1NHRA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 141
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA02
1IUUA 4D04A 2Y6RA 4DNAA 2WU5A 3GDPA 3BI2A 2CFYA 2OLNA 1TYPA 3AB1A 3QJ4A 4ICYA 4YKGA 3GSIA 1Y56A 1NPXA 4FX9A 1AOGA 4EMJA 1GALA 2A87A 2OLOA 1Q9IA 3C4AA 3NNEA 1CJ2A 4AOSA 2X8GA 4RG3A 1JNRA 1PBDA 2TMDA 2H88A 2CVJA 1QO8A 3DA1A 2AR8A 1RSGA 4K22A 4KX6A 2C64A 3VRDB 2YR5A 4ADWA 1DJNA 1KNRA 2HQMA 3CIRA 5JCLA 1CJCA 4YSHA 1NHQA 2ZZ0A 1D7LA 2O9ZA 2C76A 4U8JA 1W4XA 3FG2P 1IUSA 3GD3A 4J31A 1JRYA 1GESA 2WHDA 1CJ3A 4B68A 2YVFA 3CPJG 3VQRA 3AWIA 4A79A 1EL7A 2BYBA 4YTPA 3NHOX 3QFAA 1RYIA 2R46A 4UP3A 3UKFA 3VRAA 4U8PA 4GF7A 3UP4A 4EM4A 1CF3A 1SEZA 3P4QA 4AT2A 1KNPA 3OZ2A 3SM8A 2F5ZA 3ATRA 3CNTA 1F8RA 4CNJA 2VVLA 1O94A 4J33A 3AE6A 4BK3A 1KF6A 4H2RA 4EQRA 3GMCA 3H4KA 1MXTA 1IUTA 2B76A 3ALMA 1NHSA 4DGKA 1M6IA 4NTDA 4CCRA 4Z43A 3EAOA 4REKA 1B5QA 2WQYA 2XVFA 1E1NA 3M13A 3SFEA 3R9UA 3DK9A 2YLXA 2BS2A 4U8KA 2Z5YA 1GTEA 3BNMA 1EL8A 1CC6A 5FMHA 1CC4A 2WP5A 2A8XA 1L9DA 2BC1A 2XYOA 4Z25A 5KOXA 3B6DA 2GR1A 4EQXA 5EB5A 4UDPA 3AYIA 1PXAA 3V3NA 3NRNA 3DJGX 2WESA 2GV8A 3AEEA 4EIQA 5DBJA 1KDGA 4JY3A 3D1CA 3KLJA 2B7RA 4K5SA 5KVIA 1GRFA 2R45A 2GF3A 4C5OA 2AAQA 4ZN0A 1GEUA 3CGCA 3AE2A 1EL9A 2XFNA 4H4VA 3VR8A 4IVMB 4D03A 5BVAA 3BHFA 4CCQA 3E1TA 3QSEA 2C67A 5JCIA 4NTEA 5TR3A 2Q6UA 3QVRA 4AP1A 2VRMA 3II4A 1CL0A 4IA6A 4IA5A 4GUVA 1NG3A 3DGHA 2PHHA 1OJTA 3ITJA 1PBEA 4JY2A 3V3OA 1K0IA 3NYFA 3G5SA 2Q7VA 5U1OA 3ZYXA 1TDFA 4NZHA 1QJDA 1EL5A 1JRXA 3FPZA 4WX1A 4O5UA 1GPEA 1QLBA 3ALLA 4OPTA 4H4YA 3AE4A 2BXSA 4J2WA 2VQ7A 2JB3A 2ACZA 3DJEA 3QSSA 2IVEA 1JOAA 3PVCA 4JNQA 4U8LA 3SGLA 3BNUA 4OPDA 2GR2A 2Z5XA 2YAUA 4KPRA 3NG7X 2V60A 3RP7A 3SQPA 3K30A 1JRZA 5HHFA 1ZY8A 4C3XA 4XWRA 2AQJA 2GR3A 2E4GA 2XVEA 2BS3A 3GWDA 3IC9A 3KKJA 4CBQA 3UKLA 1GTHA 1LTXR 3C4NA 3P4SA 2B9XA 2XLUA 1PHHA 4B67A 2C3CA 2FBWA 1ZP0A 3GMBA 3NK2X 4BK2A 4UDRA 3CGEA 5IPYA 3PO7A 5J60A 1NHRA 4K7ZA 3AE7A 4B1BA 1LJ1A 2WOVA 4FK1C 4K2XA 1GETA 1ZMDA 3F8PA 3RP8A 1F8WA 2C75A 3GWFA 1FEAA 1DOCA 5JCNA 5FS9A 2WDVA 1D5TA 2BA9A 4XWZA 4H7UA 1CHUA 3CTYA 1L9EA 4TM4A 4FK1A 3UKKA 4AT0A 2NPXA 1TDNA 5CQFA 3AE1A 3BI5A 4A6NB 3G5RA 3F8RA 1S3BA 1LQUA 3DMEA 4IVOB 4H4QA 3CGBA 1VDCA 4Y4NA 3H8IA 4USQA 4Y4MA 2XCGA 1ZOYA 2BK3A 1D4EA 1S2YA 1LQTA 1PBCA 2V3BA 5M0ZA 2BK5A 2XDOA 4Z26A 2X50A 4OPLA 2R4EA 3SFDA 1LPFA 4X4JA 2YQUA 4A7AA 1F8SA 1DNCA 3NIXA 3NTDA 2E1MA 4HB9A 3QSMA 4AP3A 4FDCB 1D4DA 3NT6A 1M64A 3P4RA 3B3RA 5GRTA 1TYTA 2XVJA 3NN0X 3UKPA 4RG4A 5KOWA 1OJAA 1ZOVA 3QFBA 3M0OA 2YLRA 1N1PA 5KXJA 3GRTA 4J36A 4TM3A 1N4VA 1P2EA 4YSXA 1Q1WA 1B8SA 1FCDA 1H7XA 4OVIA 3D8XA 4H4RA 3NLCA 2YVJA 1E1LA 2JK6A 2WBAA 2C72A 1VG0A 4I59A 1CC2A 4HA6A 4YSYA 3QVPA 4TM1A 3KA7A 1PJ5A 3ZDNA 3GRSA 1VG9A 2ZZBA 4N9XA 1IUXA 1L0VA 1GT8A 1NENA 2C7GA 3UTHA 2VRLA 2EQ9A 3IHGA 1X31B 2CDUA 1LV0A 4PAAA 1YQ3A 4ZCDA 2QA2A 1IJHA 3CPHG 5EOWA 3P1WA 2E5VA 3COXA 4H4WA 4CY6A 2YLZA 3AXBA 2WS3A 3GYJA 1BGNA 1DODA 2YG5A 5CKUA 1YKJA 2WPEA 4P9SA 1K0LA 4C3YA 3UOXA 2YLWA 3AD9B 3AD8B 1PJ7A 1GNDA 1OJCA 2YM1A 5HYMA 2FJAA 3LOVA 3CNDA 2R0CA 2YLSA 2DKIA 2XFPA 3RNMA 3NH3X 3S5WA 2GH5A 2WPFA 2B9WA 2BXRA 1O5WA 1S2QA 3JSKA 4K8DA 1GXFA 2GQWA 5IQ4A 4EQWA 4H4TA 4OCGA 2WOIA 4H50A 2XFQA 2WDRA 4H4PA 2XVIA 3OC4A 2R0PA 4AOXA 2TPRA 4YWOA 3DJJA 3WE0A 5C3JA 1S3EA 3ALJA 1ONFA 4GDEA 2EQ8A 3KPFA 1E7PA 4OPUA 2J3NA 2GAGB 1BF3A 1CJ4A 4J57A 4JN9A 5C2TA 2BK4A 4DSGA 1PDHA 2VVMA 1PBBA 2YG3A 3UTGA 1PXCA 1YQZA 5BUKA 1Z6LA 1PJ6A 2QCUA 3ICTA 4U8OA 4BJZA 1XDIA 2GMJA 5JCMA 3CGDA 2IIDA 3NN6X 3DK8A 4H2PA 4A99A 2V6OA 2X99A 4ECHA 1E6EA 4XXGA 3UOVA 4B65A 2VVLG 4OPCA 2WPCA 1PN0A 4U2TA 3REDA 4APNA 4YSZA 5KWFA 4YXDA 1BKWA 1NAAA 1V59A 4C74A 4EM3A 2C70A 3O0HA 3FMWA 3CNJA 1FEBA 1N4UA 2YG6A 2DKHA 2FJBA 2Q0LA 2YVGA 4CRTA 5HY5A 4USRA 2I0ZA 1FOHA 3AEAA 5ER0A 3KVEA 4ZCCA 1LVLA 3LXDA 1ZKQA 1XPQA 1JU2A 3AEDA 3CPIG 4LIIA 3AEGA 4Y4LA 3M12A 4U8IA 4DSHA 1UKVG 3AE5A 3IF9A 1O95A 1TDEA 2GEWA 5U63A 5HXIA 1K4QA 4A5LA 2BCPA 2H89A 1GRTA 3FIMB 5L46A 4A9WA 5JCKA 4Z2TA 3UTEA 3F8DA 3I3LA 4B64A 2WEUA 1ZK7A 1E39A 1Y0PA 4OPGA 2RGHA 4LU6A 1TDKA 1H6VA 1OJDA 3DH9A 3CNSA 4NTCA 3LJPA 2IVDA 1DXLA 1JEHA 3NK0X 1N4WA 3V76A 3EF6A 3LZXA 1GOSA 1GRHA 1H7WA 2WDQA 3L1RA 3DJDA 1KSUA 2R0GA 2YR6A 3BHKA 2C65A 2GQFA 2JB1A 1ZX9A 1PS9A 2R4JA 4JNAA 1E1KA 2WOWA 3UOYA 5FS8A 3EANA 2CULA 4Z24A 1BGJA 4U2SA 2RGOA 4B63A 2ARDA 3PS9A 1FL2A 3NYEA 1VQWA 2WP6A 1PBFA 4Z2UA 3I6DA 2WETA 4EIPA 3EPTA 3K7TA 1IUVA 1DOEA 4J56A 1BWCA 1GRBA 1RP0A 3IHMA 3KU9A 4CNKA 1NDAA 5GSNA 4WCTA 1DJQA 2NVKX 2BCGG 1F6MA 2Y6QA 3LZWA 5KVHA 3L8KA 2V5ZA 3ATQA 4J34A 4TLXA 3VR9A 4Z2RA 2GRTA 2GVCA 4GRTA 1ZMCA 3Q6JA 4JQ9A 1KFYA 2XVHA 4Z44A 3UP5A 5FS6A 2V61A 1GV4A 2BABA 4MJWA 1D7YA 2JBVA 3HZLA 4B66A 2YWLA 2FJDA 3AEBA 2YG4A 5BULA 2GR0A 1GSNA 3LB8A 4LA1A 1H84A 4GR1A 2B9YA 3Q9TA 3DGZA 4A6NA 1D4CA 2APGA 1COYA 2YR4A 2GB0A 3KD9A 5FS7A 1EBDA 3GD4A 4M52A 4U8MA 4UDQA 4CY8A 3P4PA 1ELIA 4YT0A 4GDPA 3UTFA 2X3NA 1REOA 3RHAA 1HYUA 2QA1A 4BJYA 3ISHA 1PXBA 5LV9A 2OALA 2C3DA 1TDOA 2ZBWA 2C66A 3NK1X 3BI4A 3K7MX 5KRQA 4EQSA 1NHPA 1XANA 2XLSA 3AYLA 1P2HA 3ABVA 3C96A 4BV6A 1FECA 1BZLA 3NGCX 4X9NA 2W0HA 4YTMA 3CN8A 2VQBA 4IV9A 4A65A 4TLZA 4B69A 2RGJA 2VOUA 1E1MA 4O5QA 2VZ2A 2BC0A 4RSLA 3AE9A 4YTNA 2QAEA 1Q1RA 1Y56B 2V3AA 2OA1A 3CNPA 1B4VA 4JDRA 5U25A 1NG4A 1CBOA 2GAHB 4H4XA 2RABA 1L9CA 3AEFA 1H81A 2JB2A 4H4SA 5BRTA 2R9ZA 3FBSA 3K7QX 3H8LA 4C77A 3NTAA 4X9MA 1GERA 3GYIA 2FJEA 4H4UA 3URHA 1YQ4A 2EQ7A 2A89A 2XLRA 3ICRA 3NKSA 3UKAA 3UOZA 1NEKA 2C73A 2YLTA 2BACA 4OPIA 2X8CA 3NYCA 1GREA 4H2NA 4U2LA 5M10A 1GRAA 3ICSA 5EBKA 2XLPA 2Q0KA 2WU2A 4EMIA 4H4ZA 3AE8A 2XFOA 4YKFA 1JNZA 4EMWA 2EQ6A 3AECA 1GRGA 3T37A 5IQ1A 1IUWA 1KSSA 4BK1A 2YG7A 2XLTA 3ADAB 1DOBA 2XFUA 1K0JA 3G5QA 3UKHA 1B37A 3AD7B 1XHCA 4H2QA 4NEVA 3IWAA 3RP6A 3S61A 3UCLA 1F3PA 3AE3A 1H83A 4K5RA 1TRBA 5EB4A 3AYJA 3VRBA 2BS4A 1VRQB 2B7SA 4PABA 4U8NA 1YY5A 3UKQA 4NEWA 1H82A 4GCMA 4I58A 3DK4A 4TM0A 5J7XA 3LADA 2YM2A 2GMHA 2WP9A 2ZZCA 2OAMA 2JKCA 3P9UA 4E0VA 4BURA 1OJ9A 2UZZA 1H86A 2JAEA 3GDNA 1MOKA 2PYXA 1MO9A 2X8HA 1ZDLA
chains in the Genus database with same CATH superfamily
