z43A 1IUXA 5HYMA 4GRTA 2X8CA 1GETA 1NAAA 2R45A 3COXA 3RHAA 3RP7A 1O5WA 2XLTA 3UKLA 2RGOA 4REKA 1ZY8A 3CPJG 1S3BA 2R0PA 4EMJA 3D8XA 3SM8A 3ZDNA 4C74A 1EL5A 3PO7A 4IVMB 1Q9IA 4G74A 3V3NA 4J57A 3P4QA 1K0LA 1ZDLA 4NTEA 3ATRA 4OPGA 3UKPA 1GERA 2DKHA 2BXSA 3SY4A 5J60A 2BC0A 5ER0A 5KNLA 1DJNA 1PBDA 2C67A 3P4RA 2V61A 4B68A 2CDUA 4JN9A 3OZ2A 4CY6A 1M64A 2PYXA 4A9WA 1ZMCA 3QFBA 5JCNA 4AP1A 4U2LA 4H4VA 4BURA 3V76A 4YTNA 3SGLA 3ABVA 3GD3A 4CRTA 1BGNA 3NYEA 3F8PA 3WE0A 2VOUA 1YKJA 2YAUA 4YKFA 4J2WA 2F5ZA 3F8RA 2XFUA 1UKVG 3CTYA 5EOWA 2XFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CNT A;  3CN8 A;  3KLJ A;  1RYI A;  1DOE A;  1KSS A;  1H84 A;  1OJ9 A;  2YLW A;  3UKA A;  4CBQ A;  5BRT A;  3DME A;  1CHU A;  1K0J A;  1TDN A;  1KNP A;  4U8P A;  2VQB A;  3NLC A;  1H81 A;  2XVF A;  2OLO A;  4YSZ A;  3VR8 A;  5IPY A;  2Q6U A;  4C3Y A;  2VZ2 A;  2BAB A;  4EM4 A;  2WDR A;  1NG4 A;  1E6E A;  1XAN A;  3IC9 A;  4H4R A;  3K7T A;  1L9E A;  1Q1R A;  2ARD A;  4HA6 A;  2YVJ A;  1EL9 A;  4H4X A;  3BNU A;  4H4P A;  4Y4M A;  1NEK A;  1ZKQ A;  5U1O A;  3I3L A;  2R4J A;  3Q6J A;  3UOZ A;  2C76 A;  5HXI A;  4O5U A;  3AWI A;  2WBA A;  3B6D A;  2V5Z A;  2JB2 A;  3CPI G;  5L46 A;  3SFE A;  4AOX A;  1XDI A;  2XYO A;  2WQY A;  3EAN A;  5JCM A;  2XFN A;  2C70 A;  2UZZ A;  3BHK A;  3BI5 A;  3FPZ A;  4H2Q A;  2WDQ A;  2YR6 A;  4BV6 A;  3LAD A;  2GMJ A;  4Y4L A;  3C4A A;  5CKU A;  1IUW A;  3VQR A;  4EMI A;  4U8M A;  2BC1 A;  4UDR A;  1IUS A;  4DGK A;  2Q0L A;  4YSX A;  1GRA A;  1BGJ A;  3DGH A;  3NGC X;  4H4Z A;  1JRX A;  4B67 A;  1E1M A;  4CNK A;  2R0C A;  1H7X A;  4UDQ A;  1RSG A;  1IUT A;  2BCG G;  4Z24 A;  3GYI A;  2YM1 A;  4O5Q A;  1O95 A;  2OAM A;  2I0Z A;  3FG2 P;  1GRE A;  2WP5 A;  2C3D A;  2XVI A;  2B76 A;  1VQW A;  3LOV A;  2EQ6 A;  1NHS A;  2B7R A;  3O0H A;  1PHH A;  1Y56 B;  1X31 B;  4U8J A;  4FK1 C;  2APG A;  1S2Y A;  3BI4 A;  3CPH G;  3UOV A;  3BI2 A;  2XFP A;  1TYP A;  3VR9 A;  2JKC A;  2YLT A;  1ZX9 A;  2O9Z A;  3ALL A;  2FBW A;  1PXB A;  2IID A;  2ACZ A;  2DKI A;  3VRA A;  3G5R A;  5IQ1 A;  4WX1 A;  1MO9 A;  3OC4 A;  1IJH A;  2Y6R A;  4GUV A;  4X9M A;  2YVG A;  4CNJ A;  1IUU A;  2BA9 A;  5HY5 A;  1QO8 A;  1GES A;  5HHF A;  3AXB A;  4LII A;  3NIX A;  3QSS A;  3UTH A;  4GCM A;  3FMW A;  1EL7 A;  3L1R A;  4K5R A;  1SEZ A;  1GTE A;  2YG3 A;  1M6I A;  3E1T A;  3AYL A;  3NH3 X;  4YXD A;  1NHQ A;  3GSI A;  5BUL A;  1B37 A;  2VVL A;  4Z2R A;  1DNC A;  1FL2 A;  4AP3 A;  4C5O A;  4DSG A;  2XVJ A;  4XXG A;  4PAA A;  4AOS A;  1LQU A;  2WES A;  1ZOV A;  3CGE A;  1LPF A;  1V59 A;  3K30 A;  3AEC A;  3ICR A;  2V3B A;  3QVP A;  3GD4 A;  2A8X A;  1CJ3 A;  3UOX A;  1KNR A;  5U25 A;  4AT2 A;  1E1N A;  2Q7V A;  1NPX A;  2BAC A;  3URH A;  5KVI A;  5EBK A;  3C4N A;  1B8S A;  4OPC A;  2IVE A;  3QVR A;  4U8N A;  1Y56 A;  2GV8 A;  1OJA A;  3GDN A;  2BCP A;  4K8D A;  3KA7 A;  3SQP A;  1LV0 A;  1GRF A;  2TPR A;  1H82 A;  4I58 A;  4D04 A;  1JNZ A;  2E4G A;  4J56 A;  1PBB A;  4RSL A;  2JAE A;  3KD9 A;  1YQZ A;  5EB5 A;  3AD8 B;  3NK2 X;  1H6V A;  4GDE A;  1GOS A;  4H2P A;  5FS8 A;  4YTP A;  2C3C A;  1AOG A;  4K22 A;  3IHM A;  1TDK A;  3ATQ A;  1P2H A;  2WDV A;  1EBD A;  3AEA A;  3AEB A;  1PDH A;  2WP6 A;  4N9X A;  4GF7 A;  2R4E A;  1JU2 A;  4JY3 A;  3RNM A;  1QLB A;  4B66 A;  2AAQ A;  4CCQ A;  5KOW A;  2XVE A;  4B1B A;  3KKJ A;  2ZZB A;  3VRB A;  2ZZ0 A;  3CGB A;  2WEU A;  3VRD B;  4USQ A;  3BNM A;  1PBC A;  2BK5 A;  4ECH A;  3CNS A;  3CIR A;  3FBS A;  5FMH A;  1NHR A;  3FIM B;  4APN A;  2FJB A;  2XLR A;  2JB1 A;  3M13 A;  4DNA A;  3NYF A;  5KXJ A;  4H7U A;  4YSH A;  2YLS A;  3QFA A;  1GEU A;  4XWR A;  4EIQ A;  4J33 A;  3NTD A;  3S5W A;  3UTE A;  4P9S A;  3AE2 A;  4H50 A;  2YLR A;  1LVL A;  3RP8 A;  1CJ4 A;  1DXL A;  5FS9 A;  2A87 A;  1FEC A;  4H4U A;  2H89 A;  2GVC A;  1ONF A;  2OLN A;  3NK1 X;  3Q9T A;  2VVM A;  2R0G A;  2XLU A;  2GR2 A;  2X8H A;  4AT0 A;  1JRY A;  3NKS A;  1TDO A;  3DJE A;  2YG5 A;  1K0I A;  3AD9 B;  4OVI A;  