1NHRA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
447
structure length
447
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 141
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA02
4K8DA 3NTAA 4Z43A 3FG2P 2WP5A 2BXSA 2Q6UA 4UDQA 3UOVA 4KPRA 2TMDA 3NK1X 3RHAA 4Z2UA 3LXDA 3LZWA 3L8KA 1GALA 1OJAA 2BK3A 4CY6A 1PJ6A 1DJNA 5U1OA 1JRXA 5L46A 1E6EA 1ZK7A 2XFOA 4K2XA 3NH3X 3ISHA 5JCIA 3AE7A 1YQ4A 4A7AA 2WU5A 2X50A 4EM4A 2Z5XA 1KF6A 3ZYXA 1M64A 2WOWA 2VZ2A 4OPTA 3KU9A 3KVEA 3EAOA 4K22A 4YXDA 3II4A 1LTXR 1Q1RA 3GD3A 1GRBA 1NHRA 1SEZA 3AB1A 4J57A 1AOGA 4H4TA 1NG4A 3AEAA 2BS3A 1FEAA 3AYLA 4OPDA 2XYOA 1CJ4A 4B69A 3AEGA 3CPIG 1HYUA 1E7PA 2ZZ0A 2CFYA 1IUSA 4B67A 1H7XA 3DJDA 3JSKA 1H6VA 3UKAA 1ZDLA 4Z44A 4OPLA 2WEUA 1L9CA 2IVDA 3URHA 2E4GA 2WP6A 2BCPA 4Z2RA 3VQRA 3C4AA 2XLTA 1ZKQA 3AYIA 3FPZA 2FJBA 2QA2A 2GB0A 3AE5A 3QSSA 2WDQA 5BULA 4JY2A 2CVJA 2JB3A 1CBOA 3K7TA 2YG3A 4EQSA 3KKJA 1ELIA 4DSGA 4GF7A 4ZCCA 2XFPA 3IWAA 3H8LA 2EQ7A 5JCLA 5U63A 4YWOA 3CNTA 5DBJA 1JNZA 4BK2A 4U8MA 1TDKA 2C70A 2YG5A 5EB4A 5GSNA 3QFAA 1F8SA 5BUKA 5KWFA 2BCGG 1FEBA 3NT6A 4H7UA 3BI5A 1IUWA 1O94A 1PBCA 1BZLA 1GRHA 4YTMA 3AYJA 3NTDA 1N1PA 5J60A 4RG3A 1UKVG 3AE2A 4EQXA 1F6MA 2R0PA 2JBVA 4TM0A 3F8DA 3PS9A 2CDUA 1PS9A 3V76A 2W0HA 1EBDA 4CCQA 4LU6A 4TM4A 5FMHA 3OC4A 3CGEA 1EL7A 2GF3A 1Q1WA 4GDPA 1ZMDA 4H50A 4J31A 4U8PA 4WX1A 5M0ZA 2YLXA 4C5OA 3FBSA 1D7YA 2OLNA 4FK1A 4J36A 4EMJA 1IJHA 3NHOX 2R9ZA 3P9UA 4BV6A 4U8NA 3SGLA 1S3EA 4MJWA 3F8RA 1COYA 3M12A 1W4XA 4M52A 1Z6LA 3SQPA 1CJ3A 2YG7A 2FJDA 3AXBA 1GETA 1NEKA 2V3BA 3P4SA 2R46A 3G5SA 4IVMB 1L0VA 2YAUA 2IIDA 5HHFA 4Z26A 4OPUA 1FCDA 1RYIA 3GRSA 4H2NA 3LB8A 2OAMA 1GRTA 2X3NA 3H4KA 2YR6A 5C2TA 2VRMA 3CNSA 3B3RA 1S3BA 3DMEA 1E1LA 1PDHA 1VRQB 2BYBA 4NEWA 2XLPA 4A79A 1EL9A 5KRQA 3AD7B 4NTCA 4D04A 1CF3A 2B7SA 3VRBA 3ICSA 3VR8A 1ZX9A 1GTEA 1GPEA 5IQ4A 3VRAA 1TDNA 2C7GA 2WDVA 2RABA 2ARDA 3AE8A 3AD8B 3ABVA 1N4WA 3BHKA 4H2PA 4JN9A 4AOSA 1PN0A 4ICYA 1TDEA 1N4VA 2BK5A 4A99A 1LQUA 3NLCA 1XANA 1B5QA 1JU2A 2WS3A 1BGJA 4O5UA 5C3JA 2QAEA 2JKCA 3RNMA 3CGDA 3GWFA 4HB9A 2JK6A 1KNRA 3L1RA 4C3XA 3B6DA 3ATRA 1PHHA 3DK4A 4FDCB 3LOVA 1D5TA 1CJCA 1K0JA 2FJAA 2YVJA 3NYEA 4Y4NA 4YSZA 1KNPA 3KA7A 3QJ4A 4GDEA 1PBBA 2RGOA 1FECA 2WETA 4J33A 4Z25A 2B9XA 3C4NA 4H4QA 5IQ1A 2YVFA 2GV8A 4I58A 4D03A 2WDRA 4ADWA 1D4DA 1NENA 1FOHA 2IVEA 2XDOA 3ALJA 3GYJA 3M0OA 4OVIA 4C77A 4EMIA 5JCNA 5EOWA 2C76A 5GRTA 3LADA 1TDFA 1GSNA 2E1MA 3K30A 4EIPA 2XCGA 1CJ2A 2XFNA 2R0CA 2VOUA 1LJ1A 4BK3A 4DNAA 3M13A 2V3AA 2ZBWA 4GR1A 2B9WA 3O0HA 1L9EA 3QSMA 2EQ6A 1BKWA 3EANA 4TM1A 1H81A 1PXAA 3G5RA 3WE0A 2V6OA 3UP4A 2C72A 1E1MA 4ZCDA 2GR0A 4YT0A 4CY8A 5CQFA 2YR4A 3K7MX 2XVHA 2GEWA 3NG7X 3DJJA 2BK4A 4U8LA 1IUVA 3R9UA 4AOXA 4B64A 3UKPA 2J3NA 3D1CA 1CC4A 5BVAA 2YG4A 2YR5A 4GRTA 2GR3A 1PJ5A 1O95A 1K0LA 3G5QA 3GDNA 3NGCX 3RP6A 4O5QA 4P9SA 2Q7VA 3P4QA 1B37A 5KOXA 1D4EA 5CKUA 1NG3A 1REOA 1VDCA 5LV9A 2UZZA 2GMHA 2YLSA 2C73A 4TLZA 3AE6A 5KXJA 4USQA 2AAQA 2GAHB 3SM8A 4B65A 2BS2A 2Q0KA 3ITJA 3P4RA 2ZZCA 2JB1A 3UKFA 3QVRA 2I0ZA 1OJ9A 3DGHA 5EB5A 4LIIA 3ADAB 3HZLA 1OJDA 4DSHA 3KLJA 2H89A 2OA1A 3NRNA 4HA6A 3CNDA 1ZMCA 4CNKA 1CC2A 2WPCA 4JDRA 3BI2A 2DKHA 1GREA 4OPIA 2EQ9A 1H86A 4H4SA 2YG6A 2YLRA 3P1WA 3CIRA 3PVCA 2OALA 3CPJG 4REKA 2WPFA 3REDA 1NHPA 3QVPA 3QSEA 3COXA 1NAAA 4TLXA 4AP3A 4YKGA 3CGCA 1DXLA 1MO9A 1EL5A 1GTHA 2A87A 2VQ7A 3IHGA 2YLTA 3S5WA 1GEUA 2XLSA 1GXFA 2F5ZA 2R4EA 2GMJA 1TYPA 1JOAA 4J56A 2A8XA 2TPRA 2QA1A 2RGJA 5KVIA 4Y4LA 3VR9A 5FS7A 4Z24A 5FS8A 3AEDA 4BK1A 3Q9TA 3T37A 1GRGA 1GESA 3EF6A 2OLOA 3UKQA 4H4WA 3CPHG 2YM2A 5FS6A 4YSXA 4UDRA 2XFUA 4U8JA 4U2SA 2C3DA 3NK2X 4TM3A 4UP3A 4CNJA 1QO8A 3AEEA 2WQYA 2X8HA 2XFQA 3H8IA 4EM3A 4X4JA 4XXGA 4C3YA 4JNAA 3UOZA 2GRTA 2XVFA 4PAAA 2GVCA 2GH5A 3CN8A 4BJZA 3NIXA 1F8WA 2HQMA 4LA1A 4YSHA 5JCMA 1GRFA 4NEVA 1GV4A 2WOVA 3IC9A 1P2EA 3AEBA 1IUUA 1S2QA 2YWLA 2BA9A 3UKKA 3UOYA 2BC0A 2C64A 4UDPA 4U2TA 3DK9A 2FJEA 1DJQA 5TR3A 2WHDA 3FMWA 2AQJA 3AECA 2B76A 1YQZA 1RP0A 3UTHA 2RGHA 2V61A 2VVLA 3KPFA 2R0GA 4H4YA 5HY5A 4NTDA 3NN6X 4I59A 4C74A 1IUXA 4XWZA 2BC1A 1CL0A 1PBFA 3K7QX 2XVIA 3ATQA 2ACZA 4J34A 1D7LA 2C65A 3NYFA 2YM1A 2X99A 3AE1A 2JB2A 2XVJA 1NPXA 1JRZA 1Y0PA 1CC6A 1BF3A 4USRA 4AT0A 1DOBA 1NHQA 2ZZBA 4U8OA 4A5LA 4E0VA 5M10A 1PJ7A 3GD4A 1NHSA 1H83A 2DKIA 3I3LA 2V60A 4H2RA 5HYMA 3V3NA 1F8RA 4IA5A 4A9WA 1E1NA 3ICTA 1ZP0A 4GUVA 1LQTA 3GMCA 3UTGA 1MXTA 2PHHA 5ER0A 2H88A 3CTYA 2R45A 4FK1C 4B63A 1XPQA 2WP9A 4NZHA 4OCGA 4AT2A 3E1TA 2XVEA 3OZ2A 3V3OA 2PYXA 1H82A 5KVHA 5JCKA 1CHUA 2WPEA 3UOXA 2JAEA 1GT8A 4K5RA 2YQUA 1GNDA 1DODA 3IF9A 4NTEA 2WBAA 3NKSA 1KSUA 3LZXA 4B68A 1V59A 3VRDB 3NNEA 1XHCA 2GR1A 4OPCA 3ALLA 1GERA 4H4RA 4N9XA 4U2LA 1MOKA 3DK8A 1YKJA 3GMBA 5FS9A 2C3CA 2C75A 2BXRA 2Y6RA 3ZDNA 1LVLA 2NVKX 2NPXA 3DH9A 3NK0X 3LJPA 3AE9A 4Y4MA 2B9YA 4IV9A 1NDAA 1QJDA 2Q0LA 1Y56B 3CNJA 4ZN0A 1H84A 4YSYA 4XWRA 2APGA 3BNMA 3AE3A 3DA1A 4CBQA 4GCMA 2VRLA 3UTEA 2WESA 2CULA 3P4PA 3UCLA 3GWDA 2XLRA 1P2HA 1ZOYA 4EMWA 2GR2A 4BJYA 3PO7A 4H4ZA 1LV0A 3NN0X 3GRTA 1VQWA 1H7WA 4A65A 4JQ9A 1ZOVA 1ONFA 3DJGX 3RP8A 3BI4A 4J2WA 1DOCA 3SFDA 1ZY8A 1QLBA 3QFBA 1Y56A 4IA6A 4JY3A 1F3PA 2VVLG 4ECHA 1B8SA 4EQRA 3UKHA 1EL8A 1DOEA 1XDIA 3FIMB 4AP1A 1O5WA 1VG9A 4DGKA 1JNRA 1GRAA 2X8GA 2Y6QA 3KD9A 2O9ZA 3CGBA 2B7RA 1JEHA 3BHFA 2A89A 3GSIA 4A6NB 3ICRA 3BNUA 1S2YA 4K5SA 4RSLA 1YQ3A 1OJCA 3SFEA 2AR8A 1K4QA 2C66A 4YTPA 1E1KA 1LPFA 3AD9B 1VG0A 2XLUA 4YKFA 3DJEA 1TDOA 3AWIA 1DNCA 4WCTA 4EQWA 1GOSA 2R4JA 2YLWA 2GAGB 1IUTA 1KFYA 3ALMA 4U8KA 4IVOB 4PABA 3UKLA 2BABA 5IPYA 3GYIA 1KSSA 1M6IA 2BS4A 4U8IA 3AEFA 4A6NA 1L9DA 2GQWA 4KX6A 3AE4A 2WU2A 2QCUA 2WOIA 5BRTA 2E5VA 4H4PA 3C96A 4JNQA 1B4VA 1TRBA 1N4UA 4APNA 3NYCA 3GDPA 1OJTA 3UTFA 1PXCA 3EPTA 2FBWA 5HXIA 3I6DA 1Q9IA 4H2QA 3DGZA 4FX9A 4RG4A 4X9NA 5KOWA 1BGNA 4Z2TA 2EQ8A 2YVGA 4H4VA 1D4CA 2VQBA 1YY5A 2BACA 2VVMA 3UP5A 4H4UA 4CRTA 3IHMA 5EBKA 4X9MA 2Z5YA 5U25A 4B66A 1RSGA 2GQFA 2V5ZA 4YTNA 1K0IA 1E39A 4CCRA 1FL2A 2C67A 1BWCA 3Q6JA 3CNPA 2YLZA 3RP7A 3F8PA 4B1BA 1X31B 4BURA 1TYTA 1KDGA 2X8CA 4K7ZA 5J7XA 3D8XA 1PBEA 1PXBA 4H4XA 3S61A 1JRYA 4OPGA 4EIQA 1PBDA
chains in the Genus database with same CATH superfamily