3TOYA 2CFYA 3T9PA 3QJ4A 4YKGA 3GSIA 4AOSA 2FKPA 4IZGA 1FIQB 1KNRA 1R6WA 1D7LA 2O9ZA 3EEZA 2PGEA 4U8JA 1GESA 2WHDA 1CJ3A 4B68A 5IDZA 4A6GA 3AWIA 5JRBA 1RYIA 4GF7A 3UP4A 3MWCA 3ATRA 3CNTA 5J04A 1F8RA 4CNJA 3AE6A 3GMCA 1MXTA 3UCDA 2B76A 3ALMA 4DGKA 4Z43A 1B5QA 2WQYA 1N5XA 3M13A 3SFEA 3R9UA 4MKSA 2YLXA 1E9IA 2BS2A 3BNMA 1EL8A 3GY1A 1CC4A 2WP5A 3B6DA 3AYIA 3V3NA 3NRNA 2WESA 1KCZA 3I6TA 3D1CA 3V5FA 1X2HA 2GF3A 3CMMA 3AE2A 2XFNA 4D03A 4DWDA 3E1TA 2C67A 3SSZA 2Q6UA 4AP1A 3II4A 4IA6A 4GUVA 4X2PA 1OEPA 1PBEA 3ZYXA 4NZHA 2AKZA 4HPNA 1GPEA 3Q4DA 4TVYA 4H83A 2OZTA 3NO1A 2IVEA 2Z5XA 2YAUA 3NG7X 3T8QA 4XWRA 3FXGA 3KPKA 3GWDA 1WUFA 4CBQA 1GTHA 3C4NA 3P4SA 4DHGA 1PHHA 3NK2X 4UDRA 5J60A 1NHRA 3AE7A 4B1BA 2WOVA 3VFCA 4II2A 3F8PA 5EU9A 1DOCA 2WDVA 4ENLA 1EBGA 4IT1A 5CQFA 5FJTA 3SZ0A 3D46A 4IVOB 3H8IA 3T2ZA 5KMPA 2XCGA 2PMQA 2E5AA 3ENLA 2BK5A 2R4EA 3SFDA 4A7AA 3NFUA 3SR6B 1DNCA 3NIXA 4HB9A 4AP3A 4A35A 3B3RA 2OVLA 4GMEA 4RG4A 2YLRA 1N1PA 3DEQA 3GRTA 4J36A 1P2EA 1Q1WA 3NLCA 1E1LA 2JK6A 3FJ4A 6ENLA 1PDYA 4TM1A 1PJ5A 1VG9A 1IUXA 3PWGA 1NENA 2C7GA 4G8TA 1YQ3A 3BOXA 3UJEA 3P1WA 3COXA 4H4WA 3GYJA 1BGNA 4IL2A 2DW7A 2YG5A 1K0LA 2PS2A 3AD8B 3AD9B 1OJCA 2FJAA 3CNDA 2R0CA 4FP1A 3S5WA 1YEYA 3FCPA 4GIRA 4H50A 2XFQA 2XVIA 2R0PA 4AOXA 3I4KA 4YWOA 3WE0A 5BOEA 1ONFA 2EQ8A 2QGYA 1BF3A 2XSXA 4JN9A 2BK4A 4DSGA 1PDHA 3N4EA 4GFIA 2QCUA 1PJ6A 4BJZA 3S5SA 2GMJA 3TTEA 3HYWA 3CGDA 2IIDA 3DK8A 4H2PA 2V6OA 2X99A 4HN8A 1E6EA 4B65A 3QTPA 2AL2B 4YXDA 1NAAA 4C74A 4EM3A 1N4UA 4IP4A 1EC7A 4USRA 1FOHA 3AEAA 5ER0A 1LVLA 3IJIA 2FYMA 1BKHA 3AEGA 4U8IA 2QJJA 5U63A 1K4QA 2H89A 5L46A 5JCKA 1P48A 2POZA 4Z2TA 4B64A 2WEUA 2RGHA 1H6VA 4NTCA 1N4WA 3V76A 1GOSA 2PPGA 2OO6A 2AL1A 3UXKA 1FFUC 2C65A 1PS9A 3H7VA 1E1KA 3UOYA 1ONEA 2CULA 4Z24A 3TQPA 4B63A 3PS9A 3GO2A 1FL2A 2WP6A 3DERA 3EPTA 1IUVA 3VC5A 4CNKA 1DJQA 3LZWA 1L8PA 2GVCA 2XVHA 3UJ2A 3SZWA 2BRAA 2BABA 1D7YA 2JBVA 3RGTA 3HZLA 2QJMA 2FJDA 2YG4A 1GSNA 3LB8A 3DGZA 2YR4A 4M52A 2OFJA 3QPEA 2OKTA 1ELIA 4GDPA 3UTFA 3IJLA 3K7MX 1NHPA 3AYLA 3FVDA 4B69A 3DG3A 2RGJA 4O5QA 2QAEA 4G9KA 1B4VA 1NG4A 1TE6A 1SJBA 5FJPA 1H81A 3FYYA 3K1GA 3K7QX 3H8LA 1BQGA 4X9MA 4H4UA 3ICRA 4MGGA 2C73A 2BACA 2X8CA 4U2LA 4Z1YA 2OQHA 2XFOA 1KN0A 2EQ6A 1ZXIC 5IQ1A 1IUWA 2XLTA 3ADAB 1TKKA 4MMWA 1DOBA 2XFUA 3UJRA 3BSMA 3UKHA 3UCLA 4K5RA 1TRBA 5EB4A 1VRQB 2XH0A 4U8NA 4I58A 3V4BA 2BRYA 2GMHA 2ZZCA 1OJ9A 1MO9A 2X8HA 1ZDLA 1IUUA 5G5GB 4J3ZA 3GDPA 3BI2A 2CHRA 3ZLGA 1SJDA 2XGZA 4ICYA 1Y56A 1NPXA 2OLOA 4EMJA 2C4CA 1CJ2A 2X8GA 1JNRA 3NVYB 1RSGA 2C64A 3VRDB 3CIRA 5JCLA 1NHQA 2C76A 3SXIA 3A7RA 3FG2P 3TWAA 4J31A 2PTXA 2YVFA 3CPJG 1W6TA 2W54A 1EL7A 3VRAA 3I6EA 4UP3A 3UKFA 2HNEA 3T2YA 4AT2A 3OZ2A 1MNSA 4K1WA 2VVLA 4J33A 3CAWA 3TWBA 4H2RA 1NHSA 1M6IA 3OP2A 3PFRA 4NTDA 4CCRA 5KNLA 1E1NA 1L9DA 2A8XA 5KOXA 2XYOA 4EQXA 3DJGX 2GV8A 3SZCA 2R45A 4C5OA 4ZN0A 1MUCA 1GEUA 3CGCA 5BVAA 3BHFA 5JCIA 3QVRA 2VRMA 1WYGA 3DGHA 3B97A 3V3OA 3DFYA 3NRZB 1EL5A 1JRXA 4Z17A 4H4YA 3TJIA 2VQ7A 2JB3A 3BNUA 2GR2A 1JRZA 1PDZA 4C3XA 2E4GA 4G7FA 2BS3A 3IC9A 3ZVIA 4B67A 1ZP0A 3CGEA 5IPYA 1LJ1A 4FK1C 1GETA 3RP8A 2C75A 4GAVA 5FS9A 4TM4A 3UKKA 3CTYA 1L9EA 4AT0A 2NPXA 1TDNA 3AE1A 3BI5A 4A6NB 3U9IA 3G5RA 4H4QA 1VDCA 1WUEA 4FI4A 4HNLA 1N5WC 1S2YA 1LQTA 5M0ZA 2V3BA 2X50A 4FDCB 1D4DA 1M64A 2XVJA 3NN0X 3UKPA 2P0IA 4II3A 3QFBA 3CB3A 4HCHA 4TM3A 1N4VA 3VA8A 4YSXA 1FCDA 1H7XA 3D8XA 2AKMA 4I59A 4YSYA 5FJOA 3NXLA 1L0VA 3UTHA 2VRLA 2EQ9A 1X31B 2CDUA 4ZCDA 1JDFA 2QA2A 3HW2A 3CPHG 5EOWA 2O56A 1YKJA 4C3YA 3UOXA 1EC9A 2YLSA 3R07C 2HXUA 2GH5A 2BXRA 1O5WA 2GQWA 5IQ4A 4H4PA 4EWJA 3AM9A 3SBFA 1E7PA 1CJ4A 2VVMA 2OZ3A 3H12A 2QDEA 3PK7A 5BUKA 1Z6LA 4U8OA 5JCMA 3ZLHA 4A99A 4U2TA 2WPCA 1BKWA 3SQSA 3EKGA 3CNJA 2FJBA 2Q0LA 3V3WA 3STPA 3LXDA 3AEDA 3CPIG 4LIIA 1N63C 3AE5A 3IF9A 1O95A 2GEWA 1SB3B 5HXIA 4M0XA 3UTEA 3CXBA 1E39A 3DH9A 4HYRA 1GRHA 4KT2A 4A9WA 3BHKA 2GQFA 1ZX9A 2QJNA 3EANA 2P88A 1MRAA 1BGJA 2ARDA 3NYEA 4HNCA 4EIPA 3HYXA 4J56A 1BWCA 3IHMA 3L5OA 5KVHA 2V5ZA 3VR9A 4YWSA 4Z2RA 2W3SA 4Z44A 4GRTA 1ZMCA 3Q6JA 3A7UA 1GV4A 4MJWA 4B66A 4J1OA 2YWLA 2MNRA 5FJRA 2GR0A 3N4FA 3Q9TA 4A6NA 1D4CA 2GB0A 3KD9A 5FS7A 3P4PA 2QA1A 4BJYA 5LV9A 2OALA 2C66A 3BI4A 4EQSA 4A3RA 2XLSA 3ABVA 1FECA 1BZLA 4X9NA 2W0HA 4K8GA 4YTMA 4A65A 2VZ2A 2I5QA 1Q1RA 1Y56B 4DX3A 2OA1A 4KPLA 2GAHB 4H4XA 3AEFA 1XPYA 3THUA 3GYIA 1YQ4A 2XLRA 2A89A 4OPIA 1N62C 1GREA 1GRAA 3ICSA 5EBKA 2XLPA 2WU2A 4EMIA 3UJFA 4H4ZA 4KWSA 3T0KA 1GRGA 4GGHA 2OLAA 3R1ZA 3MY9A 4G6HA 4K2SA 3G5QA 3NVZB 1XHCA 4NEVA 1RVKA 1F3PA 3FV9A 4GYPA 3AYJA 3VRBA 4PABA 3UKQA 4NEWA 1H82A 4TM0A 5J7XA 2YM2A 2WP9A 3OW1A 1H86A 4D04A 4DNAA 3RO6A 2QDDA 2OLNA 3AB1A 3T14A 4F4RA 3C4AA 1Q9IA 1IYXA 2RDXA 4DN1A 1PBDA 2TMDA 2PP1A 1QO8A 1KKRA 2YR5A 4ADWA 1DJNA 3DFHA 2ZZ0A 3PG6A 1N61C 1W4XA 3GD3A 2QQ6A 2BYBA 4YTPA 3NHOX 3QFAA 4ZCWA 4U8PA 4EM4A 3P4QA 1X2GA 2F5ZA 1O94A 4BK3A 4EQRA 3H4KA 1IUTA 3ZLFA 2XVFA 3DK9A 4U8KA 1GTEA 5FMHA 1EC8A 4UDPA 3AEEA 5DBJA 1KDGA 4JY3A 3OTRA 3KLJA 2B7RA 5KVIA 1GRFA 2AAQA 3U4FA 1EL9A 3VR8A 4CCQA 4NTEA 1JPDX 1CL0A 4IA5A 2PHHA 3MZNA 3ITJA 4JY2A 1K0IA 3G5SA 2Q7VA 5U1OA 1TDFA 3R25A 3VCCA 1QLBA 1N60C 2BXSA 2ACZA 3DJEA 3QSSA 3PVCA 1JOAA 3SGLA 4JNQA 3JVAA 4U8LA 4KPRA 3SQPA 2GGJA 1ECQA 1ZY8A 2PGWA 3KKJA 3UKLA 2XLUA 3GMBA 3P3BA 4K7ZA 1F8WA 1FEAA 5JCNA 2BA9A 4XWZA 1CHUA 3ES8A 3F8RA 1S3BA 1TZZA 4G73A 4Y4NA 1ZOYA 2PTZA 5BOFA 2OQYA 1PBCA 4Z26A 1FFVC 1LPFA 4X4JA 4TVWA 3MKCA 3H70A 3DDMA 5GRTA 1TYTA 3JW7A 3TW9A 1OJAA 1ZOVA 4M6UA 4H4RA 2WBAA 2C72A 1VG0A 1CC2A 2PP0A 3QVPA 3KA7A 3ZDNA 1KD0A 4E5TA 2ZZBA 4N9XA 1STZA 1IJHA 3MUCA 2YLZA 5KMRA 3RR1A 2E3TA 2YLWA 1PJ7A 5HYMA 2GGGA 2XFPA 3RNMA 3NH3X 2WPFA 3AN1A 4K8DA 1GXFA 3OZYA 3A7AA 4EQWA 2P8CA 4OCGA 2WOIA 2WDRA 2TPRA 1S3EA 3ALJA 4GDEA 2PP3A 2J3NA 4J57A 4ROPA 2YG3A 1PBBA 3D9XA 3UTGA 3NN6X 2VVLG 1PN0A 3IK4A 3QN3A 4APNA 2OG9A 1V59A 5KMSA 2C70A 3O0HA 1DTNA 3FMWA 1FEBA 2YG6A 2DKHA 2YVGA 3VCNA 4CRTA 5HY5A 2I0ZA 2PTYA 3NZGA 2W55A 1JU2A 2DW6A 4DSHA 1TDEA 4A5LA 2BCPA 1GRTA 3F8DA 3I3LA 2P3ZA 1Y0PA 3T4WA 4LU6A 4JHMA 3CNSA 3DG7A 3LJPA 2IVDA 1JEHA 3NK0X 3EF6A 3LZXA 2PODA 3GC2A 3DJDA 1KSUA 2YR6A 3MSYA 2JB1A 2R4JA 2WOWA 3JZUA 4U2SA 2RGOA 1VQWA 1PBFA 4Z2UA 3I6DA 1F9CA 4E4UA 1NDAA 5GSNA 3IJQA 3L8KA 3ATQA 4J34A 3CK5A 2GRTA 4JN7A 3SN4A 3B9JB 3SZFA 3DIPA 2PSNA 4KEMA 5FJUA 3AEBA 3GYXA 5BULA 3H8AA 3ZVHA 4IHCA 4GR1A 3EUB3 2APGA 3PWIA 1EBDA 3GD4A 4CY8A 5KMQA 4YT0A 3ISHA 2C3DA 2ZBWA 4H1ZA 1XANA 2GGIA 3NS1B 3C96A 4BV6A 3R0UA 4IV9A 4TLZA 2GSHA 5G5HB 1E1MA 2BC0A 4RSLA 4YTNA 3HRDC 5U25A 5BRTA 3Q45A 3MQTA 2JB2A 2R9ZA 4C77A 1GERA 2FJEA 3UOZA 3SN0A 3NVVB 3UKAA 1SJCA 2OX4A 5M10A 4H2NA 2PTWA 1JNZA 4EMWA 3AECA 1JRPA 5ENLA 3AD7B 3IWAA 3S61A 3P93A 4NNJA 3AE3A 2B7SA 1YY5A 4GCMA 3DK4A 2GDQA 3LADA 2OAMA 2PCEA 2JKCA 3P9UA 4E0VA 2UZZA 1MDLA 2JAEA 3GDNA 1MOKA 2PYXA 1FO4A 2Y6RA 2WU5A 4IL0A 4JN8A 1TYPA 2GGEA 4FX9A 1AOGA 1GALA 2A87A 4OPGA 3RRAA 3NNEA 4RG3A 2H88A 2CVJA 3DA1A 2ZADA 2AR8A 4K22A 4KX6A 2HQMA 3SY4A 1CJCA 4YSHA 2ONEA 7ENLA 4E4FA 2ZC8A 1IUSA 1JRYA 3OZMA 3VQRA 4A79A 2R46A 3GD6A 1CF3A 1SEZA 1KNPA 3SM8A 3AMZA 4H2HA 4E8GA 1KF6A 4NWZA 1JROA 3EAOA 4REKA 3OPSA 3CYJA 2Z5YA 1CC6A 2BC1A 4Z25A 2GR1A 5EB5A 1PXAA 