1NHRA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
447
structure length
447
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFCSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 141
structure length 447
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhrA02
2YLXA 2C3CA 3BI5A 3I6DA 4A6NA 1ZMDA 4Y4MA 3UKLA 4EIPA 1VG9A 2TMDA 4TM4A 3UKPA 1H86A 3NLCA 2C72A 4RG4A 1K4QA 5EBKA 2DKHA 3KD9A 4EMIA 1EL7A 1B4VA 2YLZA 3BHKA 2H88A 3BNMA 1GRHA 1E39A 2AQJA 1CC4A 4A65A 4EQXA 3LXDA 1Y0PA 1L9CA 3GDNA 4U8LA 1W4XA 4X4JA 5BULA 1M64A 2BS4A 4ZCCA 2XVJA 2GEWA 4IV9A 1H83A 2FBWA 5KVIA 1YY5A 1TYTA 1TDEA 1IUXA 2FJEA 2YG4A 4PABA 5HHFA 3ISHA 3QFBA 2JB3A 3NHOX 4H4PA 1XHCA 3AXBA 1IUTA 1S3EA 3CN8A 3G5QA 4IVMB 3K7MX 2B9WA 4AT2A 4YSXA 1E1LA 4U8NA 1COYA 3O0HA 2GVCA 5CKUA 2X8HA 2WPFA 3EF6A 4O5UA 1NENA 1L9EA 2EQ9A 2V61A 2B9YA 3IF9A 1EL5A 1DNCA 2Z5XA 3P4RA 3DA1A 2Q0LA 3PO7A 4Z43A 1NEKA 3GWDA 1E1KA 1GTHA 2R4JA 3LADA 2WOWA 4NEWA 3GMBA 1DJNA 4OCGA 4N9XA 1FEBA 3CNTA 4H2QA 1RSGA 2R0GA 2BCGG 1KSSA 3NNEA 4IA6A 5KWFA 4XXGA 1PBBA 1D4CA 4J36A 2DKIA 3KVEA 1QO8A 4PAAA 4TM1A 1CF3A 4YT0A 2WP9A 2GRTA 3CGCA 2IIDA 3P1WA 2XFUA 2OALA 1GERA 1ZY8A 2Z5YA 3BI4A 2WPEA 5L46A 1NHSA 2ACZA 2OLOA 3AEGA 1LPFA 3C4AA 3CPHG 3GWFA 2WDVA 5GSNA 1DJQA 3FPZA 1MO9A 3GMCA 2WP5A 2GR0A 1BGJA 2O9ZA 1VRQB 4TM3A 4YTPA 4X9MA 4CNJA 4FX9A 4H4TA 1B37A 4GDEA 3AYJA 3ALLA 4IVOB 4RSLA 4WX1A 4A99A 2VVMA 3K7TA 3DJJA 3G5RA 3URHA 1KF6A 4C3YA 1M6IA 3GSIA 4H4UA 2WU2A 4UP3A 2JB2A 4LIIA 4EM4A 1RYIA 3NK1X 2X3NA 4DNAA 2E5VA 3NG7X 3AB1A 3V3NA 2XDOA 1ZX9A 1KDGA 3AD8B 4NTCA 3AE8A 2FJBA 4JNAA 4USQA 1CBOA 1RP0A 4TLZA 3UKHA 1XANA 2GR2A 1GRTA 4TLXA 3ZYXA 5KXJA 1UKVG 5FMHA 3M12A 1H6VA 2EQ8A 1NG4A 5U1OA 1OJTA 2JB1A 3AWIA 1IUUA 1NHPA 3UTFA 3VRDB 1NHQA 4WCTA 2QAEA 2XVFA 1QJDA 3CPIG 4BK2A 3AE4A 4FK1C 4B67A 1YKJA 