1NHRA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 141
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA02
3RNMA 3DH9A 1Q1RA 1BWCA 1YY5A 4J31A 2YQUA 2V60A 2V5ZA 4AP3A 3GRTA 4NEWA 1JNRA 2YR6A 3AWIA 4I59A 4RSLA 5J7XA 4B64A 1GERA 2R0PA 4EIPA 5IPYA 4H4ZA 3NGCX 2BA9A 4U8JA 2YWLA 2Z5XA 2JAEA 2BS4A 2F5ZA 2GAHB 2C66A 4P9SA 4NZHA 4TM1A 4Y4NA 5EB5A 1LTXR 1L9EA 3UP5A 3DJGX 1YQZA 4U2SA 3ITJA 1TYTA 3NTDA 3AECA 3KPFA 4JNAA 5J60A 5FS7A 4H4YA 3LZXA 4YKGA 1ZP0A 1XHCA 2ZZ0A 2BC1A 2GMJA 5LV9A 2WP6A 5DBJA 3RP6A 2UZZA 3DGHA 4ADWA 1E1NA 5U63A 4A5LA 3CPHG 3NLCA 4GDEA 2BS2A 2CFYA 3SFEA 4FDCB 4JQ9A 3NN0X 4Z25A 4H7UA 1M64A 4U8PA 5KWFA 4C3YA 4OPGA 1LQUA 5KVHA 1PBBA 3M0OA 3Q6JA 3PO7A 1DOEA 4J56A 4DGKA 3IHMA 4EQRA 1IUUA 4EMJA 4CCRA 3GWFA 1PXAA 1ZOYA 2BS3A 1F8SA 3KU9A 4M52A 1W4XA 5KVIA 1CC2A 1CJ3A 1E1MA 2AAQA 1Q1WA 1ZMCA 1PJ5A 1VG0A 1ZMDA 2H88A 2I0ZA 3O0HA 1Y0PA 2R4EA 2XVEA 3RP8A 2B7SA 3G5RA 1PS9A 4B65A 1TDOA 2WEUA 4EQXA 3P4PA 4LA1A 1GRTA 1DJNA 1DOBA 2BK3A 3NHOX 4XWRA 5BULA 3UKKA 4OPLA 4O5QA 1ZY8A 2YG4A 4CBQA 2YLWA 3CGDA 3AD7B 4TM3A 1OJ9A 1GETA 3NT6A 1IUXA 1CJCA 3P4RA 4H2RA 3UOVA 1GRFA 3AB1A 4IA6A 3UOXA 2YVJA 3LJPA 2RGJA 1E39A 1RYIA 3KA7A 2VRLA 1JRYA 4H4QA 2A8XA 1XDIA 4EMIA 2WDVA 1E1KA 2YG7A 1N1PA 4GF7A 1OJDA 4EMWA 2YLXA 1BKWA 3ABVA 3ALLA 1LQTA 4ZCCA 1NHPA 1LV0A 1B4VA 1OJCA 1FEBA 1BF3A 1PN0A 1JU2A 2C3CA 3URHA 2C75A 5HY5A 1F6MA 3II4A 1Y56B 2E1MA 3I3LA 5IQ1A 4AOSA 2C70A 3DMEA 3NTAA 3AE9A 3CNDA 3COXA 2BACA 2CDUA 2FJBA 3AEEA 1GXFA 2YLTA 4IA5A 2GQWA 4USQA 2FJDA 2C67A 2R4JA 4OPIA 2QCUA 2GRTA 3SGLA 3GD4A 3KLJA 2VVMA 4UP3A 3UTGA 4Z43A 3AYIA 2RABA 3BI2A 3B3RA 3ATQA 2DKIA 3CIRA 2WOVA 1IUWA 2TMDA 4B63A 4J36A 2YAUA 2B9YA 3AD9B 3AEAA 4U2TA 4Y4LA 1KSUA 3NYCA 4YSYA 4FK1C 3QSSA 5EB4A 2Y6RA 3Q9TA 2XLRA 3UCLA 3BHFA 3ALJA 3NKSA 1LPFA 5GRTA 1ZDLA 4X9MA 3UP4A 3NK0X 1ONFA 4PABA 3AE5A 3UTFA 4BK1A 3L8KA 1ZKQA 3GYJA 1VRQB 1EL8A 4BJZA 1GSNA 2VQ7A 4YSXA 2ZBWA 3VRAA 5JCMA 3QFAA 1AOGA 1XANA 3QVRA 4H2QA 3UKPA 1LJ1A 2BXRA 2DKHA 4YWOA 3NYEA 3NK1X 4JNQA 3RP7A 2OAMA 3KD9A 2BABA 3IWAA 4X9NA 5BVAA 2YG5A 2WP5A 1PBEA 1NEKA 2R46A 3DK9A 2WOWA 1H86A 1H83A 3BNMA 2X8CA 4CY6A 4EQWA 2WU2A 4U8OA 2WS3A 1X31B 3PVCA 1O5WA 3SM8A 3VQRA 2AQJA 4YSHA 1FL2A 3ATRA 3VRBA 4BK3A 3LXDA 1JOAA 3AE3A 2X8HA 3M12A 1D5TA 1NDAA 2Z5YA 2XYOA 3EF6A 3QFBA 3CPIG 3K7QX 3ZYXA 2XLSA 1NAAA 3EANA 2GF3A 3AD8B 3AEDA 3AYLA 4H2PA 3UOZA 3H4KA 2XFUA 1PBCA 2WU5A 4B1BA 4JDRA 4CY8A 1NENA 2WHDA 2BK5A 3UKAA 4OPDA 2C73A 3UOYA 2APGA 4U2LA 2OLOA 1NHSA 1KDGA 1IJHA 5FS6A 4EM4A 3AE6A 1TDEA 2YR5A 2IVDA 4JN9A 1K4QA 2WP9A 4U8MA 3PS9A 5KXJA 2JB2A 3FIMB 3BI5A 2WDRA 1N4VA 1PBDA 3K7TA 4K5RA 1GALA 3VR9A 4C77A 2GR0A 3LB8A 2XVFA 1B5QA 4Z2RA 1GRAA 1VG9A 2YLZA 2QA2A 4ICYA 4C5OA 3AYJA 3M13A 1OJAA 3AE7A 4CNJA 1GEUA 1IUSA 1ZOVA 4TM0A 4DNAA 4J57A 1PDHA 1NG4A 2WESA 3QSEA 3S61A 3DJJA 1YQ3A 5M10A 3EAOA 2OALA 2EQ7A 3CGBA 5BRTA 4K7ZA 4Z44A 1KNPA 2XVJA 3LADA 2RGHA 3DK4A 4UDQA 1HYUA 2PYXA 3BI4A 4TLZA 2X8GA 5HYMA 2NPXA 1UKVG 1N4UA 2VZ2A 5C3JA 2PHHA 2Q7VA 4NTEA 4Z2UA 1GOSA 2XFOA 3UKLA 4LIIA 3B6DA 4IVOB 4WX1A 2YR4A 4XWZA 3VR8A 1GREA 1NHRA 1S2YA 4AT2A 5U1OA 2Q0KA 2XFQA 4B66A 5BUKA 1FCDA 2C3DA 2BYBA 3NK2X 1BGNA 1F3PA 1E6EA 1K0JA 4H50A 2XVHA 1QLBA 4U8IA 3AE4A 1Z6LA 1ZK7A 2GMHA 4J2WA 4UDRA 2V3AA 5EOWA 2BCGG 3F8PA 3GDNA 4D04A 3OZ2A 1DOCA 5GSNA 1PBFA 2ZZBA 3CPJG 1VQWA 3L1RA 4AT0A 2XDOA 1BGJA 4N9XA 5TR3A 1RP0A 2R9ZA 5L46A 3NNEA 3UKQA 2JB1A 5U25A 3P9UA 4AOXA 4IVMB 2GEWA 5JCLA 4KPRA 2H89A 2VOUA 3NIXA 2R45A 4GR1A 3AE1A 4OPCA 1V59A 4EQSA 4IV9A 4TLXA 4A9WA 1KF6A 1H7WA 2GB0A 2A89A 1CL0A 1JRZA 1CHUA 1KNRA 2V6OA 2JBVA 3ICSA 4B67A 4H4XA 2WETA 2Y6QA 4BURA 4I58A 4GRTA 3NH3X 4ZN0A 4H4PA 5JCKA 4APNA 2C7GA 1Y56A 4CCQA 3CGCA 2C76A 1GPEA 4O5UA 1RSGA 1CC4A 5JCIA 1E7PA 2R0CA 2XCGA 2VQBA 3BNUA 3C4AA 2OLNA 4U8LA 1L0VA 3P1WA 3SFDA 2YVFA 4BK2A 3UKHA 1K0LA 4H4TA 2GV8A 2FBWA 2GR2A 1GRGA 2CULA 3C4NA 3QSMA 3FBSA 1TDKA 4NTCA 2XLTA 3RHAA 4H2NA 3GWDA 2BC0A 4RG4A 3V76A 4OPUA 4YXDA 1MO9A 1TDFA 1H6VA 4H4SA 3F8DA 5CQFA 1O94A 3AEBA 4EM3A 4B69A 3AXBA 2A87A 1PJ7A 3AEFA 4GCMA 1NG3A 1LVLA 3CNTA 1QJDA 3DGZA 1PJ6A 3G5QA 1YQ4A 1B8SA 1S3EA 1EBDA 5FMHA 2Q0LA 3C96A 3NRNA 2YVGA 5EBKA 1NHQA 2WOIA 3D8XA 2XLUA 4OPTA 4YTNA 2QAEA 4NEVA 2FJAA 1FOHA 1GTHA 3ADAB 1MOKA 1GTEA 2NVKX 3CNJA 4FX9A 2E5VA 2XFNA 1L9DA 3V3NA 2BXSA 2E4GA 3AEGA 1SEZA 1ELIA 3GYIA 2FJEA 3CGEA 4K8DA 2RGOA 1H7XA 4A65A 5KOXA 3OC4A 1F8WA 1GRHA 1KSSA 2EQ8A 1CF3A 1PHHA 4XXGA 3ICRA 3IHGA 3P4QA 3AE2A 3JSKA 1COYA 1H81A 1CJ4A 5M0ZA 1DXLA 2C72A 4C74A 2JKCA 1ZX9A 1F8RA 3GMCA 4KX6A 4YT0A 4A99A 4X4JA 2Q6UA 4BV6A 1K0IA 1D4CA 1QO8A 3SQPA 1DJQA 1EL9A 3DA1A 3GDPA 1GESA 4HB9A 4K22A 2BK4A 4OCGA 1EL5A 3V3OA 4FK1A 3K30A 1TYPA 1H84A 1REOA 3KVEA 4E0VA 4OVIA 1Q9IA 4U8KA 1N4WA 2BCPA 5C2TA 1CJ2A 3HZLA 2B76A 3ICTA 1FEAA 4J34A 3CTYA 1CBOA 4ECHA 2IIDA 1DNCA 1P2EA 2GR1A 2XFPA 3CNPA 3LZWA 4GUVA 1EL7A 3DJDA 2EQ6A 4UDPA 4ZCDA 1JNZA 3E1TA 5HHFA 3VRDB 1FECA 1GRBA 1D4DA 1KFYA 2YM2A 4B68A 5KOWA 2JB3A 2X3NA 5FS9A 2IVEA 4Z26A 1IUVA 2YM1A 4K5SA 3CNSA 4PAAA 3GD3A 3DJEA 3FMWA 2XLPA 4YTMA 3I6DA 4YSZA 4NTDA 1S3BA 4TM4A 2VVLG 1VDCA 4Z24A 3P4SA 4H4VA 2JK6A 2YLSA 2C64A 1D7LA 4GDPA 1D7YA 2ZZCA 3K7MX 3UKFA 1TRBA 3GRSA 4A6NB 3GSIA 1NPXA 3ISHA 3F8RA 2WPEA 4K2XA 5HXIA 3FG2P 2V61A 2VRMA 2YG6A 4CRTA 1JEHA 4D03A 3S5WA 1GV4A 1M6IA 2WBAA 2WPCA 2J3NA 3UTEA 3R9UA 2B9WA 1O95A 1D4EA 2C65A 3BHKA 4H4RA 2GAGB 2VVLA 2QA1A 3IC9A 3EPTA 1P2HA 2EQ9A 3KKJA 4HA6A 1OJTA 1CC6A 2X99A 1IUTA 5CKUA 2W0HA 4A6NA 4YTPA 3T37A 1TDNA 4EIQA 3REDA 3ZDNA 2R0GA 4LU6A 5FS8A 5JCNA 3ALMA 3LOVA 4DSHA 4U8NA 2O9ZA 3H8LA 2GVCA 2V3BA 5ER0A 4J33A 2GR3A 2TPRA 4USRA 1JRXA 2CVJA 2WPFA 1H82A 4WCTA 1GT8A 4H4WA 1MXTA 2HQMA 2WDQA 1DODA 1XPQA 4C3XA 2WQYA 2B7RA 3D1CA 3IF9A 4JY2A 3AE8A 4AP1A 2OA1A 4YKFA 4CNKA 2GH5A 1PXCA 4H4UA 4MJWA 2X50A 2ARDA 1GNDA 4RG3A 4Y4MA 3DK8A 2XVIA 2GQFA 3UTHA 4A7AA 4Z2TA 5KRQA 1PXBA 1BZLA 3NG7X 3NYFA 5IQ4A 3H8IA 3QVPA 3FPZA 3CN8A 4BJYA 1L9CA 3NN6X 1YKJA 2YG3A 2B9XA 4A79A 2YLRA 1S2QA 1E1LA 4REKA 3G5SA 2ACZA 4JY3A 3QJ4A 3GMBA 1B37A 4DSGA 2AR8A 3WE0A
chains in the Genus database with same CATH superfamily