4EIQA 3UXLA 2XH2A 2XH7A 3DESA 4K5SA 3T6CA 4H4VA 4IVMB 3QSEA 3DG6A 3QKEA 5TR3A 1NG3A 1OJTA 3NYFA 1H2IA 1QJDA 3FPZA 4WX1A 4O5UA 3ALLA 4OPTA 3AE4A 3UJSA 4J2WA 3V5CA 3D47A 4OPDA 2V60A 3RP7A 3K30A 5HHFA 2AQJA 2GR3A 2XVEA 4GGBA 3N6HA 1LTXR 2B9XA 2C3CA 2FBWA 4BK2A 3UGVA 3PO7A 3SN1A 4K2XA 1ZMDA 3GWFA 1D5TA 4H7UA 4FK1A 3QLDA 2PU1A 2HXTA 1LQUA 3DMEA 3CGBA 1R0MA 4USQA 3SJNA 4Y4MA 2BK3A 1D4EA 1VQZA 3VC6A 2XDOA 4OPLA 2YQUA 3R10A 1F8SA 3BJSA 3NTDA 2E1MA 3QSMA 3NT6A 1T3QC 3DGBA 3P4RA 5KOWA 3RCYA 1FHVA 3M0OA 5KXJA 3P0WA 1B8SA 4OVIA 2YVJA 1P43A 4HA6A 4ZA0A 4DXKA 2PU0A 3GRSA 1EBHA 1GT8A 4HCLA 3IHGA 2P8BA 1LV0A 4PAAA 1ELSA 2E5VA 4CY6A 3AXBA 3SYIA 2WS3A 1DODA 3HYVA 5CKUA 2WPEA 4P9SA 3ETRB 1GNDA 2YM1A 3LOVA 2DKIA 2B9WA 1S2QA 3JSKA 4H4TA 4G6GA 1XS2A 3OC4A 2W3RA 3DJJA 5C3JA 3RITA 3S47A 3KPFA 4OPUA 2GAGB 5C2TA 3R11A 2GGHA 1SJAA 3T2KA 1PXCA 1YQZA 3ICTA 1V97A 1XDIA 1NU5A 4ECHA 4XXGA 3UOVA 4OPCA 3REDA 5KWFA 4YSZA 3HPFA 2PA6A 3KVEA 4ZCCA 3KUMA 1ZKQA 1XPQA 3ZVHB 4Y4LA 3M12A 1UKVG 1JPMA 4IP5A 3FIMB 1ZK7A 4GISA 1TDKA 1OJDA 3TJ4A 1DXLA 1H7WA 2WDQA 1FHUA 3L1RA 1MDRA 2R0GA 4JNAA 3NVWB 5FS8A 1JCTA 2WETA 3TCSA 3K7TA 1DOEA 1GRBA 4ZOHB 1RP0A 3R0KA 3KU9A 4WCTA 2AL2A 2NVKX 2BCGG 1F6MA 2Y6QA 4TLXA 4JQ9A 1KFYA 3UP5A 3SX6A 5FS6A 3N6JA 2V61A 3CT2A 4LA1A 1H84A 2B9YA 1VDVA 1COYA 4U8MA 1S7MA 4UDQA 3CXOA 2X3NA 1REOA 3RHAA 1HYUA 1PXBA 3T31A 2MUCA 1RM6B 1TDOA 3NK1X 5KRQA 2GL5A 1P2HA 3ES7A 3NGCX 1KKOA 3CN8A 2VQBA 2OZ8A 2VOUA 3AE9A 2V3AA 4GAPA 3CNPA 4JDRA 1CBOA 2RABA 1L9CA 4H4SA 3FBSA 3NTAA 3URHA 2EQ7A 3NKSA 1NEKA 4DYEA 2YLTA 3NYCA 2Q0KA 3AE8A 4YKFA 3VDGA 2NQLA 3T37A 2HZGA 1KSSA 4BK1A 4GYPC 4H19A 2YG7A 1K0JA 1B37A 4G74A 4H2QA 3RP6A 1H83A 2BS4A 4E6MA 4BURA 4HCDA 1NELA 2QVHA 2OPJA 3UCCA 2XH4A
chains in the Genus database with same CATH topology
1IUUA 4D04A 2Y6RA 4DNAA 2WU5A 3GDPA 3BI2A 2CFYA 2OLNA 1TYPA 3AB1A 3T14A 3QJ4A 4ICYA 4YKGA 3GSIA 1Y56A 1NPXA 4FX9A 1AOGA 4EMJA 1GALA 2A87A 2OLOA 1Q9IA 2C4CA 3C4AA 1CJ2A 3NNEA 4AOSA 2X8GA 4RG3A 1JNRA 1PBDA 2TMDA 2H88A 2CVJA 1QO8A 3DA1A 2AR8A 1RSGA 4K22A 4KX6A 2C64A 3VRDB 2YR5A 4ADWA 1DJNA 1KNRA 2HQMA 3CIRA 5JCLA 3SY4A 1CJCA 4YSHA 1NHQA 2ZZ0A 1D7LA 2O9ZA 3PG6A 2C76A 3SXIA 4U8JA 1W4XA 3FG2P 1IUSA 3GD3A 4J31A 1JRYA 1GESA 2WHDA 1CJ3A 4B68A 2YVFA 3CPJG 3VQRA 3AWIA 4A79A 1EL7A 2BYBA 4YTPA 3NHOX 3QFAA 5JRBA 1RYIA 2R46A 4UP3A 3UKFA 3VRAA 4U8PA 4GF7A 3UP4A 4EM4A 1CF3A 1SEZA 3P4QA 3T2YA 4AT2A 1KNPA 3OZ2A 3SM8A 2F5ZA 3ATRA 3CNTA 1F8RA 4CNJA 2VVLA 1O94A 4J33A 3AE6A 4BK3A 1KF6A 4H2RA 4EQRA 3GMCA 3H4KA 1MXTA 1IUTA 2B76A 3ALMA 1NHSA 4NWZA 4DGKA 1M6IA 4NTDA 4CCRA 4Z43A 3EAOA 5KNLA 4REKA 1B5QA 2WQYA 2XVFA 1E1NA 3M13A 3SFEA 3R9UA 3DK9A 2YLXA 2BS2A 4U8KA 2Z5YA 1GTEA 3BNMA 1EL8A 1CC6A 5FMHA 1CC4A 2WP5A 2A8XA 1L9DA 2BC1A 2XYOA 4Z25A 5KOXA 3B6DA 2GR1A 4EQXA 5EB5A 4UDPA 3AYIA 1PXAA 3V3NA 3NRNA 3DJGX 2WESA 2GV8A 3AEEA 4EIQA 5DBJA 1KDGA 4JY3A 3D1CA 3SZCA 3KLJA 2B7RA 4K5SA 5KVIA 1GRFA 2R45A 2GF3A 4C5OA 2AAQA 4ZN0A 1GEUA 3CGCA 3CMMA 3AE2A 1EL9A 2XFNA 4H4VA 3VR8A 4IVMB 4D03A 5BVAA 3BHFA 4CCQA 3E1TA 3QSEA 2C67A 5JCIA 4NTEA 5TR3A 2Q6UA 3QVRA 4AP1A 2VRMA 3II4A 1CL0A 4IA6A 4IA5A 4GUVA 1NG3A 3DGHA 2PHHA 1OJTA 3ITJA 1PBEA 4JY2A 3V3OA 1K0IA 3NYFA 1H2IA 3G5SA 2Q7VA 5U1OA 3ZYXA 1TDFA 4NZHA 1QJDA 1EL5A 1JRXA 3FPZA 4WX1A 4O5UA 1GPEA 1QLBA 3ALLA 4OPTA 4H4YA 3AE4A 2BXSA 4J2WA 2VQ7A 2JB3A 2ACZA 3DJEA 3QSSA 2IVEA 1JOAA 3PVCA 4JNQA 4U8LA 3SGLA 3BNUA 4OPDA 2GR2A 2Z5XA 2YAUA 4KPRA 3NG7X 2V60A 3RP7A 3SQPA 3K30A 1JRZA 5HHFA 1ZY8A 4C3XA 4XWRA 2AQJA 2GR3A 2E4GA 2XVEA 3KPKA 2BS3A 3GWDA 3IC9A 3KKJA 4CBQA 3UKLA 1GTHA 1LTXR 3C4NA 3P4SA 2B9XA 2XLUA 1PHHA 4B67A 2C3CA 2FBWA 1ZP0A 3GMBA 3NK2X 4BK2A 4UDRA 3CGEA 5IPYA 3PO7A 5J60A 1NHRA 4K7ZA 3AE7A 4B1BA 1LJ1A 2WOVA 4II2A 4FK1C 4K2XA 1GETA 1ZMDA 3F8PA 3RP8A 1F8WA 2C75A 3GWFA 1FEAA 4GAVA 1DOCA 5JCNA 5FS9A 2WDVA 1D5TA 2BA9A 4XWZA 4H7UA 1CHUA 3CTYA 1L9EA 4TM4A 4FK1A 3UKKA 4AT0A 2NPXA 1TDNA 5CQFA 3AE1A 3BI5A 4A6NB 3SZ0A 3G5RA 3F8RA 1S3BA 1LQUA 3DMEA 4IVOB 4H4QA 4G73A 3CGBA 1VDCA 4Y4NA 3H8IA 3T2ZA 4USQA 5KMPA 4Y4MA 2XCGA 1ZOYA 2BK3A 1D4EA 1S2YA 1LQTA 1PBCA 2V3BA 5M0ZA 2BK5A 2XDOA 4Z26A 2X50A 4OPLA 2R4EA 3SFDA 1LPFA 4X4JA 2YQUA 4A7AA 1F8SA 1DNCA 3NIXA 3NTDA 2E1MA 4HB9A 3QSMA 4AP3A 4FDCB 1D4DA 3NT6A 1M64A 3P4RA 3B3RA 5GRTA 1TYTA 2XVJA 3NN0X 3UKPA 4RG4A 5KOWA 1OJAA 1ZOVA 4II3A 3QFBA 3M0OA 2YLRA 1N1PA 5KXJA 3GRTA 4J36A 4TM3A 1N4VA 1P2EA 4YSXA 1Q1WA 1B8SA 1FCDA 1H7XA 4OVIA 3D8XA 4H4RA 3NLCA 2YVJA 1E1LA 2JK6A 2WBAA 2C72A 1VG0A 4I59A 1CC2A 4HA6A 4YSYA 3QVPA 4TM1A 3KA7A 1PJ5A 3ZDNA 3GRSA 1VG9A 2ZZBA 4N9XA 1IUXA 1L0VA 1GT8A 1NENA 2C7GA 3UTHA 2VRLA 2EQ9A 3IHGA 1X31B 2CDUA 1LV0A 4PAAA 1YQ3A 4ZCDA 2QA2A 1IJHA 3CPHG 5EOWA 3P1WA 2E5VA 3COXA 4H4WA 4CY6A 2YLZA 3AXBA 3SYIA 5KMRA 2WS3A 3GYJA 1BGNA 1DODA 2YG5A 3HYVA 5CKUA 1YKJA 2WPEA 4P9SA 1K0LA 4C3YA 3UOXA 2YLWA 3AD9B 3AD8B 1PJ7A 1GNDA 1OJCA 2YM1A 5HYMA 2FJAA 3LOVA 3CNDA 2R0CA 2YLSA 2DKIA 2XFPA 3RNMA 3NH3X 3S5WA 2GH5A 2WPFA 2B9WA 2BXRA 1O5WA 1S2QA 3JSKA 4K8DA 1GXFA 2GQWA 5IQ4A 4EQWA 4H4TA 4OCGA 2WOIA 4H50A 4G6GA 2XFQA 2WDRA 4H4PA 2XVIA 3OC4A 2R0PA 4AOXA 2TPRA 4YWOA 3DJJA 3WE0A 5C3JA 1S3EA 3ALJA 1ONFA 4GDEA 2EQ8A 3KPFA 1E7PA 4OPUA 2J3NA 2GAGB 1BF3A 1CJ4A 4J57A 4JN9A 5C2TA 2BK4A 4DSGA 1PDHA 2VVMA 1PBBA 2YG3A 3D9XA 3UTGA 3T2KA 1PXCA 1YQZA 5BUKA 1Z6LA 1PJ6A 2QCUA 3ICTA 4U8OA 4BJZA 1XDIA 2GMJA 5JCMA 3HYWA 3CGDA 2IIDA 3NN6X 3DK8A 4H2PA 4A99A 2V6OA 2X99A 4ECHA 1E6EA 4XXGA 3UOVA 4B65A 2VVLG 4OPCA 2WPCA 1PN0A 4U2TA 3REDA 4APNA 4YSZA 5KWFA 4YXDA 1BKWA 1NAAA 1V59A 4C74A 5KMSA 4EM3A 2C70A 3O0HA 3FMWA 3CNJA 1FEBA 1N4UA 2YG6A 2DKHA 2FJBA 2Q0LA 2YVGA 4CRTA 5HY5A 4USRA 2I0ZA 1FOHA 3AEAA 5ER0A 3KVEA 4ZCCA 1LVLA 3LXDA 1ZKQA 1XPQA 1JU2A 3AEDA 3CPIG 4LIIA 3AEGA 4Y4LA 3M12A 4U8IA 4DSHA 1UKVG 3AE5A 3IF9A 1O95A 1TDEA 2GEWA 5U63A 5HXIA 1K4QA 4A5LA 2BCPA 2H89A 1GRTA 3FIMB 5L46A 4A9WA 5JCKA 4Z2TA 3UTEA 3F8DA 3I3LA 4B64A 2WEUA 1ZK7A 1E39A 1Y0PA 4OPGA 2RGHA 4LU6A 1TDKA 1H6VA 1OJDA 3DH9A 3CNSA 4NTCA 3LJPA 2IVDA 1DXLA 1JEHA 3NK0X 1N4WA 3V76A 3EF6A 3LZXA 1GOSA 1GRHA 1H7WA 2WDQA 3L1RA 3DJDA 1KSUA 2R0GA 2YR6A 3BHKA 2C65A 2GQFA 2JB1A 1ZX9A 1PS9A 2R4JA 4JNAA 1E1KA 2WOWA 3UOYA 5FS8A 3EANA 2CULA 4Z24A 1BGJA 4U2SA 2RGOA 4B63A 2ARDA 3PS9A 1FL2A 3NYEA 1VQWA 2WP6A 1PBFA 4Z2UA 3I6DA 2WETA 4EIPA 3EPTA 3HYXA 3K7TA 1IUVA 1DOEA 4J56A 1BWCA 1GRBA 1RP0A 3IHMA 3KU9A 4CNKA 1NDAA 5GSNA 4WCTA 1DJQA 3L5OA 2NVKX 2BCGG 1F6MA 2Y6QA 3LZWA 5KVHA 3L8KA 2V5ZA 3ATQA 4J34A 4TLXA 3VR9A 4Z2RA 2GRTA 2GVCA 4GRTA 1ZMCA 3Q6JA 4JQ9A 1KFYA 2XVHA 4Z44A 2BRAA 3SZWA 3UP5A 3SX6A 5FS6A 2V61A 1GV4A 3SZFA 2BABA 4MJWA 1D7YA 2JBVA 3HZLA 4B66A 2YWLA 2FJDA 3AEBA 2YG4A 