4K8DA 3NTAA 3FG2P 3AN1A 2Q6UA 2BXSA 3RHAA 3L5OA 3ZVHB 2POZA 1E6EA 1ZK7A 2XFOA 3NH3X 1YQ4A 1TZZA 4EM4A 2WOWA 3OPSA 2VZ2A 3T2ZA 3KVEA 4YXDA 3GD3A 1SEZA 2BS3A 2XH2A 1FEAA 4OPDA 1HYUA 1E7PA 2CFYA 2P0IA 1H7XA 4IL0A 4Z1YA 3QLDA 2WEUA 3A7AA 1JCTA 2IVDA 3URHA 3C4AA 2XLTA 1ZXIC 3QKEA 3AYIA 2FJBA 3AE5A 2WDQA 2CVJA 2YG3A 3H8LA 3D47A 4BK2A 1TDKA 5GSNA 2YG5A 3UCDA 1SJCA 1N1PA 3AE2A 2I5QA 4EQXA 1F6MA 2OFJA 3PS9A 1PS9A 3V76A 3T14A 1EBDA 1EBGA 4LU6A 5FMHA 2GF3A 1Q1WA 4E4UA 1ZMDA 4H50A 4WX1A 1D7YA 3P9UA 4NWZA 3M12A 1Z6LA 3EKGA 3SQPA 1CJ3A 1GETA 1SJBA 2R46A 4H19A 2YAUA 4Z26A 3GRSA 4H2NA 3LB8A 3CK5A 2X3NA 3H4KA 2VRMA 3DESA 1S3BA 2PTZA 2XLPA 4NEWA 4TVYA 4A79A 3AD7B 1CF3A 1PDYA 3VRBA 5J04A 1GPEA 3VRAA 2QJJA 1TDNA 2RABA 3NLCA 4O5UA 3MY9A 3CGDA 3GWFA 5JRBA 1KNRA 3ATRA 3LOVA 1D5TA 1CJCA 2E3TA 3NYEA 4Y4NA 3THUA 3C4NA 4JHMA 4I58A 3M0OA 3GYJA 2PPGA 1FOHA 3ALJA 3T2YA 5GRTA 3P3BA 1TDFA 3SX6A 2R0CA 4BK3A 2PU0A 2ZBWA 3HW2A 4GR1A 2B9WA 1VDVA 3QSMA 1N5XA 4A35A 2HXTA 4YT0A 5CQFA 2YR4A 1IUVA 4H1ZA 3D1CA 2PSNA 5BVAA 2YR5A 1H2IA 3CMMA 3G5QA 4P9SA 5KOXA 5CKUA 4IP5A 4G7FA 3T31A 2PP1A 4USQA 4ROPA 2ZZCA 3QVRA 1OJ9A 3DGHA 4LIIA 3HZLA 3FYYA 3A7RA 3NRNA 3CNDA 2OO6A 3BI2A 3ES7A 3T4WA 1NU5A 1H86A 4H4SA 2YG6A 2W54A 1X2GA 4AP3A 1EL5A 3S5WA 2YLTA 5KNLA 1GXFA 2OX4A 1WUFA 4Y4LA 3U9IA 5FS7A 3AEDA 3Q9TA 3EUB3 2OLOA 2YM2A 5KMSA 4UP3A 3AEEA 1RM6B 2X8HA 4BJZA 1F8WA 2HQMA 5JCMA 3A7UA 1S2QA 2YWLA 2PGWA 3RCYA 3UOYA 2BC0A 1DJQA 3N4FA 1XS2A 1YQZA 1RP0A 2R0GA 4I59A 3RR1A 1IUXA 3V5CA 1PBFA 3ATQA 3RGTA 2C65A 2X99A 1JRZA 3I6TA 2ZZBA 4GAPA 3TCSA 4U8OA 3MUCA 4GIRA 4GAVA 2XH7A 3ICTA 1ZP0A 4IHCA 1LQTA 3CTYA 4G74A 4OCGA 2CHRA 3V3OA 1N63C 5KVHA 5JCKA 3UOXA 3SZWA 1GT8A 1DODA 2WBAA 1E9IA 4K1WA 3LZXA 2NQLA 3MSYA 3DG6A 3DK8A 2C75A 2Y6RA 3ZDNA 3LJPA 3CNJA 3H70A 3N4EA 4YSYA 2OZ8A 2QJMA 2DW6A 1ZOYA 4EMWA 3D46A 1JROA 3R25A 2PODA 3DJGX 2OG9A 1F3PA 3ENLA 4AP1A 1SJAA 1S2YA 4K5SA 1YQ3A 3SFEA 1K4QA 2C66A 3AD9B 2XLUA 4IZGA 1DNCA 1GOSA 2YLWA 1TKKA 2BABA 5IPYA 4MKSA 1M6IA 4U8IA 2QCUA 2WOIA 2E5VA 4H4PA 3C96A 3SZCA 3UTFA 3DGZA 4F4RA 4X9NA 4Z2TA 2EQ8A 4H4VA 3KUMA 2BACA 3UP5A 4X9MA 4YTNA 1K0IA 3CNPA 2YLZA 4K7ZA 3GYXA 4IT1A 1PBDA 4Z43A 2MUCA 3GD6A 4KPRA 3SR6B 3NK1X 3LXDA 1OJAA 2PP3A 1PJ6A 5U1OA 4G6GA 4K2XA 3AE7A 2X50A 3ZYXA 3KU9A 3II4A 1GRBA 3AB1A 1IYXA 3R07C 1CJ4A 2AL1A 3SQSA 2ZZ0A 1SB3B 2BCPA 3VQRA 3FPZA 1X2HA 3DG3A 5BULA 4JY2A 4DSGA 3K7TA 4EQSA 4ZCCA 5JCLA 2OPJA 3CNTA 1JNZA 4U8MA 2C70A 5EB4A 1F8SA 5BUKA 1FHVA 3NT6A 3BI5A 1IUWA 1PBCA 1BZLA 3AYJA 1UKVG 4TM0A 2CDUA 3IJQA 4U8PA 1FIQB 1V97A 4J1OA 3OZYA 4EMJA 1IJHA 4U8NA 3SGLA 1W4XA 4M52A 5G5GB 2YG7A 3AXBA 1NEKA 3DIPA 3R11A 1RYIA 3JVAA 3DMEA 1E1LA 2BYBA 4NTCA 4D04A 4GYPA 3UGVA 5IQ4A 2W55A 2GGHA 3ABVA 3BHKA 3SXIA 1N4VA 1N5WC 1JU2A 2WS3A 2PS2A 4IP4A 4HB9A 2JK6A 3L1RA 3TJIA 1PHHA 3DK4A 3DDMA 3IJLA 3NVVB 2FJAA 1K0JA 2YVJA 4YSZA 4NNJA 3KA7A 2ZC8A 1FECA 4Z25A 4H4QA 2YVFA 3DFHA 2IVEA 5JCNA 4G9KA 2C76A 2E1MA 4JN8A 2XFNA 2VOUA 1LJ1A 2EQ6A 3UJEA 1PXAA 3G5RA 2V6OA 4J3ZA 4ZCDA 2GR0A 3CB3A 3K7MX 4HNLA 4G6HA 4AOXA 3MQTA 4B64A 2YG4A 3S47A 1O95A 3GDNA 2Q7VA 1B37A 3IJIA 1NG3A 1REOA 1KKOA 2YLSA 2C73A 2ZADA 4TLZA 3AE6A 5KXJA 3D9XA 3SM8A 3P4RA 3ITJA 3ADAB 4DSHA 3Q4DA 3KLJA 2H89A 2FKPA 3NRZB 2EQ9A 5FJPA 2ONEA 2OALA 3CPJG 3QVPA 5FJOA 3COXA 3TWAA 1ONEA 3TW9A 1DXLA 3IHGA 2A87A 2VQ7A 3JW7A 2R4EA 1TYPA 1JOAA 2QA1A 4Z24A 3CXOA 3T37A 3AMZA 3UJ2A 3EF6A 3NO1A 4YSXA 4U8JA 3T9PA 3NK2X 4ZOHB 1QO8A 2XFQA 4EM3A 4Z17A 2GRTA 3SJNA 1R6WA 3CN8A 4LA1A 1GV4A 3DK9A 3KPKA 5TR3A 3FMWA 3AECA 3T2KA 2V61A 4NTDA 4C74A 2MNRA 4XWZA 5KMQA 2XH0A 1D7LA 3NVWB 1XPYA 1NPXA 4AT0A 1DTNA 4A5LA 5M10A 1H83A 3PG6A 1STZA 1MDRA 3V3NA 1F8RA 1VQZA 1E1NA 3GMCA 2H88A 4FK1C 4B63A 5KMRA 4KT2A 2PYXA 2JAEA 2W3SA 2YQUA 4K5RA 3IF9A 4NTEA 3CYJA 1KD0A 3NKSA 2GGJA 2GGIA 4B68A 3ZLGA 3NNEA 1GERA 1MDLA 3ZLHA 3OTRA 1YKJA 2BXRA 2NVKX 2NPXA 3NK0X 3AE9A 4Y4MA 1H84A 4XWRA 2APGA 3DA1A 1WUEA 1P2HA 4BJYA 2GR2A 3PO7A 4M0XA 3NN0X 3GY1A 1H7WA 4JQ9A 1ZOVA 3N6HA 1DOCA 1Y56A 2VVLG 4ECHA 2PA6A 1B8SA 1EL8A 1DOEA 1XDIA 2PTYA 1GRAA 3KD9A 3CGBA 3VFCA 1JEHA 3UJFA 3ICRA 4RSLA 4YTPA 1VG0A 3RRAA 1TDOA 3AWIA 4WCTA 2R4JA 4E5TA 4IL2A 1KFYA 4U8KA 1T3QC 4PABA 2BS4A 4A6NA 3UJSA 3I6EA 1N4UA 1OJTA 5HXIA 3I6DA 4FX9A 4RG4A 5KOWA 1BGNA 1KKRA 3MKCA 4H4UA 5EBKA 2V5ZA 2RDXA 4CCRA 3Q6JA 4B1BA 1X31B 3H8AA 4BURA 1KDGA 4TVWA 4EIQA 4ZA0A 4UDQA 3UOVA 2TMDA 1R0MA 4Z2UA 3L8KA 1GALA 2BK3A 4HPNA 2OQYA 4CY6A 1DJNA 1RVKA 1JRXA 5L46A 5JCIA 4A7AA 2WU5A 1KF6A 3EAOA 1NHRA 4J57A 3CAWA 3AYLA 2XYOA 4MGGA 2BRAA 4G73A 4B67A 3DJDA 3JSKA 3UKAA 1ZDLA 4Z44A 4OPLA 2E4GA 4Z2RA 4GYPC 2O56A 2QA2A 2P3ZA 2GB0A 3QSSA 4YWSA 2PTXA 3GC2A 1CBOA 1ELIA 2XFPA 3IWAA 4YWOA 5DBJA 3I4KA 4HYRA 1O94A 1GRHA 5J60A 4RG3A 2R0PA 2JBVA 3F8DA 2W0HA 4CCQA 4TM4A 1NELA 3CGEA 4GDPA 3SBFA 4J31A 4C5OA 2YLXA 3FBSA 3HPFA 4FK1A 4J36A 3ES8A 3SN4A 3MZNA 3BOXA 1S3EA 4II3A 3UJRA 3VC5A 2FJDA 3P4SA 1L0VA 2IIDA 2OLAA 5HHFA 1FCDA 4E6MA 4FP1A 2OAMA 1GRTA 1JDFA 2YR6A 5C2TA 1KCZA 3CNSA 1PDHA 3VCCA 1EL9A 3PWGA 5KRQA 2B7SA 3ICSA 5G5HB 3VR8A 1ZX9A 4DYEA 2WDVA 2ARDA 4H2PA 4JN9A 1N4WA 1PN0A 1TDEA 1S7MA 2BK5A 4A99A 1LQUA 3ZLFA 3UXKA 3RNMA 2OQHA 3B6DA 4FDCB 3V4BA 3SY4A 3QJ4A 3HYWA 2B9XA 1P43A 2QJNA 3HRDC 2WDRA 4ADWA 1NENA 1BQGA 4C77A 4OVIA 5EOWA 4DHGA 4HCLA 4EIPA 2XCGA 1CJ2A 4DNAA 3M13A 3O0HA 3DG7A 1BKWA 3EANA 4TM1A 3UP4A 3JZUA 3QPEA 3R9UA 2GEWA 4U8LA 2BK4A 2XGZA 4DX3A 4GRTA 3B9JB 1K0LA 3BSMA 5BOEA 1L8PA 3DFYA 1VDCA 2UZZA 2AAQA 2GAHB 4B65A 4K2SA 2Q0KA 4K8GA 2I0ZA 5EB5A 3R0KA 2GDQA 1OJDA 2OA1A 7ENLA 2WPCA 3TWBA 2DKHA 3PVCA 3DERA 4REKA 3VCNA 1NHPA 3QSEA 1NAAA 4HN8A 4YKGA 1MO9A 1GEUA 2F5ZA 5BOFA 2A8XA 2TPRA 2RGJA 3VR9A 5FS8A 3B97A 1GRGA 3PWIA 1GESA 3UKQA 4E8GA 4H4WA 2XFUA 2C3DA 4TM3A 4CNJA 4JN7A 4DN1A 2PU1A 4XXGA 4C3YA 2GVCA 2GH5A 2DW7A 3UCCA 3TOYA 4NEVA 2WOVA 3IC9A 1IUUA 2BA9A 3UKKA 2PCEA 2C64A 4UDPA 3H7VA 1EC7A 2B76A 3UTHA 2RGHA 3KPFA 4H4YA 5FJRA 3NN6X 2GGGA 2PTWA 2XVIA 2ACZA 4HCHA 3NYFA 4J34A 2XVJA 4USRA 2XH4A 3SN1A 1DOBA 3BJSA 1N62C 1PJ7A 3H12A 2V60A 4H2RA 5HYMA 2P8CA 4A9WA 4GUVA 3UTGA 1MRAA 1MXTA 2PHHA 1FFUC 2R45A 4X2PA 2GSHA 1H82A 3GO2A 2WPEA 3NFUA 1V59A 4H2HA 1XHCA 4OPCA 4H4RA 4N9XA 3QN3A 1MOKA 3GMBA 3DH9A 2QDDA 2B9YA 1QJDA 1Y56B 3TQPA 3AE3A 2WESA 2CULA 3P4PA 3UCLA 2XLRA 4H4ZA 1LV0A 2PMQA 2C4CA 1JPMA 4A65A 1P48A 4H83A 3BI4A 4J2WA 1FO4A 3SFDA 1ZY8A 1QLBA 4IA6A 4JY3A 4EQRA 1JPDX 3FIMB 1O5WA 4DGKA 2X8GA 2AKZA 2O9ZA 3BHFA 2A89A 3GSIA 4A6NB 3OP2A 1ECQA 1OJCA 2AR8A 1E1KA 4KPLA 2GAGB 3ALMA 3UXLA 1L9DA 2GQWA 2WU2A 4JNQA 2QGYA 1TRBA 2PP0A 3NYCA 3GDPA 3NVYB 3DEQA 3EPTA 1WYGA 2FBWA 1D4CA 2VQBA 2VVMA 4B66A 2GQFA 1E39A 1BWCA 3RP7A 3F8PA 1TYTA 3R1ZA 1OEPA 2X8CA 2GGEA 3SSZA 1PBEA 1JRYA 4OPGA 3V3WA 4M6UA 2WP5A 1EC9A 3LZWA 4G8TA 3SN0A 1MNSA 3ISHA 2Z5XA 1M64A 2HXUA 4OPTA 4K22A 1LTXR 1Q1RA 3NVZB 3AEAA 1AOGA 4H4TA 1NG4A 2OVLA 5FJTA 3ZVIA 4B69A 3ZVHA 2XSXA 3AEGA 3VA8A 3CPIG 3MWCA 1IUSA 4A6GA 1H6VA 3P0WA 1N60C 1L9CA 2WP6A 3N6JA 5KMPA 4HNCA 3TJ4A 1ZKQA 3T6CA 3PFRA 3R0UA 4DXKA 5FJUA 2JB3A 3KKJA 4GF7A 2W3RA 5U63A 2EQ7A 2PGEA 3QFAA 5KWFA 2BCGG 1FEBA 4H7UA 2FYMA 4YTMA 3NTDA 2P8BA 3HYVA 