3RNMA 3GRTA 4ZOHB 2YR6A 4P9SA 5EB5A 1LTXR 1L9EA 3DJGX 4U2SA 3NTDA 3KPFA 5FS7A 4H4YA 1XHCA 2PTWA 3VC6A 3RP6A 3P0WA 3DGHA 4ADWA 1E1NA 3CPHG 2CFYA 4Z25A 4NWZA 1M64A 3MY9A 3PO7A 1DOEA 3GWFA 1PXAA 1F8SA 3R25A 4DYEA 2OPJA 2QJJA 2AL2A 4OPLA 4O5QA 4CBQA 2YLWA 3AD7B 4TM3A 2XGZA 2AKMA 4H2RA 3AB1A 3NRZB 1ELSA 2YVJA 3DG3A 1JROA 3KA7A 2VRLA 3TWAA 2A8XA 1XDIA 4EMIA 4GF7A 4EMWA 1LQTA 4ZCCA 1FEBA 1PN0A 2C3CA 5HY5A 1F6MA 1Y56B 2E1MA 5IQ1A 1KKOA 3N6JA 2QDEA 3NTAA 3AE9A 2MUCA 3CNDA 2BACA 2FJBA 1GXFA 3T8QA 2AKZA 3SGLA 4OPIA 3UTGA 2GRTA 4E5TA 1ONEA 2TMDA 3CXBA 3FVDA 3Q9TA 5IDZA 3NKSA 3UP4A 1VRQB 1GSNA 3NVVB 1XANA 4H2QA 3NYEA 2BXRA 2DKHA 3NK1X 3KD9A 5BVAA 2YG5A 3DK9A 1X31B 1O5WA 3MWCA 3ATRA 2X8HA 1D5TA 2XYOA 3QFBA 3ZYXA 2GF3A 3AD8B 3UOZA 2C73A 3UCDA 4EM4A 1TDEA 2YR5A 3B9JB 3FIMB 4HCDA 3EKGA 4K5RA 1PBDA 2CHRA 5BOEA 3VR9A 3LB8A 4GFIA 1B5QA 4Z2RA 3IJLA 4ICYA 3AYJA 4IL0A 3T9PA 1NG4A 3QSEA 5M10A 3EAOA 2OALA 2EQ7A 5BRTA 4Z44A 1KNPA 2RGHA 1UKVG 3SQSA 4Z2UA 1GOSA 3BOXA 4AT2A 3VR8A 3ZVIA 5BUKA 2C3DA 1BGNA 1F3PA 3THUA 1K0JA 4H50A 1Z6LA 3I6EA 4D04A 3PWIA 1DOCA 1PBFA 1VQWA 1KKRA 1BGJA 4N9XA 3HRDC 3UKQA 3P9UA 2AL2B 3A7AA 2H89A 4KPRA 1V59A 4IV9A 1JRZA 1KNRA 2JBVA 3ICSA 4B67A 2WETA 2Y6QA 4BURA 4GRTA 2E3TA 4H4PA 3RITA 3CGCA 4GMEA 1RSGA 1JPMA 3BNUA 3C4AA 2HNEA 2VQBA 4BK2A 3P1WA 2YVFA 3UKHA 3DG7A 1K0LA 4H4TA 4HCLA 5KMSA 3RHAA 2BC0A 4YXDA 3T31A 5FJRA 4H4SA 2PGWA 3AEBA 3AN1A 3SX6A 1NG3A 1OEPA 3C96A 3CMMA 2Q0LA 1B8SA 1EC7A 4GGHA 5FMHA 2WOIA 1JRPA 2QAEA 4TVWA 3NFUA 4FX9A 1L9DA 3GY1A 3GYIA 3UJEA 4K8DA 1TZZA 3OC4A 3IHGA 3JSKA 1H81A 2P0IA 4KX6A 4YT0A 4YWSA 2Q6UA 4BV6A 1D4CA 4K22A 2MNRA 3T2KA 1TYPA 4E0VA 3SY4A 1Q9IA 4U8KA 2BCPA 2B76A 2PODA 5HHFA 3DJDA 3NO1A 1EBGA 1FECA 2YM2A 3JVAA 2JB3A 2YM1A 3GD3A 3FMWA 3I6DA 3UXKA 2VVLG 1VDCA 2JK6A 2C64A 1D7LA 4Z17A 2W54A 3GRSA 3DIPA 3GSIA 2WPEA 2V61A 1JEHA 1M6IA 3UGVA 3R9UA 1L8PA 3BHKA 4H4RA 3KKJA 4HA6A 3OP2A 2W0HA 3V5CA 1TDNA 4EIQA 2R0GA 5FS8A 5JCNA 3SXIA 4U8NA 2O9ZA 4H19A 3VDGA 3ES8A 5ER0A 2WPFA 4WCTA 2POZA 1MXTA 1DODA 1XPQA 4IP4A 2WQYA 3S5SA 3D1CA 1VDVA 1SJDA 1N5XA 1PXCA 4H4UA 1GNDA 2XVIA 2GQFA 1PXBA 3QVPA 3NXLA 4BJYA 4HN8A 1YKJA 2B9XA 4H1ZA 4JY3A 2OKTA 5JRBA 3R10A 1YY5A 4AP3A 4B64A 1JNRA 4RSLA 2RDXA 4JN7A 2YWLA 2JAEA 2BS4A 2C66A 3UJRA 1FFUC 3UP5A 2QJMA 1X2GA 2ZZ0A 2BC1A 3U9IA 2UZZA 3NLCA 1PDYA 4GDEA 4JQ9A 1N63C 3R0KA 4E6MA 3NVZB 3D46A 4U8PA 3Q6JA 7ENLA 2OZTA 4CCRA 4M52A 1W4XA 5KVIA 4J36A 1ZMDA 3O0HA 2R4EA 3RP8A 2XVEA 1PS9A 5FJOA 1GRTA 1DOBA 5BULA 2P8CA 2YG4A 3D9XA 3CGDA 3EEZA 3JZUA 4G73A 1CJCA 3UOVA 1GRFA 2OFJA 4IA6A 3A7UA 1BKWA 4HYRA 3I6TA 1W6TA 3IJQA 4ZCWA 3DMEA 3QN3A 4II3A 4K1WA 3COXA 4A6GA 4IA5A 2GQWA 2FJDA 2C67A 2QCUA 3AYIA 3BI2A 2DKIA 2WOVA 3AEAA 3NYCA 4X2PA 4FK1C 5EB4A 4E4UA 5GRTA 1ZDLA 4PABA 3L8KA 1ZKQA 3GYJA 2VQ7A 3SZWA 1LJ1A 4YWOA 3IWAA 2PSNA 2XH2A 1PBEA 1H83A 4CY6A 4E8GA 4EQWA 4U8OA 2WS3A 3PVCA 3VQRA 3SM8A 2AQJA 3VRBA 3EF6A 4DX3A 3CPIG 3K7QX 3T2YA 3AEDA 2OLAA 3R07C 4B1BA 3SBFA 2WHDA 2BK5A 1EC8A 3UOYA 2APGA 4U2LA 5FS6A 3TOYA 3AE6A 1K4QA 2OVLA 4U8MA 2JB2A 1N4VA 3T2ZA 1GALA 4C77A 2GR0A 2XVFA 3PK7A 1GRAA 1VG9A 2P3ZA 3GYXA 3M13A 3S61A 4DNAA 4J57A 2WESA 1YQ3A 3QKEA 3DG6A 4DHGA 2XVJA 3VA8A 1HYUA 3BI4A 2X8GA 5HYMA 2VZ2A 2PHHA 2Q7VA 3UKLA 4WX1A 2YR4A 2Q0KA 1WUEA 3SN1A 3N4FA 3D47A 4UDRA 2V3AA 3F8PA 3OZ2A 5GSNA 2ZZBA 2XDOA 4GYPA 3CYJA 1R0MA 2R9ZA 3HYXA 4AOXA 4IVMB 1NU5A 5JCLA 1DTNA 4KPLA 2R45A 3AE1A 4A9WA 1KF6A 2A89A 1RM6B 4H4XA 4I58A 4ZN0A 2PS2A 2C7GA 4CCQA 2XH7A 1CC4A 1E7PA 3SFDA 3H8AA 3V5FA 3N4EA 3S47A 1TDKA 2XLTA 4H2NA 3GWDA 4RG4A 3V76A 3ZVHB 4OPUA 1TDFA 5KMQA 3T4WA 1JDFA 1H6VA 3F8DA 1O94A 4B69A 3U4FA 3DGZA 2W3SA 1S3EA 3NRNA 5G5GB 4YTNA 1NHQA 3OZMA 3DFHA 4NEVA 2FJAA 1GTHA 2NVKX 2E5VA 2E4GA 1ELIA 2RGOA 3SYIA 3P4QA 3AE2A 1COYA 2C72A 1ZX9A 3GMCA 1EC9A 4NNJA 4G6HA 1BQGA 3GDPA 1GESA 2BK4A 3HPFA 4OCGA 2P8BA 1H84A 3KVEA 5C2TA 3FV9A 3ICTA 1TKKA 3CTYA 1XS2A 2IIDA 2GR1A 3LZWA 4GUVA 4UDPA 2OQHA 3E1TA 4B68A 3FXGA 1FHUA 4NTDA 1H2IA 3P4SA 4H4VA 2YLSA 1D7YA 3UKFA 1TRBA 4A6NB 5HXIA 4CRTA 4GGBA 3UTEA 2J3NA 2B9WA 2C65A 2GAGB 2VVLA 4HNLA 5KMPA 1S7MA 1CC6A 2X99A 3TQPA 5CKUA 1WUFA 4A6NA 3T37A 2BRAA 3LOVA 3VCCA 3H8LA 2V3BA 1H82A 4A35A 2HQMA 2OQYA 2DW6A 1MNSA 2OA1A 2GH5A 2X50A 4A7AA 3FPZA 4G6GA 1L9CA 3VCNA 5FJTA 3TCSA 3SR6B 2YG3A 3NS1B 1X2HA 2ACZA 2AR8A 2OO6A 3DH9A 1Q1RA 1BWCA 4J31A 4B63A 3R0UA 3AWIA 2R0PA 4EIPA 4H4ZA 2Z5XA 2GAHB 4TM1A 3AMZA 2HXUA 3AECA 5J60A 3LZXA 1ZP0A 5LV9A 4A5LA 1STZA 2BS2A 2GGJA 2GGEA 4FDCB 4E4FA 4H7UA 5KWFA 4C3YA 4OPGA 2O56A 3CAWA 1IUUA 3MQTA 4A3RA 4EMJA 1E1MA 1CC2A 2AAQA 2I0ZA 2H88A 1VG0A 2NQLA 1Y0PA 3GD6A 4H2HA 4B65A 2PMQA 2WEUA 4LA1A 3NHOX 1MUCA 3UKKA 1OJ9A 1GETA 1FIQB 4IHCA 2RGJA 2PPGA 1E39A 1RYIA 2PP0A 1JRYA 2WDVA 2YG7A 4J3ZA 1N1PA 4FP1A 1OJDA 2W55A 3ALLA 1NHPA 1B4VA 1BF3A 1JU2A 3URHA 3ZLHA 3P3BA 3MKCA 2CDUA 3OTRA 4DXKA 2YLTA 2R4JA 3KLJA 4Z43A 3P93A 2RABA 4JN8A 3CIRA 1IUWA 2PP1A 4U2TA 4Y4LA 1KSUA 2HXTA 2Y6RA 2XLRA 3BHFA 3ALJA 2C4CA 1LPFA 4X9MA 3NK0X 1ONFA 3AE5A 6ENLA 1EL8A 3SJNA 2ZBWA 3VRAA 3QFAA 3IK4A 1AOGA 3UKPA 3RP7A 4JNQA 2OAMA 3I4KA 3KPKA 1NEKA 3BNMA 2X8CA 4JHMA 1BKHA 1FL2A 3TTEA 3HW2A 1JOAA 3AE3A 2Z5YA 3VFCA 1SJBA 3EANA 3AYLA 3H4KA 2XFUA 1PBCA 1ZXIC 3BSMA 4CY8A 2GGGA 5G5HB 4OPDA 3T6CA 2OLOA 1KDGA 2PU1A 2XH0A 4JN9A 2WP9A 3PS9A 5KXJA 3IJIA 3TJIA 3BI5A 3K7TA 4HCHA 3TW9A 2QA2A 2FYMA 1OJAA 3AE7A 1ZOVA 1PDHA 3DJJA 2W3RA 4K7ZA 3DK4A 2PYXA 1N4UA 5C3JA 3TJ4A 2XFOA 4LIIA 4XWZA 1NHRA 1S2YA 3UXLA 3TWBA 2XFQA 4B66A 3PG6A 3NVWB 1FCDA 2BYBA 3NK2X 2XVHA 4U8IA 1ZK7A 2GMHA 2E5AA 1N62C 2P88A 3L1RA 3CPJG 4AT0A 3RR1A 1RP0A 5L46A 3NNEA 2JB1A 5U25A 3NIXA 2VOUA 4EQSA 1H7WA 2GB0A 4II2A 2V6OA 3QLDA 3V4BA 1Y56A 2C76A 4O5UA 5JCIA 2R0CA 4U8LA 2I5QA 2GL5A 3PFRA 1YEYA 3CB3A 3DGBA 3ES7A 3N6HA 3OW1A 4DWDA 2CULA 3C4NA 3FBSA 4NTCA 4KWSA 4DN1A 4EM3A 2A87A 1PJ7A 3AEFA 1LVLA 3CNTA 2OG9A 1EBDA 1SB3B 3S5WA 2YVGA 5EBKA 4OPTA 4ZA0A 3OZYA 1MOKA 1GTEA 3CNJA 2XFNA 2BXSA 1SEZA 2FJEA 4A65A 5KOXA 2GGIA 2QQ6A 1KSSA 1PHHA 4XXGA 3ICRA 5ENLA 3B97A 3SZCA 4C74A 2JKCA 1KD0A 4GAPA 2GGHA 1QO8A 1N60C 3SQPA 3DA1A 3DESA 3MSYA 3NZGA 1EL5A 3V3OA 4FI4A 4MKSA 1REOA 3ENLA 3SN0A 1CBOA 2XFPA 2EQ6A 1N61C 3VRDB 1GRBA 1D4DA 1KFYA 5KOWA 5FS9A 2IVEA 4K5SA 3T0KA 3CK5A 3DJEA 4YTMA 2XLPA 1S3BA 3UJSA 3K7MX 3Q4DA 1NPXA 3FG2P 2YG6A 1ECQA 1IYXA 2WBAA 2WPCA 1O95A 1D4EA 5BOFA 3BJSA 2QA1A 2FKPA 1P2HA 1OJTA 4F4RA 4YTPA 1N5WC 4LU6A 3ALMA 2TPRA 4USRA 4G9KA 2ZADA 4C3XA 2B7RA 2XSXA 1MRAA 2ARDA 4Y4MA 4EWJA 3DK8A 3UTHA 5IQ4A 3FYYA 3NN6X 2YLRA 1E1LA 4REKA 1MDRA 3G5SA 3QJ4A 1B37A 4IP5A 4DSGA 3WE0A 3RRAA 3L5OA 2YQUA 2V60A 2V5ZA 4NEWA 5J7XA 4I59A 1GERA 5IPYA 3NGCX 2BA9A 4U8JA 2F5ZA 4Y4NA 4MMWA 4NZHA 4K2SA 1YQZA 1R6WA 3ITJA 1TYTA 2ONEA 4JNAA 2GDQA 4TVYA 4YKGA 2GMJA 3SSZA 2WP6A 5DBJA 4IT1A 5U63A 2DW7A 2PTZA 3SFEA 3NN0X 5FJPA 3KUMA 1LQUA 5KVHA 1PBBA 3M0OA 4MGGA 4J56A 4DGKA 3SN4A 3ZVHA 3IHMA 4EQRA 3K1GA 3KU9A 1ZOYA 2BS3A 4HNCA 1P48A 1SJCA 1CJ3A 1Q1WA 1PJ5A 1ZMCA 3UJ2A 2B7SA 3G5RA 3MZNA 1TDOA 1NELA 4H83A 4EQXA 3P4PA 1DJNA 3SZ0A 2BK3A 4XWRA 1ZY8A 4KT2A 3NT6A 1IUXA 3P4RA 3UOXA 4KEMA 3LJPA 4H4QA 3H7VA 1E1KA 5KNLA 2YLXA 3ABVA 3H12A 1E9IA 4HPNA 2XH4A 1LV0A 1OJCA 3QTPA 3ZLGA 4GAVA 2C75A 