2GR0 A;  1D5T A;  1OJC A;  1GT8 A;  2JB3 A;  3CNJ A;  3DK9 A;  2GAH B;  3AYI A;  3NRN A;  1F3P A;  4EQW A;  1VDC A;  1PBF A;  2RGH A;  4KPR A;  1KF6 A;  2XLS A;  4H2R A;  4J36 A;  1YY5 A;  1ZK7 A;  1ZMD A;  3L8K A;  2YR4 A;  1Y0P A;  4K2X A;  1COY A;  2GR1 A;  3JSK A;  1DOC A;  3DK8 A;  4X4J A;  4ICY A;  4C77 A;  3ITJ A;  2YLZ A;  4U8K A;  5M0Z A;  2YQU A;  4OPL A;  2FJE A;  1KFY A;  3CGC A;  3UP4 A;  3LZW A;  4TLZ A;  1YQ3 A;  3ADA B;  5FS7 A;  5KRQ A;  1GRG A;  4DSH A;  1E39 A;  3AED A;  3ICS A;  2QA2 A;  2B9Y A;  2V6O A;  4A5L A;  3GWF A;  4U2S A;  2X3N A;  2RAB A;  2BXR A;  4JQ9 A;  1CJC A;  4BJZ A;  3AEF A;  5EB4 A;  4EMW A;  2IVD A;  4K7Z A;  4LU6 A;  3PS9 A;  1L9D A;  1NEN A;  3AEG A;  3IF9 A;  3UOY A;  2VRL A;  3IWA A;  1D4D A;  1H83 A;  4LA1 A;  4ZN0 A;  3AEE A;  2C72 A;  3DA1 A;  2NPX A;  5GSN A;  4U8L A;  4WCT A;  2GR3 A;  3I6D A;  4A79 A;  4ADW A;  3DJD A;  1GAL A;  1Z6L A;  2WET A;  1GRB A;  2WS3 A;  1REO A;  1PJ6 A;  4Y4N A;  3DGZ A;  5CQF A;  4OPD A;  2TMD A;  2WHD A;  1S2Q A;  3QJ4 A;  1PXC A;  4TM3 A;  4A6N B;  1GSN A;  1VG0 A;  3AYJ A;  4YKG A;  5C3J A;  1TDE A;  2B7S A;  5C2T A;  2EQ9 A;  2EQ8 A;  1E1K A;  3AB1 A;  4IA5 A;  2BS3 A;  4H4W A;  1KSU A;  2FJA A;  2GQF A;  3IHG A;  5JCL A;  2CVJ A;  1DJQ A;  2GF3 A;  4TM4 A;  1S3E A;  2ZZC A;  2OA1 A;  3V3O A;  4OPU A;  2ZBW A;  3QSM A;  3DH9 A;  4JY2 A;  2R9Z A;  1ELI A;  2E1M A;  2XVH A;  4RG4 A;  1BZL A;  3GYJ A;  3T37 A;  4Z2T A;  3NYC A;  3P9U A;  3KVE A;  2J3N A;  4M52 A;  4BJY A;  3EPT A;  3UP5 A;  2WP9 A;  4NZH A;  3NK0 X;  2JBV A;  3DJJ A;  1GRH A;  4H4T A;  2C65 A;  1DOB A;  1JNR A;  1TYT A;  3P4P A;  1GRT A;  1P2E A;  2W0H A;  4B65 A;  1JRZ A;  2XDO A;  3AE4 A;  5FS6 A;  4X9N A;  2WOI A;  2WPF A;  2B9X A;  4UDP A;  2EQ7 A;  3C96 A;  3AE9 A;  3H8I A;  2BYB A;  3NNE A;  4ZCD A;  1XHC A;  3S61 A;  1F6M A;  1MXT A;  2XCG A;  1XPQ A;  2Y6Q A;  3NHO X;  5KVH A;  4TM1 A;  4OPT A;  3R9U A;  2C75 A;  5U63 A;  1FCD A;  1NG3 A;  4C3X A;  4H4S A;  3DJG X;  3LJP A;  4EQR A;  4U8I A;  4RG3 A;  3ALM A;  2JK6 A;  2YLX A;  3UKH A;  3II4 A;  2WU2 A;  4A6N A;  4BK1 A;  3GRS A;  1CC4 A;  3QSE A;  4MJW A;  1BF3 A;  1FOH A;  5KWF A;  3UTF A;  3SFD A;  5JCI A;  3AE5 A;  4Z25 A;  4GR1 A;  1CJ2 A;  1E7P A;  1GV4 A;  3P4S A;  1NDA A;  3ICT A;  3ZYX A;  1CBO A;  4IV9 A;  5LV9 A;  2BS2 A;  1DOD A;  1ZP0 A;  3P1W A;  3ALJ A;  3LZX A;  1K4Q A;  2YG6 A;  4YWO A;  3H4K A;  5GRT A;  2QA1 A;  3HZL A;  1L0V A;  2X50 A;  1B4V A;  1VG9 A;  3K7M X;  2WOV A;  1CC2 A;  4I59 A;  2OAL A;  4Z26 A;  2X8G A;  1VRQ B;  1F8R A;  1ZOY A;  5M10 A;  4A7A A;  4EQS A;  3UTG A;  4E0V A;  4B69 A;  4BK2 A;  4UP3 A;  3NTA A;  3PVC A;  5JCK A;  2RGJ A;  1PJ7 A;  5BUK A;  1H86 A;  2Z5X A;  1GTH A;  4OPI A;  5KOX A;  2XFQ A;  4JNA A;  2YG7 A;  4Z2U A;  4D03 A;  3CND A;  4NEV A;  4ZCC A;  2CUL A;  3M12 A;  2HQM A;  4FK1 A;  4NEW A;  2BK4 A;  1HYU A;  2R46 A;  2AR8 A;  4K5S A;  3G5Q A;  1CL0 A;  3UKQ A;  1JEH A;  1D7L A;  3UCL A;  2WOW A;  3UKK A;  2X99 A;  2QCU A;  1D7Y A;  1PN0 A;  1BWC A;  1Q1W A;  2WPE A;  3KPF A;  4A65 A;  3AE1 A;  1L9C A;  3EF6 A;  1TRB A;  4B64 A;  1PXA A;  1EL8 A;  1RP0 A;  2GQW A;  3M0O A;  4HB9 A;  2E5V A;  3K7Q X;  1O94 A;  4YSY A;  2FJD A;  2Z5Y A;  1E1L A;  1TDF A;  2GMH A;  4OCG A;  4YTM A;  2YR5 A;  5DBJ A;  1FEA A;  4H4Y A;  2C64 A;  4H2N A;  4FDC B;  2AQJ A;  1N4V A;  1GND A;  2GB0 A;  2VRM A;  3AD7 B;  1CF3 A;  1OJT A;  1PBE A;  1FEB A;  5J7X A;  3EAO A;  4Z44 A;  2GRT A;  2B9W A;  4NTD A;  1IUV A;  4TLX A;  2H88 A;  4GDP A;  4J31 A;  5BVA A;  1PJ5 A;  2GEW A;  4CCR A;  3NN6 X;  2BS4 A;  2A89 A;  3GMB A;  1LTX R;  1LQT A;  4NTC A;  3CGD A;  4H4Q A;  3GWD A;  4PAB A;  4B63 A;  3AE6 A;  3RP6 A;  4JNQ A;  3B3R A;  1CC6 A;  3GMC A;  2VQ7 A;  2C7G A;  1JOA A;  1GPE A;  4A99 A;  4EQX A;  1F8W A;  1N4W A;  4U2T A;  1MOK A;  2NVK X;  2YVF A;  3LXD A;  4EM3 A;  4CY8 A;  1W4X A;  3BHF A;  1N4U A;  1D4C A;  1N1P A;  1PS9 A;  3CNP A;  1LJ1 