3GYXA 5BULA 2GR0A 1GSNA 3LB8A 4LA1A 1H84A 4GR1A 2B9YA 3Q9TA 3DGZA 4A6NA 1D4CA 2APGA 1COYA 2YR4A 2GB0A 3KD9A 5FS7A 1EBDA 3GD4A 4M52A 4U8MA 1S7MA 4UDQA 5KMQA 3P4PA 4CY8A 1ELIA 4YT0A 4GDPA 3UTFA 2X3NA 1REOA 3RHAA 1HYUA 2QA1A 4BJYA 3ISHA 1PXBA 3T31A 5LV9A 2OALA 2C3DA 1TDOA 2ZBWA 2C66A 3NK1X 3BI4A 3K7MX 5KRQA 4EQSA 1NHPA 1XANA 2XLSA 3AYLA 1P2HA 3ABVA 3C96A 4BV6A 1FECA 1BZLA 3NGCX 4X9NA 2W0HA 4YTMA 3CN8A 2VQBA 4IV9A 4A65A 4TLZA 4B69A 2RGJA 2VOUA 1E1MA 4O5QA 2VZ2A 2BC0A 4RSLA 3AE9A 4YTNA 2QAEA 1Q1RA 2V3AA 1Y56B 4G9KA 2OA1A 3CNPA 4GAPA 1B4VA 4JDRA 5U25A 1NG4A 1CBOA 2GAHB 4H4XA 2RABA 1L9CA 3AEFA 1H81A 2JB2A 4H4SA 5BRTA 2R9ZA 3FBSA 3K7QX 3H8LA 4C77A 3NTAA 4X9MA 1GERA 3GYIA 2FJEA 4H4UA 3URHA 1YQ4A 2EQ7A 2A89A 2XLRA 3ICRA 3NKSA 3UKAA 3UOZA 1NEKA 2C73A 2YLTA 2BACA 4OPIA 2X8CA 3NYCA 1GREA 4H2NA 4U2LA 5M10A 1GRAA 3ICSA 5EBKA 2XLPA 2Q0KA 2WU2A 4EMIA 4H4ZA 3AE8A 2XFOA 4YKFA 1KN0A 3T0KA 1JNZA 4EMWA 2EQ6A 3AECA 1GRGA 3T37A 5IQ1A 1IUWA 1KSSA 4BK1A 2YG7A 2XLTA 3ADAB 1DOBA 2XFUA 4G6HA 1K0JA 3G5QA 3UKHA 1B37A 3AD7B 4G74A 1XHCA 4H2QA 4NEVA 3IWAA 3RP6A 3S61A 3UCLA 1F3PA 4NNJA 3AE3A 1H83A 4K5RA 1TRBA 5EB4A 3AYJA 3VRBA 2BS4A 1VRQB 2B7SA 4PABA 4U8NA 1YY5A 3UKQA 4NEWA 1H82A 4GCMA 4I58A 3DK4A 4TM0A 2BRYA 5J7XA 3LADA 2YM2A 2GMHA 2WP9A 2ZZCA 2OAMA 2JKCA 3P9UA 4E0VA 4BURA 1OJ9A 2UZZA 1H86A 2JAEA 3GDNA 1MOKA 2PYXA 1MO9A 2X8HA 1ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUU A;  4D04 A;  2Y6R A;  4DNA A;  2WU5 A;  3GDP A;  3BI2 A;  2CFY A;  2OLN A;  1TYP A;  3AB1 A;  3QJ4 A;  4ICY A;  4YKG A;  3GSI A;  1Y56 A;  1NPX A;  4FX9 A;  1AOG A;  4EMJ A;  1GAL A;  2A87 A;  2OLO A;  1Q9I A;  3C4A A;  3NNE A;  1CJ2 A;  4AOS A;  2X8G A;  4RG3 A;  1JNR A;  1PBD A;  2TMD A;  2H88 A;  2CVJ A;  1QO8 A;  3DA1 A;  2AR8 A;  1RSG A;  4K22 A;  4KX6 A;  2C64 A;  3VRD B;  2YR5 A;  4ADW A;  1DJN A;  1KNR A;  2HQM A;  3CIR A;  5JCL A;  1CJC A;  4YSH A;  1NHQ A;  2ZZ0 A;  1D7L A;  2O9Z A;  2C76 A;  4U8J A;  1W4X A;  3FG2 P;  1IUS A;  3GD3 A;  4J31 A;  1JRY A;  1GES A;  2WHD A;  1CJ3 A;  4B68 A;  2YVF A;  3CPJ G;  3VQR A;  3AWI A;  4A79 A;  1EL7 A;  2BYB A;  4YTP A;  3NHO X;  3QFA A;  1RYI A;  2R46 A;  4UP3 A;  3UKF A;  3VRA A;  4U8P A;  4GF7 A;  3UP4 A;  4EM4 A;  1CF3 A;  1SEZ A;  3P4Q A;  4AT2 A;  1KNP A;  3OZ2 A;  3SM8 A;  2F5Z A;  3ATR A;  3CNT A;  1F8R A;  4CNJ A;  2VVL A;  1O94 A;  4J33 A;  3AE6 A;  4BK3 A;  1KF6 A;  4H2R A;  4EQR A;  3GMC A;  3H4K A;  1MXT A;  1IUT A;  2B76 A;  3ALM A;  1NHS A;  4DGK A;  1M6I A;  4NTD A;  4CCR A;  4Z43 A;  3EAO A;  4REK A;  1B5Q A;  2WQY A;  2XVF A;  1E1N A;  3M13 A;  3SFE A;  3R9U A;  3DK9 A;  2YLX A;  2BS2 A;  4U8K A;  2Z5Y A;  1GTE A;  3BNM A;  1EL8 A;  1CC6 A;  5FMH A;  1CC4 A;  2WP5 A;  2A8X A;  1L9D A;  2BC1 A;  2XYO A;  4Z25 A;  5KOX A;  3B6D A;  2GR1 A;  4EQX A;  5EB5 A;  4UDP A;  3AYI A;  1PXA A;  3V3N A;  3NRN A;  3DJG X;  2WES A;  2GV8 A;  3AEE A;  4EIQ A;  5DBJ A;  1KDG A;  4JY3 A;  3D1C A;  3KLJ A;  2B7R A;  4K5S A;  5KVI A;  1GRF A;  2R45 A;  2GF3 A;  4C5O A;  2AAQ A;  4ZN0 A;  1GEU A;  3CGC A;  3AE2 A;  1EL9 A;  2XFN A;  4H4V A;  3VR8 A;  4IVM B;  4D03 A;  5BVA A;  3BHF A;  4CCQ A;  3E1T A;  3QSE A;  2C67 A;  5JCI A;  4NTE A;  5TR3 A;  2Q6U A;  3QVR A;  4AP1 A;  2VRM A;  3II4 A;  1CL0 A;  4IA6 A;  4IA5 A;  4GUV A;  1NG3 A;  3DGH A;  2PHH A;  1OJT A;  3ITJ A;  1PBE A;  4JY2 A;  3V3O A;  1K0I A;  3NYF A;  3G5S A;  2Q7V A;  5U1O A;  3ZYX A;  1TDF A;  4NZH A;  1QJD A;  1EL5 A;  1JRX A;  3FPZ A;  4WX1 A;  4O5U A;  1GPE A;  1QLB A;  3ALL A;  4OPT A;  4H4Y A;  3AE4 A;  2BXS A;  4J2W A;  2VQ7 A;  2JB3 A;  2ACZ A;  3DJE A;  3QSS A;  2IVE A;  1JOA A;  3PVC A;  4JNQ A;  4U8L A;  3SGL A;  3BNU A;  4OPD A;  2GR2 A;  2Z5X A;  2YAU A;  4KPR A;  3NG7 X;  2V60 A;  3RP7 A;  3SQP A;  3K30 A;  1JRZ A;  5HHF A;  1ZY8 A;  4C3X A;  4XWR A;  2AQJ A;  2GR3 A;  2E4G A;  2XVE A;  2BS3 A;  3GWD A;  3IC9 A;  3KKJ A;  4CBQ A;  3UKL A;  1GTH A;  1LTX R;  3C4N A;  3P4S A;  2B9X A;  2XLU A;  1PHH A;  4B67 A;  2C3C A;  2FBW A;  1ZP0 A;  3GMB A;  3NK2 X;  4BK2 A;  4UDR A;  3CGE A;  5IPY A;  3PO7 A;  5J60 A;  1NHR A;  4K7Z A;  3AE7 A;  4B1B A;  1LJ1 A;  2WOV A;  4FK1 C;  4K2X A;  1GET A;  1ZMD A;  3F8P A;  3RP8 A;  1F8W A;  2C75 A;  3GWF A;  1FEA A;  1DOC A;  5JCN A;  5FS9 A;  2WDV A;  1D5T A;  2BA9 A;  4XWZ A;  4H7U A;  1CHU A;  3CTY A;  1L9E A;  4TM4 A;  4FK1 A;  3UKK A;  4AT0 A;  2NPX A;  1TDN A;  5CQF A;  3AE1 A;  3BI5 A;  4A6N B;  3G5R A;  3F8R A;  1S3B A;  1LQU A;  3DME A;  4IVO B;  4H4Q A;  3CGB A;  1VDC A;  4Y4N A;  3H8I A;  4USQ A;  4Y4M A;  2XCG A;  1ZOY A;  2BK3 A;  1D4E A;  1S2Y A;  1LQT A;  1PBC A;  2V3B A;  5M0Z A;  2BK5 A;  2XDO A;  4Z26 A;  2X50 A;  4OPL A;  2R4E A;  3SFD A;  1LPF A;  4X4J A;  2YQU A;  4A7A A;  1F8S A;  1DNC A;  3NIX A;  3NTD A;  2E1M A;  4HB9 A;  3QSM A;  4AP3 A;  4FDC B;  1D4D A;  3NT6 A;  1M64 A;  3P4R A;  3B3R A;  5GRT A;  1TYT A;  2XVJ A;  3NN0 X;  3UKP A;  4RG4 A;  5KOW A;  1OJA A;  1ZOV A;  3QFB A;  3M0O A;  2YLR A;  1N1P A;  5KXJ A;  3GRT A;  4J36 A;  4TM3 A;  1N4V A;  1P2E A;  4YSX A;  1Q1W A;  1B8S A;  1FCD A;  1H7X A;  4OVI A;  3D8X A;  4H4R A;  3NLC A;  2YVJ A;  1E1L A;  2JK6 A;  2WBA A;  2C72 A;  1VG0 A;  4I59 A;  1CC2 A;  4HA6 A;  4YSY A;  3QVP A;  4TM1 A;  3KA7 A;  1PJ5 A;  3ZDN A;  3GRS A;  1VG9 A;  2ZZB A;  4N9X A;  1IUX A;  1L0V A;  1GT8 A;  1NEN A;  2C7G A;  3UTH A;  2VRL A;  2EQ9 A;  3IHG A;  1X31 B;  2CDU A;  1LV0 A;  4PAA A;  1YQ3 A;  4ZCD A;  2QA2 A;  1IJH A;  3CPH G;  5EOW A;  3P1W A;  2E5V A;  3COX A;  4H4W A;  4CY6 A;  2YLZ A;  3AXB A;  2WS3 A;  3GYJ A;  1BGN A;  1DOD A;  2YG5 A;  5CKU A;  1YKJ A;  2WPE A;  4P9S A;  1K0L A;  4C3Y A;  3UOX A;  2YLW A;  3AD9 B;  3AD8 B;  1PJ7 A;  1GND A;  1OJC A;  2YM1 A;  5HYM A;  2FJA A;  3LOV A;  3CND A;  2R0C A;  2YLS A;  2DKI A;  2XFP A;  3RNM A;  3NH3 X;  3S5W A;  2GH5 A;  2WPF A;  2B9W A;  2BXR A;  1O5W A;  1S2Q A;  3JSK A;  4K8D A;  1GXF A;  2GQW A;  5IQ4 A;  4EQW A;  4H4T A;  4OCG A;  2WOI A;  4H50 A;  2XFQ A;  2WDR A;  4H4P A;  2XVI A;  3OC4 A;  2R0P A;  4AOX A;  2TPR A;  4YWO A;  3DJJ A;  3WE0 A;  5C3J A;  1S3E A;  3ALJ A;  1ONF A;  4GDE A;  2EQ8 A;  3KPF A;  1E7P A;  4OPU A;  2J3N A;  2GAG B;  1BF3 A;  1CJ4 A;  4J57 A;  4JN9 A;  5C2T A;  2BK4 A;  4DSG A;  1PDH A;  2VVM A;  1PBB A;  2YG3 A;  3UTG A;  1PXC A;  1YQZ A;  5BUK A;  1Z6L A;  1PJ6 A;  2QCU A;  3ICT A;  4U8O A;  4BJZ A;  1XDI A;  2GMJ A;  5JCM A;  3CGD A;  2IID A;  3NN6 X;  3DK8 A;  4H2P A;  4A99 A;  2V6O A;  2X99 A;  4ECH A;  1E6E A;  4XXG A;  3UOV A;  4B65 A;  2VVL G;  