3OC4A 1EL7A 3STPA 5M0ZA 4ZCWA 2P88A 2OLNA 3NHOX 2R9ZA 4BV6A 1YEYA 2AL2B 4MJWA 3F8RA 1COYA 3HYXA 2V3BA 3G5SA 4IVMB 4OPUA 3RITA 2OZ3A 3AM9A 3FJ4A 1TE6A 3B3RA 1VRQB 1GTEA 2OZTA 2C7GA 3AE8A 4AOSA 3AD8B 3P93A 4ICYA 4KEMA 2HZGA 1XANA 3FVDA 4GGBA 1B5QA 1BGJA 5C3JA 3T8QA 2QAEA 2JKCA 4MMWA 4C3XA 4KWSA 1KNPA 3SZFA 4GDEA 3PK7A 1PBBA 2RGOA 2WETA 4J33A 5IQ1A 2GV8A 4D03A 4DWDA 1D4DA 2XDOA 2AKMA 1JRPA 4EMIA 5IDZA 3LADA 6ENLA 1GSNA 3K30A 4GGHA 2V3AA 1L9EA 3NZGA 1H81A 3WE0A 5EU9A 3R10A 2C72A 1E1MA 4CY8A 2XVHA 3NG7X 3DJJA 3UKPA 2J3NA 3EEZA 1CC4A 2GR3A 1PJ5A 3NGCX 3RP6A 4O5QA 3P4QA 1D4EA 3Q45A 1FFVC 5LV9A 1W6TA 2GMHA 1SJDA 2BS2A 3UKFA 2BRYA 2JB1A 3CXBA 4GFIA 3V5FA 4HA6A 1EC8A 1ZMCA 4CNKA 1CC2A 4JDRA 1GREA 4OPIA 2YLRA 3P1WA 2HNEA 3CIRA 2WPFA 3REDA 3IK4A 4TLXA 3CGCA 3NS1B 1GTHA 4GMEA 2XLSA 3RO6A 1EBHA 2QQ6A 3SZ0A 2GMJA 4E4FA 4J56A 4A3RA 5KVIA 4BK1A 3CPHG 3FV9A 5FS6A 4UDRA 4U2SA 2AL2A 2WQYA 3H8IA 1ELSA 4X4JA 4JNAA 3UOZA 2XVFA 4PAAA 3NIXA 4YSHA 3AEBA 1GRFA 1KN0A 1P2EA 4U2TA 2FJEA 2WHDA 2AQJA 2VVLA 3FCPA 2GL5A 5HY5A 3T0KA 2BC1A 1CL0A 3K7QX 2YM1A 3TTEA 3AE1A 2JB2A 2E5AA 1Y0PA 1CC6A 1BF3A 2QDEA 3QTPA 1NHQA 4E0VA 3GD4A 1NHSA 2DKIA 3I3LA 4IA5A 4ENLA 3OW1A 5ER0A 1XPQA 2WP9A 4NZHA 4AT2A 3E1TA 2XVEA 3OZ2A 1CHUA 1GNDA 1KSUA 1PDZA 3VRDB 2GR1A 3ALLA 4U2LA 5FS9A 2C3CA 3VDGA 3VC6A 1LVLA 4IV9A 1NDAA 2Q0LA 4ZN0A 3DGBA 1MUCA 4CBQA 3BNMA 3S5SA 2VRLA 1BKHA 4GCMA 3UTEA 3GWDA 3ETRB 3GRTA 1VQWA 3SYIA 4GISA 1ONFA 3RP8A 3NXLA 3QFBA 3UKHA 5ENLA 2OKTA 1VG9A 1JNRA 3FXGA 2Y6QA 2B7RA 1F9CA 1FHUA 3BNUA 1N61C 1LPFA 4YKFA 3DJEA 4EQWA 1IUTA 4IVOB 3UKLA 3GYIA 1KSSA 3AEFA 4KX6A 3AE4A 3K1GA 3CT2A 5BRTA 1B4VA 4APNA 1PXCA 4H2QA 4HCDA 1Q9IA 4EWJA 2YVGA 2QVHA 4CRTA 1YY5A 3IHMA 3U4FA 2Z5YA 5U25A 1RSGA 4II2A 1FL2A 2C67A 4FI4A 3OZMA 5J7XA 3D8XA 1PXBA 4H4XA 3S61A
chains in the Genus database with same CATH topology
4K8DA 3NTAA 4Z43A 3FG2P 2WP5A 2BXSA 2Q6UA 4UDQA 3UOVA 4KPRA 2TMDA 3NK1X 3L5OA 3RHAA 3LXDA 3LZWA 4Z2UA 3L8KA 1GALA 1OJAA 2BK3A 4CY6A 1PJ6A 1DJNA 5U1OA 1JRXA 5L46A 1E6EA 4G6GA 1ZK7A 2XFOA 4K2XA 3NH3X 3ISHA 5JCIA 3AE7A 1YQ4A 4A7AA 2WU5A 2X50A 4EM4A 2Z5XA 1KF6A 3ZYXA 1M64A 2WOWA 2VZ2A 3T2ZA 4OPTA 3KU9A 3KVEA 3EAOA 4K22A 4YXDA 3II4A 1LTXR 1Q1RA 3GD3A 1GRBA 1NHRA 1SEZA 3AB1A 4J57A 1AOGA 4H4TA 1NG4A 3AEAA 2BS3A 1FEAA 3AYLA 4OPDA 2XYOA 1CJ4A 4B69A 3AEGA 2BRAA 3CPIG 1HYUA 1E7PA 2ZZ0A 2CFYA 1IUSA 4G73A 4B67A 1H7XA 3DJDA 3JSKA 1H6VA 3UKAA 1ZDLA 4Z44A 4OPLA 2WEUA 1L9CA 2IVDA 3URHA 2E4GA 2WP6A 2BCPA 4Z2RA 3VQRA 5KMPA 3C4AA 2XLTA 1ZKQA 3AYIA 3FPZA 2FJBA 2QA2A 2GB0A 3AE5A 3QSSA 2WDQA 5BULA 4JY2A 2CVJA 2JB3A 1CBOA 3K7TA 2YG3A 4EQSA 3KKJA 1ELIA 4DSGA 4GF7A 4ZCCA 2XFPA 3IWAA 3H8LA 2EQ7A 5JCLA 5U63A 4YWOA 3CNTA 5DBJA 1JNZA 4BK2A 4U8MA 1TDKA 2C70A 2YG5A 5EB4A 5GSNA 3QFAA 1F8SA 5BUKA 5KWFA 2BCGG 1FEBA 3NT6A 4H7UA 3BI5A 1IUWA 1O94A 1PBCA 1BZLA 1GRHA 4YTMA 3AYJA 3NTDA 1N1PA 5J60A 4RG3A 1UKVG 3AE2A 4EQXA 1F6MA 2R0PA 2JBVA 3HYVA 4TM0A 3F8DA 3PS9A 2CDUA 1PS9A 3T14A 3V76A 2W0HA 1EBDA 4CCQA 4LU6A 4TM4A 5FMHA 3OC4A 3CGEA 1EL7A 2GF3A 1Q1WA 4GDPA 1ZMDA 4H50A 4J31A 4U8PA 4WX1A 5M0ZA 2YLXA 4C5OA 3FBSA 1D7YA 2OLNA 4FK1A 4J36A 4EMJA 1IJHA 3NHOX 2R9ZA 3P9UA 4BV6A 4U8NA 3SGLA 4NWZA 1S3EA 4II3A 4MJWA 3F8RA 1COYA 3M12A 1W4XA 4M52A 1Z6LA 3SQPA 1CJ3A 2YG7A 2FJDA 3AXBA 1GETA 1NEKA 2V3BA 3HYXA 3P4SA 2R46A 3G5SA 4IVMB 1L0VA 2YAUA 2IIDA 5HHFA 4Z26A 4OPUA 1FCDA 1RYIA 3GRSA 4H2NA 3LB8A 2OAMA 1GRTA 2X3NA 3H4KA 2YR6A 5C2TA 2VRMA 3CNSA 3B3RA 1S3BA 3DMEA 1E1LA 1PDHA 1VRQB 2BYBA 4NEWA 2XLPA 4A79A 1EL9A 5KRQA 3AD7B 4NTCA 4D04A 1CF3A 2B7SA 3VRBA 3ICSA 3VR8A 1ZX9A 1GTEA 1GPEA 5IQ4A 3VRAA 1TDNA 2C7GA 2WDVA 2RABA 2ARDA 3AE8A 3AD8B 3ABVA 1N4WA 3BHKA 4H2PA 4JN9A 3SXIA 1PN0A 4ICYA 1TDEA 1S7MA 1N4VA 2BK5A 4A99A 1LQUA 3NLCA 1XANA 1B5QA 1JU2A 2WS3A 1BGJA 4O5UA 5C3JA 2QAEA 2JKCA 3RNMA 3CGDA 3GWFA 4HB9A 2JK6A 5JRBA 1KNRA 3L1RA 4C3XA 3B6DA 3ATRA 1PHHA 3DK4A 4FDCB 3LOVA 1D5TA 1CJCA 1K0JA 2FJAA 2YVJA 3SY4A 3NYEA 4Y4NA 4YSZA 1KNPA 4NNJA 3KA7A 3SZFA 3QJ4A 4GDEA 3HYWA 1PBBA 2RGOA 1FECA 2WETA 4J33A 4Z25A 2B9XA 3C4NA 4H4QA 5IQ1A 2YVFA 2GV8A 4I58A 4D03A 2WDRA 4ADWA 1D4DA 1NENA 1FOHA 2IVEA 2XDOA 3ALJA 3GYJA 3M0OA 4OVIA 3T2YA 4C77A 4EMIA 5JCNA 4G9KA 2C76A 5EOWA 5GRTA 4AOSA 3LADA 1TDFA 1GSNA 2E1MA 3K30A 3SX6A 4EIPA 2XCGA 1CJ2A 2XFNA 2R0CA 2VOUA 1LJ1A 4BK3A 4DNAA 3M13A 2V3AA 2ZBWA 4GR1A 2B9WA 3O0HA 1L9EA 3QSMA 2EQ6A 1BKWA 3EANA 4TM1A 1H81A 1PXAA 3G5RA 3WE0A 2V6OA 3UP4A 2C72A 1E1MA 4ZCDA 2GR0A 4YT0A 4CY8A 5CQFA 2YR4A 3K7MX 2XVHA 2GEWA 3NG7X 3DJJA 2BK4A 4U8LA 1IUVA 3R9UA 4G6HA 4AOXA 4B64A 3UKPA 2J3NA 3D1CA 1CC4A 5BVAA 2YG4A 2YR5A 4GRTA 1H2IA 2GR3A 1O95A 1PJ5A 1K0LA 3CMMA 3G5QA 3GDNA 3NGCX 3RP6A 4O5QA 4P9SA 2Q7VA 3P4QA 1B37A 5KOXA 1D4EA 5CKUA 1NG3A 1REOA 3T31A 1VDCA 5LV9A 2UZZA 2GMHA 2YLSA 2C73A 4TLZA 3AE6A 5KXJA 4USQA 2AAQA 3D9XA 2GAHB 3SM8A 4B65A 2BS2A 2Q0KA 3ITJA 3P4RA 2ZZCA 2BRYA 2JB1A 3UKFA 3QVRA 2I0ZA 1OJ9A 3DGHA 5EB5A 4LIIA 3ADAB 3HZLA 1OJDA 4DSHA 3KLJA 2H89A 2OA1A 3NRNA 4HA6A 3CNDA 1ZMCA 4CNKA 1CC2A 2WPCA 4JDRA 3BI2A 2DKHA 1GREA 4OPIA 2EQ9A 1H86A 4H4SA 2YG6A 2YLRA 3P1WA 3CIRA 3PVCA 2OALA 3CPJG 4REKA 2WPFA 3REDA 1NHPA 3QVPA 3QSEA 3COXA 1NAAA 4TLXA 4AP3A 4YKGA 3CGCA 1DXLA 1MO9A 1EL5A 1GTHA 2A87A 2VQ7A 3IHGA 2YLTA 3S5WA 1GEUA 5KNLA 2XLSA 1GXFA 3SZ0A 2F5ZA 2R4EA 2GMJA 1TYPA 1JOAA 4J56A 2A8XA 2TPRA 2QA1A 2RGJA 5KVIA 4Y4LA 3VR9A 5FS7A 4Z24A 5FS8A 3AEDA 4BK1A 3Q9TA 3T37A 1GRGA 1GESA 3EF6A 2OLOA 3UKQA 4H4WA 3CPHG 2YM2A 5FS6A 4YSXA 4UDRA 2XFUA 4U8JA 4U2SA 5KMSA 2C3DA 3NK2X 4TM3A 4UP3A 4CNJA 1QO8A 3AEEA 2WQYA 2X8HA 2XFQA 3H8IA 4EM3A 4X4JA 4XXGA 4C3YA 4JNAA 3UOZA 2GRTA 2XVFA 4PAAA 2GVCA 2GH5A 3CN8A 4BJZA 3NIXA 1F8WA 2HQMA 4LA1A 4YSHA 5JCMA 1GRFA 4NEVA 1GV4A 1KN0A 2WOVA 3IC9A 1P2EA 3AEBA 1IUUA 1S2QA 2YWLA 2BA9A 3UKKA 3UOYA 2BC0A 2C64A 4UDPA 4U2TA 3DK9A 2FJEA 1DJQA 3KPKA 5TR3A 2WHDA 3FMWA 2AQJA 3AECA 2B76A 3T2KA 1YQZA 1RP0A 3UTHA 2RGHA 2V61A 2VVLA 3KPFA 2R0GA 4H4YA 5HY5A 4NTDA 3NN6X 4I59A 4C74A 1IUXA 4XWZA 5KMQA 3T0KA 2BC1A 1CL0A 1PBFA 3K7QX 2XVIA 3ATQA 2ACZA 4J34A 1D7LA 2C65A 3NYFA 2YM1A 2X99A 3AE1A 2JB2A 2XVJA 1NPXA 1JRZA 1Y0PA 1CC6A 1BF3A 4USRA 4AT0A 1DOBA 1NHQA 2ZZBA 4GAPA 4U8OA 4A5LA 4E0VA 5M10A 1PJ7A 3GD4A 1NHSA 1H83A 3PG6A 2DKIA 3I3LA 2V60A 4H2RA 4GAVA 5HYMA 3V3NA 1F8RA 4IA5A 4A9WA 1E1NA 3ICTA 1ZP0A 4GUVA 1LQTA 3GMCA 3UTGA 1MXTA 2PHHA 5ER0A 2H88A 3CTYA 2R45A 4G74A 4FK1C 4B63A 1XPQA 2WP9A 5KMRA 4NZHA 4OCGA 4AT2A 3E1TA 2XVEA 3OZ2A 3V3OA 2PYXA 1H82A 5KVHA 5JCKA 1CHUA 2WPEA 3UOXA 2JAEA 3SZWA 1GT8A 4K5RA 2YQUA 1GNDA 1DODA 3IF9A 4NTEA 2WBAA 3NKSA 1KSUA 3LZXA 4B68A 1V59A 3VRDB 3NNEA 1XHCA 2GR1A 4OPCA 3ALLA 1GERA 4H4RA 4N9XA 4U2LA 1MOKA 3DK8A 