A;  5TR3 A;  4FX9 A;  4EIP A;  5IQ4 A;  4IA6 A;  3AE7 A;  2YM2 A;  1KDG A;  3RED A;  1QJD A;  3G5S A;  3LB8 A;  3ISH A;  3NT6 A;  3NG7 X;  3GRT A;  2V60 A;  3D1C A;  2BK3 A;  2Q0K A;  2VVL G;  2YWL A;  1OJD A;  2QAE A;  3AE3 A;  1BKW A;  2PHH A;  3UKF A;  3GDP A;  4KX6 A;  2WPC A;  3NN0 X;  1YQ4 A;  1GXF A;  2V3A A;  1F8S A;  2XLP A;  3F8D A;  3DK4 A;  4JDR A;  2GAG B;  2GH5 A;  3H8L A;  1H7W A;  4IVO B;  4BK3 A;  2C66 A;  2CFY A;  4TM0 A;  4USR A;  1B5Q A;  3KU9 A;  1D4E A;  2YG4 A;  4J34 A;  4U8O A;  4YT0 A;  1NHP A;  2WU5 A;  3AE8 A;  2C73 A;  4XWZ A;  4Z43 A;  1IUX A;  5HYM A;  4GRT A;  2X8C A;  1GET A;  1NAA A;  2R45 A;  3COX A;  3RHA A;  3RP7 A;  1O5W A;  2XLT A;  3UKL A;  2RGO A;  4REK A;  1ZY8 A;  3CPJ G;  1S3B A;  2R0P A;  4EMJ A;  3D8X A;  3SM8 A;  3ZDN A;  4C74 A;  1EL5 A;  3PO7 A;  4IVM B;  1Q9I A;  3V3N A;  4J57 A;  3P4Q A;  1K0L A;  1ZDL A;  4NTE A;  3ATR A;  4OPG A;  3UKP A;  1GER A;  2DKH A;  2BXS A;  5J60 A;  2BC0 A;  5ER0 A;  1DJN A;  1PBD A;  2C67 A;  3P4R A;  2V61 A;  4B68 A;  2CDU A;  4JN9 A;  3OZ2 A;  4CY6 A;  1M64 A;  2PYX A;  4A9W A;  1ZMC A;  3QFB A;  5JCN A;  4AP1 A;  4U2L A;  4H4V A;  4BUR A;  3V76 A;  4YTN A;  3SGL A;  3ABV A;  3GD3 A;  4CRT A;  1BGN A;  3NYE A;  3F8P A;  3WE0 A;  2VOU A;  1YKJ A;  2YAU A;  4YKF A;  4J2W A;  2F5Z A;  3F8R A;  2XFU A;  1UKV G;  3CTY A;  5EOW A;  2XFO A; 
#chains in the Genus database with same CATH topology
 3KLJ A;  1RYI A;  4CBQ A;  1OJ9 A;  3UKA A;  1CHU A;  2XVF A;  3VR8 A;  2BAB A;  3L5O A;  1MUC A;  1E6E A;  1XAN A;  3K7T A;  1L9E A;  4HA6 A;  2YVJ A;  1EL9 A;  3T0K A;  4H4P A;  4Y4M A;  3AWI A;  2WBA A;  3B6D A;  2JB2 A;  5L46 A;  3SFE A;  3SZW A;  3FPZ A;  3SYI A;  1IUS A;  2DW6 A;  1JRX A;  4B67 A;  4CNK A;  1IUT A;  2OAM A;  2I0Z A;  2WP5 A;  2C3D A;  3LOV A;  2EQ6 A;  3MKC A;  4HYR A;  2YLT A;  2O9Z A;  3CB3 A;  1KCZ A;  4WX1 A;  1MO9 A;  3AMZ A;  3VCC A;  1SJA A;  3H7V A;  1GES A;  5HHF A;  3NIX A;  1SEZ A;  2YG3 A;  5BUL A;  2OO6 A;  4Z2R A;  1MRA A;  4AOS A;  3SZC A;  3V3W A;  3PG6 A;  3K30 A;  2HXU A;  2XH7 A;  3AEC A;  3QVP A;  3SN4 A;  1YEY A;  1MNS A;  3MUC A;  5U25 A;  4AT2 A;  1NPX A;  5KVI A;  3T9P A;  3C4N A;  1B8S A;  1XS2 A;  1OJA A;  2BCP A;  4K8D A;  1LV0 A;  1ONE A;  2POD A;  1PBB A;  4G6G A;  3KD9 A;  1YQZ A;  2XH2 A;  3AD8 B;  3NK2 X;  1GOS A;  2C3C A;  1AOG A;  4K22 A;  1PDZ A;  1L8P A;  3RNM A;  4KWS A;  3OPS A;  2C4C A;  2ZZB A;  4A35 A;  3VRB A;  2ZZ0 A;  3TWB A;  3NVW B;  5FMH A;  3DDM A;  4TVY A;  1FHV A;  1GEU A;  3S5W A;  1LVL A;  3D9X A;  2A87 A;  1ONF A;  3NK1 X;  1R6W A;  2VVM A;  2R0G A;  2XLU A;  2GR2 A;  1TDO A;  3DJE A;  2GR0 A;  3TJI A;  1GT8 A;  4ZA0 A;  3NRN A;  4H2R A;  4KPR A;  3I6E A;  2XLS A;  5BUK A;  1ZMD A;  2GR1 A;  1DOC A;  1P43 A;  2FJE A;  1KFY A;  3DEQ A;  4TLZ A;  4IP4 A;  4DYE A;  4Z17 A;  3ES8 A;  4DSH A;  3ICS A;  2B9Y A;  3N4F A;  2V6O A;  5EB4 A;  4K7Z A;  1L9D A;  3IF9 A;  4GIS A;  4FI4 A;  3T2Z A;  1F9C A;  4LA1 A;  4ZN0 A;  5GSN A;  1NEL A;  4U8L A;  3I6D A;  1Z6L A;  4OPD A;  1S2Q A;  4A6N B;  1VG0 A;  5C3J A;  4YKG A;  1XPY A;  2PP1 A;  3SN0 A;  5C2T A;  4DWD A;  2CVJ A;  3TQP A;  3QSM A;  3DH9 A;  3GYJ A;  5FJT A;  3OW1 A;  3RR1 A;  2WP9 A;  1BQG A;  4H2H A;  3DJJ A;  2OLA A;  2C65 A;  1DOB A;  4IHC A;  2BRA A;  1P2E A;  3FCP A;  3DIP A;  2WOI A;  4UDP A;  3H8I A;  4ZCD A;  2XCG A;  1MDR A;  4TM1 A;  5U63 A;  4EQR A;  4U8I A;  2GDQ A;  4MJW A;  1FOH A;  3UTF A;  4Z25 A;  4GR1 A;  3P4S A;  1NDA A;  3PFR A;  3ZYX A;  1DOD A;  3T6C A;  1K4Q A;  2YG6 A;  5GRT A;  3HZL A;  5BOF A;  4A3R A;  1B4V A;  2WOV A;  1CC2 A;  2O56 A;  2GGI A;  4A7A A;  4E0V A;  1FFV C;  3HYV A;  3I4K A;  4OPI A;  1E9I A;  2YG7 A;  4NEV A;  2HQM A;  2R46 A;  4K5S A;  1TKK A;  3QLD A;  3UKQ A;  2AKZ A;  1JEH A;  1D7Y A;  3KPF A;  3AE1 A;  4HPN A;  4H4Y A;  2C64 A;  1OJT A;  4G7F A;  5FJO A;  3R10 A;  3D47 A;  5BVA A;  4J31 A;  3CXB A;  3GMB A;  3GWD A;  3AE6 A;  4JNQ A;  2VQ7 A;  