4OPC A;  2WPC A;  1PN0 A;  4U2T A;  3RED A;  4APN A;  4YSZ A;  5KWF A;  4YXD A;  1BKW A;  1NAA A;  1V59 A;  4C74 A;  4EM3 A;  2C70 A;  3O0H A;  3FMW A;  3CNJ A;  1FEB A;  1N4U A;  2YG6 A;  2DKH A;  2FJB A;  2Q0L A;  2YVG A;  4CRT A;  5HY5 A;  4USR A;  2I0Z A;  1FOH A;  3AEA A;  5ER0 A;  3KVE A;  4ZCC A;  1LVL A;  3LXD A;  1ZKQ A;  1XPQ A;  1JU2 A;  3AED A;  3CPI G;  4LII A;  3AEG A;  4Y4L A;  3M12 A;  4U8I A;  4DSH A;  1UKV G;  3AE5 A;  3IF9 A;  1O95 A;  1TDE A;  2GEW A;  5U63 A;  5HXI A;  1K4Q A;  4A5L A;  2BCP A;  2H89 A;  1GRT A;  3FIM B;  5L46 A;  4A9W A;  5JCK A;  4Z2T A;  3UTE A;  3F8D A;  3I3L A;  4B64 A;  2WEU A;  1ZK7 A;  1E39 A;  1Y0P A;  4OPG A;  2RGH A;  4LU6 A;  1TDK A;  1H6V A;  1OJD A;  3DH9 A;  3CNS A;  4NTC A;  3LJP A;  2IVD A;  1DXL A;  1JEH A;  3NK0 X;  1N4W A;  3V76 A;  3EF6 A;  3LZX A;  1GOS A;  1GRH A;  1H7W A;  2WDQ A;  3L1R A;  3DJD A;  1KSU A;  2R0G A;  2YR6 A;  3BHK A;  2C65 A;  2GQF A;  2JB1 A;  1ZX9 A;  1PS9 A;  2R4J A;  4JNA A;  1E1K A;  2WOW A;  3UOY A;  5FS8 A;  3EAN A;  2CUL A;  4Z24 A;  1BGJ A;  4U2S A;  2RGO A;  4B63 A;  2ARD A;  3PS9 A;  1FL2 A;  3NYE A;  1VQW A;  2WP6 A;  1PBF A;  4Z2U A;  3I6D A;  2WET A;  4EIP A;  3EPT A;  3K7T A;  1IUV A;  1DOE A;  4J56 A;  1BWC A;  1GRB A;  1RP0 A;  3IHM A;  3KU9 A;  4CNK A;  1NDA A;  5GSN A;  4WCT A;  1DJQ A;  2NVK X;  2BCG G;  1F6M A;  2Y6Q A;  3LZW A;  5KVH A;  3L8K A;  2V5Z A;  3ATQ A;  4J34 A;  4TLX A;  3VR9 A;  4Z2R A;  2GRT A;  2GVC A;  4GRT A;  1ZMC A;  3Q6J A;  4JQ9 A;  1KFY A;  2XVH A;  4Z44 A;  3UP5 A;  5FS6 A;  2V61 A;  1GV4 A;  2BAB A;  4MJW A;  1D7Y A;  2JBV A;  3HZL A;  4B66 A;  2YWL A;  2FJD A;  3AEB A;  2YG4 A;  5BUL A;  2GR0 A;  1GSN A;  3LB8 A;  4LA1 A;  1H84 A;  4GR1 A;  2B9Y A;  3Q9T A;  3DGZ A;  4A6N A;  1D4C A;  2APG A;  1COY A;  2YR4 A;  2GB0 A;  3KD9 A;  5FS7 A;  1EBD A;  3GD4 A;  4M52 A;  4U8M A;  4UDQ A;  4CY8 A;  3P4P A;  1ELI A;  4YT0 A;  4GDP A;  3UTF A;  2X3N A;  1REO A;  3RHA A;  1HYU A;  2QA1 A;  4BJY A;  3ISH A;  1PXB A;  5LV9 A;  2OAL A;  2C3D A;  1TDO A;  2ZBW A;  2C66 A;  3NK1 X;  3BI4 A;  3K7M X;  5KRQ A;  4EQS A;  1NHP A;  1XAN A;  2XLS A;  3AYL A;  1P2H A;  3ABV A;  3C96 A;  4BV6 A;  1FEC A;  1BZL A;  3NGC X;  4X9N A;  2W0H A;  4YTM A;  3CN8 A;  2VQB A;  4IV9 A;  4A65 A;  4TLZ A;  4B69 A;  2RGJ A;  2VOU A;  1E1M A;  4O5Q A;  2VZ2 A;  2BC0 A;  4RSL A;  3AE9 A;  4YTN A;  2QAE A;  1Q1R A;  1Y56 B;  2V3A A;  2OA1 A;  3CNP A;  1B4V A;  4JDR A;  5U25 A;  1NG4 A;  1CBO A;  2GAH B;  4H4X A;  2RAB A;  1L9C A;  3AEF A;  1H81 A;  2JB2 A;  4H4S A;  5BRT A;  2R9Z A;  3FBS A;  3K7Q X;  3H8L A;  4C77 A;  3NTA A;  4X9M A;  1GER A;  3GYI A;  2FJE A;  4H4U A;  3URH A;  1YQ4 A;  2EQ7 A;  2A89 A;  2XLR A;  3ICR A;  3NKS A;  3UKA A;  3UOZ A;  1NEK A;  2C73 A;  2YLT A;  2BAC A;  4OPI A;  2X8C A;  3NYC A;  1GRE A;  4H2N A;  4U2L A;  5M10 A;  1GRA A;  3ICS A;  5EBK A;  2XLP A;  2Q0K A;  2WU2 A;  4EMI A;  4H4Z A;  3AE8 A;  2XFO A;  4YKF A;  1JNZ A;  4EMW A;  2EQ6 A;  3AEC A;  1GRG A;  3T37 A;  5IQ1 A;  1IUW A;  1KSS A;  4BK1 A;  2YG7 A;  2XLT A;  3ADA B;  1DOB A;  2XFU A;  1K0J A;  3G5Q A;  3UKH A;  1B37 A;  3AD7 B;  1XHC A;  4H2Q A;  4NEV A;  3IWA A;  3RP6 A;  3S61 A;  3UCL A;  1F3P A;  3AE3 A;  1H83 A;  4K5R A;  1TRB A;  5EB4 A;  3AYJ A;  3VRB A;  2BS4 A;  1VRQ B;  2B7S A;  4PAB A;  4U8N A;  1YY5 A;  3UKQ A;  4NEW A;  1H82 A;  4GCM A;  4I58 A;  3DK4 A;  4TM0 A;  5J7X A;  3LAD A;  2YM2 A;  2GMH A;  2WP9 A;  2ZZC A;  2OAM A;  2JKC A;  3P9U A;  4E0V A;  4BUR A;  1OJ9 A;  2UZZ A;  1H86 A;  2JAE A;  3GDN A;  1MOK A;  2PYX A;  1MO9 A;  2X8H A;  1ZDL A; 
#chains in the Genus database with same CATH topology
 3TOY A;  2CFY A;  3T9P A;  3QJ4 A;  4YKG A;  3GSI A;  4AOS A;  2FKP A;  4IZG A;  1FIQ B;  1KNR A;  1R6W A;  1D7L A;  2O9Z A;  3EEZ A;  2PGE A;  4U8J A;  1GES A;  2WHD A;  1CJ3 A;  4B68 A;  5IDZ A;  4A6G A;  3AWI A;  5JRB A;  1RYI A;  4GF7 A;  3UP4 A;  3MWC A;  3ATR A;  3CNT A;  5J04 A;  1F8R A;  4CNJ A;  3AE6 A;  3GMC A;  1MXT A;  3UCD A;  2B76 A;  3ALM A;  4DGK A;  4Z43 A;  1B5Q A;  2WQY A;  1N5X A;  3M13 A;  3SFE A;  3R9U A;  4MKS A;  2YLX A;  1E9I A;  2BS2 A;  3BNM A;  1EL8 A;  3GY1 A;  1CC4 A;  2WP5 A;  3B6D A;  3AYI A;  3V3N A;  3NRN A;  2WES A;  1KCZ A;  3I6T A;  3D1C A;  3V5F A;  1X2H A;  2GF3 A;  3CMM A;  3AE2 A;  2XFN A;  4D03 A;  4DWD A;  3E1T A;  2C67 A;  3SSZ A;  2Q6U A;  4AP1 A;  3II4 A;  4IA6 A;  4GUV A;  4X2P A;  1OEP A;  1PBE A;  3ZYX A;  4NZH A;  2AKZ A;  4HPN A;  1GPE A;  3Q4D A;  4TVY A;  4H83 A;  2OZT A;  3NO1 A;  2IVE A;  2Z5X A;  2YAU A;  3NG7 X;  3T8Q A;  4XWR A;  3FXG A;  3KPK A;  3GWD A;  1WUF A;  4CBQ A;  1GTH A;  3C4N A;  3P4S A;  4DHG A;  1PHH A;  3NK2 X;  4UDR A;  5J60 A;  1NHR A;  3AE7 A;  4B1B A;  2WOV A;  3VFC A;  4II2 A;  3F8P A;  5EU9 A;  1DOC A;  2WDV A;  4ENL A;  1EBG A;  4IT1 A;  5CQF A;  5FJT A;  3SZ0 A;  3D46 A;  4IVO B;  3H8I A;  3T2Z A;  5KMP A;  2XCG A;  2PMQ A;  2E5A A;  3ENL A;  2BK5 A;  2R4E A;  3SFD A;  4A7A A;  3NFU A;  3SR6 B;  1DNC A;  3NIX A;  4HB9 A;  4AP3 A;  4A35 A;  3B3R A;  2OVL A;  4GME A;  4RG4 A;  2YLR A;  1N1P A;  3DEQ A;  3GRT A;  4J36 A;  1P2E A;  1Q1W A;  3NLC A;  1E1L A;  2JK6 A;  3FJ4 A;  6ENL A;  1PDY A;  4TM1 A;  1PJ5 A;  1VG9 A;  1IUX A;  3PWG A;  1NEN A;  2C7G A;  4G8T A;  1YQ3 A;  3BOX A;  3UJE A;  3P1W A;  3COX A;  4H4W A;  3GYJ A;  1BGN A;  4IL2 A;  2DW7 A;  2YG5 A;  1K0L A;  2PS2 A;  3AD8 B;  3AD9 B;  1OJC A;  2FJA A;  3CND A;  2R0C A;  4FP1 A;  3S5W A;  1YEY A;  3FCP A;  4GIR A;  4H50 A;  2XFQ A;  2XVI A;  2R0P A;  4AOX A;  3I4K A;  4YWO A;  3WE0 A;  5BOE A;  1ONF A;  2EQ8 A;  2QGY A;  1BF3 A;  2XSX A;  4JN9 A;  2BK4 A;  4DSG A;  1PDH A;  3N4E A;  4GFI A;  2QCU A;  1PJ6 A;  4BJZ A;  3S5S A;  2GMJ A;  3TTE A;  3HYW A;  3CGD A;  2IID A;  3DK8 A;  4H2P A;  2V6O A;  2X99 A;  4HN8 A;  1E6E A;  4B65 A;  3QTP A;  2AL2 B;  4YXD A;  1NAA A;  4C74 A;  4EM3 A;  1N4U A;  4IP4 A;  1EC7 A;  4USR A;  1FOH A;  3AEA A;  5ER0 A;  1LVL A;  3IJI A;  2FYM A;  1BKH A;  3AEG A;  4U8I A;  2QJJ A;  5U63 A;  1K4Q A;  2H89 A;  5L46 A;  5JCK A;  1P48 A;  2POZ A;  4Z2T A;  4B64 A;  2WEU A;  2RGH A;  1H6V A;  4NTC A;  1N4W A;  3V76 A;  1GOS A;  2PPG A;  2OO6 A;  2AL1 A;  3UXK A;  1FFU C;  2C65 A;  1PS9 A;  3H7V A;  1E1K A;  3UOY A;  1ONE A;  2CUL A;  4Z24 A;  3TQP A;  4B63 A;  3PS9 A;  3GO2 A;  1FL2 A;  2WP6 A;  3DER A;  3EPT A;  1IUV A;  3VC5 A;  4CNK A;  1DJQ A;  3LZW A;  1L8P A;  2GVC A;  2XVH A;  3UJ2 A;  3SZW A;  2BRA A;  2BAB A;  1D7Y A;  2JBV A;  3RGT A;  