3II4A 3I3LA 4AOSA 2C70A 3AM9A 3V3WA 3AEEA 4USQA 3GD4A 2VVMA 4UP3A 3FCPA 3B3RA 3ATQA 2YAUA 4ROPA 2B9YA 3AD9B 4YSYA 3QSSA 3MUCA 3ETRB 3UCLA 4GISA 2GSHA 3GO2A 3UTFA 4BK1A 4BJZA 4YSXA 5JCMA 3QVRA 2QVHA 2BABA 4X9NA 1F9CA 2WP5A 4G74A 2R46A 2WOWA 1H86A 3NVYB 2WU2A 2BRYA 4YSHA 3RGTA 4BK3A 3LXDA 3M12A 1NDAA 3Q45A 2XLSA 1NAAA 4H2PA 5J04A 2WU5A 5EU9A 1SJAA 4JDRA 1NENA 3UKAA 3GC2A 1NHSA 1IJHA 2IVDA 3UCCA 1WYGA 2WDRA 3FJ4A 1FFVC 2YLZA 4C5OA 4CNJA 1GEUA 1IUSA 4TM0A 3CGBA 3DERA 3PWGA 4K8GA 3LADA 3OPSA 4UDQA 4TLZA 1VQZA 2NPXA 4NTEA 1MDLA 3JW7A 1KCZA 4G8TA 3B6DA 4IVOB 1GREA 4ENLA 5U1OA 1E6EA 2PP3A 1QLBA 3AE4A 4J2WA 5EOWA 3R1ZA 2BCGG 4GIRA 3GDNA 1V97A 3VC5A 3SZFA 5TR3A 3R11A 2GEWA 4OPCA 4GR1A 4TLXA 3CT2A 1CL0A 2QJNA 1CHUA 3H70A 1P43A 3NH3X 5JCKA 4APNA 2OZ3A 1GPEA 2XCGA 1L0VA 2HZGA 2OLNA 2GV8A 2FBWA 2GR2A 1GRGA 3QSMA 3RCYA 4M6UA 1MO9A 5CQFA 4G7FA 3AXBA 4M0XA 4GCMA 1QJDA 1PJ6A 3G5QA 3DEQA 1YQ4A 1FO4A 3D8XA 2XLUA 4Z1YA 1FOHA 3ADAB 4GYPC 3V3NA 1KN0A 3AEGA 3CGEA 1H7XA 1F8WA 1GRHA 2EQ8A 1CF3A 3UJFA 1CJ4A 5M0ZA 1DXLA 3STPA 1F8RA 4A99A 4X4JA 3EUB3 4IL2A 1K0IA 2PTXA 1DJQA 1EL9A 1EBHA 4HB9A 2OX4A 4FK1A 3K30A 3DFYA 1FHVA 2PU0A 4OVIA 1N4WA 2PGEA 1CJ2A 1PDZA 3A7RA 3HZLA 1FEAA 4J34A 2PTYA 4ECHA 1DNCA 1P2EA 3CNPA 1EL7A 4ZCDA 1JNZA 1RVKA 3T14A 2X3NA 4Z26A 1IUVA 3CNSA 4PAAA 1XPYA 4YSZA 4TM4A 1JCTA 4Z24A 3QPEA 4GDPA 2ZZCA 3ZLFA 2QGYA 3ISHA 3F8RA 4K2XA 2VRMA 4D03A 2PCEA 1GV4A 4IZGA 4J1OA 3HYVA 2AL1A 2QDDA 3IC9A 3EPTA 2ZC8A 2EQ9A 1IUTA 3DDMA 3REDA 3ZDNA 4DSHA 2GVCA 4J33A 2GR3A 2OZ8A 1JRXA 2CVJA 1GT8A 4H4WA 2WDQA 3IF9A 5FJUA 4JY2A 3AE8A 4AP1A 4YKFA 4CNKA 3HYWA 2PA6A 4MJWA 4RG3A 4Z2TA 5KRQA 3RO6A 3NYFA 1BZLA 3NG7X 5KMRA 3H8IA 3CN8A 1TE6A 3CXOA 4A79A 1S2QA 3GMBA 1T3QC 1JPDX
chains in the Genus database with same CATH topology
3RNMA 3L5OA 3DH9A 1Q1RA 1BWCA 1YY5A 4J31A 2YQUA 2V60A 2V5ZA 4AP3A 3GRTA 4NEWA 1JNRA 2YR6A 3AWIA 4I59A 4RSLA 5J7XA 4B64A 1GERA 2R0PA 4EIPA 5IPYA 4H4ZA 3NGCX 2BA9A 4U8JA 2YWLA 2Z5XA 2JAEA 2BS4A 2F5ZA 2GAHB 2C66A 4P9SA 4NZHA 4TM1A 4Y4NA 5EB5A 1LTXR 1L9EA 3UP5A 3DJGX 1YQZA 4U2SA 3ITJA 1TYTA 3NTDA 3AECA 3KPFA 4JNAA 5J60A 5FS7A 4H4YA 3LZXA 4YKGA 1ZP0A 1XHCA 2ZZ0A 2BC1A 2GMJA 5LV9A 2WP6A 5DBJA 3RP6A 2UZZA 3DGHA 4ADWA 1E1NA 5U63A 4A5LA 3CPHG 3NLCA 4GDEA 2BS2A 2CFYA 3SFEA 4FDCB 4JQ9A 3NN0X 4Z25A 4H7UA 4NWZA 1M64A 4U8PA 5KWFA 4C3YA 4OPGA 1LQUA 5KVHA 1PBBA 3M0OA 3Q6JA 3PO7A 1DOEA 4J56A 4DGKA 3IHMA 4EQRA 1IUUA 4EMJA 4CCRA 3GWFA 1PXAA 1ZOYA 2BS3A 1F8SA 3KU9A 4M52A 1W4XA 5KVIA 1CC2A 1CJ3A 1E1MA 2AAQA 1Q1WA 1ZMCA 1PJ5A 1VG0A 1ZMDA 2H88A 2I0ZA 3O0HA 1Y0PA 2R4EA 2XVEA 3RP8A 2B7SA 3G5RA 1PS9A 4B65A 1TDOA 2WEUA 4EQXA 3P4PA 4LA1A 1GRTA 1DJNA 1DOBA 2BK3A 3NHOX 4XWRA 3SZ0A 5BULA 3UKKA 4OPLA 4O5QA 1ZY8A 2YG4A 4CBQA 3D9XA 2YLWA 3CGDA 3AD7B 4TM3A 1OJ9A 1GETA 3NT6A 1IUXA 4G73A 1CJCA 3P4RA 4H2RA 3UOVA 1GRFA 3AB1A 4IA6A 3UOXA 2YVJA 3LJPA 2RGJA 1E39A 1RYIA 3KA7A 2VRLA 1JRYA 4H4QA 2A8XA 1XDIA 4EMIA 2WDVA 1E1KA 2YG7A 1N1PA 4GF7A 1OJDA 4EMWA 5KNLA 2YLXA 1BKWA 3ABVA 3ALLA 1LQTA 4ZCCA 1NHPA 1LV0A 1B4VA 1OJCA 1FEBA 1BF3A 4GAVA 1PN0A 1JU2A 2C3CA 3URHA 2C75A 5HY5A 1F6MA 3II4A 1Y56B 2E1MA 3I3LA 5IQ1A 4AOSA 2C70A 3DMEA 3NTAA 4II3A 3AE9A 3CNDA 3COXA 2BACA 2CDUA 2FJBA 3AEEA 1GXFA 2YLTA 4IA5A 2GQWA 4USQA 2FJDA 2C67A 2R4JA 4OPIA 2QCUA 2GRTA 3SGLA 3GD4A 3KLJA 2VVMA 4UP3A 3UTGA 4Z43A 3AYIA 2RABA 3BI2A 3B3RA 3ATQA 2DKIA 3CIRA 2WOVA 1IUWA 2TMDA 4B63A 4J36A 2YAUA 2B9YA 3AD9B 3AEAA 4U2TA 4Y4LA 1KSUA 3NYCA 4YSYA 4FK1C 3QSSA 5EB4A 2Y6RA 3Q9TA 2XLRA 3UCLA 3BHFA 3ALJA 3NKSA 2C4CA 1LPFA 5GRTA 1ZDLA 4X9MA 3UP4A 3NK0X 1ONFA 4PABA 3AE5A 3UTFA 4BK1A 3L8KA 1ZKQA 3GYJA 1VRQB 1EL8A 4BJZA 1GSNA 2VQ7A 4YSXA 2ZBWA 3VRAA 5JCMA 3QFAA 1AOGA 1XANA 3QVRA 4H2QA 3UKPA 3SZWA 1LJ1A 2BXRA 2DKHA 4YWOA 3NYEA 3NK1X 4JNQA 3RP7A 2OAMA 3KD9A 2BABA 3IWAA 4X9NA 5BVAA 3KPKA 2YG5A 2WP5A 1PBEA 4G74A 1NEKA 2R46A 3DK9A 2WOWA 1H86A 1H83A 3BNMA 2X8CA 4CY6A 4EQWA 2WU2A 4U8OA 2WS3A 1X31B 2BRYA 3PVCA 1O5WA 3SM8A 3VQRA 2AQJA 4YSHA 1FL2A 3ATRA 3VRBA 4BK3A 3LXDA 1JOAA 3AE3A 2X8HA 3M12A 1D5TA 1NDAA 2Z5YA 2XYOA 3EF6A 3QFBA 3CPIG 3K7QX 3ZYXA 3T2YA 2XLSA 1NAAA 3EANA 2GF3A 3AD8B 3AEDA 3AYLA 4H2PA 3UOZA 3H4KA 2XFUA 1PBCA 2WU5A 4B1BA 4JDRA 4CY8A 1NENA 2WHDA 2BK5A 3UKAA 4OPDA 2C73A 3UOYA 2APGA 4U2LA 2OLOA 1NHSA 1KDGA 1IJHA 5FS6A 4EM4A 3AE6A 1TDEA 2YR5A 2IVDA 4JN9A 1K4QA 2WP9A 4U8MA 3PS9A 5KXJA 2JB2A 3FIMB 3BI5A 2WDRA 1N4VA 1PBDA 3K7TA 4K5RA 1GALA 3T2ZA 3VR9A 4C77A 2GR0A 3LB8A 2XVFA 1B5QA 4Z2RA 1GRAA 1VG9A 2YLZA 2QA2A 4ICYA 4C5OA 3AYJA 3GYXA 1OJAA 3AE7A 3M13A 1GEUA 1IUSA 1ZOVA 4TM0A 4DNAA 4J57A 1PDHA 1NG4A 2WESA 3QSEA 3S61A 3DJJA 1YQ3A 5M10A 3EAOA 2OALA 2EQ7A 3CGBA 5BRTA 4K7ZA 4Z44A 1KNPA 2XVJA 3LADA 2RGHA 3DK4A 4UDQA 1HYUA 2PYXA 3BI4A 4TLZA 2X8GA 5HYMA 2NPXA 1UKVG 1N4UA 2VZ2A 5C3JA 2PHHA 2Q7VA 4NTEA 4Z2UA 1GOSA 2XFOA 3UKLA 4LIIA 3B6DA 4IVOB 4WX1A 2YR4A 4XWZA 3VR8A 1GREA 1NHRA 1S2YA 4AT2A 5U1OA 2Q0KA 2XFQA 4B66A 5BUKA 3PG6A 1FCDA 2C3DA 2BYBA 3NK2X 1BGNA 1F3PA 1E6EA 1K0JA 4H50A 2XVHA 1QLBA 4U8IA 3AE4A 1Z6LA 1ZK7A 2GMHA 4J2WA 4UDRA 2V3AA 5EOWA 2BCGG 3F8PA 3GDNA 4D04A 3OZ2A 1DOCA 5GSNA 1PBFA 2ZZBA 3CPJG 1VQWA 3L1RA 4AT0A 3SZFA 2XDOA 1BGJA 4N9XA 5TR3A 1RP0A 2R9ZA 5L46A 3NNEA 3UKQA 2JB1A 5U25A 3P9UA 3HYXA 4AOXA 4IVMB 2GEWA 5JCLA 4KPRA 2H89A 2VOUA 3NIXA 2R45A 4GR1A 3AE1A 4OPCA 1V59A 4EQSA 4IV9A 4TLXA 4A9WA 1KF6A 1H7WA 2GB0A 2A89A 1CL0A 1JRZA 1CHUA 1KNRA 3NRNA 2V6OA 2JBVA 4II2A 3ICSA 4B67A 4H4XA 2WETA 2Y6QA 4BURA 4I58A 4GRTA 3NH3X 4ZN0A 4H4PA 5JCKA 4APNA 2C7GA 1Y56A 4CCQA 3CGCA 2C76A 1GPEA 4O5UA 1RSGA 1CC4A 5JCIA 1E7PA 2R0CA 2XCGA 2VQBA 3BNUA 3C4AA 2OLNA 4U8LA 1L0VA 3P1WA 3SFDA 2YVFA 4BK2A 3UKHA 1K0LA 4H4TA 2GV8A 2FBWA 2GR2A 1GRGA 2CULA 5KMSA 3C4NA 3QSMA 3FBSA 1TDKA 4NTCA 2XLTA 3RHAA 4H2NA 3GWDA 2BC0A 4RG4A 3V76A 4OPUA 4YXDA 1MO9A 3T31A 1TDFA 5KMQA 1H6VA 4H4SA 3F8DA 5CQFA 1O94A 3AEBA 4EM3A 4B69A 3AXBA 2A87A 1PJ7A 3AEFA 4GCMA 3SX6A 1NG3A 1LVLA 3CNTA 1QJDA 3DGZA 1PJ6A 3G5QA 1YQ4A 1B8SA 1S3EA 1EBDA 5FMHA 2Q0LA 3C96A 3CMMA 2YVGA 5EBKA 1NHQA 2WOIA 3D8XA 2XLUA 4OPTA 4YTNA 2QAEA 4NEVA 2FJAA 1FOHA 1GTHA 3ADAB 1MOKA 1GTEA 2NVKX 3CNJA 4FX9A 2E5VA 2XFNA 1L9DA 3V3NA 2BXSA 2E4GA 1KN0A 1SEZA 1ELIA 3AEGA 3GYIA 2FJEA 3CGEA 4K8DA 2RGOA 1H7XA 3SYIA 4A65A 5KOXA 3OC4A 1F8WA 1GRHA 1KSSA 2EQ8A 1CF3A 1PHHA 4XXGA 3ICRA 3IHGA 3P4QA 3AE2A 3JSKA 1COYA 1H81A 1CJ4A 5M0ZA 1DXLA 2C72A 3SZCA 4C74A 2JKCA 1ZX9A 1F8RA 3GMCA 4KX6A 4YT0A 4A99A 4X4JA 4NNJA 2Q6UA 4BV6A 1K0IA 4G6HA 4GAPA 1D4CA 1QO8A 3SQPA 1DJQA 1EL9A 3DA1A 3GDPA 1GESA 4HB9A 4K22A 2BK4A 4OCGA 1EL5A 3V3OA 4FK1A 3K30A 3T2KA 1TYPA 1H84A 1REOA 3KVEA 3SY4A 4OVIA 4E0VA 1Q9IA 4U8KA 1N4WA 2BCPA 5C2TA 1CJ2A 3HZLA 