1GPE A;  3AM9 A;  3LXD A;  2NVK X;  4EM3 A;  1N4U A;  5IQ4 A;  4MGG A;  3RED A;  3LB8 A;  4KT2 A;  2PCE A;  3NG7 X;  5JRB A;  2GSH A;  2BK3 A;  2YWL A;  3GO2 A;  2WPC A;  4KPL A;  1YQ4 A;  2V3A A;  2PTX A;  1H7W A;  3SZF A;  4USR A;  1TE6 A;  5FJU A;  1D4E A;  4J34 A;  4GAV A;  4YT0 A;  1NU5 A;  5HYM A;  2OVL A;  3RRA A;  1GET A;  4DX3 A;  2PA6 A;  3SN1 A;  3UKL A;  2RGO A;  3VA8 A;  3D8X A;  3T4W A;  4EMJ A;  3ATR A;  2BXS A;  3RCY A;  2C67 A;  2CDU A;  1ZMC A;  4KEM A;  4U2L A;  4H4V A;  4BUR A;  3SGL A;  3WE0 A;  1YKJ A;  2YAU A;  2GGG A;  4IL0 A;  1UKV G;  3CTY A;  3R25 A;  1H84 A;  1KNP A;  4U8P A;  3NLC A;  4YSZ A;  2OLO A;  2VZ2 A;  4EM4 A;  4J3Z A;  4H4R A;  4H4X A;  1ZKQ A;  2R4J A;  3Q6J A;  2C76 A;  3ETR B;  4AOX A;  1XDI A;  2WQY A;  2XFN A;  3BHK A;  2UZZ A;  2WDQ A;  2YR6 A;  1W6T A;  3K1G A;  3LAD A;  4J1O A;  1FHU A;  5CKU A;  2BC1 A;  4DGK A;  2PTZ A;  2Q0L A;  4IL2 A;  3NGC X;  1E1M A;  2PS2 A;  2YM1 A;  3B97 A;  2XVI A;  3RGT A;  1EBH A;  3BJS A;  1NHS A;  2APG A;  3DFH A;  1S2Y A;  1KKR A;  4E5T A;  2IID A;  2DKI A;  3VRA A;  4CNJ A;  1IJH A;  2Y6R A;  4X9M A;  4GIR A;  3UTH A;  3FMW A;  1EL7 A;  1R0M A;  1GTE A;  1FO4 A;  1FIQ B;  1M6I A;  3AYL A;  4JHM A;  3NH3 X;  3GSI A;  1B37 A;  5IDZ A;  4DSG A;  3V4B A;  2WES A;  1ZOV A;  1V59 A;  2V3B A;  2A8X A;  1CJ3 A;  3NS1 B;  1KNR A;  2Q7V A;  2IVE A;  4U8N A;  3GDN A;  2QJM A;  3KA7 A;  2TPR A;  1N63 C;  2E4G A;  1WYG A;  3BOX A;  2JAE A;  1H6V A;  1JRO A;  4GDE A;  1TDK A;  1EBD A;  4HCD A;  3AEA A;  3AEB A;  1PDH A;  1JU2 A;  3KKJ A;  2HZG A;  3IK4 A;  4G9K A;  2WEU A;  2FYM A;  5KMP A;  2XLR A;  3P93 A;  3NYF A;  5KXJ A;  2YLS A;  4XWR A;  4H19 A;  3AE2 A;  4H50 A;  1RVK A;  2W55 A;  2YLR A;  3CYJ A;  1CJ4 A;  4H4U A;  2ONE A;  3Q9T A;  2X8H A;  1JRY A;  3NVZ B;  3NKS A;  3RO6 A;  2YG5 A;  3AN1 A;  1OJC A;  2JB3 A;  3CNJ A;  4P9S A;  3AYI A;  1PBF A;  3T2Y A;  1ZK7 A;  4DHG A;  4K2X A;  2OZ8 A;  3JSK A;  3B9J B;  3KUM A;  4ICY A;  2YLZ A;  2YQU A;  3ENL A;  5FS7 A;  4H1Z A;  1GRG A;  3GD6 A;  3AED A;  3GC2 A;  4A5L A;  2POZ A;  2X3N A;  2BXR A;  4JQ9 A;  4BJZ A;  1N5X A;  1H83 A;  2PP0 A;  3DA1 A;  2NPX A;  2E3T A;  1STZ A;  3HRD C;  1GAL A;  2WS3 A;  3OZY A;  4Y4N A;  5J04 A;  3QJ4 A;  1GSN A;  1TDE A;  4IA5 A;  2PU0 A;  4E4U A;  3AB1 A;  1KSU A;  1N5W C;  4YWS A;  3IHG A;  1DJQ A;  6ENL A;  4TM4 A;  4ZCW A;  3V3O A;  1ELI A;  2XVH A;  3T2K A;  3P9U A;  1ZXI C;  3EPT A;  4NZH A;  1GRH A;  4H4T A;  1JNR A;  3P4P A;  4B65 A;  1JRZ A;  3R07 C;  3MWC A;  2WPF A;  2EQ7 A;  3DER A;  3C96 A;  3AE9 A;  1XHC A;  1XPQ A;  2Y6Q A;  3NHO X;  5KVH A;  2QVH A;  4OPT A;  2PU1 A;  2C75 A;  4GAP A;  1NG3 A;  3N4E A;  3LJP A;  4RG3 A;  3ALM A;  2XSX A;  3CMM A;  3V5F A;  3UKH A;  4A6N A;  3EKG A;  1CC4 A;  3QSE A;  5KWF A;  2FKP A;  5JCI A;  1E7P A;  1GV4 A;  4NNJ A;  3A7R A;  3NO1 A;  2PPG A;  4YWO A;  2QA1 A;  2X8G A;  1VQZ A;  3T8Q A;  3S47 A;  5JCK A;  2RGJ A;  1JDF A;  4GYP A;  2Z5X A;  4JNA A;  3NVY B;  4D03 A;  2CUL A;  1SJC A;  4FK1 A;  4NEW A;  2BK4 A;  3UCL A;  5ENL A;  2X99 A;  2QCU A;  4HB9 A;  1RP0 A;  2Z5Y A;  1TDF A;  2ZC8 A;  2GMH A;  4OCG A;  5DBJ A;  1H2I A;  3UJ2 A;  3EAO A;  1VDV A;  3SSZ A;  3HYW A;  3NN6 X;  2BS4 A;  2A89 A;  3R1Z A;  1SJD A;  3I6T A;  3RP6 A;  3GMC A;  4HN8 A;  4U2T A;  1PS9 A;  3UCD A;  1LJ1 A;  4FX9 A;  4IA6 A;  3SX6 A;  3ISH A;  3D1C A;  3FVD A;  1OJD A;  3ZVI A;  3T31 A;  3H8A A;  3NN0 X;  3MQT A;  4IZG A;  4IVO B;  4JDR A;  3DG7 A;  4XWZ A;  2C73 A;  3TTE A;  4A6G A;  4GRT A;  1NAA A;  3COX A;  3NXL A;  1ELS A;  4REK A;  1ZY8 A;  4E4F A;  4IVM B;  1Q9I A;  3P4Q A;  1K0L A;  1ZDL A;  4NTE A;  3UKP A;  5J60 A;  1DJN A;  3P4R A;  4JN9 A;  1M64 A;  2PYX A;  3QFB A;  3N6H A;  4AP1 A;  3V76 A;  3OTR A;  4CRT A;  3EUB 3;  3NYE A;  2XH0 A;  4J2W A;  3F8R A;  5EOW A;  2XFO A;  3CNT A;  1DOE A;  3DME A;  5KMS A;  1TDN A;  2OPJ A;  2VQB A;  5IPY A;  1OEP A;  3OP2 A;  2WDR A;  3IC9 A;  4DN1 