3HZL A;  2QJM A;  2FJD A;  2YG4 A;  1GSN A;  3LB8 A;  3DGZ A;  2YR4 A;  4M52 A;  2OFJ A;  3QPE A;  2OKT A;  1ELI A;  4GDP A;  3UTF A;  3IJL A;  3K7M X;  1NHP A;  3AYL A;  3FVD A;  4B69 A;  3DG3 A;  2RGJ A;  4O5Q A;  2QAE A;  4G9K A;  1B4V A;  1NG4 A;  1TE6 A;  1SJB A;  5FJP A;  1H81 A;  3FYY A;  3K1G A;  3K7Q X;  3H8L A;  1BQG A;  4X9M A;  4H4U A;  3ICR A;  4MGG A;  2C73 A;  2BAC A;  2X8C A;  4U2L A;  4Z1Y A;  2OQH A;  2XFO A;  1KN0 A;  2EQ6 A;  1ZXI C;  5IQ1 A;  1IUW A;  2XLT A;  3ADA B;  1TKK A;  4MMW A;  1DOB A;  2XFU A;  3UJR A;  3BSM A;  3UKH A;  3UCL A;  4K5R A;  1TRB A;  5EB4 A;  1VRQ B;  2XH0 A;  4U8N A;  4I58 A;  3V4B A;  2BRY A;  2GMH A;  2ZZC A;  1OJ9 A;  1MO9 A;  2X8H A;  1ZDL A;  1IUU A;  5G5G B;  4J3Z A;  3GDP A;  3BI2 A;  2CHR A;  3ZLG A;  1SJD A;  2XGZ A;  4ICY A;  1Y56 A;  1NPX A;  2OLO A;  4EMJ A;  2C4C A;  1CJ2 A;  2X8G A;  1JNR A;  3NVY B;  1RSG A;  2C64 A;  3VRD B;  3CIR A;  5JCL A;  1NHQ A;  2C76 A;  3SXI A;  3A7R A;  3FG2 P;  3TWA A;  4J31 A;  2PTX A;  2YVF A;  3CPJ G;  1W6T A;  2W54 A;  1EL7 A;  3VRA A;  3I6E A;  4UP3 A;  3UKF A;  2HNE A;  3T2Y A;  4AT2 A;  3OZ2 A;  1MNS A;  4K1W A;  2VVL A;  4J33 A;  3CAW A;  3TWB A;  4H2R A;  1NHS A;  1M6I A;  3OP2 A;  3PFR A;  4NTD A;  4CCR A;  5KNL A;  1E1N A;  1L9D A;  2A8X A;  5KOX A;  2XYO A;  4EQX A;  3DJG X;  2GV8 A;  3SZC A;  2R45 A;  4C5O A;  4ZN0 A;  1MUC A;  1GEU A;  3CGC A;  5BVA A;  3BHF A;  5JCI A;  3QVR A;  2VRM A;  1WYG A;  3DGH A;  3B97 A;  3V3O A;  3DFY A;  3NRZ B;  1EL5 A;  1JRX A;  4Z17 A;  4H4Y A;  3TJI A;  2VQ7 A;  2JB3 A;  3BNU A;  2GR2 A;  1JRZ A;  1PDZ A;  4C3X A;  2E4G A;  4G7F A;  2BS3 A;  3IC9 A;  3ZVI A;  4B67 A;  1ZP0 A;  3CGE A;  5IPY A;  1LJ1 A;  4FK1 C;  1GET A;  3RP8 A;  2C75 A;  4GAV A;  5FS9 A;  4TM4 A;  3UKK A;  3CTY A;  1L9E A;  4AT0 A;  2NPX A;  1TDN A;  3AE1 A;  3BI5 A;  4A6N B;  3U9I A;  3G5R A;  4H4Q A;  1VDC A;  1WUE A;  4FI4 A;  4HNL A;  1N5W C;  1S2Y A;  1LQT A;  5M0Z A;  2V3B A;  2X50 A;  4FDC B;  1D4D A;  1M64 A;  2XVJ A;  3NN0 X;  3UKP A;  2P0I A;  4II3 A;  3QFB A;  3CB3 A;  4HCH A;  4TM3 A;  1N4V A;  3VA8 A;  4YSX A;  1FCD A;  1H7X A;  3D8X A;  2AKM A;  4I59 A;  4YSY A;  5FJO A;  3NXL A;  1L0V A;  3UTH A;  2VRL A;  2EQ9 A;  1X31 B;  2CDU A;  4ZCD A;  1JDF A;  2QA2 A;  3HW2 A;  3CPH G;  5EOW A;  2O56 A;  1YKJ A;  4C3Y A;  3UOX A;  1EC9 A;  2YLS A;  3R07 C;  2HXU A;  2GH5 A;  2BXR A;  1O5W A;  2GQW A;  5IQ4 A;  4H4P A;  4EWJ A;  3AM9 A;  3SBF A;  1E7P A;  1CJ4 A;  2VVM A;  2OZ3 A;  3H12 A;  2QDE A;  3PK7 A;  5BUK A;  1Z6L A;  4U8O A;  5JCM A;  3ZLH A;  4A99 A;  4U2T A;  2WPC A;  1BKW A;  3SQS A;  3EKG A;  3CNJ A;  2FJB A;  2Q0L A;  3V3W A;  3STP A;  3LXD A;  3AED A;  3CPI G;  4LII A;  1N63 C;  3AE5 A;  3IF9 A;  1O95 A;  2GEW A;  1SB3 B;  5HXI A;  4M0X A;  3UTE A;  3CXB A;  1E39 A;  3DH9 A;  4HYR A;  1GRH A;  4KT2 A;  4A9W A;  3BHK A;  2GQF A;  1ZX9 A;  2QJN A;  3EAN A;  2P88 A;  1MRA A;  1BGJ A;  2ARD A;  3NYE A;  4HNC A;  4EIP A;  3HYX A;  4J56 A;  1BWC A;  3IHM A;  3L5O A;  5KVH A;  2V5Z A;  3VR9 A;  4YWS A;  4Z2R A;  2W3S A;  4Z44 A;  4GRT A;  1ZMC A;  3Q6J A;  3A7U A;  1GV4 A;  4MJW A;  4B66 A;  4J1O A;  2YWL A;  2MNR A;  5FJR A;  2GR0 A;  3N4F A;  3Q9T A;  4A6N A;  1D4C A;  2GB0 A;  3KD9 A;  5FS7 A;  3P4P A;  2QA1 A;  4BJY A;  5LV9 A;  2OAL A;  2C66 A;  3BI4 A;  4EQS A;  4A3R A;  2XLS A;  3ABV A;  1FEC A;  1BZL A;  4X9N A;  2W0H A;  4K8G A;  4YTM A;  4A65 A;  2VZ2 A;  2I5Q A;  1Q1R A;  1Y56 B;  4DX3 A;  2OA1 A;  4KPL A;  2GAH B;  4H4X A;  3AEF A;  1XPY A;  3THU A;  3GYI A;  1YQ4 A;  2XLR A;  2A89 A;  4OPI A;  1N62 C;  1GRE A;  1GRA A;  3ICS A;  5EBK A;  2XLP A;  2WU2 A;  4EMI A;  3UJF A;  4H4Z A;  4KWS A;  3T0K A;  1GRG A;  4GGH A;  2OLA A;  3R1Z A;  3MY9 A;  4G6H A;  4K2S A;  3G5Q A;  3NVZ B;  1XHC A;  4NEV A;  1RVK A;  1F3P A;  3FV9 A;  4GYP A;  3AYJ A;  3VRB A;  4PAB A;  3UKQ A;  4NEW A;  1H82 A;  4TM0 A;  5J7X A;  2YM2 A;  2WP9 A;  3OW1 A;  1H86 A;  4D04 A;  4DNA A;  3RO6 A;  2QDD A;  2OLN A;  3AB1 A;  3T14 A;  4F4R A;  3C4A A;  1Q9I A;  1IYX A;  2RDX A;  4DN1 A;  1PBD A;  2TMD A;  2PP1 A;  1QO8 A;  1KKR A;  2YR5 A;  4ADW A;  1DJN A;  3DFH A;  2ZZ0 A;  3PG6 A;  1N61 C;  1W4X A;  3GD3 A;  2QQ6 A;  2BYB A;  4YTP A;  3NHO X;  3QFA A;  4ZCW A;  4U8P A;  4EM4 A;  3P4Q A;  1X2G A;  2F5Z A;  1O94 A;  4BK3 A;  4EQR A;  3H4K A;  1IUT A;  3ZLF A;  2XVF A;  3DK9 A;  4U8K A;  1GTE A;  5FMH A;  1EC8 A;  4UDP A;  3AEE A;  5DBJ A;  1KDG A;  4JY3 A;  3OTR A;  3KLJ A;  2B7R A;  5KVI A;  1GRF A;  2AAQ A;  3U4F A;  1EL9 A;  3VR8 A;  4CCQ A;  4NTE A;  1JPD X;  1CL0 A;  4IA5 A;  2PHH A;  3MZN A;  3ITJ A;  4JY2 A;  1K0I A;  3G5S A;  2Q7V A;  5U1O A;  1TDF A;  3R25 A;  3VCC A;  1QLB A;  1N60 C;  2BXS A;  2ACZ A;  3DJE A;  3QSS A;  3PVC A;  1JOA A;  3SGL A;  4JNQ A;  3JVA A;  4U8L A;  4KPR A;  3SQP A;  2GGJ A;  1ECQ A;  1ZY8 A;  2PGW A;  3KKJ A;  3UKL A;  2XLU A;  3GMB A;  3P3B A;  4K7Z A;  1F8W A;  1FEA A;  5JCN A;  2BA9 A;  4XWZ A;  1CHU A;  3ES8 A;  3F8R A;  1S3B A;  1TZZ A;  4G73 A;  4Y4N A;  1ZOY A;  2PTZ A;  5BOF A;  2OQY A;  1PBC A;  4Z26 A;  1FFV C;  1LPF A;  4X4J A;  4TVW A;  3MKC A;  3H70 A;  3DDM A;  5GRT A;  1TYT A;  3JW7 A;  3TW9 A;  1OJA A;  1ZOV A;  4M6U A;  4H4R A;  2WBA A;  2C72 A;  1VG0 A;  1CC2 A;  2PP0 A;  3QVP A;  3KA7 A;  3ZDN A;  1KD0 A;  4E5T A;  2ZZB A;  4N9X A;  1STZ A;  1IJH A;  3MUC A;  2YLZ A;  5KMR A;  3RR1 A;  2E3T A;  2YLW A;  1PJ7 A;  5HYM A;  2GGG A;  2XFP A;  3RNM A;  3NH3 X;  2WPF A;  3AN1 A;  4K8D A;  1GXF A;  3OZY A;  3A7A A;  4EQW A;  2P8C A;  4OCG A;  2WOI A;  2WDR A;  2TPR A;  1S3E A;  3ALJ A;  4GDE A;  2PP3 A;  2J3N A;  4J57 A;  4ROP A;  2YG3 A;  1PBB A;  3D9X A;  3UTG A;  3NN6 X;  2VVL G;  1PN0 A;  3IK4 A;  3QN3 A;  4APN A;  2OG9 A;  1V59 A;  5KMS A;  2C70 A;  3O0H A;  1DTN A;  3FMW A;  1FEB A;  2YG6 A;  2DKH A;  2YVG A;  3VCN A;  4CRT A;  5HY5 A;  2I0Z A;  2PTY A;  3NZG A;  2W55 A;  1JU2 A;  2DW6 A;  4DSH A;  1TDE A;  4A5L A;  2BCP A;  1GRT A;  3F8D A;  3I3L A;  2P3Z A;  1Y0P A;  3T4W A;  4LU6 A;  4JHM A;  3CNS A;  3DG7 A;  3LJP A;  2IVD A;  1JEH A;  3NK0 X;  3EF6 A;  3LZX A;  2POD A;  3GC2 A;  3DJD A;  1KSU A;  2YR6 A;  3MSY A;  2JB1 A;  2R4J A;  2WOW A;  3JZU A;  4U2S A;  2RGO A;  1VQW A;  1PBF A;  4Z2U A;  3I6D A;  1F9C A;  4E4U A;  1NDA A;  5GSN A;  3IJQ A;  3L8K A;  3ATQ A;  4J34 A;  3CK5 A;  2GRT A;  4JN7 A;  3SN4 A;  3B9J B;  3SZF A;  3DIP A;  2PSN A;  4KEM A;  5FJU A;  3AEB A;  3GYX A;  5BUL A;  3H8A A;  3ZVH A;  4IHC A;  4GR1 A;  3EUB 3;  2APG A;  3PWI