2B7RA 5BRTA 1PS9A 4H4RA 2WEUA 1O94A 3OZ2A 4TM0A 5M10A 2YVFA 3KLJA 2VVLG 3CNPA 4UDQA 2YR4A 2Q7VA 4EIQA 1PBDA 3ABVA 4JDRA 3COXA 4I59A 5EOWA 2FJDA 3KPFA 4B69A 3Q6JA 2WU5A 3KKJA 2YLRA 3ALMA 3SGLA 1ZP0A 5LV9A 3CGEA 4K5SA 1K0IA 2PYXA 4D03A 1PN0A 3AD9B 2C7GA 2TPRA 2B7SA 4GF7A 1TDFA 4NZHA 2XLTA 5U25A 2XLRA 1NHRA 2EQ6A 1GRBA 3AD7B 4FK1A 3NT6A 3DH9A 1CJ3A 1REOA 2W0HA 3IC9A 1PJ7A 3F8DA 2APGA 4K22A 3KA7A 4GUVA 1CJ2A 1BWCA 2R46A 4H2RA 4UDPA 2YAUA 1X31B 3NN6X 1H84A 2WPCA 2EQ7A 3UOXA 5IPYA 4AP1A 5J60A 1DOCA 5U63A 4U8OA 2RABA 1N1PA 2YG6A 3FMWA 3H8IA 4H4SA 2Q0KA 3F8RA 4ECHA 5KRQA 4H4QA 2V3BA 3BHFA 2VVLA 1KNRA 2BXSA 4BV6A 4GR1A 3EPTA 1L9DA 2RGHA 2WQYA 1BKWA 1D4DA 4D04A 3ICTA 1Y56B 2YR6A 5JCMA 3GYJA 3UKKA 4DSGA 1YQ4A 2X50A 3UTHA 4APNA 3UKAA 1OJAA 3EANA 3NRNA 1GSNA 3ADAB 3CNSA 2WP6A 3GDPA 3LOVA 1O95A 3I3LA 4JNQA 2V6OA 3RP7A 4IA5A 2C70A 3HZLA 1S2YA 3M0OA 4H2PA 4K5RA 3AE9A 2WOIA 4OPIA 4OPGA 4EQSA 2BXRA 3GD4A 2GF3A 4YKFA 1GREA 1TDOA 1ONFA 2HQMA 2R4EA 2YG7A 2VZ2A 3ICSA 4DGKA 1PJ5A 4CCQA 2C66A 4LA1A 2BC1A 2V3AA 4EQRA 2YLTA 3NIXA 5IQ1A 4Z25A 2YM1A 2OLNA 4CNKA 5BVAA 2OAMA 3BNUA 3CPJG 1NG3A 3DJEA 4C77A 1PXAA 1Q1WA 3VRAA 2GMHA 4I58A 4M52A 5FS6A 4K2XA 5C2TA 2YQUA 2JKCA 3REDA 1GETA 1GEUA 1EL8A 1LQUA 3VRBA 4MJWA 3DGHA 1GOSA 3AE6A 5M0ZA 3UKQA 2XYOA 5EB5A 3QSSA 3SFEA 1PDHA 1O5WA 4E0VA 2C67A 1EL9A 1K0LA 2GB0A 1PBCA 1H81A 2BK4A 4JY2A 4H50A 1F3PA 1GRFA 2R0CA 5TR3A 4U8KA 4B1BA 2BC0A 2YVJA 2PHHA 4AOSA 3V3OA 3T37A 3NGCX 2BK5A 2WDQA 3CGDA 1P2EA 4A5LA 4AOXA 3IHGA 2XFQA 4A7AA 2GQFA 1BGNA 4Z24A 1S2QA 3AEEA 4A9WA 3GYIA 1H7WA 3QVPA 4Z44A 3NK0X 3ATRA 1FECA 1PXBA 3ALJA 2C3DA 1JRYA 1LVLA 1ZK7A 2GR1A 3QFAA 3UTGA 3P4PA 3GD3A 2V60A 1N4WA 2F5ZA 1SEZA 2R9ZA 1GNDA 3UOVA 5HY5A 3AE3A 4YTNA 3CNDA 3RP6A 3DK4A 4U2TA 2C65A 2GH5A 4NEVA 3B3RA 4J2WA 3VQRA 1NPXA 2BK3A 1H7XA 2YLSA 2GMJA 