2B76A 3ICTA 1FEAA 4J34A 3CTYA 1CBOA 4ECHA 2IIDA 1DNCA 1P2EA 2GR1A 2XFPA 3CNPA 3LZWA 4GUVA 1EL7A 3DJDA 2EQ6A 4UDPA 4ZCDA 1JNZA 3E1TA 5HHFA 3VRDB 1FECA 1GRBA 1D4DA 1KFYA 2YM2A 4B68A 5KOWA 3T14A 2JB3A 2X3NA 5FS9A 2IVEA 4Z26A 1IUVA 2YM1A 4K5SA 3T0KA 3CNSA 4PAAA 3GD3A 3DJEA 3FMWA 2XLPA 4YTMA 3I6DA 4YSZA 4NTDA 1S3BA 4TM4A 2VVLG 1H2IA 1VDCA 4Z24A 3P4SA 4H4VA 2JK6A 2YLSA 2C64A 1D7LA 4GDPA 1D7YA 2ZZCA 3K7MX 3UKFA 1TRBA 3GRSA 4A6NB 3GSIA 1NPXA 3ISHA 3F8RA 2WPEA 4K2XA 4CNJA 5HXIA 3FG2P 2V61A 2VRMA 2YG6A 4CRTA 1JEHA 4D03A 3S5WA 1GV4A 1M6IA 2WBAA 2WPCA 2J3NA 3UTEA 3R9UA 2B9WA 1O95A 3HYVA 1D4EA 2C65A 3BHKA 4H4RA 2GAGB 2VVLA 2QA1A 3IC9A 3EPTA 1P2HA 5KMPA 2EQ9A 3KKJA 4HA6A 1OJTA 1S7MA 1CC6A 2X99A 1IUTA 5CKUA 2W0HA 4A6NA 4YTPA 3T37A 1TDNA 4EIQA 3REDA 3ZDNA 2R0GA 2BRAA 4LU6A 5FS8A 5JCNA 3ALMA 3SXIA 3LOVA 4DSHA 4U8NA 2O9ZA 3H8LA 2GVCA 2V3BA 5ER0A 4J33A 2GR3A 2TPRA 4USRA 1JRXA 2CVJA 2WPFA 1H82A 4WCTA 1GT8A 4H4WA 1MXTA 2HQMA 4G9KA 2WDQA 1DODA 1XPQA 4C3XA 2WQYA 2B7RA 3D1CA 3IF9A 4JY2A 3AE8A 4AP1A 2OA1A 4YKFA 4CNKA 2GH5A 1PXCA 3HYWA 4H4UA 4MJWA 2X50A 2ARDA 1GNDA 4RG3A 4Y4MA 3DK8A 2XVIA 2GQFA 3UTHA 4A7AA 4Z2TA 5KRQA 1PXBA 1BZLA 3NG7X 3NYFA 5IQ4A 5KMRA 3H8IA 3QVPA 3FPZA 3CN8A 4G6GA 4BJYA 1L9CA 3NN6X 1YKJA 2YG3A 2B9XA 4A79A 2YLRA 1S2QA 1E1LA 4REKA 3G5SA 2ACZA 4JY3A 3QJ4A 3GMBA 1B37A 4DSGA 2AR8A 5JRBA 3WE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNM A;  3DH9 A;  1Q1R A;  1BWC A;  1YY5 A;  4J31 A;  2YQU A;  2V60 A;  2V5Z A;  4AP3 A;  3GRT A;  4NEW A;  1JNR A;  2YR6 A;  3AWI A;  4I59 A;  4RSL A;  5J7X A;  4B64 A;  1GER A;  2R0P A;  4EIP A;  5IPY A;  4H4Z A;  3NGC X;  2BA9 A;  4U8J A;  2YWL A;  2Z5X A;  2JAE A;  2BS4 A;  2F5Z A;  2GAH B;  2C66 A;  4P9S A;  4NZH A;  4TM1 A;  4Y4N A;  5EB5 A;  1LTX R;  1L9E A;  3UP5 A;  3DJG X;  1YQZ A;  4U2S A;  3ITJ A;  1TYT A;  3NTD A;  3AEC A;  3KPF A;  4JNA A;  5J60 A;  5FS7 A;  4H4Y A;  3LZX A;  4YKG A;  1ZP0 A;  1XHC A;  2ZZ0 A;  2BC1 A;  2GMJ A;  5LV9 A;  2WP6 A;  5DBJ A;  3RP6 A;  2UZZ A;  3DGH A;  4ADW A;  1E1N A;  5U63 A;  4A5L A;  3CPH G;  3NLC A;  4GDE A;  2BS2 A;  2CFY A;  3SFE A;  4FDC B;  4JQ9 A;  3NN0 X;  4Z25 A;  4H7U A;  1M64 A;  4U8P A;  5KWF A;  4C3Y A;  4OPG A;  1LQU A;  5KVH A;  1PBB A;  3M0O A;  3Q6J A;  3PO7 A;  1DOE A;  4J56 A;  4DGK A;  3IHM A;  4EQR A;  1IUU A;  4EMJ A;  4CCR A;  3GWF A;  1PXA A;  1ZOY A;  2BS3 A;  1F8S A;  3KU9 A;  4M52 A;  1W4X A;  5KVI A;  1CC2 A;  1CJ3 A;  1E1M A;  2AAQ A;  1Q1W A;  1ZMC A;  1PJ5 A;  1VG0 A;  1ZMD A;  2H88 A;  2I0Z A;  3O0H A;  1Y0P A;  2R4E A;  2XVE A;  3RP8 A;  2B7S A;  3G5R A;  1PS9 A;  4B65 A;  1TDO A;  2WEU A;  4EQX A;  3P4P A;  4LA1 A;  1GRT A;  1DJN A;  1DOB A;  2BK3 A;  3NHO X;  4XWR A;  5BUL A;  3UKK A;  4OPL A;  4O5Q A;  1ZY8 A;  2YG4 A;  4CBQ A;  2YLW A;  3CGD A;  3AD7 B;  4TM3 A;  1OJ9 A;  1GET A;  3NT6 A;  1IUX A;  1CJC A;  3P4R A;  4H2R A;  3UOV A;  1GRF A;  3AB1 A;  4IA6 A;  3UOX A;  2YVJ A;  3LJP A;  2RGJ A;  1E39 A;  1RYI A;  3KA7 A;  2VRL A;  1JRY A;  4H4Q A;  2A8X A;  1XDI A;  4EMI A;  2WDV A;  1E1K A;  2YG7 A;  1N1P A;  4GF7 A;  1OJD A;  4EMW A;  2YLX A;  1BKW A;  3ABV A;  3ALL A;  1LQT A;  4ZCC A;  1NHP A;  1LV0 A;  1B4V A;  1OJC A;  1FEB A;  1BF3 A;  1PN0 A;  1JU2 A;  2C3C A;  3URH A;  2C75 A;  5HY5 A;  1F6M A;  3II4 A;  1Y56 B;  2E1M A;  3I3L A;  5IQ1 A;  4AOS A;  2C70 A;  3DME A;  3NTA A;  3AE9 A;  3CND A;  3COX A;  2BAC A;  2CDU A;  2FJB A;  3AEE A;  1GXF A;  2YLT A;  4IA5 A;  2GQW A;  4USQ A;  2FJD A;  2C67 A;  2R4J A;  4OPI A;  2QCU A;  2GRT A;  3SGL A;  3GD4 A;  3KLJ A;  2VVM A;  4UP3 A;  3UTG A;  4Z43 A;  3AYI A;  2RAB A;  3BI2 A;  3B3R A;  3ATQ A;  2DKI A;  3CIR A;  2WOV A;  1IUW A;  2TMD A;  4B63 A;  4J36 A;  2YAU A;  2B9Y A;  3AD9 B;  3AEA A;  4U2T A;  4Y4L A;  1KSU A;  3NYC A;  4YSY A;  4FK1 C;  3QSS A;  5EB4 A;  2Y6R A;  3Q9T A;  2XLR A;  3UCL A;  3BHF A;  3ALJ A;  3NKS A;  1LPF A;  5GRT A;  1ZDL A;  4X9M A;  3UP4 A;  3NK0 X;  1ONF A;  4PAB A;  3AE5 A;  3UTF A;  4BK1 A;  3L8K A;  1ZKQ A;  3GYJ A;  1VRQ B;  1EL8 A;  4BJZ A;  1GSN A;  2VQ7 A;  4YSX A;  2ZBW A;  3VRA A;  5JCM A;  3QFA A;  1AOG A;  1XAN A;  3QVR A;  4H2Q A;  3UKP A;  1LJ1 A;  2BXR A;  2DKH A;  4YWO A;  3NYE A;  3NK1 X;  4JNQ A;  3RP7 A;  2OAM A;  3KD9 A;  2BAB A;  3IWA A;  4X9N A;  5BVA A;  2YG5 A;  2WP5 A;  1PBE A;  1NEK A;  2R46 A;  3DK9 A;  2WOW A;  1H86 A;  1H83 A;  3BNM A;  2X8C A;  4CY6 A;  4EQW A;  2WU2 A;  4U8O A;  2WS3 A;  1X31 B;  3PVC A;  1O5W A;  3SM8 A;  3VQR A;  2AQJ A;  4YSH A;  1FL2 A;  3ATR A;  3VRB A;  4BK3 A;  3LXD A;  1JOA A;  3AE3 A;  2X8H A;  3M12 A;  1D5T A;  1NDA A;  2Z5Y A;  2XYO A;  3EF6 A;  3QFB A;  3CPI G;  3K7Q X;  3ZYX A;  2XLS A;  1NAA A;  3EAN A;  2GF3 A;  3AD8 B;  3AED A;  3AYL A;  4H2P A;  3UOZ A;  3H4K A;  2XFU A;  1PBC A;  2WU5 A;  4B1B A;  4JDR A;  4CY8 A;  1NEN A;  2WHD A;  2BK5 A;  3UKA A;  4OPD A;  2C73 A;  3UOY A;  2APG A;  4U2L A;  2OLO A;  1NHS A;  1KDG A;  1IJH A;  5FS6 A;  4EM4 A;  3AE6 A;  1TDE A;  2YR5 A;  2IVD A;  4JN9 A;  1K4Q A;  2WP9 A;  4U8M A;  3PS9 A;  5KXJ A;  2JB2 A;  3FIM B;  3BI5 A;  2WDR A;  1N4V A;  1PBD A;  3K7T A;  4K5R A;  1GAL A;  3VR9 A;  4C77 A;  2GR0 A;  3LB8 A;  2XVF A;  1B5Q A;  4Z2R A;  1GRA A;  1VG9 A;  2YLZ A;  2QA2 A;  4ICY A;  4C5O A;  3AYJ A;  3M13 A;  1OJA A;  3AE7 A;  4CNJ A;  1GEU A;  1IUS A;  1ZOV A;  4TM0 A;  4DNA A;  4J57 A;  1PDH A;  1NG4 A;  2WES A;  3QSE A;  3S61 A;  3DJJ A;  1YQ3 A;  5M10 A;  3EAO A;  2OAL A;  2EQ7 A;  3CGB A;  5BRT A;  4K7Z A;  4Z44 A;  1KNP A;  2XVJ A;  3LAD A;  2RGH A;  3DK4 A;  4UDQ A;  1HYU A;  2PYX A;  3BI4 A;  4TLZ A;  2X8G A;  5HYM A;  2NPX A;  1UKV G;  1N4U A;  2VZ2 A;  5C3J A;  2PHH A;  2Q7V A;  4NTE A;  4Z2U A;  1GOS A;  2XFO A;  3UKL A;  4LII A;  3B6D A;  4IVO B;  4WX1 A;  2YR4 A;  4XWZ A;  3VR8 A;  1GRE A;  1NHR A;  1S2Y A;  4AT2 A;  5U1O A;  2Q0K A;  2XFQ A;  4B66 A;  5BUK A;  1FCD A;  2C3D A;  2BYB A;  3NK2 X;  1BGN A;  1F3P A;  1E6E A;  1K0J A;  4H50 A;  2XVH A;  1QLB A;  4U8I A;  3AE4 A;  1Z6L A;  1ZK7 A;  2GMH A;  4J2W A;  4UDR A;  2V3A A;  5EOW A;  2BCG G;  3F8P A;  3GDN A;  4D04 A;  3OZ2 A;  1DOC A;  5GSN A;  1PBF A;  2ZZB A;  3CPJ G;  1VQW A;  3L1R A;  4AT0 A;  2XDO A;  1BGJ A;  4N9X A;  5TR3 A;  1RP0 A;  2R9Z A;  5L46 A;  3NNE A;  3UKQ A;  2JB1 A;  5U25 A;  3P9U A;  4AOX A;  4IVM B;  2GEW A;  5JCL A;  4KPR A;  2H89 A;  2VOU A;  3NIX A;  2R45 A;  4GR1 A;  3AE1 A;  4OPC A;  1V59 A;  4EQS A;  4IV9 A;  4TLX A;  4A9W A;  1KF6 A;  1H7W A;  2GB0 A;  2A89 A;  1CL0 A;  1JRZ A;  1CHU A;  1KNR A;  2V6O A;  2JBV