A;  1EBD A;  3GD4 A;  4CY8 A;  5KMQ A;  4YT0 A;  3ISH A;  2C3D A;  2ZBW A;  4H1Z A;  1XAN A;  2GGI A;  3NS1 B;  3C96 A;  4BV6 A;  3R0U A;  4IV9 A;  4TLZ A;  2GSH A;  5G5H B;  1E1M A;  2BC0 A;  4RSL A;  4YTN A;  3HRD C;  5U25 A;  5BRT A;  3Q45 A;  3MQT A;  2JB2 A;  2R9Z A;  4C77 A;  1GER A;  2FJE A;  3UOZ A;  3SN0 A;  3NVV B;  3UKA A;  1SJC A;  2OX4 A;  5M10 A;  4H2N A;  2PTW A;  1JNZ A;  4EMW A;  3AEC A;  1JRP A;  5ENL A;  3AD7 B;  3IWA A;  3S61 A;  3P93 A;  4NNJ A;  3AE3 A;  2B7S A;  1YY5 A;  4GCM A;  3DK4 A;  2GDQ A;  3LAD A;  2OAM A;  2PCE A;  2JKC A;  3P9U A;  4E0V A;  2UZZ A;  1MDL A;  2JAE A;  3GDN A;  1MOK A;  2PYX A;  1FO4 A;  2Y6R A;  2WU5 A;  4IL0 A;  4JN8 A;  1TYP A;  2GGE A;  4FX9 A;  1AOG A;  1GAL A;  2A87 A;  4OPG A;  3RRA A;  3NNE A;  4RG3 A;  2H88 A;  2CVJ A;  3DA1 A;  2ZAD A;  2AR8 A;  4K22 A;  4KX6 A;  2HQM A;  3SY4 A;  1CJC A;  4YSH A;  2ONE A;  7ENL A;  4E4F A;  2ZC8 A;  1IUS A;  1JRY A;  3OZM A;  3VQR A;  4A79 A;  2R46 A;  3GD6 A;  1CF3 A;  1SEZ A;  1KNP A;  3SM8 A;  3AMZ A;  4H2H A;  4E8G A;  1KF6 A;  4NWZ A;  1JRO A;  3EAO A;  4REK A;  3OPS A;  3CYJ A;  2Z5Y A;  1CC6 A;  2BC1 A;  4Z25 A;  2GR1 A;  5EB5 A;  1PXA A;  4EIQ A;  3UXL A;  2XH2 A;  2XH7 A;  3DES A;  4K5S A;  3T6C A;  4H4V A;  4IVM B;  3QSE A;  3DG6 A;  3QKE A;  5TR3 A;  1NG3 A;  1OJT A;  3NYF A;  1H2I A;  1QJD A;  3FPZ A;  4WX1 A;  4O5U A;  3ALL A;  4OPT A;  3AE4 A;  3UJS A;  4J2W A;  3V5C A;  3D47 A;  4OPD A;  2V60 A;  3RP7 A;  3K30 A;  5HHF A;  2AQJ A;  2GR3 A;  2XVE A;  4GGB A;  3N6H A;  1LTX R;  2B9X A;  2C3C A;  2FBW A;  4BK2 A;  3UGV A;  3PO7 A;  3SN1 A;  4K2X A;  1ZMD A;  3GWF A;  1D5T A;  4H7U A;  4FK1 A;  3QLD A;  2PU1 A;  2HXT A;  1LQU A;  3DME A;  3CGB A;  1R0M A;  4USQ A;  3SJN A;  4Y4M A;  2BK3 A;  1D4E A;  1VQZ A;  3VC6 A;  2XDO A;  4OPL A;  2YQU A;  3R10 A;  1F8S A;  3BJS A;  3NTD A;  2E1M A;  3QSM A;  3NT6 A;  1T3Q C;  3DGB A;  3P4R A;  5KOW A;  3RCY A;  1FHV A;  3M0O A;  5KXJ A;  3P0W A;  1B8S A;  4OVI A;  2YVJ A;  1P43 A;  4HA6 A;  4ZA0 A;  4DXK A;  2PU0 A;  3GRS A;  1EBH A;  1GT8 A;  4HCL A;  3IHG A;  2P8B A;  1LV0 A;  4PAA A;  1ELS A;  2E5V A;  4CY6 A;  3AXB A;  3SYI A;  2WS3 A;  1DOD A;  3HYV A;  5CKU A;  2WPE A;  4P9S A;  3ETR B;  1GND A;  2YM1 A;  3LOV A;  2DKI A;  2B9W A;  1S2Q A;  3JSK A;  4H4T A;  4G6G A;  1XS2 A;  3OC4 A;  2W3R A;  3DJJ A;  5C3J A;  3RIT A;  3S47 A;  3KPF A;  4OPU A;  2GAG B;  5C2T A;  3R11 A;  2GGH A;  1SJA A;  3T2K A;  1PXC A;  1YQZ A;  3ICT A;  1V97 A;  1XDI A;  1NU5 A;  4ECH A;  4XXG A;  3UOV A;  4OPC A;  3RED A;  5KWF A;  4YSZ A;  3HPF A;  2PA6 A;  3KVE A;  4ZCC A;  3KUM A;  1ZKQ A;  1XPQ A;  3ZVH B;  4Y4L A;  3M12 A;  1UKV G;  1JPM A;  4IP5 A;  3FIM B;  1ZK7 A;  4GIS A;  1TDK A;  1OJD A;  3TJ4 A;  1DXL A;  1H7W A;  2WDQ A;  1FHU A;  3L1R A;  1MDR A;  2R0G A;  4JNA A;  3NVW B;  5FS8 A;  1JCT A;  2WET A;  3TCS A;  3K7T A;  1DOE A;  1GRB A;  4ZOH B;  1RP0 A;  3R0K A;  3KU9 A;  4WCT A;  2AL2 A;  2NVK X;  2BCG G;  1F6M A;  2Y6Q A;  4TLX A;  4JQ9 A;  1KFY A;  3UP5 A;  3SX6 A;  5FS6 A;  3N6J A;  2V61 A;  3CT2 A;  4LA1 A;  1H84 A;  2B9Y A;  1VDV A;  1COY A;  4U8M A;  1S7M A;  4UDQ A;  3CXO A;  2X3N A;  1REO A;  3RHA A;  1HYU A;  1PXB A;  3T31 A;  2MUC A;  1RM6 B;  1TDO A;  3NK1 X;  5KRQ A;  2GL5 A;  1P2H A;  3ES7 A;  3NGC X;  1KKO A;  3CN8 A;  2VQB A;  2OZ8 A;  2VOU A;  3AE9 A;  2V3A A;  4GAP A;  3CNP A;  4JDR A;  1CBO A;  2RAB A;  1L9C A;  4H4S A;  3FBS A;  3NTA A;  3URH A;  2EQ7 A;  3NKS A;  1NEK A;  4DYE A;  2YLT A;  3NYC A;  2Q0K A;  3AE8 A;  4YKF A;  3VDG A;  2NQL A;  3T37 A;  2HZG A;  1KSS A;  4BK1 A;  4GYP C;  4H19 A;  2YG7 A;  1K0J A;  1B37 A;  4G74 A;  4H2Q A;  3RP6 A;  1H83 A;  2BS4 A;  4E6M A;  4BUR A;  4HCD A;  1NEL A;  2QVH A;  2OPJ A;  3UCC A;  2XH4 A; 
#chains in the Genus database with same CATH homology
 1IUU A;  4D04 A;  2Y6R A;  4DNA A;  2WU5 A;  3GDP A;  3BI2 A;  2CFY A;  2OLN A;  1TYP A;  3AB1 A;  3T14 A;  3QJ4 A;  4ICY A;  4YKG A;  3GSI A;  1Y56 A;  1NPX A;  4FX9 A;  1AOG A;  4EMJ A;  1GAL A;  2A87 A;  2OLO A;  1Q9I A;  2C4C A;  3C4A A;  1CJ2 A;  3NNE A;  4AOS A;  2X8G A;  4RG3 A;  1JNR A;  1PBD A;  2TMD A;  2H88 A;  2CVJ A;  1QO8 A;  3DA1 A;  2AR8 A;  1RSG A;  4K22 A;  4KX6 A;  2C64 A;  3VRD B;  2YR5 A;  4ADW A;  1DJN A;  1KNR A;  2HQM A;  3CIR A;  5JCL A;  3SY4 A;  1CJC A;  4YSH A;  1NHQ A;  2ZZ0 A;  1D7L A;  2O9Z A;  3PG6 A;  2C76 A;  3SXI A;  4U8J A;  1W4X A;  3FG2 P;  1IUS A;  3GD3 A;  4J31 A;  1JRY A;  1GES A;  2WHD A;  1CJ3 A;  4B68 A;  2YVF A;  3CPJ G;  3VQR A;  3AWI A;  4A79 A;  1EL7 A;  2BYB A;  4YTP A;  3NHO X;  3QFA A;  5JRB A;  1RYI A;  2R46 A;  4UP3 A;  3UKF A;  3VRA A;  4U8P A;  4GF7 A;  3UP4 A;  4EM4 A;  1CF3 A;  1SEZ A;  3P4Q A;  3T2Y A;  4AT2 A;  1KNP A;  3OZ2 A;  3SM8 A;  2F5Z A;  3ATR A;  3CNT A;  1F8R A;  4CNJ A;  2VVL A;  1O94 A;  4J33 A;  3AE6 A;  4BK3 A;  1KF6 A;  4H2R A;  4EQR A;  3GMC A;  3H4K A;  1MXT A;  1IUT A;  2B76 A;  3ALM A;  1NHS A;  4NWZ A;  4DGK A;  1M6I A;  4NTD A;  4CCR A;  4Z43 A;  3EAO A;  5KNL A;  4REK A;  1B5Q A;  2WQY A;  2XVF A;  1E1N A;  3M13 A;  3SFE A;  3R9U A;  3DK9 A;  2YLX A;  2BS2 A;  4U8K A;  2Z5Y A;  1GTE A;  3BNM A;  1EL8 A;  1CC6 A;  5FMH A;  1CC4 A;  2WP5 A;  2A8X A;  1L9D A;  2BC1 A;  2XYO A;  4Z25 A;  5KOX A;  3B6D A;  2GR1 A;  4EQX A;  5EB5 A;  4UDP A;  3AYI A;  1PXA A;  3V3N A;  3NRN A;  3DJG X;  2WES A;  2GV8 A;  3AEE A;  4EIQ A;  5DBJ A;  1KDG A;  4JY3 A;  3D1C A;  3SZC A;  3KLJ A;  2B7R A;  4K5S A;  5KVI A;  1GRF A;  2R45 A;  2GF3 A;  4C5O A;  2AAQ A;  4ZN0 A;  1GEU A;  3CGC A;  3CMM A;  3AE2 A;  1EL9 A;  2XFN A;  4H4V A;  3VR8 A;  4IVM B;  4D03 A;  5BVA A;  3BHF A;  4CCQ A;  3E1T A;  3QSE A;  2C67 A;  5JCI A;  4NTE A;  5TR3 A;  2Q6U A;  3QVR A;  4AP1 A;  2VRM A;  3II4 A;  1CL0 A;  4IA6 A;  4IA5 A;  4GUV A;  1NG3 A;  3DGH A;  2PHH A;  1OJT A;  3ITJ A;  1PBE A;  4JY2 A;  3V3O A;  1K0I A;  3NYF A;  1H2I A;  3G5S A;  2Q7V A;  5U1O A;  3ZYX A;  1TDF A;  4NZH A;  1QJD A;  1EL5 A;  1JRX A;  3FPZ A;  4WX1 A;  4O5U A;  1GPE A;  1QLB A;  3ALL A;  4OPT A;  4H4Y A;  3AE4 A;  2BXS A;  4J2W A;  2VQ7 A;  2JB3 A;  2ACZ A;  3DJE A;  3QSS A;  2IVE A;  1JOA A;  3PVC A;  4JNQ A;  4U8L A;  3SGL A;  3BNU A;  4OPD A;  2GR2 A;  2Z5X A;  2YAU A;  4KPR A;  3NG7 X;  2V60 A;  3RP7 A;  3SQP A;  3K30 A;  1JRZ A;  5HHF A;  1ZY8 A;  4C3X A;  4XWR A;  2AQJ A;  2GR3 A;  2E4G A;  2XVE A;  3KPK A;  2BS3 A;  3GWD A;  3IC9 A;  3KKJ A;  4CBQ A;  3UKL A;  1GTH A;  1LTX R;  3C4N A;  3P4S A;  2B9X A;  2XLU A;  1PHH A;  4B67 A;  