1YKJA 3GMBA 5FS9A 2C3CA 2C75A 2BXRA 2Y6RA 3ZDNA 1LVLA 2NVKX 2NPXA 3DH9A 3NK0X 3LJPA 3AE9A 4Y4MA 2B9YA 4IV9A 1NDAA 1QJDA 2Q0LA 1Y56B 3CNJA 4ZN0A 1H84A 4YSYA 4XWRA 2APGA 3BNMA 3AE3A 3DA1A 4CBQA 4GCMA 2VRLA 3UTEA 2WESA 2CULA 3P4PA 3UCLA 3GWDA 2XLRA 1P2HA 1ZOYA 4EMWA 2GR2A 4BJYA 3PO7A 4H4ZA 1LV0A 3NN0X 3GRTA 1VQWA 3SYIA 2C4CA 1H7WA 4A65A 4JQ9A 1ZOVA 1ONFA 3DJGX 3RP8A 3BI4A 4J2WA 1DOCA 3SFDA 1ZY8A 1QLBA 3QFBA 1Y56A 4IA6A 4JY3A 1F3PA 2VVLG 4ECHA 1B8SA 4EQRA 3UKHA 1EL8A 1DOEA 1XDIA 3FIMB 4AP1A 1O5WA 1VG9A 4DGKA 1JNRA 1GRAA 2X8GA 2Y6QA 3KD9A 2O9ZA 3CGBA 2B7RA 1JEHA 3BHFA 2A89A 3GSIA 4A6NB 3ICRA 3BNUA 1S2YA 4K5SA 4RSLA 1YQ3A 1OJCA 3SFEA 2AR8A 1K4QA 2C66A 4YTPA 1E1KA 1LPFA 3AD9B 1VG0A 2XLUA 4YKFA 3DJEA 1TDOA 3AWIA 1DNCA 4WCTA 4EQWA 1GOSA 2R4JA 2YLWA 2GAGB 1IUTA 1KFYA 3ALMA 4U8KA 4IVOB 4PABA 3UKLA 2BABA 5IPYA 3GYIA 1KSSA 1M6IA 2BS4A 4U8IA 3AEFA 4A6NA 1L9DA 2GQWA 4KX6A 3AE4A 2WU2A 2QCUA 2WOIA 5BRTA 2E5VA 4H4PA 3C96A 4JNQA 1B4VA 1TRBA 1N4UA 4APNA 3NYCA 3GDPA 3SZCA 1OJTA 3UTFA 1PXCA 3EPTA 2FBWA 5HXIA 3I6DA 1Q9IA 4H2QA 3DGZA 4FX9A 4RG4A 4X9NA 5KOWA 1BGNA 4Z2TA 2EQ8A 2YVGA 4H4VA 1D4CA 2VQBA 1YY5A 2BACA 2VVMA 3UP5A 4H4UA 4CRTA 3IHMA 5EBKA 4X9MA 2Z5YA 5U25A 4B66A 1RSGA 2GQFA 2V5ZA 4YTNA 1K0IA 1E39A 4II2A 4CCRA 1FL2A 2C67A 1BWCA 3Q6JA 3CNPA 2YLZA 3RP7A 3F8PA 4B1BA 1X31B 4BURA 1TYTA 1KDGA 2X8CA 4K7ZA 5J7XA 3D8XA 1PBEA 1PXBA 4H4XA 3GYXA 3S61A 1JRYA 4OPGA 4EIQA 1PBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8D A;  3NTA A;  4Z43 A;  3FG2 P;  2WP5 A;  2BXS A;  2Q6U A;  4UDQ A;  3UOV A;  4KPR A;  2TMD A;  3NK1 X;  3RHA A;  4Z2U A;  3LXD A;  3LZW A;  3L8K A;  1GAL A;  1OJA A;  2BK3 A;  4CY6 A;  1PJ6 A;  1DJN A;  5U1O A;  1JRX A;  5L46 A;  1E6E A;  1ZK7 A;  2XFO A;  4K2X A;  3NH3 X;  3ISH A;  5JCI A;  3AE7 A;  1YQ4 A;  4A7A A;  2WU5 A;  2X50 A;  4EM4 A;  2Z5X A;  1KF6 A;  3ZYX A;  1M64 A;  2WOW A;  2VZ2 A;  4OPT A;  3KU9 A;  3KVE A;  3EAO A;  4K22 A;  4YXD A;  3II4 A;  1LTX R;  1Q1R A;  3GD3 A;  1GRB A;  1NHR A;  1SEZ A;  3AB1 A;  4J57 A;  1AOG A;  4H4T A;  1NG4 A;  3AEA A;  2BS3 A;  1FEA A;  3AYL A;  4OPD A;  2XYO A;  1CJ4 A;  4B69 A;  3AEG A;  3CPI G;  1HYU A;  1E7P A;  2ZZ0 A;  2CFY A;  1IUS A;  4B67 A;  1H7X A;  3DJD A;  3JSK A;  1H6V A;  3UKA A;  1ZDL A;  4Z44 A;  4OPL A;  2WEU A;  1L9C A;  2IVD A;  3URH A;  2E4G A;  2WP6 A;  2BCP A;  4Z2R A;  3VQR A;  3C4A A;  2XLT A;  1ZKQ A;  3AYI A;  3FPZ A;  2FJB A;  2QA2 A;  2GB0 A;  3AE5 A;  3QSS A;  2WDQ A;  5BUL A;  4JY2 A;  2CVJ A;  2JB3 A;  1CBO A;  3K7T A;  2YG3 A;  4EQS A;  3KKJ A;  1ELI A;  4DSG A;  4GF7 A;  4ZCC A;  2XFP A;  3IWA A;  3H8L A;  2EQ7 A;  5JCL A;  5U63 A;  4YWO A;  3CNT A;  5DBJ A;  1JNZ A;  4BK2 A;  4U8M A;  1TDK A;  2C70 A;  2YG5 A;  5EB4 A;  5GSN A;  3QFA A;  1F8S A;  5BUK A;  5KWF A;  2BCG G;  1FEB A;  3NT6 A;  4H7U A;  3BI5 A;  1IUW A;  1O94 A;  1PBC A;  1BZL A;  1GRH A;  4YTM A;  3AYJ A;  3NTD A;  1N1P A;  5J60 A;  4RG3 A;  1UKV G;  3AE2 A;  4EQX A;  1F6M A;  2R0P A;  2JBV A;  4TM0 A;  3F8D A;  3PS9 A;  2CDU A;  1PS9 A;  3V76 A;  2W0H A;  1EBD A;  4CCQ A;  4LU6 A;  4TM4 A;  5FMH A;  3OC4 A;  3CGE A;  1EL7 A;  2GF3 A;  1Q1W A;  4GDP A;  1ZMD A;  4H50 A;  4J31 A;  4U8P A;  4WX1 A;  5M0Z A;  2YLX A;  4C5O A;  3FBS A;  1D7Y A;  2OLN A;  4FK1 A;  4J36 A;  4EMJ A;  1IJH A;  3NHO X;  2R9Z A;  3P9U A;  4BV6 A;  4U8N A;  3SGL A;  1S3E A;  4MJW A;  3F8R A;  1COY A;  3M12 A;  1W4X A;  4M52 A;  1Z6L A;  3SQP A;  1CJ3 A;  2YG7 A;  2FJD A;  3AXB A;  1GET A;  1NEK A;  2V3B A;  3P4S A;  2R46 A;  3G5S A;  4IVM B;  1L0V A;  2YAU A;  2IID A;  5HHF A;  4Z26 A;  4OPU A;  1FCD A;  1RYI A;  3GRS A;  4H2N A;  3LB8 A;  2OAM A;  1GRT A;  2X3N A;  3H4K A;  2YR6 A;  5C2T A;  2VRM A;  3CNS A;  3B3R A;  1S3B A;  3DME A;  1E1L A;  1PDH A;  1VRQ B;  2BYB A;  4NEW A;  2XLP A;  4A79 A;  1EL9 A;  5KRQ A;  3AD7 B;  4NTC A;  4D04 A;  1CF3 A;  2B7S A;  3VRB A;  3ICS A;  3VR8 A;  1ZX9 A;  1GTE A;  1GPE A;  5IQ4 A;  3VRA A;  1TDN A;  2C7G A;  2WDV A;  2RAB A;  2ARD A;  3AE8 A;  3AD8 B;  3ABV A;  1N4W A;  3BHK A;  4H2P A;  4JN9 A;  4AOS A;  1PN0 A;  4ICY A;  1TDE A;  1N4V A;  2BK5 A;  4A99 A;  1LQU A;  3NLC A;  1XAN A;  1B5Q A;  1JU2 A;  2WS3 A;  1BGJ A;  4O5U A;  5C3J A;  2QAE A;  2JKC A;  3RNM A;  3CGD A;  3GWF A;  4HB9 A;  2JK6 A;  1KNR A;  3L1R A;  4C3X A;  3B6D A;  3ATR A;  1PHH A;  3DK4 A;  4FDC B;  3LOV A;  1D5T A;  1CJC A;  1K0J A;  2FJA A;  2YVJ A;  3NYE A;  4Y4N A;  4YSZ A;  1KNP A;  3KA7 A;  3QJ4 A;  4GDE A;  1PBB A;  2RGO A;  1FEC A;  2WET A;  4J33 A;  4Z25 A;  2B9X A;  3C4N A;  4H4Q A;  5IQ1 A;  2YVF A;  2GV8 A;  4I58 A;  4D03 A;  2WDR A;  4ADW A;  1D4D A;  1NEN A;  1FOH A;  2IVE A;  2XDO A;  3ALJ A;  3GYJ A;  3M0O A;  4OVI A;  4C77 A;  4EMI A;  5JCN A;  5EOW A;  2C76 A;  5GRT A;  3LAD A;  1TDF A;  1GSN A;  2E1M A;  3K30 A;  4EIP A;  2XCG A;  1CJ2 A;  2XFN A;  2R0C A;  2VOU A;  1LJ1 A;  4BK3 A;  4DNA A;  3M13 A;  2V3A A;  2ZBW A;  4GR1 A;  2B9W A;  3O0H A;  1L9E A;  3QSM A;  2EQ6 A;  1BKW A;  3EAN A;  4TM1 A;  1H81 A;  1PXA A;  3G5R A;  3WE0 A;  2V6O A;  3UP4 A;  2C72 A;  1E1M A;  4ZCD A;  2GR0 A;  4YT0 A;  4CY8 A;  5CQF A;  2YR4 A;  3K7M X;  2XVH A;  2GEW A;  3NG7 X;  3DJJ A;  2BK4 A;  4U8L A;  1IUV A;  3R9U A;  4AOX A;  4B64 A;  3UKP A;  2J3N A;  3D1C A;  1CC4 A;  5BVA A;  2YG4 A;  2YR5 A;  4GRT A;  2GR3 A;  1PJ5 A;  1O95 A;  1K0L A;  3G5Q A;  3GDN A;  3NGC X;  3RP6 A;  4O5Q A;  4P9S A;  2Q7V A;  3P4Q A;  1B37 A;  5KOX A;  1D4E A;  5CKU A;  1NG3 A;  1REO A;  1VDC A;  5LV9 A;  2UZZ A;  2GMH A;  2YLS A;  2C73 A;  4TLZ A;  3AE6 A;  5KXJ A;  4USQ A;  2AAQ A;  2GAH B;  3SM8 A;  4B65 A;  2BS2 A;  2Q0K A;  3ITJ A;  3P4R A;  2ZZC A;  2JB1 A;  3UKF A;  3QVR A;  2I0Z A;  1OJ9 A;  3DGH A;  5EB5 A;  4LII A;  3ADA B;  3HZL A;  1OJD A;  4DSH A;  3KLJ A;  2H89 A;  2OA1 A;  3NRN A;  4HA6 A;  3CND A;  1ZMC A;  4CNK A;  1CC2 A;  2WPC A;  4JDR A;  3BI2 A;  2DKH A;  1GRE A;  4OPI A;  2EQ9 A;  1H86 A;  4H4S A;  2YG6 A;  2YLR A;  3P1W A;  3CIR A;  3PVC A;  2OAL A;  3CPJ G;  4REK A;  2WPF A;  3RED A;  1NHP A;  3QVP A;  3QSE A;  3COX A;  1NAA A;  4TLX A;  4AP3 A;  4YKG A;  3CGC A;  1DXL A;  1MO9 A;  1EL5 A;  1GTH A;  2A87 A;  2VQ7 A;  3IHG A;  2YLT A;  3S5W A;  1GEU A;  2XLS A;  1GXF A;  2F5Z A;  2R4E A;  2GMJ A;  1TYP A;  1JOA A;  4J56 A;  2A8X A;  2TPR A;  2QA1 A;  2RGJ A;  5KVI A;  4Y4L A;  3VR9 A;  5FS7 A;  4Z24 A;  5FS8 A;  3AED A;  4BK1 A;  3Q9T A;  3T37 A;  1GRG A;  1GES A;  3EF6 A;  2OLO A;  3UKQ A;  4H4W A;  3CPH G;  2YM2 A;  5FS6 A;  4YSX A;  4UDR A;  2XFU A;  4U8J A;  4U2S A;  2C3D A;  3NK2 