A;  1Q1R A;  2ARD A;  3Q45 A;  3PK7 A;  5HXI A;  4H2Q A;  3EAN A;  3UJR A;  2PMQ A;  4BV6 A;  2OZ3 A;  4U8M A;  2QJN A;  3NZG A;  1BGJ A;  3RIT A;  4G8T A;  3HW2 A;  2GGH A;  4UDQ A;  1RSG A;  3ES7 A;  2B76 A;  1VQW A;  5HY5 A;  1Y56 B;  4G73 A;  3BI4 A;  3CPH G;  3UOV A;  1TYP A;  3VR9 A;  3GY1 A;  1EC9 A;  1ZX9 A;  3JW7 A;  2FBW A;  1PXB A;  4DXK A;  4GUV A;  2YVG A;  2BA9 A;  3D46 A;  3AXB A;  2QQ6 A;  4GCM A;  4K5R A;  3TJ4 A;  4GGH A;  2OKT A;  3JVA A;  3E1T A;  1NHQ A;  3CK5 A;  2E5A A;  1DNC A;  1FL2 A;  2QJJ A;  2XVJ A;  4PAA A;  1LQU A;  3THU A;  1LPF A;  3R0K A;  3QTP A;  3ICR A;  3GD4 A;  2AL1 A;  2W3S A;  1E1N A;  4M0X A;  2BAC A;  5FJR A;  3URH A;  5EBK A;  4OPC A;  1X2H A;  2GV8 A;  3SQP A;  1GRF A;  1H82 A;  4I58 A;  4D04 A;  1SB3 B;  4H2P A;  5FS8 A;  4YTP A;  3QKE A;  4GGB A;  4HNL A;  4N9X A;  2MNR A;  4GF7 A;  2R4E A;  4JY3 A;  4B66 A;  2AAQ A;  4CCQ A;  2I5Q A;  5KOW A;  2XVE A;  3CGB A;  3VRD B;  3BSM A;  2BK5 A;  2QDD A;  3CIR A;  1NHR A;  2FJB A;  2JB1 A;  3M13 A;  4DNA A;  3QFA A;  2W3R A;  3NTD A;  1DXL A;  5FS9 A;  1FEC A;  2H89 A;  2GVC A;  1EC7 A;  3AD9 B;  4X2P A;  1D5T A;  3FV9 A;  2GAH B;  1F3P A;  1VDC A;  2RGH A;  4J36 A;  1KF6 A;  3ZVH A;  1YY5 A;  3L8K A;  1Y0P A;  1COY A;  4MMW A;  3H70 A;  3ITJ A;  4U8K A;  5M0Z A;  2PTW A;  3CGC A;  3LZW A;  3HYX A;  3ADA B;  3NVV B;  3R11 A;  1E39 A;  5G5G B;  3GWF A;  4U2S A;  1DTN A;  2GL5 A;  2IVD A;  3PS9 A;  3ZLH A;  1NEN A;  1SJB A;  3ZLF A;  3CXO A;  1S7M A;  3MY9 A;  3AEE A;  3P0W A;  3S5S A;  4WCT A;  2WET A;  7ENL A;  1REO A;  1FFU C;  3DGZ A;  2TMD A;  4TM3 A;  2OFJ A;  2EQ9 A;  3DG6 A;  3FYY A;  4K1W A;  2EQ8 A;  1E1K A;  4H4W A;  4K8G A;  2FJA A;  2GQF A;  2GF3 A;  1KN0 A;  1X2G A;  2OA1 A;  4OPU A;  2OQY A;  4RG4 A;  2E1M A;  3T37 A;  3KVE A;  4M52 A;  2RDX A;  3QPE A;  2JBV A;  3STP A;  1TYT A;  4E6M A;  4II2 A;  2W0H A;  1EC8 A;  3ZVH B;  3AE4 A;  2QDE A;  2B9X A;  1F6M A;  1MXT A;  3ZLG A;  1FCD A;  2CHR A;  4BK1 A;  3Q4D A;  3VCN A;  3GRS A;  3DG3 A;  1BF3 A;  3SFD A;  1PDY A;  2MUC A;  3AE5 A;  1CBO A;  2AL2 A;  5LV9 A;  3P1W A;  3ALJ A;  2X50 A;  3PWI A;  3K7M X;  1VG9 A;  4I59 A;  2PP3 A;  2P3Z A;  3SJN A;  1VRQ B;  1ZOY A;  5M10 A;  4EQS A;  3UTG A;  4B69 A;  3PVC A;  3VC6 A;  1GTH A;  3CND A;  3UGV A;  4ZOH B;  2AR8 A;  1BKH A;  1CL0 A;  1D7L A;  2XGZ A;  1Q1W A;  4A65 A;  3EF6 A;  1TRB A;  3M0O A;  4FP1 A;  3K7Q X;  1O94 A;  4YSY A;  2HXT A;  1E1L A;  4YTM A;  2YR5 A;  2VRM A;  1GND A;  3FXG A;  1FEB A;  2P88 A;  5J7X A;  4Z44 A;  3UJF A;  2B9W A;  4NTD A;  1IUV A;  2PTY A;  3CT2 A;  2H88 A;  4TLX A;  4CCR A;  3UCC A;  1LQT A;  4NTC A;  4PAB A;  3B3R A;  1CC6 A;  2C7G A;  1JOA A;  3FJ4 A;  4EQX A;  1N4W A;  1MOK A;  3BHF A;  3CNP A;  3QN3 A;  4EIP A;  2AL2 B;  3NT6 A;  3GRT A;  2V60 A;  2Q0K A;  2QAE A;  3AE3 A;  2PHH A;  2ZAD A;  3U9I A;  1JCT A;  3GDP A;  3UJS A;  3IJQ A;  1F8S A;  2XLP A;  4A79 A;  3DK4 A;  3H8L A;  2PGE A;  2C66 A;  3V5C A;  4IP5 A;  3VFC A;  3KU9 A;  2YG4 A;  4Z43 A;  1IUX A;  2R45 A;  3RHA A;  1JPD X;  1S3B A;  3EEZ A;  3SM8 A;  4C74 A;  3SY4 A;  5KNL A;  2BC0 A;  3TW9 A;  4CY6 A;  3OZ2 A;  4A9W A;  2P8B A;  5JCN A;  3DES A;  3ABV A;  2VOU A;  1RM6 B;  4EWJ A;  2XFU A;  2OX4 A;  3CN8 A;  1KSS A;  2YLW A;  5BRT A;  1K0J A;  2XH4 A;  1H81 A;  2W54 A;  2Q6U A;  4C3Y A;  1NG4 A;  3JZU A;  3BNU A;  1NEK A;  5U1O A;  3I3L A;  3UOZ A;  4O5U A;  2V5Z A;  3MZN A;  3CPI G;  2XYO A;  4M6U A;  5JCM A;  3BI5 A;  2C70 A;  2GMJ A;  4Y4L A;  3C4A A;  1IUW A;  3VQR A;  4EMI A;  4UDR A;  3KPK A;  4YSX A;  1GRA A;  3SXI A;  3DGH A;  4H4Z A;  2R0C A;  1H7X A;  2BCG G;  4Z24 A;  4GYP C;  3GYI A;  4O5Q A;  1O95 A;  3FG2 P;  1GRE A;  4GFI A;  1KKO A;  2B7R A;  3O0H A;  1PHH A;  4U8J A;  1X31 B;  4FK1 C;  3BI2 A;  2XFP A;  3IJL A;  3HPF A;  2JKC A;  3ALL A;  2ACZ A;  3G5R A;  5IQ1 A;  2PGW A;  3OC4 A;  1IUU A;  1V97 A;  1QO8 A;  4LII A;  3QSS A;  4MKS A;  3L1R A;  5KMQ A;  4YXD A;  