A;  3ICS A;  4B67 A;  4H4X A;  2WET A;  2Y6Q A;  4BUR A;  4I58 A;  4GRT A;  3NH3 X;  4ZN0 A;  4H4P A;  5JCK A;  4APN A;  2C7G A;  1Y56 A;  4CCQ A;  3CGC A;  2C76 A;  1GPE A;  4O5U A;  1RSG A;  1CC4 A;  5JCI A;  1E7P A;  2R0C A;  2XCG A;  2VQB A;  3BNU A;  3C4A A;  2OLN A;  4U8L A;  1L0V A;  3P1W A;  3SFD A;  2YVF A;  4BK2 A;  3UKH A;  1K0L A;  4H4T A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  2CUL A;  3C4N A;  3QSM A;  3FBS A;  1TDK A;  4NTC A;  2XLT A;  3RHA A;  4H2N A;  3GWD A;  2BC0 A;  4RG4 A;  3V76 A;  4OPU A;  4YXD A;  1MO9 A;  1TDF A;  1H6V A;  4H4S A;  3F8D A;  5CQF A;  1O94 A;  3AEB A;  4EM3 A;  4B69 A;  3AXB A;  2A87 A;  1PJ7 A;  3AEF A;  4GCM A;  1NG3 A;  1LVL A;  3CNT A;  1QJD A;  3DGZ A;  1PJ6 A;  3G5Q A;  1YQ4 A;  1B8S A;  1S3E A;  1EBD A;  5FMH A;  2Q0L A;  3C96 A;  3NRN A;  2YVG A;  5EBK A;  1NHQ A;  2WOI A;  3D8X A;  2XLU A;  4OPT A;  4YTN A;  2QAE A;  4NEV A;  2FJA A;  1FOH A;  1GTH A;  3ADA B;  1MOK A;  1GTE A;  2NVK X;  3CNJ A;  4FX9 A;  2E5V A;  2XFN A;  1L9D A;  3V3N A;  2BXS A;  2E4G A;  3AEG A;  1SEZ A;  1ELI A;  3GYI A;  2FJE A;  3CGE A;  4K8D A;  2RGO A;  1H7X A;  4A65 A;  5KOX A;  3OC4 A;  1F8W A;  1GRH A;  1KSS A;  2EQ8 A;  1CF3 A;  1PHH A;  4XXG A;  3ICR A;  3IHG A;  3P4Q A;  3AE2 A;  3JSK A;  1COY A;  1H81 A;  1CJ4 A;  5M0Z A;  1DXL A;  2C72 A;  4C74 A;  2JKC A;  1ZX9 A;  1F8R A;  3GMC A;  4KX6 A;  4YT0 A;  4A99 A;  4X4J A;  2Q6U A;  4BV6 A;  1K0I A;  1D4C A;  1QO8 A;  3SQP A;  1DJQ A;  1EL9 A;  3DA1 A;  3GDP A;  1GES A;  4HB9 A;  4K22 A;  2BK4 A;  4OCG A;  1EL5 A;  3V3O A;  4FK1 A;  3K30 A;  1TYP A;  1H84 A;  1REO A;  3KVE A;  4E0V A;  4OVI A;  1Q9I A;  4U8K A;  1N4W A;  2BCP A;  5C2T A;  1CJ2 A;  3HZL A;  2B76 A;  3ICT A;  1FEA A;  4J34 A;  3CTY A;  1CBO A;  4ECH A;  2IID A;  1DNC A;  1P2E A;  2GR1 A;  2XFP A;  3CNP A;  3LZW A;  4GUV A;  1EL7 A;  3DJD A;  2EQ6 A;  4UDP A;  4ZCD A;  1JNZ A;  3E1T A;  5HHF A;  3VRD B;  1FEC A;  1GRB A;  1D4D A;  1KFY A;  2YM2 A;  4B68 A;  5KOW A;  2JB3 A;  2X3N A;  5FS9 A;  2IVE A;  4Z26 A;  1IUV A;  2YM1 A;  4K5S A;  3CNS A;  4PAA A;  3GD3 A;  3DJE A;  3FMW A;  2XLP A;  4YTM A;  3I6D A;  4YSZ A;  4NTD A;  1S3B A;  4TM4 A;  2VVL G;  1VDC A;  4Z24 A;  3P4S A;  4H4V A;  2JK6 A;  2YLS A;  2C64 A;  1D7L A;  4GDP A;  1D7Y A;  2ZZC A;  3K7M X;  3UKF A;  1TRB A;  3GRS A;  4A6N B;  3GSI A;  1NPX A;  3ISH A;  3F8R A;  2WPE A;  4K2X A;  5HXI A;  3FG2 P;  2V61 A;  2VRM A;  2YG6 A;  4CRT A;  1JEH A;  4D03 A;  3S5W A;  1GV4 A;  1M6I A;  2WBA A;  2WPC A;  2J3N A;  3UTE A;  3R9U A;  2B9W A;  1O95 A;  1D4E A;  2C65 A;  3BHK A;  4H4R A;  2GAG B;  2VVL A;  2QA1 A;  3IC9 A;  3EPT A;  1P2H A;  2EQ9 A;  3KKJ A;  4HA6 A;  1OJT A;  1CC6 A;  2X99 A;  1IUT A;  5CKU A;  2W0H A;  4A6N A;  4YTP A;  3T37 A;  1TDN A;  4EIQ A;  3RED A;  3ZDN A;  2R0G A;  4LU6 A;  5FS8 A;  5JCN A;  3ALM A;  3LOV A;  4DSH A;  4U8N A;  2O9Z A;  3H8L A;  2GVC A;  2V3B A;  5ER0 A;  4J33 A;  2GR3 A;  2TPR A;  4USR A;  1JRX A;  2CVJ A;  2WPF A;  1H82 A;  4WCT A;  1GT8 A;  4H4W A;  1MXT A;  2HQM A;  2WDQ A;  1DOD A;  1XPQ A;  4C3X A;  2WQY A;  2B7R A;  3D1C A;  3IF9 A;  4JY2 A;  3AE8 A;  4AP1 A;  2OA1 A;  4YKF A;  4CNK A;  2GH5 A;  1PXC A;  4H4U A;  4MJW A;  2X50 A;  2ARD A;  1GND A;  4RG3 A;  4Y4M A;  3DK8 A;  2XVI A;  2GQF A;  3UTH A;  4A7A A;  4Z2T A;  5KRQ A;  1PXB A;  1BZL A;  3NG7 X;  3NYF A;  5IQ4 A;  3H8I A;  3QVP A;  3FPZ A;  3CN8 A;  4BJY A;  1L9C A;  3NN6 X;  1YKJ A;  2YG3 A;  2B9X A;  4A79 A;  2YLR A;  1S2Q A;  1E1L A;  4REK A;  3G5S A;  2ACZ A;  4JY3 A;  3QJ4 A;  3GMB A;  1B37 A;  4DSG A;  2AR8 A;  3WE0 A; 
#chains in the Genus database with same CATH topology
 3RNM A;  3GRT A;  4ZOH B;  2YR6 A;  4P9S A;  5EB5 A;  1LTX R;  1L9E A;  3DJG X;  4U2S A;  3NTD A;  3KPF A;  5FS7 A;  4H4Y A;  1XHC A;  2PTW A;  3VC6 A;  3RP6 A;  3P0W A;  3DGH A;  4ADW A;  1E1N A;  3CPH G;  2CFY A;  4Z25 A;  4NWZ A;  1M64 A;  3MY9 A;  3PO7 A;  1DOE A;  3GWF A;  1PXA A;  1F8S A;  3R25 A;  4DYE A;  2OPJ A;  2QJJ A;  2AL2 A;  4OPL A;  4O5Q A;  4CBQ A;  2YLW A;  3AD7 B;  4TM3 A;  2XGZ A;  2AKM A;  4H2R A;  3AB1 A;  3NRZ B;  1ELS A;  2YVJ A;  3DG3 A;  1JRO A;  3KA7 A;  2VRL A;  3TWA A;  2A8X A;  1XDI A;  4EMI A;  4GF7 A;  4EMW A;  1LQT A;  4ZCC A;  1FEB A;  1PN0 A;  2C3C A;  5HY5 A;  1F6M A;  1Y56 B;  2E1M A;  5IQ1 A;  1KKO A;  3N6J A;  2QDE A;  3NTA A;  3AE9 A;  2MUC A;  3CND A;  2BAC A;  2FJB A;  1GXF A;  3T8Q A;  2AKZ A;  3SGL A;  4OPI A;  3UTG A;  2GRT A;  4E5T A;  1ONE A;  2TMD A;  3CXB A;  3FVD A;  3Q9T A;  5IDZ A;  3NKS A;  3UP4 A;  1VRQ B;  1GSN A;  3NVV B;  1XAN A;  4H2Q A;  3NYE A;  2BXR A;  2DKH A;  3NK1 X;  3KD9 A;  5BVA A;  2YG5 A;  3DK9 A;  1X31 B;  1O5W A;  3MWC A;  3ATR A;  2X8H A;  1D5T A;  2XYO A;  3QFB A;  3ZYX A;  2GF3 A;  3AD8 B;  3UOZ A;  2C73 A;  3UCD A;  4EM4 A;  1TDE A;  2YR5 A;  3B9J B;  3FIM B;  4HCD A;  3EKG A;  4K5R A;  1PBD A;  2CHR A;  5BOE A;  3VR9 A;  3LB8 A;  4GFI A;  1B5Q A;  4Z2R A;  3IJL A;  4ICY A;  3AYJ A;  4IL0 A;  3T9P A;  1NG4 A;  3QSE A;  5M10 A;  3EAO A;  2OAL A;  2EQ7 A;  5BRT A;  4Z44 A;  1KNP A;  2RGH A;  1UKV G;  3SQS A;  4Z2U A;  1GOS A;  3BOX A;  4AT2 A;  3VR8 A;  3ZVI A;  5BUK A;  2C3D A;  1BGN A;  1F3P A;  3THU A;  1K0J A;  4H50 A;  1Z6L A;  3I6E A;  4D04 A;  3PWI A;  1DOC A;  1PBF A;  1VQW A;  1KKR A;  1BGJ A;  4N9X A;  3HRD C;  3UKQ A;  3P9U A;  2AL2 B;  3A7A A;  2H89 A;  4KPR A;  1V59 A;  4IV9 A;  1JRZ A;  1KNR A;  2JBV A;  3ICS A;  4B67 A;  2WET A;  2Y6Q A;  4BUR A;  4GRT A;  2E3T A;  4H4P A;  3RIT A;  3CGC A;  4GME A;  1RSG A;  1JPM A;  3BNU A;  3C4A A;  2HNE A;  2VQB A;  4BK2 A;  3P1W A;  2YVF A;  3UKH A;  3DG7 A;  1K0L A;  4H4T A;  4HCL A;  5KMS A;  3RHA A;  2BC0 A;  4YXD A;  3T31 A;  5FJR A;  4H4S A;  2PGW A;  3AEB A;  3AN1 A;  3SX6 A;  1NG3 A;  1OEP A;  3C96 A;  3CMM A;  2Q0L A;  1B8S A;  1EC7 A;  4GGH A;  5FMH A;  2WOI A;  1JRP A;  2QAE A;  4TVW A;  3NFU A;  4FX9 A;  1L9D A;  3GY1 A;  3GYI A;  3UJE A;  4K8D A;  1TZZ A;  3OC4 A;  3IHG A;  3JSK A;  1H81 A;  2P0I A;  4KX6 A;  4YT0 A;  4YWS A;  2Q6U A;  4BV6 A;  1D4C A;  4K22 A;  2MNR A;  3T2K A;  1TYP A;  4E0V A;  3SY4 A;  1Q9I A;  4U8K A;  2BCP A;  2B76 A;  2POD A;  5HHF A;  3DJD A;  3NO1 A;  1EBG A;  1FEC A;  2YM2 A;  3JVA A;  2JB3 A;  2YM1 A;  3GD3 A;  3FMW A;  3I6D A;  3UXK A;  2VVL G;  1VDC A;  2JK6 A;  2C64 A;  1D7L A;  4Z17 A;  2W54 A;  3GRS A;  3DIP A;  3GSI A;  2WPE A;  2V61 A;  1JEH A;  1M6I A;  3UGV A;  3R9U A;  1L8P A;  3BHK A;  4H4R A;  3KKJ A;  4HA6 A;  3OP2 A;  2W0H A;  3V5C