X;  4TM3 A;  4UP3 A;  4CNJ A;  1QO8 A;  3AEE A;  2WQY A;  2X8H A;  2XFQ A;  3H8I A;  4EM3 A;  4X4J A;  4XXG A;  4C3Y A;  4JNA A;  3UOZ A;  2GRT A;  2XVF A;  4PAA A;  2GVC A;  2GH5 A;  3CN8 A;  4BJZ A;  3NIX A;  1F8W A;  2HQM A;  4LA1 A;  4YSH A;  5JCM A;  1GRF A;  4NEV A;  1GV4 A;  2WOV A;  3IC9 A;  1P2E A;  3AEB A;  1IUU A;  1S2Q A;  2YWL A;  2BA9 A;  3UKK A;  3UOY A;  2BC0 A;  2C64 A;  4UDP A;  4U2T A;  3DK9 A;  2FJE A;  1DJQ A;  5TR3 A;  2WHD A;  3FMW A;  2AQJ A;  3AEC A;  2B76 A;  1YQZ A;  1RP0 A;  3UTH A;  2RGH A;  2V61 A;  2VVL A;  3KPF A;  2R0G A;  4H4Y A;  5HY5 A;  4NTD A;  3NN6 X;  4I59 A;  4C74 A;  1IUX A;  4XWZ A;  2BC1 A;  1CL0 A;  1PBF A;  3K7Q X;  2XVI A;  3ATQ A;  2ACZ A;  4J34 A;  1D7L A;  2C65 A;  3NYF A;  2YM1 A;  2X99 A;  3AE1 A;  2JB2 A;  2XVJ A;  1NPX A;  1JRZ A;  1Y0P A;  1CC6 A;  1BF3 A;  4USR A;  4AT0 A;  1DOB A;  1NHQ A;  2ZZB A;  4U8O A;  4A5L A;  4E0V A;  5M10 A;  1PJ7 A;  3GD4 A;  1NHS A;  1H83 A;  2DKI A;  3I3L A;  2V60 A;  4H2R A;  5HYM A;  3V3N A;  1F8R A;  4IA5 A;  4A9W A;  1E1N A;  3ICT A;  1ZP0 A;  4GUV A;  1LQT A;  3GMC A;  3UTG A;  1MXT A;  2PHH A;  5ER0 A;  2H88 A;  3CTY A;  2R45 A;  4FK1 C;  4B63 A;  1XPQ A;  2WP9 A;  4NZH A;  4OCG A;  4AT2 A;  3E1T A;  2XVE A;  3OZ2 A;  3V3O A;  2PYX A;  1H82 A;  5KVH A;  5JCK A;  1CHU A;  2WPE A;  3UOX A;  2JAE A;  1GT8 A;  4K5R A;  2YQU A;  1GND A;  1DOD A;  3IF9 A;  4NTE A;  2WBA A;  3NKS A;  1KSU A;  3LZX A;  4B68 A;  1V59 A;  3VRD B;  3NNE A;  1XHC A;  2GR1 A;  4OPC A;  3ALL A;  1GER A;  4H4R A;  4N9X A;  4U2L A;  1MOK A;  3DK8 A;  1YKJ A;  3GMB A;  5FS9 A;  2C3C A;  2C75 A;  2BXR A;  2Y6R A;  3ZDN A;  1LVL A;  2NVK X;  2NPX A;  3DH9 A;  3NK0 X;  3LJP A;  3AE9 A;  4Y4M A;  2B9Y A;  4IV9 A;  1NDA A;  1QJD A;  2Q0L A;  1Y56 B;  3CNJ A;  4ZN0 A;  1H84 A;  4YSY A;  4XWR A;  2APG A;  3BNM A;  3AE3 A;  3DA1 A;  4CBQ A;  4GCM A;  2VRL A;  3UTE A;  2WES A;  2CUL A;  3P4P A;  3UCL A;  3GWD A;  2XLR A;  1P2H A;  1ZOY A;  4EMW A;  2GR2 A;  4BJY A;  3PO7 A;  4H4Z A;  1LV0 A;  3NN0 X;  3GRT A;  1VQW A;  1H7W A;  4A65 A;  4JQ9 A;  1ZOV A;  1ONF A;  3DJG X;  3RP8 A;  3BI4 A;  4J2W A;  1DOC A;  3SFD A;  1ZY8 A;  1QLB A;  3QFB A;  1Y56 A;  4IA6 A;  4JY3 A;  1F3P A;  2VVL G;  4ECH A;  1B8S A;  4EQR A;  3UKH A;  1EL8 A;  1DOE A;  1XDI A;  3FIM B;  4AP1 A;  1O5W A;  1VG9 A;  4DGK A;  1JNR A;  1GRA A;  2X8G A;  2Y6Q A;  3KD9 A;  2O9Z A;  3CGB A;  2B7R A;  1JEH A;  3BHF A;  2A89 A;  3GSI A;  4A6N B;  3ICR A;  3BNU A;  1S2Y A;  4K5S A;  4RSL A;  1YQ3 A;  1OJC A;  3SFE A;  2AR8 A;  1K4Q A;  2C66 A;  4YTP A;  1E1K A;  1LPF A;  3AD9 B;  1VG0 A;  2XLU A;  4YKF A;  3DJE A;  1TDO A;  3AWI A;  1DNC A;  4WCT A;  4EQW A;  1GOS A;  2R4J A;  2YLW A;  2GAG B;  1IUT A;  1KFY A;  3ALM A;  4U8K A;  4IVO B;  4PAB A;  3UKL A;  2BAB A;  5IPY A;  3GYI A;  1KSS A;  1M6I A;  2BS4 A;  4U8I A;  3AEF A;  4A6N A;  1L9D A;  2GQW A;  4KX6 A;  3AE4 A;  2WU2 A;  2QCU A;  2WOI A;  5BRT A;  2E5V A;  4H4P A;  3C96 A;  4JNQ A;  1B4V A;  1TRB A;  1N4U A;  4APN A;  3NYC A;  3GDP A;  1OJT A;  3UTF A;  1PXC A;  3EPT A;  2FBW A;  5HXI A;  3I6D A;  1Q9I A;  4H2Q A;  3DGZ A;  4FX9 A;  4RG4 A;  4X9N A;  5KOW A;  1BGN A;  4Z2T A;  2EQ8 A;  2YVG A;  4H4V A;  1D4C A;  2VQB A;  1YY5 A;  2BAC A;  2VVM A;  3UP5 A;  4H4U A;  4CRT A;  3IHM A;  5EBK A;  4X9M A;  2Z5Y A;  5U25 A;  4B66 A;  1RSG A;  2GQF A;  2V5Z A;  4YTN A;  1K0I A;  1E39 A;  4CCR A;  1FL2 A;  2C67 A;  1BWC A;  3Q6J A;  3CNP A;  2YLZ A;  3RP7 A;  3F8P A;  4B1B A;  1X31 B;  4BUR A;  1TYT A;  1KDG A;  2X8C A;  4K7Z A;  5J7X A;  3D8X A;  1PBE A;  1PXB A;  4H4X A;  3S61 A;  1JRY A;  4OPG A;  4EIQ A;  1PBD A; 
#chains in the Genus database with same CATH topology
 4K8D A;  3NTA A;  3FG2 P;  3AN1 A;  2Q6U A;  2BXS A;  3RHA A;  3L5O A;  3ZVH B;  2POZ A;  1E6E A;  1ZK7 A;  2XFO A;  3NH3 X;  1YQ4 A;  1TZZ A;  4EM4 A;  2WOW A;  3OPS A;  2VZ2 A;  3T2Z A;  3KVE A;  4YXD A;  3GD3 A;  1SEZ A;  2BS3 A;  2XH2 A;  1FEA A;  4OPD A;  1HYU A;  1E7P A;  2CFY A;  2P0I A;  1H7X A;  4IL0 A;  4Z1Y A;  3QLD A;  2WEU A;  3A7A A;  1JCT A;  2IVD A;  3URH A;  3C4A A;  2XLT A;  1ZXI C;  3QKE A;  3AYI A;  2FJB A;  3AE5 A;  2WDQ A;  2CVJ A;  2YG3 A;  3H8L A;  3D47 A;  4BK2 A;  1TDK A;  5GSN A;  2YG5 A;  3UCD A;  1SJC A;  1N1P A;  3AE2 A;  2I5Q A;  4EQX A;  1F6M A;  2OFJ A;  3PS9 A;  1PS9 A;  3V76 A;  3T14 A;  1EBD A;  1EBG A;  4LU6 A;  5FMH A;  2GF3 A;  1Q1W A;  4E4U A;  1ZMD A;  4H50 A;  4WX1 A;  1D7Y A;  3P9U A;  4NWZ A;  3M12 A;  1Z6L A;  3EKG A;  3SQP A;  1CJ3 A;  1GET A;  1SJB A;  2R46 A;  4H19 A;  2YAU A;  4Z26 A;  3GRS A;  4H2N A;  3LB8 A;  3CK5 A;  2X3N A;  3H4K A;  2VRM A;  3DES A;  1S3B A;  2PTZ A;  2XLP A;  4NEW A;  4TVY A;  4A79 A;  3AD7 B;  1CF3 A;  1PDY A;  3VRB A;  5J04 A;  1GPE A;  3VRA A;  2QJJ A;  1TDN A;  2RAB A;  3NLC A;  4O5U A;  3MY9 A;  3CGD A;  3GWF A;  5JRB A;  1KNR A;  3ATR A;  3LOV A;  1D5T A;  1CJC A;  2E3T A;  3NYE A;  4Y4N A;  3THU A;  3C4N A;  4JHM A;  4I58 A;  3M0O A;  3GYJ A;  2PPG A;  1FOH A;  3ALJ A;  3T2Y A;  5GRT A;  3P3B A;  1TDF A;  3SX6 A;  2R0C A;  4BK3 A;  2PU0 A;  2ZBW A;  3HW2 A;  4GR1 A;  2B9W A;  1VDV A;  3QSM A;  1N5X A;  4A35 A;  2HXT A;  4YT0 A;  5CQF A;  2YR4 A;  1IUV A;  4H1Z A;  3D1C A;  2PSN A;  5BVA A;  2YR5 A;  1H2I A;  3CMM A;  3G5Q A;  4P9S A;  5KOX A;  5CKU A;  4IP5 A;  4G7F A;  3T31 A;  2PP1 A;  4USQ A;  4ROP A;  2ZZC A;  3QVR A;  1OJ9 A;  3DGH A;  4LII A;  3HZL A;  3FYY A;  3A7R A;  3NRN A;  3CND A;  2OO6 A;  3BI2 A;  3ES7 A;  3T4W A;  1NU5 A;  1H86 A;  4H4S A;  2YG6 A;  2W54 A;  1X2G A;  4AP3 A;  1EL5 A;  3S5W A;  2YLT A;  5KNL A;  1GXF A;  2OX4 A;  1WUF A;  4Y4L A;  3U9I A;  5FS7 A;  3AED A;  3Q9T A;  3EUB 3;  2OLO A;  2YM2 A;  5KMS A;  4UP3 A;  3AEE A;  1RM6 B;  2X8H A;  4BJZ A;  1F8W A;  2HQM A;  5JCM A;  3A7U A;  1S2Q A;  2YWL A;  2PGW A;  3RCY A;  3UOY A;  2BC0 A;  1DJQ A;  3N4F A;  1XS2 A;  1YQZ A;  1RP0 A;  2R0G A;  4I59 A;  3RR1 A;  1IUX A;  3V5C A;  1PBF A;  3ATQ A;  3RGT A;  2C65 A;  2X99 A;  1JRZ A;  3I6T A;  2ZZB A;  4GAP A;  3TCS A;  4U8O A;  3MUC A;  4GIR A;  4GAV A;  2XH7 A;  3ICT A;  1ZP0 A;  4IHC A;  1LQT A;  3CTY A;  4G74 A;  4OCG A;  2CHR A;  3V3O A;  1N63 C;  5KVH A;  5JCK A;  3UOX A;  3SZW A;  1GT8 A;  1DOD A;  2WBA A;  1E9I A;  4K1W A;  3LZX A;  2NQL A;  3MSY A;  3DG6 A;  3DK8 A;  2C75 A;  2Y6R A;  3ZDN A;  3LJP A;  3CNJ A;  3H70 A;  3N4E A;  4YSY A;  2OZ8 A;  2QJM A;  2DW6 A;  1ZOY A;  4EMW A;  3D46 A;  1JRO A;  3R25 A;  2POD A;  3DJG X;  2OG9 A;  1F3P A;  3ENL A;  4AP1 A;  1SJA A;  