2C3C A;  2FBW A;  1ZP0 A;  3GMB A;  3NK2 X;  4BK2 A;  4UDR A;  3CGE A;  5IPY A;  3PO7 A;  5J60 A;  1NHR A;  4K7Z A;  3AE7 A;  4B1B A;  1LJ1 A;  2WOV A;  4II2 A;  4FK1 C;  4K2X A;  1GET A;  1ZMD A;  3F8P A;  3RP8 A;  1F8W A;  2C75 A;  3GWF A;  1FEA A;  4GAV A;  1DOC A;  5JCN A;  5FS9 A;  2WDV A;  1D5T A;  2BA9 A;  4XWZ A;  4H7U A;  1CHU A;  3CTY A;  1L9E A;  4TM4 A;  4FK1 A;  3UKK A;  4AT0 A;  2NPX A;  1TDN A;  5CQF A;  3AE1 A;  3BI5 A;  4A6N B;  3SZ0 A;  3G5R A;  3F8R A;  1S3B A;  1LQU A;  3DME A;  4IVO B;  4H4Q A;  4G73 A;  3CGB A;  1VDC A;  4Y4N A;  3H8I A;  3T2Z A;  4USQ A;  5KMP A;  4Y4M A;  2XCG A;  1ZOY A;  2BK3 A;  1D4E A;  1S2Y A;  1LQT A;  1PBC A;  2V3B A;  5M0Z A;  2BK5 A;  2XDO A;  4Z26 A;  2X50 A;  4OPL A;  2R4E A;  3SFD A;  1LPF A;  4X4J A;  2YQU A;  4A7A A;  1F8S A;  1DNC A;  3NIX A;  3NTD A;  2E1M A;  4HB9 A;  3QSM A;  4AP3 A;  4FDC B;  1D4D A;  3NT6 A;  1M64 A;  3P4R A;  3B3R A;  5GRT A;  1TYT A;  2XVJ A;  3NN0 X;  3UKP A;  4RG4 A;  5KOW A;  1OJA A;  1ZOV A;  4II3 A;  3QFB A;  3M0O A;  2YLR A;  1N1P A;  5KXJ A;  3GRT A;  4J36 A;  4TM3 A;  1N4V A;  1P2E A;  4YSX A;  1Q1W A;  1B8S A;  1FCD A;  1H7X A;  4OVI A;  3D8X A;  4H4R A;  3NLC A;  2YVJ A;  1E1L A;  2JK6 A;  2WBA A;  2C72 A;  1VG0 A;  4I59 A;  1CC2 A;  4HA6 A;  4YSY A;  3QVP A;  4TM1 A;  3KA7 A;  1PJ5 A;  3ZDN A;  3GRS A;  1VG9 A;  2ZZB A;  4N9X A;  1IUX A;  1L0V A;  1GT8 A;  1NEN A;  2C7G A;  3UTH A;  2VRL A;  2EQ9 A;  3IHG A;  1X31 B;  2CDU A;  1LV0 A;  4PAA A;  1YQ3 A;  4ZCD A;  2QA2 A;  1IJH A;  3CPH G;  5EOW A;  3P1W A;  2E5V A;  3COX A;  4H4W A;  4CY6 A;  2YLZ A;  3AXB A;  3SYI A;  5KMR A;  2WS3 A;  3GYJ A;  1BGN A;  1DOD A;  2YG5 A;  3HYV A;  5CKU A;  1YKJ A;  2WPE A;  4P9S A;  1K0L A;  4C3Y A;  3UOX A;  2YLW A;  3AD9 B;  3AD8 B;  1PJ7 A;  1GND A;  1OJC A;  2YM1 A;  5HYM A;  2FJA A;  3LOV A;  3CND A;  2R0C A;  2YLS A;  2DKI A;  2XFP A;  3RNM A;  3NH3 X;  3S5W A;  2GH5 A;  2WPF A;  2B9W A;  2BXR A;  1O5W A;  1S2Q A;  3JSK A;  4K8D A;  1GXF A;  2GQW A;  5IQ4 A;  4EQW A;  4H4T A;  4OCG A;  2WOI A;  4H50 A;  4G6G A;  2XFQ A;  2WDR A;  4H4P A;  2XVI A;  3OC4 A;  2R0P A;  4AOX A;  2TPR A;  4YWO A;  3DJJ A;  3WE0 A;  5C3J A;  1S3E A;  3ALJ A;  1ONF A;  4GDE A;  2EQ8 A;  3KPF A;  1E7P A;  4OPU A;  2J3N A;  2GAG B;  1BF3 A;  1CJ4 A;  4J57 A;  4JN9 A;  5C2T A;  2BK4 A;  4DSG A;  1PDH A;  2VVM A;  1PBB A;  2YG3 A;  3D9X A;  3UTG A;  3T2K A;  1PXC A;  1YQZ A;  5BUK A;  1Z6L A;  1PJ6 A;  2QCU A;  3ICT A;  4U8O A;  4BJZ A;  1XDI A;  2GMJ A;  5JCM A;  3HYW A;  3CGD A;  2IID A;  3NN6 X;  3DK8 A;  4H2P A;  4A99 A;  2V6O A;  2X99 A;  4ECH A;  1E6E A;  4XXG A;  3UOV A;  4B65 A;  2VVL G;  4OPC A;  2WPC A;  1PN0 A;  4U2T A;  3RED A;  4APN A;  4YSZ A;  5KWF A;  4YXD A;  1BKW A;  1NAA A;  1V59 A;  4C74 A;  5KMS A;  4EM3 A;  2C70 A;  3O0H A;  3FMW A;  3CNJ A;  1FEB A;  1N4U A;  2YG6 A;  2DKH A;  2FJB A;  2Q0L A;  2YVG A;  4CRT A;  5HY5 A;  4USR A;  2I0Z A;  1FOH A;  3AEA A;  5ER0 A;  3KVE A;  4ZCC A;  1LVL A;  3LXD A;  1ZKQ A;  1XPQ A;  1JU2 A;  3AED A;  3CPI G;  4LII A;  3AEG A;  4Y4L A;  3M12 A;  4U8I A;  4DSH A;  1UKV G;  3AE5 A;  3IF9 A;  1O95 A;  1TDE A;  2GEW A;  5U63 A;  5HXI A;  1K4Q A;  4A5L A;  2BCP A;  2H89 A;  1GRT A;  3FIM B;  5L46 A;  4A9W A;  5JCK A;  4Z2T A;  3UTE A;  3F8D A;  3I3L A;  4B64 A;  2WEU A;  1ZK7 A;  1E39 A;  1Y0P A;  4OPG A;  2RGH A;  4LU6 A;  1TDK A;  1H6V A;  1OJD A;  3DH9 A;  3CNS A;  4NTC A;  3LJP A;  2IVD A;  1DXL A;  1JEH A;  3NK0 X;  1N4W A;  3V76 A;  3EF6 A;  3LZX A;  1GOS A;  1GRH A;  1H7W A;  2WDQ A;  3L1R A;  3DJD A;  1KSU A;  2R0G A;  2YR6 A;  3BHK A;  2C65 A;  2GQF A;  2JB1 A;  1ZX9 A;  1PS9 A;  2R4J A;  4JNA A;  1E1K A;  2WOW A;  3UOY A;  5FS8 A;  3EAN A;  2CUL A;  4Z24 A;  1BGJ A;  4U2S A;  2RGO A;  4B63 A;  2ARD A;  3PS9 A;  1FL2 A;  3NYE A;  1VQW A;  2WP6 A;  1PBF A;  4Z2U A;  3I6D A;  2WET A;  4EIP A;  3EPT A;  3HYX A;  3K7T A;  1IUV A;  1DOE A;  4J56 A;  1BWC A;  1GRB A;  1RP0 A;  3IHM A;  3KU9 A;  4CNK A;  1NDA A;  5GSN A;  4WCT A;  1DJQ A;  3L5O A;  2NVK X;  2BCG G;  1F6M A;  2Y6Q A;  3LZW A;  5KVH A;  3L8K A;  2V5Z A;  3ATQ A;  4J34 A;  4TLX A;  3VR9 A;  4Z2R A;  2GRT A;  2GVC A;  4GRT A;  1ZMC A;  3Q6J A;  4JQ9 A;  1KFY A;  2XVH A;  4Z44 A;  2BRA A;  3SZW A;  3UP5 A;  3SX6 A;  5FS6 A;  2V61 A;  1GV4 A;  3SZF A;  2BAB A;  4MJW A;  1D7Y A;  2JBV A;  3HZL A;  4B66 A;  2YWL A;  2FJD A;  3AEB A;  2YG4 A;  3GYX A;  5BUL A;  2GR0 A;  1GSN A;  3LB8 A;  4LA1 A;  1H84 A;  4GR1 A;  2B9Y A;  3Q9T A;  3DGZ A;  4A6N A;  1D4C A;  2APG A;  1COY A;  2YR4 A;  2GB0 A;  3KD9 A;  5FS7 A;  1EBD A;  3GD4 A;  4M52 A;  4U8M A;  1S7M A;  4UDQ A;  5KMQ A;  3P4P A;  4CY8 A;  1ELI A;  4YT0 A;  4GDP A;  3UTF A;  2X3N A;  1REO A;  3RHA A;  1HYU A;  2QA1 A;  4BJY A;  3ISH A;  1PXB A;  3T31 A;  5LV9 A;  2OAL A;  2C3D A;  1TDO A;  2ZBW A;  2C66 A;  3NK1 X;  3BI4 A;  3K7M X;  5KRQ A;  4EQS A;  1NHP A;  1XAN A;  2XLS A;  3AYL A;  1P2H A;  3ABV A;  3C96 A;  4BV6 A;  1FEC A;  1BZL A;  3NGC X;  4X9N A;  2W0H A;  4YTM A;  3CN8 A;  2VQB A;  4IV9 A;  4A65 A;  4TLZ A;  4B69 A;  2RGJ A;  2VOU A;  1E1M A;  4O5Q A;  2VZ2 A;  2BC0 A;  4RSL A;  3AE9 A;  4YTN A;  2QAE A;  1Q1R A;  2V3A A;  1Y56 B;  4G9K A;  2OA1 A;  3CNP A;  4GAP A;  1B4V A;  4JDR A;  5U25 A;  1NG4 A;  1CBO A;  2GAH B;  4H4X A;  2RAB A;  1L9C A;  3AEF A;  1H81 A;  2JB2 A;  4H4S A;  5BRT A;  2R9Z A;  3FBS A;  3K7Q X;  3H8L A;  4C77 A;  3NTA A;  4X9M A;  1GER A;  3GYI A;  2FJE A;  4H4U A;  3URH A;  1YQ4 A;  2EQ7 A;  2A89 A;  2XLR A;  3ICR A;  3NKS A;  3UKA A;  3UOZ A;  1NEK A;  2C73 A;  2YLT A;  2BAC A;  4OPI A;  2X8C A;  3NYC A;  1GRE A;  4H2N A;  4U2L A;  5M10 A;  1GRA A;  3ICS A;  5EBK A;  2XLP A;  2Q0K A;  2WU2 A;  4EMI A;  4H4Z A;  3AE8 A;  2XFO A;  4YKF A;  1KN0 A;  3T0K A;  1JNZ A;  4EMW A;  2EQ6 A;  3AEC A;  1GRG A;  3T37 A;  5IQ1 A;  1IUW A;  1KSS A;  4BK1 A;  2YG7 A;  2XLT A;  3ADA B;  1DOB A;  2XFU A;  4G6H A;  1K0J A;  3G5Q A;  3UKH A;  1B37 A;  3AD7 B;  4G74 A;  1XHC A;  4H2Q A;  4NEV A;  3IWA A;  3RP6 A;  3S61 A;  3UCL A;  1F3P A;  4NNJ A;  3AE3 A;  1H83 A;  4K5R A;  1TRB A;  5EB4 A;  3AYJ A;  3VRB A;  2BS4 A;  1VRQ B;  2B7S A;  4PAB A;  4U8N A;  1YY5 A;  3UKQ A;  4NEW A;  1H82 A;  4GCM A;  4I58 A;  3DK4 A;  4TM0 A;  2BRY A;  5J7X A;  3LAD A;  2YM2 A;  2GMH A;  2WP9 A;  2ZZC A;  2OAM A;  2JKC A;  3P9U A;  4E0V A;  4BUR A;  1OJ9 A;  2UZZ A;  1H86 A;  2JAE A;  3GDN A;  1MOK A;  2PYX A;  1MO9 A;  2X8H A;  1ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...