A;  1TDN A;  4EIQ A;  2R0G A;  5FS8 A;  5JCN A;  3SXI A;  4U8N A;  2O9Z A;  4H19 A;  3VDG A;  3ES8 A;  5ER0 A;  2WPF A;  4WCT A;  2POZ A;  1MXT A;  1DOD A;  1XPQ A;  4IP4 A;  2WQY A;  3S5S A;  3D1C A;  1VDV A;  1SJD A;  1N5X A;  1PXC A;  4H4U A;  1GND A;  2XVI A;  2GQF A;  1PXB A;  3QVP A;  3NXL A;  4BJY A;  4HN8 A;  1YKJ A;  2B9X A;  4H1Z A;  4JY3 A;  2OKT A;  5JRB A;  3R10 A;  1YY5 A;  4AP3 A;  4B64 A;  1JNR A;  4RSL A;  2RDX A;  4JN7 A;  2YWL A;  2JAE A;  2BS4 A;  2C66 A;  3UJR A;  1FFU C;  3UP5 A;  2QJM A;  1X2G A;  2ZZ0 A;  2BC1 A;  3U9I A;  2UZZ A;  3NLC A;  1PDY A;  4GDE A;  4JQ9 A;  1N63 C;  3R0K A;  4E6M A;  3NVZ B;  3D46 A;  4U8P A;  3Q6J A;  7ENL A;  2OZT A;  4CCR A;  4M52 A;  1W4X A;  5KVI A;  4J36 A;  1ZMD A;  3O0H A;  2R4E A;  3RP8 A;  2XVE A;  1PS9 A;  5FJO A;  1GRT A;  1DOB A;  5BUL A;  2P8C A;  2YG4 A;  3D9X A;  3CGD A;  3EEZ A;  3JZU A;  4G73 A;  1CJC A;  3UOV A;  1GRF A;  2OFJ A;  4IA6 A;  3A7U A;  1BKW A;  4HYR A;  3I6T A;  1W6T A;  3IJQ A;  4ZCW A;  3DME A;  3QN3 A;  4II3 A;  4K1W A;  3COX A;  4A6G A;  4IA5 A;  2GQW A;  2FJD A;  2C67 A;  2QCU A;  3AYI A;  3BI2 A;  2DKI A;  2WOV A;  3AEA A;  3NYC A;  4X2P A;  4FK1 C;  5EB4 A;  4E4U A;  5GRT A;  1ZDL A;  4PAB A;  3L8K A;  1ZKQ A;  3GYJ A;  2VQ7 A;  3SZW A;  1LJ1 A;  4YWO A;  3IWA A;  2PSN A;  2XH2 A;  1PBE A;  1H83 A;  4CY6 A;  4E8G A;  4EQW A;  4U8O A;  2WS3 A;  3PVC A;  3VQR A;  3SM8 A;  2AQJ A;  3VRB A;  3EF6 A;  4DX3 A;  3CPI G;  3K7Q X;  3T2Y A;  3AED A;  2OLA A;  3R07 C;  4B1B A;  3SBF A;  2WHD A;  2BK5 A;  1EC8 A;  3UOY A;  2APG A;  4U2L A;  5FS6 A;  3TOY A;  3AE6 A;  1K4Q A;  2OVL A;  4U8M A;  2JB2 A;  1N4V A;  3T2Z A;  1GAL A;  4C77 A;  2GR0 A;  2XVF A;  3PK7 A;  1GRA A;  1VG9 A;  2P3Z A;  3GYX A;  3M13 A;  3S61 A;  4DNA A;  4J57 A;  2WES A;  1YQ3 A;  3QKE A;  3DG6 A;  4DHG A;  2XVJ A;  3VA8 A;  1HYU A;  3BI4 A;  2X8G A;  5HYM A;  2VZ2 A;  2PHH A;  2Q7V A;  3UKL A;  4WX1 A;  2YR4 A;  2Q0K A;  1WUE A;  3SN1 A;  3N4F A;  3D47 A;  4UDR A;  2V3A A;  3F8P A;  3OZ2 A;  5GSN A;  2ZZB A;  2XDO A;  4GYP A;  3CYJ A;  1R0M A;  2R9Z A;  3HYX A;  4AOX A;  4IVM B;  1NU5 A;  5JCL A;  1DTN A;  4KPL A;  2R45 A;  3AE1 A;  4A9W A;  1KF6 A;  2A89 A;  1RM6 B;  4H4X A;  4I58 A;  4ZN0 A;  2PS2 A;  2C7G A;  4CCQ A;  2XH7 A;  1CC4 A;  1E7P A;  3SFD A;  3H8A A;  3V5F A;  3N4E A;  3S47 A;  1TDK A;  2XLT A;  4H2N A;  3GWD A;  4RG4 A;  3V76 A;  3ZVH B;  4OPU A;  1TDF A;  5KMQ A;  3T4W A;  1JDF A;  1H6V A;  3F8D A;  1O94 A;  4B69 A;  3U4F A;  3DGZ A;  2W3S A;  1S3E A;  3NRN A;  5G5G B;  4YTN A;  1NHQ A;  3OZM A;  3DFH A;  4NEV A;  2FJA A;  1GTH A;  2NVK X;  2E5V A;  2E4G A;  1ELI A;  2RGO A;  3SYI A;  3P4Q A;  3AE2 A;  1COY A;  2C72 A;  1ZX9 A;  3GMC A;  1EC9 A;  4NNJ A;  4G6H A;  1BQG A;  3GDP A;  1GES A;  2BK4 A;  3HPF A;  4OCG A;  2P8B A;  1H84 A;  3KVE A;  5C2T A;  3FV9 A;  3ICT A;  1TKK A;  3CTY A;  1XS2 A;  2IID A;  2GR1 A;  3LZW A;  4GUV A;  4UDP A;  2OQH A;  3E1T A;  4B68 A;  3FXG A;  1FHU A;  4NTD A;  1H2I A;  3P4S A;  4H4V A;  2YLS A;  1D7Y A;  3UKF A;  1TRB A;  4A6N B;  5HXI A;  4CRT A;  4GGB A;  3UTE A;  2J3N A;  2B9W A;  2C65 A;  2GAG B;  2VVL A;  4HNL A;  5KMP A;  1S7M A;  1CC6 A;  2X99 A;  3TQP A;  5CKU A;  1WUF A;  4A6N A;  3T37 A;  2BRA A;  3LOV A;  3VCC A;  3H8L A;  2V3B A;  1H82 A;  4A35 A;  2HQM A;  2OQY A;  2DW6 A;  1MNS A;  2OA1 A;  2GH5 A;  2X50 A;  4A7A A;  3FPZ A;  4G6G A;  1L9C A;  3VCN A;  5FJT A;  3TCS A;  3SR6 B;  2YG3 A;  3NS1 B;  1X2H A;  2ACZ A;  2AR8 A;  2OO6 A;  3DH9 A;  1Q1R A;  1BWC A;  4J31 A;  4B63 A;  3R0U A;  3AWI A;  2R0P A;  4EIP A;  4H4Z A;  2Z5X A;  2GAH B;  4TM1 A;  3AMZ A;  2HXU A;  3AEC A;  5J60 A;  3LZX A;  1ZP0 A;  5LV9 A;  4A5L A;  1STZ A;  2BS2 A;  2GGJ A;  2GGE A;  4FDC B;  4E4F A;  4H7U A;  5KWF A;  4C3Y A;  4OPG A;  2O56 A;  3CAW A;  1IUU A;  3MQT A;  4A3R A;  4EMJ A;  1E1M A;  1CC2 A;  2AAQ A;  2I0Z A;  2H88 A;  1VG0 A;  2NQL A;  1Y0P A;  3GD6 A;  4H2H A;  4B65 A;  2PMQ A;  2WEU A;  4LA1 A;  3NHO X;  1MUC A;  3UKK A;  1OJ9 A;  1GET A;  1FIQ B;  4IHC A;  2RGJ A;  2PPG A;  1E39 A;  1RYI A;  2PP0 A;  1JRY A;  2WDV A;  2YG7 A;  4J3Z A;  1N1P A;  4FP1 A;  1OJD A;  2W55 A;  3ALL A;  1NHP A;  1B4V A;  1BF3 A;  1JU2 A;  3URH A;  3ZLH A;  3P3B A;  3MKC A;  2CDU A;  3OTR A;  4DXK A;  2YLT A;  2R4J A;  3KLJ A;  4Z43 A;  3P93 A;  2RAB A;  4JN8 A;  3CIR A;  1IUW A;  2PP1 A;  4U2T A;  4Y4L A;  1KSU A;  2HXT A;  2Y6R A;  2XLR A;  3BHF A;  3ALJ A;  2C4C A;  1LPF A;  4X9M A;  3NK0 X;  1ONF A;  3AE5 A;  6ENL A;  1EL8 A;  3SJN A;  2ZBW A;  3VRA A;  3QFA A;  3IK4 A;  1AOG A;  3UKP A;  3RP7 A;  4JNQ A;  2OAM A;  3I4K A;  3KPK A;  1NEK A;  3BNM A;  2X8C A;  4JHM A;  1BKH A;  1FL2 A;  3TTE A;  3HW2 A;  1JOA A;  3AE3 A;  2Z5Y A;  3VFC A;  1SJB A;  3EAN A;  3AYL A;  3H4K A;  2XFU A;  1PBC A;  1ZXI C;  3BSM A;  4CY8 A;  2GGG A;  5G5H B;  4OPD A;  3T6C A;  2OLO A;  1KDG A;  2PU1 A;  2XH0 A;  4JN9 A;  2WP9 A;  3PS9 A;  5KXJ A;  3IJI A;  3TJI A;  3BI5 A;  3K7T A;  4HCH A;  3TW9 A;  2QA2 A;  2FYM A;  1OJA A;  3AE7 A;  1ZOV A;  1PDH A;  3DJJ A;  2W3R A;  4K7Z A;  3DK4 A;  2PYX A;  1N4U A;  5C3J A;  3TJ4 A;  2XFO A;  4LII A;  4XWZ A;  1NHR A;  1S2Y A;  3UXL A;  3TWB A;  2XFQ A;  4B66 A;  3PG6 A;  3NVW B;  1FCD A;  2BYB A;  3NK2 X;  2XVH A;  4U8I A;  1ZK7 A;  2GMH A;  2E5A A;  1N62 C;  2P88 A;  3L1R A;  3CPJ G;  4AT0 A;  3RR1 A;  1RP0 A;  5L46 A;  3NNE A;  2JB1 A;  5U25 A;  3NIX A;  2VOU A;  4EQS A;  1H7W A;  2GB0 A;  4II2 A;  2V6O A;  3QLD A;  3V4B A;  1Y56 A;  2C76 A;  4O5U A;  5JCI A;  2R0C A;  4U8L A;  2I5Q A;  2GL5 A;  3PFR A;  1YEY A;  3CB3 A;  3DGB A;  3ES7 A;  3N6H A;  3OW1 A;  4DWD A;  2CUL A;  3C4N A;  3FBS A;  4NTC A;  4KWS A;  4DN1 A;  4EM3 A;  2A87 A;  1PJ7 A;  3AEF A;  1LVL A;  3CNT A;  2OG9 A;  1EBD A;  1SB3 B;  3S5W A;  2YVG A;  5EBK A;  4OPT A;  4ZA0 A;  3OZY A;  1MOK A;  1GTE A;  3CNJ A;  2XFN A;  2BXS A;  1SEZ A;  2FJE A;  4A65 A;  5KOX A;  2GGI A;  2QQ6 A;  1KSS A;  1PHH A;  4XXG A;  3ICR A;  5ENL A;  3B97 A;  3SZC A;  4C74 A;  2JKC A;  1KD0 A;  4GAP A;  2GGH A;  1QO8 A;  1N60 C;  3SQP A;  3DA1 A;  3DES A;  3MSY A;  3NZG A;  1EL5 A;  3V3O A;  4FI4 A;  4MKS A;  1REO A;  3ENL A;  3SN0 A;  1CBO A;  2XFP A;  2EQ6 A;  1N61 C;  3VRD B;  1GRB A;  1D4D A;  1KFY A;  5KOW A;  5FS9 A;  2IVE A;  4K5S A;  3T0K A;  3CK5 A;  3DJE A;  4YTM A;  2XLP A;  1S3B A;  3UJS A;  3K7M X;  3Q4D A;  1NPX A;  3FG2 P;  2YG6 A;  1ECQ A;  1IYX A;  2WBA A;  2WPC A;  1O95 A;  1D4E A;  5BOF A;  3BJS A;  2QA1 A;  2FKP A;  1P2H A;  1OJT A;  4F4R