1S2Y A;  4K5S A;  1YQ3 A;  3SFE A;  1K4Q A;  2C66 A;  3AD9 B;  2XLU A;  4IZG A;  1DNC A;  1GOS A;  2YLW A;  1TKK A;  2BAB A;  5IPY A;  4MKS A;  1M6I A;  4U8I A;  2QCU A;  2WOI A;  2E5V A;  4H4P A;  3C96 A;  3SZC A;  3UTF A;  3DGZ A;  4F4R A;  4X9N A;  4Z2T A;  2EQ8 A;  4H4V A;  3KUM A;  2BAC A;  3UP5 A;  4X9M A;  4YTN A;  1K0I A;  3CNP A;  2YLZ A;  4K7Z A;  3GYX A;  4IT1 A;  1PBD A;  4Z43 A;  2MUC A;  3GD6 A;  4KPR A;  3SR6 B;  3NK1 X;  3LXD A;  1OJA A;  2PP3 A;  1PJ6 A;  5U1O A;  4G6G A;  4K2X A;  3AE7 A;  2X50 A;  3ZYX A;  3KU9 A;  3II4 A;  1GRB A;  3AB1 A;  1IYX A;  3R07 C;  1CJ4 A;  2AL1 A;  3SQS A;  2ZZ0 A;  1SB3 B;  2BCP A;  3VQR A;  3FPZ A;  1X2H A;  3DG3 A;  5BUL A;  4JY2 A;  4DSG A;  3K7T A;  4EQS A;  4ZCC A;  5JCL A;  2OPJ A;  3CNT A;  1JNZ A;  4U8M A;  2C70 A;  5EB4 A;  1F8S A;  5BUK A;  1FHV A;  3NT6 A;  3BI5 A;  1IUW A;  1PBC A;  1BZL A;  3AYJ A;  1UKV G;  4TM0 A;  2CDU A;  3IJQ A;  4U8P A;  1FIQ B;  1V97 A;  4J1O A;  3OZY A;  4EMJ A;  1IJH A;  4U8N A;  3SGL A;  1W4X A;  4M52 A;  5G5G B;  2YG7 A;  3AXB A;  1NEK A;  3DIP A;  3R11 A;  1RYI A;  3JVA A;  3DME A;  1E1L A;  2BYB A;  4NTC A;  4D04 A;  4GYP A;  3UGV A;  5IQ4 A;  2W55 A;  2GGH A;  3ABV A;  3BHK A;  3SXI A;  1N4V A;  1N5W C;  1JU2 A;  2WS3 A;  2PS2 A;  4IP4 A;  4HB9 A;  2JK6 A;  3L1R A;  3TJI A;  1PHH A;  3DK4 A;  3DDM A;  3IJL A;  3NVV B;  2FJA A;  1K0J A;  2YVJ A;  4YSZ A;  4NNJ A;  3KA7 A;  2ZC8 A;  1FEC A;  4Z25 A;  4H4Q A;  2YVF A;  3DFH A;  2IVE A;  5JCN A;  4G9K A;  2C76 A;  2E1M A;  4JN8 A;  2XFN A;  2VOU A;  1LJ1 A;  2EQ6 A;  3UJE A;  1PXA A;  3G5R A;  2V6O A;  4J3Z A;  4ZCD A;  2GR0 A;  3CB3 A;  3K7M X;  4HNL A;  4G6H A;  4AOX A;  3MQT A;  4B64 A;  2YG4 A;  3S47 A;  1O95 A;  3GDN A;  2Q7V A;  1B37 A;  3IJI A;  1NG3 A;  1REO A;  1KKO A;  2YLS A;  2C73 A;  2ZAD A;  4TLZ A;  3AE6 A;  5KXJ A;  3D9X A;  3SM8 A;  3P4R A;  3ITJ A;  3ADA B;  4DSH A;  3Q4D A;  3KLJ A;  2H89 A;  2FKP A;  3NRZ B;  2EQ9 A;  5FJP A;  2ONE A;  2OAL A;  3CPJ G;  3QVP A;  5FJO A;  3COX A;  3TWA A;  1ONE A;  3TW9 A;  1DXL A;  3IHG A;  2A87 A;  2VQ7 A;  3JW7 A;  2R4E A;  1TYP A;  1JOA A;  2QA1 A;  4Z24 A;  3CXO A;  3T37 A;  3AMZ A;  3UJ2 A;  3EF6 A;  3NO1 A;  4YSX A;  4U8J A;  3T9P A;  3NK2 X;  4ZOH B;  1QO8 A;  2XFQ A;  4EM3 A;  4Z17 A;  2GRT A;  3SJN A;  1R6W A;  3CN8 A;  4LA1 A;  1GV4 A;  3DK9 A;  3KPK A;  5TR3 A;  3FMW A;  3AEC A;  3T2K A;  2V61 A;  4NTD A;  4C74 A;  2MNR A;  4XWZ A;  5KMQ A;  2XH0 A;  1D7L A;  3NVW B;  1XPY A;  1NPX A;  4AT0 A;  1DTN A;  4A5L A;  5M10 A;  1H83 A;  3PG6 A;  1STZ A;  1MDR A;  3V3N A;  1F8R A;  1VQZ A;  1E1N A;  3GMC A;  2H88 A;  4FK1 C;  4B63 A;  5KMR A;  4KT2 A;  2PYX A;  2JAE A;  2W3S A;  2YQU A;  4K5R A;  3IF9 A;  4NTE A;  3CYJ A;  1KD0 A;  3NKS A;  2GGJ A;  2GGI A;  4B68 A;  3ZLG A;  3NNE A;  1GER A;  1MDL A;  3ZLH A;  3OTR A;  1YKJ A;  2BXR A;  2NVK X;  2NPX A;  3NK0 X;  3AE9 A;  4Y4M A;  1H84 A;  4XWR A;  2APG A;  3DA1 A;  1WUE A;  1P2H A;  4BJY A;  2GR2 A;  3PO7 A;  4M0X A;  3NN0 X;  3GY1 A;  1H7W A;  4JQ9 A;  1ZOV A;  3N6H A;  1DOC A;  1Y56 A;  2VVL G;  4ECH A;  2PA6 A;  1B8S A;  1EL8 A;  1DOE A;  1XDI A;  2PTY A;  1GRA A;  3KD9 A;  3CGB A;  3VFC A;  1JEH A;  3UJF A;  3ICR A;  4RSL A;  4YTP A;  1VG0 A;  3RRA A;  1TDO A;  3AWI A;  4WCT A;  2R4J A;  4E5T A;  4IL2 A;  1KFY A;  4U8K A;  1T3Q C;  4PAB A;  2BS4 A;  4A6N A;  3UJS A;  3I6E A;  1N4U A;  1OJT A;  5HXI A;  3I6D A;  4FX9 A;  4RG4 A;  5KOW A;  1BGN A;  1KKR A;  3MKC A;  4H4U A;  5EBK A;  2V5Z A;  2RDX A;  4CCR A;  3Q6J A;  4B1B A;  1X31 B;  3H8A A;  4BUR A;  1KDG A;  4TVW A;  4EIQ A;  4ZA0 A;  4UDQ A;  3UOV A;  2TMD A;  1R0M A;  4Z2U A;  3L8K A;  1GAL A;  2BK3 A;  4HPN A;  2OQY A;  4CY6 A;  1DJN A;  1RVK A;  1JRX A;  5L46 A;  5JCI A;  4A7A A;  2WU5 A;  1KF6 A;  3EAO A;  1NHR A;  4J57 A;  3CAW A;  3AYL A;  2XYO A;  4MGG A;  2BRA A;  4G73 A;  4B67 A;  3DJD A;  3JSK A;  3UKA A;  1ZDL A;  4Z44 A;  4OPL A;  2E4G A;  4Z2R A;  4GYP C;  2O56 A;  2QA2 A;  2P3Z A;  2GB0 A;  3QSS A;  4YWS A;  2PTX A;  3GC2 A;  1CBO A;  1ELI A;  2XFP A;  3IWA A;  4YWO A;  5DBJ A;  3I4K A;  4HYR A;  1O94 A;  1GRH A;  5J60 A;  4RG3 A;  2R0P A;  2JBV A;  3F8D A;  2W0H A;  4CCQ A;  4TM4 A;  1NEL A;  3CGE A;  4GDP A;  3SBF A;  4J31 A;  4C5O A;  2YLX A;  3FBS A;  3HPF A;  4FK1 A;  4J36 A;  3ES8 A;  3SN4 A;  3MZN A;  3BOX A;  1S3E A;  4II3 A;  3UJR A;  3VC5 A;  2FJD A;  3P4S A;  1L0V A;  2IID A;  2OLA A;  5HHF A;  1FCD A;  4E6M A;  4FP1 A;  2OAM A;  1GRT A;  1JDF A;  2YR6 A;  5C2T A;  1KCZ A;  3CNS A;  1PDH A;  3VCC A;  1EL9 A;  3PWG A;  5KRQ A;  2B7S A;  3ICS A;  5G5H B;  3VR8 A;  1ZX9 A;  4DYE A;  2WDV A;  2ARD A;  4H2P A;  4JN9 A;  1N4W A;  1PN0 A;  1TDE A;  1S7M A;  2BK5 A;  4A99 A;  1LQU A;  3ZLF A;  3UXK A;  3RNM A;  2OQH A;  3B6D A;  4FDC B;  3V4B A;  3SY4 A;  3QJ4 A;  3HYW A;  2B9X A;  1P43 A;  2QJN A;  3HRD C;  2WDR A;  4ADW A;  1NEN A;  1BQG A;  4C77 A;  4OVI A;  5EOW A;  4DHG A;  4HCL A;  4EIP A;  2XCG A;  1CJ2 A;  4DNA A;  3M13 A;  3O0H A;  3DG7 A;  1BKW A;  3EAN A;  4TM1 A;  3UP4 A;  3JZU A;  3QPE A;  3R9U A;  2GEW A;  4U8L A;  2BK4 A;  2XGZ A;  4DX3 A;  4GRT A;  3B9J B;  1K0L A;  3BSM A;  5BOE A;  1L8P A;  3DFY A;  1VDC A;  2UZZ A;  2AAQ A;  2GAH B;  4B65 A;  4K2S A;  2Q0K A;  4K8G A;  2I0Z A;  5EB5 A;  3R0K A;  2GDQ A;  1OJD A;  2OA1 A;  7ENL A;  2WPC A;  3TWB A;  2DKH A;  3PVC A;  3DER A;  4REK A;  3VCN A;  1NHP A;  3QSE A;  1NAA A;  4HN8 A;  4YKG A;  1MO9 A;  1GEU A;  2F5Z A;  5BOF A;  2A8X A;  2TPR A;  2RGJ A;  3VR9 A;  5FS8 A;  3B97 A;  1GRG A;  3PWI A;  1GES A;  3UKQ A;  4E8G A;  4H4W A;  2XFU A;  2C3D A;  4TM3 A;  4CNJ A;  4JN7 A;  4DN1 A;  2PU1 A;  4XXG A;  4C3Y A;  2GVC A;  2GH5 A;  2DW7 A;  3UCC A;  3TOY A;  4NEV A;  2WOV A;  3IC9 A;  1IUU A;  2BA9 A;  3UKK A;  2PCE A;  2C64 A;  4UDP A;  3H7V A;  1EC7 A;  2B76 A;  3UTH A;  2RGH A;  3KPF A;  4H4Y A;  5FJR A;  3NN6 X;  2GGG A;  2PTW A;  2XVI A;  2ACZ A;  4HCH A;  3NYF A;  4J34 A;  2XVJ A;  4USR A;  2XH4 A;  3SN1 A;  1DOB A;  3BJS A;  1N62 C;  1PJ7 A;  3H12 A;  2V60 A;  4H2R A;  5HYM A;  2P8C A;  4A9W A;  4GUV A;  3UTG A;  1MRA A;  1MXT A;  2PHH A;  1FFU C;  2R45 A;  4X2P A;  2GSH A;  1H82 A;  3GO2 A;  2WPE A;  3NFU A;  1V59 A;  4H2H A;  1XHC A;  4OPC A;  4H4R A;  4N9X A;  3QN3 A;  1MOK A;  3GMB A;  3DH9 A;  2QDD A;  2B9Y A;  1QJD A;  1Y56 B;  3TQP A;  3AE3 A;  2WES A;  2CUL A;  3P4P A;  3UCL A;  2XLR A;  4H4Z A;  1LV0 A;  2PMQ A;  2C4C A;  1JPM A;  4A65 A;  1P48 A;  4H83 A;  3BI4 A;  4J2W A;  1FO4 A;  3SFD A;  1ZY8 A;  1QLB