2VVL A;  3MSY A;  4AP3 A;  4C5O A;  4XXG A;  2QGY A;  3CGE A;  3UOX A;  3IJI A;  3A7U A;  3SQS A;  2OQH A;  3QVR A;  1Y56 A;  2NQL A;  5KMR A;  1JNZ A;  3SR6 B;  4J56 A;  4RSL A;  5EB5 A;  4Z1Y A;  3IHM A;  3ATQ A;  1P2H A;  4TVW A;  2WDV A;  2WP6 A;  1QLB A;  4B1B A;  1N61 C;  1KD0 A;  4G6H A;  4USQ A;  3BNM A;  3DGB A;  1PBC A;  4HNC A;  4ECH A;  3CNS A;  3FBS A;  3FIM B;  2P0I A;  2OG9 A;  4APN A;  1IYX A;  4YSH A;  4H83 A;  4E8G A;  4EIQ A;  4JN7 A;  4J33 A;  3UTE A;  3RP8 A;  1N62 C;  3P3B A;  4GME A;  2OLN A;  3TOY A;  3VDG A;  4AT0 A;  1K0I A;  4OVI A;  3DK9 A;  1WUF A;  4EQW A;  1L0V A;  2YR4 A;  4ENL A;  3TCS A;  3DK8 A;  4X4J A;  3SBF A;  4C77 A;  4OPL A;  3UXK A;  3UP4 A;  1YQ3 A;  3NFU A;  5KRQ A;  2QA2 A;  3T14 A;  3PWG A;  2RAB A;  3GYX A;  1CJC A;  3U4F A;  3AEF A;  4EMW A;  4LU6 A;  5EU9 A;  3AEG A;  3UOY A;  2OZT A;  2VRL A;  3IWA A;  4IT1 A;  1D4D A;  5BOE A;  2C72 A;  2GGE A;  2GR3 A;  3VC5 A;  4ADW A;  3DJD A;  1GRB A;  2GGJ A;  4HCH A;  1PJ6 A;  5CQF A;  2WHD A;  1PXC A;  3A7A A;  3AYJ A;  2B7S A;  2PSN A;  2BS3 A;  2AKM A;  4K2S A;  5JCL A;  4NWZ A;  1S3E A;  2ZZC A;  2ZBW A;  4JY2 A;  2R9Z A;  1BZL A;  4Z2T A;  3NYC A;  5FJP A;  2J3N A;  3TWA A;  4BJY A;  3UP5 A;  4ROP A;  3NK0 X;  3CAW A;  1GRT A;  2XDO A;  1P48 A;  5FS6 A;  4X9N A;  2BYB A;  3NNE A;  2DW7 A;  3S61 A;  3OZM A;  3R9U A;  4C3X A;  4H4S A;  3DJG X;  2JK6 A;  2YLX A;  2P8C A;  3II4 A;  2WU2 A;  1CJ2 A;  3ICT A;  3DFY A;  4IV9 A;  2BS2 A;  1ZP0 A;  3LZX A;  3H4K A;  2OAL A;  4Z26 A;  1F8R A;  4BK2 A;  4UP3 A;  3NTA A;  1PJ7 A;  1TZZ A;  1H86 A;  5KOX A;  3SZ0 A;  2XFQ A;  4Z2U A;  3M12 A;  1HYU A;  3H12 A;  3G5Q A;  1JPM A;  2WOW A;  3UKK A;  1PN0 A;  1BWC A;  2WPE A;  1L9C A;  4II3 A;  4B64 A;  4HCL A;  1PXA A;  1EL8 A;  2GQW A;  2E5V A;  2FJD A;  1JRP A;  1FEA A;  4H2N A;  4FDC B;  2AQJ A;  3AD7 B;  1N4V A;  2GB0 A;  1CF3 A;  1PBE A;  1EBG A;  2GRT A;  4GDP A;  3UJE A;  1PJ5 A;  3NRZ B;  2GEW A;  1LTX R;  4JN8 A;  3CGD A;  4H4Q A;  4B63 A;  4A99 A;  1F8W A;  2YVF A;  4CY8 A;  3N6J A;  1W4X A;  1D4C A;  1N1P A;  5TR3 A;  3AE7 A;  2YM2 A;  1KDG A;  1QJD A;  3G5S A;  1WUE A;  4F4R A;  2BRY A;  2VVL G;  1T3Q C;  1BKW A;  3UKF A;  4KX6 A;  3R0U A;  1GXF A;  3F8D A;  2GAG B;  2GH5 A;  4BK3 A;  2CFY A;  4TM0 A;  1B5Q A;  4U8O A;  1NHP A;  2WU5 A;  3AE8 A;  3UXL A;  2X8C A;  3RP7 A;  1O5W A;  2XLT A;  3CPJ G;  2R0P A;  3ZDN A;  1EL5 A;  3PO7 A;  4G74 A;  3V3N A;  4J57 A;  4OPG A;  5G5H B;  1GER A;  2DKH A;  5ER0 A;  1PBD A;  4B68 A;  2V61 A;  1ECQ A;  4YTN A;  3GD3 A;  1BGN A;  3F8P A;  2HNE A;  4YKF A;  1MDL A;  2F5Z A;  1N60 C;  4H7U A;  4ZCC A; 
#chains in the Genus database with same CATH homology
 3CNT A;  3CN8 A;  3KLJ A;  1RYI A;  1DOE A;  1KSS A;  1H84 A;  1OJ9 A;  2YLW A;  3UKA A;  4CBQ A;  5BRT A;  3DME A;  1CHU A;  5KMS A;  1K0J A;  1TDN A;  1KNP A;  4U8P A;  2VQB A;  3NLC A;  1H81 A;  2XVF A;  2OLO A;  4YSZ A;  3VR8 A;  5IPY A;  2Q6U A;  4C3Y A;  2VZ2 A;  2BAB A;  4EM4 A;  3L5O A;  1NG4 A;  1E6E A;  2WDR A;  1XAN A;  3IC9 A;  4H4R A;  3K7T A;  1L9E A;  1Q1R A;  2ARD A;  4HA6 A;  2YVJ A;  1EL9 A;  3T0K A;  4H4X A;  3BNU A;  4H4P A;  4Y4M A;  1NEK A;  1ZKQ A;  5U1O A;  3I3L A;  2R4J A;  3Q6J A;  3UOZ A;  2C76 A;  5HXI A;  4O5U A;  3AWI A;  2WBA A;  3B6D A;  2V5Z A;  2JB2 A;  3CPI G;  5L46 A;  3SFE A;  4AOX A;  1XDI A;  2XYO A;  3SZW A;  2WQY A;  3EAN A;  5JCM A;  2XFN A;  2C70 A;  2UZZ A;  3BHK A;  3BI5 A;  3FPZ A;  4H2Q A;  2WDQ A;  2YR6 A;  4BV6 A;  3LAD A;  2GMJ A;  4Y4L A;  3C4A A;  3SYI A;  5CKU A;  1IUW A;  3VQR A;  4EMI A;  4U8M A;  2BC1 A;  4UDR A;  1IUS A;  3KPK A;  4DGK A;  2Q0L A;  4YSX A;  1GRA A;  3SXI A;  1BGJ A;  3DGH A;  3NGC X;  4H4Z A;  1JRX A;  4B67 A;  1E1M A;  4CNK A;  2R0C A;  1H7X A;  4UDQ A;  1RSG A;  1IUT A;  2BCG G;  4Z24 A;  3GYI A;  2YM1 A;  4O5Q A;  1O95 A;  2OAM A;  2I0Z A;  3FG2 P;  1GRE A;  2WP5 A;  2C3D A;  2XVI A;  2B76 A;  1VQW A;  3LOV A;  2EQ6 A;  1NHS A;  2B7R A;  3O0H A;  1PHH A;  1Y56 B;  1X31 B;  4G73 A;  4FK1 C;  4U8J A;  2APG A;  1S2Y A;  3BI4 A;  3CPH G;  3UOV A;  3BI2 A;  2XFP A;  1TYP A;  3VR9 A;  2JKC A;  2YLT A;  1ZX9 A;  2O9Z A;  3ALL A;  2FBW A;  1PXB A;  2IID A;  2ACZ A;  2DKI A;  3VRA A;  3G5R A;  5IQ1 A;  4WX1 A;  1MO9 A;  3OC4 A;  1IJH A;  2Y6R A;  4GUV A;  4X9M A;  2YVG A;  4CNJ A;  1IUU A;  2BA9 A;  5HY5 A;  1QO8 A;  1GES A;  5HHF A;  3AXB A;  4LII A;  3NIX A;  3QSS A;  3UTH A;  4GCM A;  3FMW A;  1EL7 A;  3L1R A;  4K5R A;  1SEZ A;  1GTE A;  2YG3 A;  1M6I A;  5KMQ A;  3E1T A;  3AYL A;  3NH3 X;  4YXD A;  1NHQ A;  3GSI A;  5BUL A;  1B37 A;  2VVL A;  4Z2R A;  1DNC A;  1FL2 A;  4AP3 A;  4C5O A;  4DSG A;  2XVJ A;  4XXG A;  4PAA A;  4AOS A;  1LQU A;  2WES A;  3SZC A;  1ZOV A;  3CGE A;  1LPF A;  1V59 A;  3PG6 A;  3K30 A;  3AEC A;  3ICR A;  2V3B A;  3QVP A;  3GD4 A;  2A8X A;  1CJ3 A;  3UOX A;  1KNR A;  5U25 A;  4AT2 A;  1E1N A;  2Q7V A;  1NPX A;  2BAC A;  3URH A;  5KVI A;  5EBK A;  3C4N A;  1B8S A;  4OPC A;  2IVE A;  3QVR A;  4U8N A;  1Y56 A;  2GV8 A;  1OJA A;  3GDN A;  2BCP A;  4K8D A;  3KA7 A;  3SQP A;  1LV0 A;  1GRF A;  2TPR A;  1H82 A;  4I58 A;  4D04 A;  1JNZ A;  5KMR A;  2E4G A;  4J56 A;  1PBB A;  4RSL A;  2JAE A;  4G6G A;  3KD9 A;  1YQZ A;  5EB5 A;  3AD8 B;  3NK2 X;  1H6V A;  4GDE A;  1GOS A;  4H2P A;  5FS8 A;  4YTP A;  2C3C A;  1AOG A;  4K22 A;  3IHM A;  1TDK A;  3ATQ A;  1P2H A;  2WDV A;  1EBD A;  3AEA A;  3AEB A;  1PDH A;  2WP6 A;  4N9X A;  4GF7 A;  2R4E A;  1JU2 A;  4JY3 A;  3RNM A;  1QLB A;  4B66 A;  2AAQ A;  4CCQ A;  5KOW A;  2XVE A;  2C4C A;  4B1B A;  3KKJ A;  2ZZB A;  3VRB A;  2ZZ0 A;  3CGB A;  4G9K A;  2WEU A;  3VRD B;  4G6H A;  4USQ A;  3BNM A;  1PBC A;  2BK5 A;  4ECH A;  3CNS A;  3CIR A;  3FBS A;  5KMP A;  5FMH A;  1NHR A;  3FIM B;  4APN A;  2FJB A;  2XLR A;  2JB1 A;  3M13 A;  4DNA A;  3NYF A;  5KXJ A;  4H7U A;  4YSH A;  2YLS A;  3QFA A;  1GEU A;  4XWR A;  4EIQ A;  4J33 A;  3NTD A;  3S5W A;  3UTE A;  4P9S A;  3AE2 A;  4H50 A;  2YLR A;  1LVL A;  3RP8 A;  1CJ4 A;  1DXL A;  3D9X A;  5FS9 A;  1FEC A;  4H4U A;  2A87 A;  2H89 A;  2GVC A;  1ONF A;  2OLN A;  3NK1 X;  3Q9T A;  2VVM A;  2R0G A;  2XLU A;  2GR2 A;  2X8H A;  4AT0 A;  1JRY A;  3NKS A;  1TDO A;  3DJE A;  2YG5 A;  1K0I A;  3AD9 B;  4OVI A;  2GR0 A;  1D5T A;  1OJC A;  1GT8 A;  2JB3 A;  3CNJ A;  3DK9 A;  2GAH B;  3AYI A;  3NRN A;  1F3P A;  4EQW A;  1VDC A;  1PBF A;  2RGH A;  4KPR A;  1KF6 A;  2XLS A;  4H2R A;  4J36 A;  1YY5 A;  1ZK7 A;  1ZMD A;  3L8K A;  2YR4 A;  1Y0P A;  4K2X A;  1COY A;  2GR1 A;  3JSK A;  1DOC A;  3DK8 A;  4X4J A;  4ICY A;  4C77 A;  3ITJ A;  2YLZ A;  4U8K A;  5M0Z A;  2YQU A;  4OPL A;  2FJE A;  1KFY A;  3CGC A;  3UP4 A;  3LZW A;  3HYX A;  4TLZ A;  1YQ3 A;  3ADA B;  5FS7 A;  5KRQ A;  1GRG A;  4DSH A;  1E39 A;  3AED A;  3ICS A;  2QA2 A;  2B9Y A;  2V6O A;  4A5L A;  3GWF A;  4U2S A;  2X3N A;  3T14 A;  2RAB A;  2BXR A;  4JQ9 A;  3GYX A;  1CJC A;  4BJZ A;  3AEF A;  5EB4 A;  4EMW A;  2IVD A;  4K7Z A;  4LU6 A;  3PS9 A;  1L9D A;  1NEN A;  3AEG A;  3IF9 A;  3UOY A;  3T2Z A;  2VRL A;  3IWA A;  1S7M A;  1D4D A;  1H83 A;  4LA1 A;  4ZN0 A;  3AEE A;  2C72 A;  3T2Y A;  3DA1 A;  2NPX A;  5GSN A;  4U8L A;  4WCT A;  2GR3 A;  3I6D A;  4A79 A;  4ADW A;  3DJD A;  1GAL A;  1Z6L A;  2WET A;  1GRB A;  2WS3 A;  1REO A;  1PJ6 A;  4Y4N A;  3DGZ A;  5CQF A;  4OPD A;  2TMD A;  2WHD A;  1S2Q A;  3QJ4 A;  1PXC A;  4TM3 A;  4A6N B;  1GSN A;  1VG0 A;  3AYJ A;  4YKG A;  5C3J A;  1TDE A;  2B7S A;  5C2T A;  2EQ9 A;  2EQ8 A;  1E1K A;  3AB1 A;  4IA5 A;  2BS3 A;  4H4W A;  1KSU A;  2FJA A;  2GQF A;  3IHG A;  5JCL A;  2CVJ A;  1DJQ A;  2GF3 A;  4NWZ A;  1KN0 A;  2ZZC A;  1S3E A;  2OA1 A;  4TM4 A;  3V3O A;  4OPU A;  2ZBW A;  3QSM A;  3DH9 A;  4JY2 A;  2R9Z A;  1ELI A;  2E1M A;  2XVH A;  4RG4 A;  1BZL A;  3GYJ A;  3T37 A;  4Z2T A;  3NYC A;  3T2K A;  3P9U A;  3KVE A;  2J3N A;  4M52 A;  4BJY A;  3EPT A;  3UP5 A;  2WP9 A;  4NZH A;  3NK0 X;  2JBV A;  3DJJ A;  1GRH A;  4H4T A;  