1KSUA 1YQZA 2RGOA 3AEBA 3NKSA 2NPXA 4OPDA 4YWOA 4C5OA 4C3XA 1VG0A 4EQWA 4HB9A 2YM2A 1LV0A 1GV4A 3QVRA 3RP8A 1GT8A 4KX6A 3UOZA 4Z2TA 3CGBA 1FCDA 4OVIA 4H7UA 2CDUA 1VDCA 2R45A 3CNJA 1DOEA 3DK9A 4REKA 3UOYA 4OPCA 2C64A 2XVIA 1IUWA 3S5WA 2C76A 3V76A 3AYIA 2B76A 4B63A 4ADWA 3LB8A 2ZZCA 2V5ZA 4EM3A 5JCIA 5KOXA 3LZWA 3VR9A 4X9NA 3E1TA 1ELIA 1IJHA 3GRSA 3AE2A 3IHMA 4OPUA 4Z26A 1OJ9A 2GV8A 3NH3X 5GRTA 2E4GA 2VQBA 2XFNA 4ZCDA 3B6DA 2BABA 1JRXA 1JNZA 1E6EA 3K7QX 3FBSA 4J57A 2XCGA 4HA6A 4AT0A 3PVCA 2YR5A 2H89A 4BURA 1TDNA 1PBEA 1VQWA 4K8DA 1F8SA 2Q6UA 1LQTA 1B8SA 4Y4NA 3UCLA 4H2NA 1Y56A 2ZBWA 2WBAA 2OA1A 1DODA 2NVKX 1FOHA 3ATQA 2AR8A 4B66A 4YSYA 1PXCA 1JU2A 2XVEA 4OPTA 2X8CA 3LZXA 4H4WA 2VRLA 4USRA 1E1NA 3AECA 1GXFA 1E7PA 3D8XA 4NTDA 3SFDA 4J56A 3C96A 1EBDA 2WOVA 3P4QA 4BK1A 5J7XA 5JCNA 2I0ZA 3F8PA 4NTEA 2UZZA 1ZKQA 3UP4A 4EMJA 2ZZBA 3WE0A 3AE5A 2IVEA 4ZN0A 3KU9A 5ER0A 3DJDA 2Y6QA 2QA2A 1JRZA 4H4ZA 3UTEA 3QSEA 5CQFA 1YQ3A 2BS2A 3NK2X 1F6MA 1ZMCA 3OC4A 1JNRA 3NYCA 2XLSA 4FDCB 1DOBA 4B68A 1F8RA 4YSZA 2JK6A 1H82A 1PHHA 2FJAA 3DGZA 4BJYA 4C74A 2XVHA 3QSMA 5FS7A 3G5SA 2BS3A 4BJZA 3ICRA 2BCPA 2VRMA 1TRBA 3S61A 4YXDA 4GDPA 1KFYA 2YLWA 4J31A 5KOWA 3NN0X 3K30A 3UP5A 3SM8A 1CL0A 3BI2A 1GTEA 3RHAA 3NYEA 2A87A 4CY6A 3C4NA 2WETA 4JN9A 4H4YA 1NDAA 4CRTA 3JSKA 2C73A 2X99A 2A89A 3NYFA 1TDKA 1JOAA 4CY8A 5BUKA 3P4SA 2R0PA 5FS8A 5C3JA 2ZZ0A 4H4VA 3SQPA 4J33A 2YWLA 1K0JA 2X8GA 4Z2RA 5KVHA 2A8XA 1QLBA 1DXLA 2YVGA 4KPRA 4RG3A 4Z2UA 1F8WA 1IUSA 2XFOA 1NAAA 1N4VA 3D1CA 2IVDA 1IUVA 2WESA 2WHDA 4U2LA 1D5TA 1XDIA 2JBVA 3QJ4A 4LU6A 4XWZA 4B64A 4YKGA 4Y4LA 4EMWA 3DK8A 4A6NB 3GRTA 2JAEA 3NTAA 1GRGA 1V59A 3AEFA 1PBFA 1KNPA 1D4EA 4P9SA 1L0VA 4BK3A 3II4A 3NTDA 1GPEA 1MOKA 2GAHB 1MXTA 2XLPA 4U8MA 2RGJA 1TYPA 3EAOA 4XWRA 4OPLA 1ZOVA 1BZLA 2ARDA 4CBQA 3AEAA 4YSHA 2C75A 