A;  4IA6 A;  4JY3 A;  4EQR A;  1JPD X;  3FIM B;  1O5W A;  4DGK A;  2X8G A;  2AKZ A;  2O9Z A;  3BHF A;  2A89 A;  3GSI A;  4A6N B;  3OP2 A;  1ECQ A;  1OJC A;  2AR8 A;  1E1K A;  4KPL A;  2GAG B;  3ALM A;  3UXL A;  1L9D A;  2GQW A;  2WU2 A;  4JNQ A;  2QGY A;  1TRB A;  2PP0 A;  3NYC A;  3GDP A;  3NVY B;  3DEQ A;  3EPT A;  1WYG A;  2FBW A;  1D4C A;  2VQB A;  2VVM A;  4B66 A;  2GQF A;  1E39 A;  1BWC A;  3RP7 A;  3F8P A;  1TYT A;  3R1Z A;  1OEP A;  2X8C A;  2GGE A;  3SSZ A;  1PBE A;  1JRY A;  4OPG A;  3V3W A;  4M6U A;  2WP5 A;  1EC9 A;  3LZW A;  4G8T A;  3SN0 A;  1MNS A;  3ISH A;  2Z5X A;  1M64 A;  2HXU A;  4OPT A;  4K22 A;  1LTX R;  1Q1R A;  3NVZ B;  3AEA A;  1AOG A;  4H4T A;  1NG4 A;  2OVL A;  5FJT A;  3ZVI A;  4B69 A;  3ZVH A;  2XSX A;  3AEG A;  3VA8 A;  3CPI G;  3MWC A;  1IUS A;  4A6G A;  1H6V A;  3P0W A;  1N60 C;  1L9C A;  2WP6 A;  3N6J A;  5KMP A;  4HNC A;  3TJ4 A;  1ZKQ A;  3T6C A;  3PFR A;  3R0U A;  4DXK A;  5FJU A;  2JB3 A;  3KKJ A;  4GF7 A;  2W3R A;  5U63 A;  2EQ7 A;  2PGE A;  3QFA A;  5KWF A;  2BCG G;  1FEB A;  4H7U A;  2FYM A;  4YTM A;  3NTD A;  2P8B A;  3HYV A;  3OC4 A;  1EL7 A;  3STP A;  5M0Z A;  4ZCW A;  2P88 A;  2OLN A;  3NHO X;  2R9Z A;  4BV6 A;  1YEY A;  2AL2 B;  4MJW A;  3F8R A;  1COY A;  3HYX A;  2V3B A;  3G5S A;  4IVM B;  4OPU A;  3RIT A;  2OZ3 A;  3AM9 A;  3FJ4 A;  1TE6 A;  3B3R A;  1VRQ B;  1GTE A;  2OZT A;  2C7G A;  3AE8 A;  4AOS A;  3AD8 B;  3P93 A;  4ICY A;  4KEM A;  2HZG A;  1XAN A;  3FVD A;  4GGB A;  1B5Q A;  1BGJ A;  5C3J A;  3T8Q A;  2QAE A;  2JKC A;  4MMW A;  4C3X A;  4KWS A;  1KNP A;  3SZF A;  4GDE A;  3PK7 A;  1PBB A;  2RGO A;  2WET A;  4J33 A;  5IQ1 A;  2GV8 A;  4D03 A;  4DWD A;  1D4D A;  2XDO A;  2AKM A;  1JRP A;  4EMI A;  5IDZ A;  3LAD A;  6ENL A;  1GSN A;  3K30 A;  4GGH A;  2V3A A;  1L9E A;  3NZG A;  1H81 A;  3WE0 A;  5EU9 A;  3R10 A;  2C72 A;  1E1M A;  4CY8 A;  2XVH A;  3NG7 X;  3DJJ A;  3UKP A;  2J3N A;  3EEZ A;  1CC4 A;  2GR3 A;  1PJ5 A;  3NGC X;  3RP6 A;  4O5Q A;  3P4Q A;  1D4E A;  3Q45 A;  1FFV C;  5LV9 A;  1W6T A;  2GMH A;  1SJD A;  2BS2 A;  3UKF A;  2BRY A;  2JB1 A;  3CXB A;  4GFI A;  3V5F A;  4HA6 A;  1EC8 A;  1ZMC A;  4CNK A;  1CC2 A;  4JDR A;  1GRE A;  4OPI A;  2YLR A;  3P1W A;  2HNE A;  3CIR A;  2WPF A;  3RED A;  3IK4 A;  4TLX A;  3CGC A;  3NS1 B;  1GTH A;  4GME A;  2XLS A;  3RO6 A;  1EBH A;  2QQ6 A;  3SZ0 A;  2GMJ A;  4E4F A;  4J56 A;  4A3R A;  5KVI A;  4BK1 A;  3CPH G;  3FV9 A;  5FS6 A;  4UDR A;  4U2S A;  2AL2 A;  2WQY A;  3H8I A;  1ELS A;  4X4J A;  4JNA A;  3UOZ A;  2XVF A;  4PAA A;  3NIX A;  4YSH A;  3AEB A;  1GRF A;  1KN0 A;  1P2E A;  4U2T A;  2FJE A;  2WHD A;  2AQJ A;  2VVL A;  3FCP A;  2GL5 A;  5HY5 A;  3T0K A;  2BC1 A;  1CL0 A;  3K7Q X;  2YM1 A;  3TTE A;  3AE1 A;  2JB2 A;  2E5A A;  1Y0P A;  1CC6 A;  1BF3 A;  2QDE A;  3QTP A;  1NHQ A;  4E0V A;  3GD4 A;  1NHS A;  2DKI A;  3I3L A;  4IA5 A;  4ENL A;  3OW1 A;  5ER0 A;  1XPQ A;  2WP9 A;  4NZH A;  4AT2 A;  3E1T A;  2XVE A;  3OZ2 A;  1CHU A;  1GND A;  1KSU A;  1PDZ A;  3VRD B;  2GR1 A;  3ALL A;  4U2L A;  5FS9 A;  2C3C A;  3VDG A;  3VC6 A;  1LVL A;  4IV9 A;  1NDA A;  2Q0L A;  4ZN0 A;  3DGB A;  1MUC A;  4CBQ A;  3BNM A;  3S5S A;  2VRL A;  1BKH A;  4GCM A;  3UTE A;  3GWD A;  3ETR B;  3GRT A;  1VQW A;  3SYI A;  4GIS A;  1ONF A;  3RP8 A;  3NXL A;  3QFB A;  3UKH A;  5ENL A;  2OKT A;  1VG9 A;  1JNR A;  3FXG A;  2Y6Q A;  2B7R A;  1F9C A;  1FHU A;  3BNU A;  1N61 C;  1LPF A;  4YKF A;  3DJE A;  4EQW A;  1IUT A;  4IVO B;  3UKL A;  3GYI A;  1KSS A;  3AEF A;  4KX6 A;  3AE4 A;  3K1G A;  3CT2 A;  5BRT A;  1B4V A;  4APN A;  1PXC A;  4H2Q A;  4HCD A;  1Q9I A;  4EWJ A;  2YVG A;  2QVH A;  4CRT A;  1YY5 A;  3IHM A;  3U4F A;  2Z5Y A;  5U25 A;  1RSG A;  4II2 A;  1FL2 A;  2C67 A;  4FI4 A;  3OZM A;  5J7X A;  3D8X A;  1PXB A;  4H4X A;  3S61 A; 
#chains in the Genus database with same CATH homology
 4K8D A;  3NTA A;  4Z43 A;  3FG2 P;  2WP5 A;  2BXS A;  2Q6U A;  4UDQ A;  3UOV A;  4KPR A;  2TMD A;  3NK1 X;  3L5O A;  3RHA A;  3LXD A;  3LZW A;  4Z2U A;  3L8K A;  1GAL A;  1OJA A;  2BK3 A;  4CY6 A;  1PJ6 A;  1DJN A;  5U1O A;  1JRX A;  5L46 A;  1E6E A;  4G6G A;  1ZK7 A;  2XFO A;  4K2X A;  3NH3 X;  3ISH A;  5JCI A;  3AE7 A;  1YQ4 A;  4A7A A;  2WU5 A;  2X50 A;  4EM4 A;  2Z5X A;  1KF6 A;  3ZYX A;  1M64 A;  2WOW A;  2VZ2 A;  3T2Z A;  4OPT A;  3KU9 A;  3KVE A;  3EAO A;  4K22 A;  4YXD A;  3II4 A;  1LTX R;  1Q1R A;  3GD3 A;  1GRB A;  1NHR A;  1SEZ A;  3AB1 A;  4J57 A;  1AOG A;  4H4T A;  1NG4 A;  3AEA A;  2BS3 A;  1FEA A;  3AYL A;  4OPD A;  2XYO A;  1CJ4 A;  4B69 A;  3AEG A;  2BRA A;  3CPI G;  1HYU A;  1E7P A;  2ZZ0 A;  2CFY A;  1IUS A;  4G73 A;  4B67 A;  1H7X A;  3DJD A;  3JSK A;  1H6V A;  3UKA A;  1ZDL A;  4Z44 A;  4OPL A;  2WEU A;  1L9C A;  2IVD A;  3URH A;  2E4G A;  2WP6 A;  2BCP A;  4Z2R A;  3VQR A;  5KMP A;  3C4A A;  2XLT A;  1ZKQ A;  3AYI A;  3FPZ A;  2FJB A;  2QA2 A;  2GB0 A;  3AE5 A;  3QSS A;  2WDQ A;  5BUL A;  4JY2 A;  2CVJ A;  2JB3 A;  1CBO A;  3K7T A;  2YG3 A;  4EQS A;  3KKJ A;  1ELI A;  4DSG A;  4GF7 A;  4ZCC A;  2XFP A;  3IWA A;  3H8L A;  2EQ7 A;  5JCL A;  5U63 A;  4YWO A;  3CNT A;  5DBJ A;  1JNZ A;  4BK2 A;  4U8M A;  1TDK A;  2C70 A;  2YG5 A;  5EB4 A;  5GSN A;  3QFA A;  1F8S A;  5BUK A;  5KWF A;  2BCG G;  1FEB A;  3NT6 A;  4H7U A;  3BI5 A;  1IUW A;  1O94 A;  1PBC A;  1BZL A;  1GRH A;  4YTM A;  3AYJ A;  3NTD A;  1N1P A;  5J60 A;  4RG3 A;  1UKV G;  3AE2 A;  4EQX A;  1F6M A;  2R0P A;  2JBV A;  3HYV A;  4TM0 A;  3F8D A;  3PS9 A;  2CDU A;  1PS9 A;  3T14 A;  3V76 A;  2W0H A;  1EBD A;  4CCQ A;  4LU6 A;  4TM4 A;  5FMH A;  3OC4 A;  3CGE A;  1EL7 A;  2GF3 A;  1Q1W A;  4GDP A;  1ZMD A;  4H50 A;  4J31 A;  4U8P A;  4WX1 A;  5M0Z A;  2YLX A;  4C5O A;  3FBS A;  1D7Y A;  2OLN A;  4FK1 A;  4J36 A;  4EMJ A;  1IJH A;  3NHO X;  2R9Z A;  3P9U A;  4BV6 A;  4U8N A;  3SGL A;  4NWZ A;  1S3E A;  4II3 A;  4MJW A;  3F8R A;  1COY A;  3M12 A;  1W4X A;  4M52 A;  1Z6L A;  3SQP A;  1CJ3 A;  2YG7 A;  2FJD A;  3AXB A;  1GET A;  1NEK A;  2V3B A;  3HYX A;  3P4S A;  2R46 A;  3G5S A;  4IVM B;  1L0V A;  2YAU A;  2IID A;  5HHF A;  4Z26 A;  4OPU A;  1FCD A;  1RYI A;  3GRS A;  4H2N A;  3LB8 A;  2OAM A;  1GRT A;  2X3N A;  3H4K A;  2YR6 A;  5C2T A;  2VRM A;  3CNS A;  3B3R A;  1S3B A;  3DME A;  1E1L A;  1PDH A;  1VRQ B;  2BYB A;  4NEW A;  2XLP A;  4A79 A;  1EL9 A;  5KRQ A;  3AD7 B;  4NTC A;  4D04 A;  1CF3 A;  2B7S A;  3VRB A;  3ICS A;  3VR8 A;  1ZX9 A;  1GTE A;  1GPE A;  5IQ4 A;  3VRA A;  1TDN A;  2C7G A;  2WDV A;  2RAB A;  2ARD A;  3AE8 A;  3AD8 B;  3ABV A;  1N4W A;  3BHK A;  4H2P A;  