2C65 A;  1DOB A;  1JNR A;  1TYT A;  2BRA A;  3P4P A;  1GRT A;  4II2 A;  1P2E A;  2W0H A;  4B65 A;  1JRZ A;  2XDO A;  3AE4 A;  5FS6 A;  4X9N A;  2WOI A;  2WPF A;  2B9X A;  4UDP A;  2EQ7 A;  3C96 A;  3AE9 A;  3H8I A;  2BYB A;  3NNE A;  4ZCD A;  1XHC A;  3S61 A;  1F6M A;  1MXT A;  2XCG A;  1XPQ A;  2Y6Q A;  3NHO X;  5KVH A;  4TM1 A;  4OPT A;  3R9U A;  2C75 A;  5U63 A;  1FCD A;  4GAP A;  1NG3 A;  4C3X A;  4H4S A;  3DJG X;  3LJP A;  4EQR A;  4U8I A;  4RG3 A;  3ALM A;  2JK6 A;  2YLX A;  3CMM A;  3UKH A;  3II4 A;  2WU2 A;  4A6N A;  4BK1 A;  3GRS A;  1CC4 A;  3QSE A;  4MJW A;  1BF3 A;  1FOH A;  5KWF A;  3UTF A;  3SFD A;  5JCI A;  3AE5 A;  4Z25 A;  4GR1 A;  1CJ2 A;  1E7P A;  1GV4 A;  3P4S A;  1NDA A;  3ICT A;  3ZYX A;  1CBO A;  4IV9 A;  4NNJ A;  2BS2 A;  1DOD A;  1ZP0 A;  3P1W A;  3ALJ A;  5LV9 A;  3LZX A;  1K4Q A;  2YG6 A;  4YWO A;  3H4K A;  5GRT A;  2QA1 A;  3HZL A;  1L0V A;  2X50 A;  1B4V A;  1VG9 A;  3K7M X;  2WOV A;  1CC2 A;  4I59 A;  2OAL A;  4Z26 A;  2X8G A;  1VRQ B;  1F8R A;  1ZOY A;  5M10 A;  4A7A A;  4EQS A;  3UTG A;  4E0V A;  4B69 A;  4BK2 A;  4UP3 A;  3NTA A;  3PVC A;  5JCK A;  2RGJ A;  1PJ7 A;  3HYV A;  5BUK A;  1H86 A;  2Z5X A;  1GTH A;  4OPI A;  5KOX A;  3SZ0 A;  2XFQ A;  4JNA A;  2YG7 A;  4Z2U A;  4D03 A;  3CND A;  4NEV A;  4ZCC A;  2CUL A;  3M12 A;  2HQM A;  4FK1 A;  4NEW A;  2BK4 A;  1HYU A;  2R46 A;  2AR8 A;  4K5S A;  3G5Q A;  1CL0 A;  3UKQ A;  1JEH A;  1D7L A;  3UCL A;  2WOW A;  3UKK A;  2X99 A;  2QCU A;  1D7Y A;  1PN0 A;  1BWC A;  1Q1W A;  2WPE A;  3KPF A;  4A65 A;  3AE1 A;  1L9C A;  3EF6 A;  1TRB A;  4II3 A;  4B64 A;  1PXA A;  1EL8 A;  1RP0 A;  2GQW A;  3M0O A;  4HB9 A;  2E5V A;  3K7Q X;  1O94 A;  4YSY A;  2FJD A;  2Z5Y A;  1E1L A;  1TDF A;  2GMH A;  4OCG A;  4YTM A;  2YR5 A;  5DBJ A;  1FEA A;  1H2I A;  4H4Y A;  2C64 A;  4H2N A;  4FDC B;  2AQJ A;  1N4V A;  1GND A;  2GB0 A;  2VRM A;  3AD7 B;  1CF3 A;  1OJT A;  1PBE A;  1FEB A;  5J7X A;  3EAO A;  4Z44 A;  2GRT A;  2B9W A;  4NTD A;  1IUV A;  4TLX A;  2H88 A;  4GDP A;  3HYW A;  4J31 A;  5BVA A;  1PJ5 A;  2GEW A;  4CCR A;  3NN6 X;  2BS4 A;  2A89 A;  3GMB A;  1LTX R;  1LQT A;  4NTC A;  3CGD A;  4H4Q A;  3GWD A;  4PAB A;  4B63 A;  3AE6 A;  3RP6 A;  4JNQ A;  3B3R A;  1CC6 A;  3GMC A;  2VQ7 A;  2C7G A;  1JOA A;  1GPE A;  4A99 A;  4EQX A;  1F8W A;  1N4W A;  4U2T A;  1MOK A;  2NVK X;  2YVF A;  3LXD A;  4EM3 A;  4CY8 A;  1W4X A;  3BHF A;  1N4U A;  1D4C A;  1N1P A;  1PS9 A;  3CNP A;  1LJ1 A;  5TR3 A;  4FX9 A;  4EIP A;  5IQ4 A;  4IA6 A;  3AE7 A;  2YM2 A;  1KDG A;  3RED A;  1QJD A;  3G5S A;  3SX6 A;  3LB8 A;  3ISH A;  3NT6 A;  3NG7 X;  5JRB A;  3GRT A;  2BRY A;  2V60 A;  3D1C A;  2BK3 A;  2Q0K A;  2VVL G;  2YWL A;  1OJD A;  2QAE A;  3AE3 A;  3T31 A;  1BKW A;  2PHH A;  3UKF A;  3GDP A;  4KX6 A;  2WPC A;  3NN0 X;  1YQ4 A;  1GXF A;  2V3A A;  1F8S A;  2XLP A;  3F8D A;  3DK4 A;  4JDR A;  2GAG B;  2GH5 A;  3H8L A;  1H7W A;  4IVO B;  3SZF A;  4BK3 A;  2C66 A;  2CFY A;  4TM0 A;  4USR A;  1B5Q A;  3KU9 A;  1D4E A;  2YG4 A;  4J34 A;  4U8O A;  4GAV A;  4YT0 A;  1NHP A;  2WU5 A;  3AE8 A;  2C73 A;  4XWZ A;  4Z43 A;  1IUX A;  5HYM A;  4GRT A;  2X8C A;  1GET A;  1NAA A;  2R45 A;  3COX A;  3RHA A;  3RP7 A;  1O5W A;  2XLT A;  3UKL A;  2RGO A;  4REK A;  1ZY8 A;  3CPJ G;  1S3B A;  2R0P A;  4EMJ A;  3D8X A;  3SM8 A;  3ZDN A;  4C74 A;  1EL5 A;  3PO7 A;  4IVM B;  1Q9I A;  4G74 A;  3V3N A;  4J57 A;  3P4Q A;  1K0L A;  1ZDL A;  4NTE A;  3ATR A;  4OPG A;  3UKP A;  1GER A;  2DKH A;  2BXS A;  3SY4 A;  5J60 A;  2BC0 A;  5ER0 A;  5KNL A;  1DJN A;  1PBD A;  2C67 A;  3P4R A;  2V61 A;  4B68 A;  2CDU A;  4JN9 A;  3OZ2 A;  4CY6 A;  1M64 A;  2PYX A;  4A9W A;  1ZMC A;  3QFB A;  5JCN A;  4AP1 A;  4U2L A;  4H4V A;  4BUR A;  3V76 A;  4YTN A;  3SGL A;  3ABV A;  3GD3 A;  4CRT A;  1BGN A;  3NYE A;  3F8P A;  3WE0 A;  2VOU A;  1YKJ A;  2YAU A;  4YKF A;  4J2W A;  2F5Z A;  3F8R A;  2XFU A;  1UKV G;  3CTY A;  5EOW A;  2XFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...