A;  4YTP A;  1N5W C;  4LU6 A;  3ALM A;  2TPR A;  4USR A;  4G9K A;  2ZAD A;  4C3X A;  2B7R A;  2XSX A;  1MRA A;  2ARD A;  4Y4M A;  4EWJ A;  3DK8 A;  3UTH A;  5IQ4 A;  3FYY A;  3NN6 X;  2YLR A;  1E1L A;  4REK A;  1MDR A;  3G5S A;  3QJ4 A;  1B37 A;  4IP5 A;  4DSG A;  3WE0 A;  3RRA A;  3L5O A;  2YQU A;  2V60 A;  2V5Z A;  4NEW A;  5J7X A;  4I59 A;  1GER A;  5IPY A;  3NGC X;  2BA9 A;  4U8J A;  2F5Z A;  4Y4N A;  4MMW A;  4NZH A;  4K2S A;  1YQZ A;  1R6W A;  3ITJ A;  1TYT A;  2ONE A;  4JNA A;  2GDQ A;  4TVY A;  4YKG A;  2GMJ A;  3SSZ A;  2WP6 A;  5DBJ A;  4IT1 A;  5U63 A;  2DW7 A;  2PTZ A;  3SFE A;  3NN0 X;  5FJP A;  3KUM A;  1LQU A;  5KVH A;  1PBB A;  3M0O A;  4MGG A;  4J56 A;  4DGK A;  3SN4 A;  3ZVH A;  3IHM A;  4EQR A;  3K1G A;  3KU9 A;  1ZOY A;  2BS3 A;  4HNC A;  1P48 A;  1SJC A;  1CJ3 A;  1Q1W A;  1PJ5 A;  1ZMC A;  3UJ2 A;  2B7S A;  3G5R A;  3MZN A;  1TDO A;  1NEL A;  4H83 A;  4EQX A;  3P4P A;  1DJN A;  3SZ0 A;  2BK3 A;  4XWR A;  1ZY8 A;  4KT2 A;  3NT6 A;  1IUX A;  3P4R A;  3UOX A;  4KEM A;  3LJP A;  4H4Q A;  3H7V A;  1E1K A;  5KNL A;  2YLX A;  3ABV A;  3H12 A;  1E9I A;  4HPN A;  2XH4 A;  1LV0 A;  1OJC A;  3QTP A;  3ZLG A;  4GAV A;  2C75 A;  3II4 A;  3I3L A;  4AOS A;  2C70 A;  3AM9 A;  3V3W A;  3AEE A;  4USQ A;  3GD4 A;  2VVM A;  4UP3 A;  3FCP A;  3B3R A;  3ATQ A;  2YAU A;  4ROP A;  2B9Y A;  3AD9 B;  4YSY A;  3QSS A;  3MUC A;  3ETR B;  3UCL A;  4GIS A;  2GSH A;  3GO2 A;  3UTF A;  4BK1 A;  4BJZ A;  4YSX A;  5JCM A;  3QVR A;  2QVH A;  2BAB A;  4X9N A;  1F9C A;  2WP5 A;  4G74 A;  2R46 A;  2WOW A;  1H86 A;  3NVY B;  2WU2 A;  2BRY A;  4YSH A;  3RGT A;  4BK3 A;  3LXD A;  3M12 A;  1NDA A;  3Q45 A;  2XLS A;  1NAA A;  4H2P A;  5J04 A;  2WU5 A;  5EU9 A;  1SJA A;  4JDR A;  1NEN A;  3UKA A;  3GC2 A;  1NHS A;  1IJH A;  2IVD A;  3UCC A;  1WYG A;  2WDR A;  3FJ4 A;  1FFV C;  2YLZ A;  4C5O A;  4CNJ A;  1GEU A;  1IUS A;  4TM0 A;  3CGB A;  3DER A;  3PWG A;  4K8G A;  3LAD A;  3OPS A;  4UDQ A;  4TLZ A;  1VQZ A;  2NPX A;  4NTE A;  1MDL A;  3JW7 A;  1KCZ A;  4G8T A;  3B6D A;  4IVO B;  1GRE A;  4ENL A;  5U1O A;  1E6E A;  2PP3 A;  1QLB A;  3AE4 A;  4J2W A;  5EOW A;  3R1Z A;  2BCG G;  4GIR A;  3GDN A;  1V97 A;  3VC5 A;  3SZF A;  5TR3 A;  3R11 A;  2GEW A;  4OPC A;  4GR1 A;  4TLX A;  3CT2 A;  1CL0 A;  2QJN A;  1CHU A;  3H70 A;  1P43 A;  3NH3 X;  5JCK A;  4APN A;  2OZ3 A;  1GPE A;  2XCG A;  1L0V A;  2HZG A;  2OLN A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  3QSM A;  3RCY A;  4M6U A;  1MO9 A;  5CQF A;  4G7F A;  3AXB A;  4M0X A;  4GCM A;  1QJD A;  1PJ6 A;  3G5Q A;  3DEQ A;  1YQ4 A;  1FO4 A;  3D8X A;  2XLU A;  4Z1Y A;  1FOH A;  3ADA B;  4GYP C;  3V3N A;  1KN0 A;  3AEG A;  3CGE A;  1H7X A;  1F8W A;  1GRH A;  2EQ8 A;  1CF3 A;  3UJF A;  1CJ4 A;  5M0Z A;  1DXL A;  3STP A;  1F8R A;  4A99 A;  4X4J A;  3EUB 3;  4IL2 A;  1K0I A;  2PTX A;  1DJQ A;  1EL9 A;  1EBH A;  4HB9 A;  2OX4 A;  4FK1 A;  3K30 A;  3DFY A;  1FHV A;  2PU0 A;  4OVI A;  1N4W A;  2PGE A;  1CJ2 A;  1PDZ A;  3A7R A;  3HZL A;  1FEA A;  4J34 A;  2PTY A;  4ECH A;  1DNC A;  1P2E A;  3CNP A;  1EL7 A;  4ZCD A;  1JNZ A;  1RVK A;  3T14 A;  2X3N A;  4Z26 A;  1IUV A;  3CNS A;  4PAA A;  1XPY A;  4YSZ A;  4TM4 A;  1JCT A;  4Z24 A;  3QPE A;  4GDP A;  2ZZC A;  3ZLF A;  2QGY A;  3ISH A;  3F8R A;  4K2X A;  2VRM A;  4D03 A;  2PCE A;  1GV4 A;  4IZG A;  4J1O A;  3HYV A;  2AL1 A;  2QDD A;  3IC9 A;  3EPT A;  2ZC8 A;  2EQ9 A;  1IUT A;  3DDM A;  3RED A;  3ZDN A;  4DSH A;  2GVC A;  4J33 A;  2GR3 A;  2OZ8 A;  1JRX A;  2CVJ A;  1GT8 A;  4H4W A;  2WDQ A;  3IF9 A;  5FJU A;  4JY2 A;  3AE8 A;  4AP1 A;  4YKF A;  4CNK A;  3HYW A;  2PA6 A;  4MJW A;  4RG3 A;  4Z2T A;  5KRQ A;  3RO6 A;  3NYF A;  1BZL A;  3NG7 X;  5KMR A;  3H8I A;  3CN8 A;  1TE6 A;  3CXO A;  4A79 A;  1S2Q A;  3GMB A;  1T3Q C;  1JPD X; 
#chains in the Genus database with same CATH homology
 3RNM A;  3L5O A;  3DH9 A;  1Q1R A;  1BWC A;  1YY5 A;  4J31 A;  2YQU A;  2V60 A;  2V5Z A;  4AP3 A;  3GRT A;  4NEW A;  1JNR A;  2YR6 A;  3AWI A;  4I59 A;  4RSL A;  5J7X A;  4B64 A;  1GER A;  2R0P A;  4EIP A;  5IPY A;  4H4Z A;  3NGC X;  2BA9 A;  4U8J A;  2YWL A;  2Z5X A;  2JAE A;  2BS4 A;  2F5Z A;  2GAH B;  2C66 A;  4P9S A;  4NZH A;  4TM1 A;  4Y4N A;  5EB5 A;  1LTX R;  1L9E A;  3UP5 A;  3DJG X;  1YQZ A;  4U2S A;  3ITJ A;  1TYT A;  3NTD A;  3AEC A;  3KPF A;  4JNA A;  5J60 A;  5FS7 A;  4H4Y A;  3LZX A;  4YKG A;  1ZP0 A;  1XHC A;  2ZZ0 A;  2BC1 A;  2GMJ A;  5LV9 A;  2WP6 A;  5DBJ A;  3RP6 A;  2UZZ A;  3DGH A;  4ADW A;  1E1N A;  5U63 A;  4A5L A;  3CPH G;  3NLC A;  4GDE A;  2BS2 A;  2CFY A;  3SFE A;  4FDC B;  4JQ9 A;  3NN0 X;  4Z25 A;  4H7U A;  4NWZ A;  1M64 A;  4U8P A;  5KWF A;  4C3Y A;  4OPG A;  1LQU A;  5KVH A;  1PBB A;  3M0O A;  3Q6J A;  3PO7 A;  1DOE A;  4J56 A;  4DGK A;  3IHM A;  4EQR A;  1IUU A;  4EMJ A;  4CCR A;  3GWF A;  1PXA A;  1ZOY A;  2BS3 A;  1F8S A;  3KU9 A;  4M52 A;  1W4X A;  5KVI A;  1CC2 A;  1CJ3 A;  1E1M A;  2AAQ A;  1Q1W A;  1ZMC A;  1PJ5 A;  1VG0 A;  1ZMD A;  2H88 A;  2I0Z A;  3O0H A;  1Y0P A;  2R4E A;  2XVE A;  3RP8 A;  2B7S A;  3G5R A;  1PS9 A;  4B65 A;  1TDO A;  2WEU A;  4EQX A;  3P4P A;  4LA1 A;  1GRT A;  1DJN A;  1DOB A;  2BK3 A;  3NHO X;  4XWR A;  3SZ0 A;  5BUL A;  3UKK A;  4OPL A;  4O5Q A;  1ZY8 A;  2YG4 A;  4CBQ A;  3D9X A;  2YLW A;  3CGD A;  3AD7 B;  4TM3 A;  1OJ9 A;  1GET A;  3NT6 A;  1IUX A;  4G73 A;  1CJC A;  3P4R A;  4H2R A;  3UOV A;  1GRF A;  3AB1 A;  4IA6 A;  3UOX A;  2YVJ A;  3LJP A;  2RGJ A;  1E39 A;  1RYI A;  3KA7 A;  2VRL A;  1JRY A;  4H4Q A;  2A8X A;  1XDI A;  4EMI A;  2WDV A;  1E1K A;  2YG7 A;  1N1P A;  4GF7 A;  1OJD A;  4EMW A;  5KNL A;  2YLX A;  1BKW A;  3ABV A;  3ALL A;  1LQT A;  4ZCC A;  1NHP A;  1LV0 A;  1B4V A;  1OJC A;  1FEB A;  1BF3 A;  4GAV A;  1PN0 A;  1JU2 A;  2C3C A;  3URH A;  2C75 A;  5HY5 A;  1F6M A;  3II4 A;  1Y56 B;  2E1M A;  3I3L A;  5IQ1 A;  4AOS A;  2C70 A;  3DME A;  3NTA A;  4II3 A;  3AE9 A;  3CND A;  3COX A;  2BAC A;  2CDU A;  2FJB A;  3AEE A;  1GXF A;  2YLT A;  4IA5 A;  2GQW A;  4USQ A;  2FJD A;  2C67 A;  2R4J A;  4OPI A;  2QCU A;  2GRT A;  3SGL A;  3GD4 A;  3KLJ A;  2VVM A;  4UP3 A;  3UTG A;  4Z43 A;  3AYI A;  2RAB A;  3BI2 A;  3B3R A;  3ATQ A;  2DKI A;  3CIR A;  2WOV A;  1IUW A;  2TMD A;  4B63 A;  4J36 A;  2YAU A;  2B9Y A;  3AD9 B;  3AEA A;  4U2T A;  4Y4L A;  1KSU A;  3NYC A;  4YSY A;  4FK1 C;  3QSS A;  5EB4 A;  2Y6R A;  3Q9T A;  2XLR A;  3UCL A;  3BHF A;  3ALJ A;  3NKS A;  2C4C A;  1LPF A;  5GRT A;  1ZDL A;  4X9M A;  3UP4 A;  3NK0 X;  1ONF A;  4PAB A;  3AE5 A;  3UTF A;  4BK1 A;  3L8K A;  1ZKQ A;  3GYJ A;  1VRQ B;  1EL8 A;  4BJZ A;  1GSN A;  2VQ7 A;  4YSX A;  2ZBW A;  3VRA A;  5JCM A;  3QFA A;  1AOG A;  1XAN A;  3QVR A;  4H2Q A;  3UKP A;  3SZW A;  1LJ1 A;  2BXR A;  2DKH A;  4YWO A;  3NYE A;  3NK1 X;  4JNQ A;  3RP7 A;  2OAM A;  3KD9 A;  2BAB A;  3IWA A;  4X9N A;  5BVA A;  3KPK A;  2YG5 A;  2WP5 A;  1PBE A;  4G74 A;  1NEK A;  2R46 A;  3DK9 A;  2WOW A;  1H86 A;  1H83 A;  3BNM A;  2X8C A;  4CY6 A;  4EQW A;  2WU2 A;  4U8O A;  2WS3 A;  1X31 B;  2BRY A;  3PVC A;  1O5W A;  3SM8 A;  3VQR A;  2AQJ A;  4YSH A;  1FL2 A;  3ATR A;  3VRB A;  4BK3 A;  3LXD A;  1JOA A;  3AE3 A;  2X8H A;  3M12 A;  1D5T A;  1NDA A;  2Z5Y A;  2XYO A;  3EF6 A;  3QFB A;  3CPI G;  3K7Q X;  3ZYX A;  3T2Y A;  2XLS A;  1NAA A;  3EAN A;  2GF3 A;  3AD8 B;  3AED A;  3AYL A;  4H2P A;  3UOZ A;  3H4K A;  2XFU A;  1PBC A;  2WU5 A;  4B1B A;  4JDR A;  4CY8 A;  1NEN A;  2WHD A;  2BK5 A;  3UKA A;  4OPD A;  2C73 A;  3UOY A;  2APG A;  4U2L A;  2OLO A;  1NHS A;  1KDG A;  1IJH A;  5FS6 A;  4EM4 A;  3AE6 A;  1TDE A;  2YR5 A;  2IVD A;  4JN9 A;  1K4Q A;  2WP9 A;  4U8M A;  3PS9 A;  5KXJ A;  2JB2 A;  3FIM B;  3BI5 A;  2WDR A;  1N4V A;  1PBD A;  3K7T A;  4K5R A;  1GAL A;  3T2Z A;  3VR9 A;  4C77 A;  2GR0 A;  3LB8 A;  2XVF A;  1B5Q A;  4Z2R A;  1GRA A;  1VG9 A;  2YLZ A;  2QA2 A;  4ICY A;  4C5O A;  3AYJ A;  3GYX A;  1OJA A;  3AE7 A;  3M13 A;  1GEU A;  1IUS A;  1ZOV A;  4TM0 A;  4DNA A;  4J57 A;  1PDH A;  1NG4 A;  2WES A;  3QSE A;  3S61 A;  3DJJ A;  1YQ3 A;  5M10 A;  3EAO A;  2OAL A;  2EQ7 A;  3CGB A;  5BRT A;  4K7Z A;  4Z44 A;  1KNP A;  2XVJ A;  3LAD A;  2RGH A;  3DK4 A;  4UDQ A;  1HYU A;  2PYX A;  3BI4 A;  4TLZ A;  2X8G A;  5HYM A;  2NPX A;  1UKV G;  1N4U A;  2VZ2 A;  5C3J A;  2PHH A;  2Q7V A;  4NTE A;  4Z2U A;  1GOS A;  2XFO A;  3UKL A;  4LII A;  3B6D A;  4IVO B;  4WX1 A;  2YR4 A;  4XWZ A;  3VR8 A;  1GRE A;  1NHR A;  1S2Y A;  4AT2 A;  5U1O A;  2Q0K A;  2XFQ A;  4B66 A;  5BUK A;  3PG6 A;  1FCD A;  2C3D A;  2BYB A;  3NK2 X;  1BGN A;  1F3P A;  1E6E A;  1K0J A;  4H50 A;  2XVH A;  1QLB A;  4U8I A;  3AE4 A;  1Z6L A;  1ZK7 A;  2GMH A;  4J2W A;  4UDR A;  2V3A A;  5EOW A;  2BCG G;  3F8P A;  3GDN A;  4D04 A;  3OZ2 A;  1DOC A;  5GSN A;  1PBF A;  2ZZB A;  3CPJ G;  1VQW A;  3L1R A;  4AT0 A;  3SZF A;  2XDO A;  1BGJ A;  4N9X A;  5TR3 A;  1RP0 A;  2R9Z A;  5L46 A;  3NNE A;  3UKQ A;  2JB1 A;  5U25 A;  3P9U A;  3HYX A;  4AOX A;  4IVM B;  2GEW A;  5JCL A;  4KPR A;  2H89 A;  2VOU A;  3NIX A;  2R45 A;  4GR1 A;  3AE1 A;  4OPC A;  1V59 A;  4EQS A;  4IV9 A;  4TLX A;  4A9W A;  1KF6 A;  1H7W A;  2GB0 A;  2A89 A;  1CL0 A;  1JRZ A;  1CHU A;  1KNR A;  3NRN A;  2V6O A;  2JBV A;  4II2 A;  3ICS A;  4B67 A;  4H4X A;  2WET A;  2Y6Q A;  4BUR A;  4I58 A;  4GRT A;  3NH3 X;  4ZN0 A;  4H4P A;  5JCK A;  4APN A;  2C7G A;  1Y56 A;  4CCQ A;  3CGC A;  2C76 A;  1GPE A;  4O5U A;  1RSG A;  1CC4 A;  5JCI A;  1E7P A;  2R0C A;  2XCG A;  2VQB A;  3BNU A;  3C4A A;  2OLN A;  4U8L A;  1L0V A;  3P1W A;  3SFD A;  2YVF A;  4BK2 A;  3UKH A;  1K0L A;  4H4T A;  2GV8 A;  2FBW A;  2GR2 A;  1GRG A;  2CUL A;  5KMS A;  3C4N A;  3QSM A;  3FBS A;  1TDK A;  4NTC A;  2XLT A;  3RHA A;  4H2N A;  3GWD A;  2BC0 A;  4RG4 A;  3V76 A;  4OPU A;  4YXD A;  1MO9 A;  3T31 A;  1TDF A;  5KMQ A;  1H6V A;  4H4S A;  3F8D A;  5CQF A;  1O94 A;  3AEB A;  4EM3 A;  4B69 A;  3AXB A;  2A87 A;  1PJ7 A;  3AEF A;  4GCM A;  3SX6 A;  1NG3 A;  1LVL A;  3CNT A;  1QJD A;  3DGZ A;  1PJ6 A;  3G5Q A;  1YQ4 A;  1B8S A;  1S3E A;  1EBD A;  5FMH A;  2Q0L A;  3C96 A;  3CMM A;  2YVG A;  5EBK A;  1NHQ A;  2WOI A;  3D8X A;  2XLU A;  4OPT A;  4YTN A;  2QAE A;  4NEV A;  2FJA A;  1FOH A;  1GTH A;  3ADA B;  1MOK A;  1GTE A;  2NVK X;  3CNJ A;  4FX9 A;  2E5V A;  2XFN A;  1L9D A;  3V3N A;  2BXS A;  2E4G A;  1KN0 A;  1SEZ A;  1ELI A;  3AEG A;  3GYI A;  2FJE A;  3CGE A;  4K8D A;  2RGO A;  1H7X A;  3SYI A;  4A65 A;  5KOX A;  3OC4 A;  1F8W A;  1GRH A;  1KSS A;  2EQ8 A;  1CF3 A;  1PHH A;  4XXG A;  3ICR A;  3IHG A;  3P4Q A;  3AE2 A;  3JSK A;  1COY A;  1H81 A;  1CJ4 A;  5M0Z A;  1DXL A;  2C72 A;  3SZC A;  4C74 A;  2JKC A;  1ZX9 A;  1F8R A;  3GMC A;  4KX6 A;  4YT0 A;  4A99 A;  4X4J A;  4NNJ A;  2Q6U A;  4BV6 A;  1K0I A;  4G6H A;  4GAP A;  1D4C A;  1QO8 A;  3SQP A;  1DJQ A;  1EL9 A;  3DA1 A;  3GDP A;  1GES A;  4HB9 A;  4K22 A;  2BK4 A;  4OCG A;  1EL5 A;  3V3O A;  4FK1 A;  3K30 A;  3T2K A;  1TYP A;  1H84 A;  1REO A;  3KVE A;  3SY4 A;  4OVI A;  4E0V A;  1Q9I A;  4U8K A;  1N4W A;  2BCP A;  5C2T A;  1CJ2 A;  3HZL A;  2B76 A;  3ICT A;  1FEA A;  4J34 A;  3CTY A;  1CBO A;  4ECH A;  2IID A;  1DNC A;  1P2E A;  2GR1 A;  2XFP A;  3CNP A;  3LZW A;  4GUV A;  1EL7 A;  3DJD A;  2EQ6 A;  4UDP A;  4ZCD A;  1JNZ A;  3E1T A;  5HHF A;  3VRD B;  1FEC A;  1GRB A;  1D4D A;  1KFY A;  2YM2 A;  4B68 A;  5KOW A;  3T14 A;  2JB3 A;  2X3N A;  5FS9 A;  2IVE A;  4Z26 A;  1IUV A;  2YM1 A;  4K5S A;  3T0K A;  3CNS A;  4PAA A;  3GD3 A;  3DJE A;  3FMW A;  2XLP A;  4YTM A;  3I6D A;  4YSZ A;  4NTD A;  1S3B A;  4TM4 A;  2VVL G;  1H2I A;  1VDC A;  4Z24 A;  3P4S A;  4H4V A;  2JK6 A;  2YLS A;  2C64 A;  1D7L A;  4GDP A;  1D7Y A;  2ZZC A;  3K7M X;  3UKF A;  1TRB A;  3GRS A;  4A6N B;  3GSI A;  1NPX A;  3ISH A;  3F8R A;  2WPE A;  4K2X A;  4CNJ A;  5HXI A;  3FG2 P;  2V61 A;  2VRM A;  2YG6 A;  4CRT A;  1JEH A;  4D03 A;  3S5W A;  1GV4 A;  1M6I A;  2WBA A;  2WPC A;  2J3N A;  3UTE A;  3R9U A;  2B9W A;  1O95 A;  3HYV A;  1D4E A;  2C65 A;  3BHK A;  4H4R A;  2GAG B;  2VVL A;  2QA1 A;  3IC9 A;  3EPT A;  1P2H A;  5KMP A;  2EQ9 A;  3KKJ A;  4HA6 A;  1OJT A;  1S7M A;  1CC6 A;  2X99 A;  1IUT A;  5CKU A;  2W0H A;  4A6N A;  4YTP A;  3T37 A;  1TDN A;  4EIQ A;  3RED A;  3ZDN A;  2R0G A;  2BRA A;  4LU6 A;  5FS8 A;  5JCN A;  3ALM A;  3SXI A;  3LOV A;  4DSH A;  4U8N A;  2O9Z A;  3H8L A;  2GVC A;  2V3B A;  5ER0 A;  4J33 A;  2GR3 A;  2TPR A;  4USR A;  1JRX A;  2CVJ A;  2WPF A;  1H82 A;  4WCT A;  1GT8 A;  4H4W A;  1MXT A;  2HQM A;  4G9K A;  2WDQ A;  1DOD A;  1XPQ A;  4C3X A;  2WQY A;  2B7R A;  3D1C A;  3IF9 A;  4JY2 A;  3AE8 A;  4AP1 A;  2OA1 A;  4YKF A;  4CNK A;  2GH5 A;  1PXC A;  3HYW A;  4H4U A;  4MJW A;  2X50 A;  2ARD A;  1GND A;  4RG3 A;  4Y4M A;  3DK8 A;  2XVI A;  2GQF A;  3UTH A;  4A7A A;  4Z2T A;  5KRQ A;  1PXB A;  1BZL A;  3NG7 X;  3NYF A;  5IQ4 A;  5KMR A;  3H8I A;  3QVP A;  3FPZ A;  3CN8 A;  4G6G A;  4BJY A;  1L9C A;  3NN6 X;  1YKJ A;  2YG3 A;  2B9X A;  4A79 A;  2YLR A;  1S2Q A;  1E1L A;  4REK A;  3G5S A;  2ACZ A;  4JY3 A;  3QJ4 A;  3GMB A;  1B37 A;  4DSG A;  2AR8 A;  5JRB A;  3WE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...