4JN9 A;  3SXI A;  1PN0 A;  4ICY A;  1TDE A;  1S7M A;  1N4V A;  2BK5 A;  4A99 A;  1LQU A;  3NLC A;  1XAN A;  1B5Q A;  1JU2 A;  2WS3 A;  1BGJ A;  4O5U A;  5C3J A;  2QAE A;  2JKC A;  3RNM A;  3CGD A;  3GWF A;  4HB9 A;  2JK6 A;  5JRB A;  1KNR A;  3L1R A;  4C3X A;  3B6D A;  3ATR A;  1PHH A;  3DK4 A;  4FDC B;  3LOV A;  1D5T A;  1CJC A;  1K0J A;  2FJA A;  2YVJ A;  3SY4 A;  3NYE A;  4Y4N A;  4YSZ A;  1KNP A;  4NNJ A;  3KA7 A;  3SZF A;  3QJ4 A;  4GDE A;  3HYW A;  1PBB A;  2RGO A;  1FEC A;  2WET A;  4J33 A;  4Z25 A;  2B9X A;  3C4N A;  4H4Q A;  5IQ1 A;  2YVF A;  2GV8 A;  4I58 A;  4D03 A;  2WDR A;  4ADW A;  1D4D A;  1NEN A;  1FOH A;  2IVE A;  2XDO A;  3ALJ A;  3GYJ A;  3M0O A;  4OVI A;  3T2Y A;  4C77 A;  4EMI A;  5JCN A;  4G9K A;  2C76 A;  5EOW A;  5GRT A;  4AOS A;  3LAD A;  1TDF A;  1GSN A;  2E1M A;  3K30 A;  3SX6 A;  4EIP A;  2XCG A;  1CJ2 A;  2XFN A;  2R0C A;  2VOU A;  1LJ1 A;  4BK3 A;  4DNA A;  3M13 A;  2V3A A;  2ZBW A;  4GR1 A;  2B9W A;  3O0H A;  1L9E A;  3QSM A;  2EQ6 A;  1BKW A;  3EAN A;  4TM1 A;  1H81 A;  1PXA A;  3G5R A;  3WE0 A;  2V6O A;  3UP4 A;  2C72 A;  1E1M A;  4ZCD A;  2GR0 A;  4YT0 A;  4CY8 A;  5CQF A;  2YR4 A;  3K7M X;  2XVH A;  2GEW A;  3NG7 X;  3DJJ A;  2BK4 A;  4U8L A;  1IUV A;  3R9U A;  4G6H A;  4AOX A;  4B64 A;  3UKP A;  2J3N A;  3D1C A;  1CC4 A;  5BVA A;  2YG4 A;  2YR5 A;  4GRT A;  1H2I A;  2GR3 A;  1O95 A;  1PJ5 A;  1K0L A;  3CMM A;  3G5Q A;  3GDN A;  3NGC X;  3RP6 A;  4O5Q A;  4P9S A;  2Q7V A;  3P4Q A;  1B37 A;  5KOX A;  1D4E A;  5CKU A;  1NG3 A;  1REO A;  3T31 A;  1VDC A;  5LV9 A;  2UZZ A;  2GMH A;  2YLS A;  2C73 A;  4TLZ A;  3AE6 A;  5KXJ A;  4USQ A;  2AAQ A;  3D9X A;  2GAH B;  3SM8 A;  4B65 A;  2BS2 A;  2Q0K A;  3ITJ A;  3P4R A;  2ZZC A;  2BRY A;  2JB1 A;  3UKF A;  3QVR A;  2I0Z A;  1OJ9 A;  3DGH A;  5EB5 A;  4LII A;  3ADA B;  3HZL A;  1OJD A;  4DSH A;  3KLJ A;  2H89 A;  2OA1 A;  3NRN A;  4HA6 A;  3CND A;  1ZMC A;  4CNK A;  1CC2 A;  2WPC A;  4JDR A;  3BI2 A;  2DKH A;  1GRE A;  4OPI A;  2EQ9 A;  1H86 A;  4H4S A;  2YG6 A;  2YLR A;  3P1W A;  3CIR A;  3PVC A;  2OAL A;  3CPJ G;  4REK A;  2WPF A;  3RED A;  1NHP A;  3QVP A;  3QSE A;  3COX A;  1NAA A;  4TLX A;  4AP3 A;  4YKG A;  3CGC A;  1DXL A;  1MO9 A;  1EL5 A;  1GTH A;  2A87 A;  2VQ7 A;  3IHG A;  2YLT A;  3S5W A;  1GEU A;  5KNL A;  2XLS A;  1GXF A;  3SZ0 A;  2F5Z A;  2R4E A;  2GMJ A;  1TYP A;  1JOA A;  4J56 A;  2A8X A;  2TPR A;  2QA1 A;  2RGJ A;  5KVI A;  4Y4L A;  3VR9 A;  5FS7 A;  4Z24 A;  5FS8 A;  3AED A;  4BK1 A;  3Q9T A;  3T37 A;  1GRG A;  1GES A;  3EF6 A;  2OLO A;  3UKQ A;  4H4W A;  3CPH G;  2YM2 A;  5FS6 A;  4YSX A;  4UDR A;  2XFU A;  4U8J A;  4U2S A;  5KMS A;  2C3D A;  3NK2 X;  4TM3 A;  4UP3 A;  4CNJ A;  1QO8 A;  3AEE A;  2WQY A;  2X8H A;  2XFQ A;  3H8I A;  4EM3 A;  4X4J A;  4XXG A;  4C3Y A;  4JNA A;  3UOZ A;  2GRT A;  2XVF A;  4PAA A;  2GVC A;  2GH5 A;  3CN8 A;  4BJZ A;  3NIX A;  1F8W A;  2HQM A;  4LA1 A;  4YSH A;  5JCM A;  1GRF A;  4NEV A;  1GV4 A;  1KN0 A;  2WOV A;  3IC9 A;  1P2E A;  3AEB A;  1IUU A;  1S2Q A;  2YWL A;  2BA9 A;  3UKK A;  3UOY A;  2BC0 A;  2C64 A;  4UDP A;  4U2T A;  3DK9 A;  2FJE A;  1DJQ A;  3KPK A;  5TR3 A;  2WHD A;  3FMW A;  2AQJ A;  3AEC A;  2B76 A;  3T2K A;  1YQZ A;  1RP0 A;  3UTH A;  2RGH A;  2V61 A;  2VVL A;  3KPF A;  2R0G A;  4H4Y A;  5HY5 A;  4NTD A;  3NN6 X;  4I59 A;  4C74 A;  1IUX A;  4XWZ A;  5KMQ A;  3T0K A;  2BC1 A;  1CL0 A;  1PBF A;  3K7Q X;  2XVI A;  3ATQ A;  2ACZ A;  4J34 A;  1D7L A;  2C65 A;  3NYF A;  2YM1 A;  2X99 A;  3AE1 A;  2JB2 A;  2XVJ A;  1NPX A;  1JRZ A;  1Y0P A;  1CC6 A;  1BF3 A;  4USR A;  4AT0 A;  1DOB A;  1NHQ A;  2ZZB A;  4GAP A;  4U8O A;  4A5L A;  4E0V A;  5M10 A;  1PJ7 A;  3GD4 A;  1NHS A;  1H83 A;  3PG6 A;  2DKI A;  3I3L A;  2V60 A;  4H2R A;  4GAV A;  5HYM A;  3V3N A;  1F8R A;  4IA5 A;  4A9W A;  1E1N A;  3ICT A;  1ZP0 A;  4GUV A;  1LQT A;  3GMC A;  3UTG A;  1MXT A;  2PHH A;  5ER0 A;  2H88 A;  3CTY A;  2R45 A;  4G74 A;  4FK1 C;  4B63 A;  1XPQ A;  2WP9 A;  5KMR A;  4NZH A;  4OCG A;  4AT2 A;  3E1T A;  2XVE A;  3OZ2 A;  3V3O A;  2PYX A;  1H82 A;  5KVH A;  5JCK A;  1CHU A;  2WPE A;  3UOX A;  2JAE A;  3SZW A;  1GT8 A;  4K5R A;  2YQU A;  1GND A;  1DOD A;  3IF9 A;  4NTE A;  2WBA A;  3NKS A;  1KSU A;  3LZX A;  4B68 A;  1V59 A;  3VRD B;  3NNE A;  1XHC A;  2GR1 A;  4OPC A;  3ALL A;  1GER A;  4H4R A;  4N9X A;  4U2L A;  1MOK A;  3DK8 A;  1YKJ A;  3GMB A;  5FS9 A;  2C3C A;  2C75 A;  2BXR A;  2Y6R A;  3ZDN A;  1LVL A;  2NVK X;  2NPX A;  3DH9 A;  3NK0 X;  3LJP A;  3AE9 A;  4Y4M A;  2B9Y A;  4IV9 A;  1NDA A;  1QJD A;  2Q0L A;  1Y56 B;  3CNJ A;  4ZN0 A;  1H84 A;  4YSY A;  4XWR A;  2APG A;  3BNM A;  3AE3 A;  3DA1 A;  4CBQ A;  4GCM A;  2VRL A;  3UTE A;  2WES A;  2CUL A;  3P4P A;  3UCL A;  3GWD A;  2XLR A;  1P2H A;  1ZOY A;  4EMW A;  2GR2 A;  4BJY A;  3PO7 A;  4H4Z A;  1LV0 A;  3NN0 X;  3GRT A;  1VQW A;  3SYI A;  2C4C A;  1H7W A;  4A65 A;  4JQ9 A;  1ZOV A;  1ONF A;  3DJG X;  3RP8 A;  3BI4 A;  4J2W A;  1DOC A;  3SFD A;  1ZY8 A;  1QLB A;  3QFB A;  1Y56 A;  4IA6 A;  4JY3 A;  1F3P A;  2VVL G;  4ECH A;  1B8S A;  4EQR A;  3UKH A;  1EL8 A;  1DOE A;  1XDI A;  3FIM B;  4AP1 A;  1O5W A;  1VG9 A;  4DGK A;  1JNR A;  1GRA A;  2X8G A;  2Y6Q A;  3KD9 A;  2O9Z A;  3CGB A;  2B7R A;  1JEH A;  3BHF A;  2A89 A;  3GSI A;  4A6N B;  3ICR A;  3BNU A;  1S2Y A;  4K5S A;  4RSL A;  1YQ3 A;  1OJC A;  3SFE A;  2AR8 A;  1K4Q A;  2C66 A;  4YTP A;  1E1K A;  1LPF A;  3AD9 B;  1VG0 A;  2XLU A;  4YKF A;  3DJE A;  1TDO A;  3AWI A;  1DNC A;  4WCT A;  4EQW A;  1GOS A;  2R4J A;  2YLW A;  2GAG B;  1IUT A;  1KFY A;  3ALM A;  4U8K A;  4IVO B;  4PAB A;  3UKL A;  2BAB A;  5IPY A;  3GYI A;  1KSS A;  1M6I A;  2BS4 A;  4U8I A;  3AEF A;  4A6N A;  1L9D A;  2GQW A;  4KX6 A;  3AE4 A;  2WU2 A;  2QCU A;  2WOI A;  5BRT A;  2E5V A;  4H4P A;  3C96 A;  4JNQ A;  1B4V A;  1TRB A;  1N4U A;  4APN A;  3NYC A;  3GDP A;  3SZC A;  1OJT A;  3UTF A;  1PXC A;  3EPT A;  2FBW A;  5HXI A;  3I6D A;  1Q9I A;  4H2Q A;  3DGZ A;  4FX9 A;  4RG4 A;  4X9N A;  5KOW A;  1BGN A;  4Z2T A;  2EQ8 A;  2YVG A;  4H4V A;  1D4C A;  2VQB A;  1YY5 A;  2BAC A;  2VVM A;  3UP5 A;  4H4U A;  4CRT A;  3IHM A;  5EBK A;  4X9M A;  2Z5Y A;  5U25 A;  4B66 A;  1RSG A;  2GQF A;  2V5Z A;  4YTN A;  1K0I A;  1E39 A;  4II2 A;  4CCR A;  1FL2 A;  2C67 A;  1BWC A;  3Q6J A;  3CNP A;  2YLZ A;  3RP7 A;  3F8P A;  4B1B A;  1X31 B;  4BUR A;  1TYT A;  1KDG A;  2X8C A;  4K7Z A;  5J7X A;  3D8X A;  1PBE A;  1PXB A;  4H4X A;  3GYX A;  3S61 A;  1JRY A;  4OPG A;  4EIQ A;  1PBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...