1PJ6A 3P9UA 3L1RA 4J34A 5DBJA 5IQ4A 4JY3A 4CCRA 1ZOYA 2J3NA 2GQWA 2BA9A 4JQ9A 4GRTA 1P2HA 1S3BA 2GAGB 2GR3A 1GRAA 3L8KA 1D7LA 3FG2P 2XLUA 1ZDLA 3H4KA 5FS9A 3M13A 4YTMA 1CC6A 2YG5A 3ZDNA 1JEHA 5JCLA 3CIRA 1D7YA 4GCMA 3CTYA 4B65A 2CVJA 1GESA 3Q9TA 2CFYA 4U2SA 1CC2A 1HYUA 1GALA 1LJ1A 3AYLA 2BACA 4H4XA 5EB4A 1XPQA 4O5QA 4A79A 4UDRA 1AOGA 2B9XA 1CJCA 2CULA 3RNMA 1E1MA 1OJCA 3AE7A 3UKFA 4AP3A 1CHUA 2VOUA 3PS9A 2WS3A 1B5QA 1FL2A 2QA1A 2VQ7A 4U8JA 1Q1RA 2AAQA 2E1MA 3H8LA 2YG3A 3IWAA 2XFPA 1N4UA 3DJGX 1Z6LA 5JCKA 2BYBA 3LJPA 3ITJA 4ICYA 3VR8A 4U8IA 1OJDA 4DSHA 2Y6RA 1Q9IA 4K7ZA 1CJ4A 3AE1A 3FIMB 1LTXR 3AEDA 2WDRA 3R9UA 1BF3A 4U8PA 1FEAA 5HXIA 2QCUA 5HYMA 3DMEA
chains in the Genus database with same CATH superfamily
2YLXA 3VC6A 3I6DA 4Y4MA 3UKLA 3CK5A 2TMDA 1H86A 3IJLA 4FP1A 3I4KA 1B4VA 2YLZA 3BHKA 5ENLA 1E39A 4A65A 4EQXA 3LXDA 1SJBA 3OTRA 1YY5A 3ISHA 2JB3A 3CN8A 3G5QA 4U8NA 1COYA 2X8HA 4DN1A 2V61A 3TJIA 1DNCA 3I6TA 3PO7A 3THUA 2WOWA 2MUCA 4NEWA 2OZTA 4N9XA 2QJMA 3VC5A 3NNEA 4IA6A 4XXGA 4G6HA 1D4CA 3RGTA 4TM1A 3P1WA 1ZY8A 5L46A 1NHSA 1NU5A 1MDRA 1DJQA 2PS2A 2GR0A 4CNJA 4H4TA 4WX1A 3AYJA 3ALLA 3CMMA 2VVMA 3PWIA 4C3YA 3V3NA 1KDGA 3AD8B 4KPLA 2FJBA 4USQA 2QVHA 3UKHA 4TLXA 1UKVG 3M12A 4DX3A 3UJFA 3SN0A 1IUUA 2QAEA 2XVFA 3AE4A 4B67A 4TVWA 5M10A 4IT1A 2YVFA 2Q7VA 1PBDA 5EOWA 4I59A 4B69A 1S7MA 4EWJA 1K0IA 1L8PA 2XLTA 5U25A 2W55A 1CJ3A 3KA7A 4GUVA 3MY9A 2YAUA 1X31B 2EQ7A 3UOXA 3FYYA 5FJUA 3TW9A 2RABA 4ECHA 5KRQA 3IJIA 1KNRA 2PMQA 4ZCWA 1L9DA 3ICTA 3PWGA 1Y56B 2YR6A 3GYJA 3UKKA 4HYRA 1OJAA 4GAVA 1GSNA 3ADAB 3LOVA 5IDZA 3HZLA 4H2PA 3T8QA 1SJDA 4OPIA 4OPGA 4EQSA 3A7RA 4H1ZA 2GF3A 3CXOA 1GREA 1TDOA 1ONFA 3ICSA 1PJ5A 2GGJA 2C66A 4LA1A 2YLTA 4EQRA 4Z25A 4CNKA 5KMPA 1EC9A 3VRAA 2YQUA 3HPFA 1N5XA 5M0ZA 2OX4A 4E0VA 1EL9A 1K0LA 1PBCA 1WYGA 3PK7A 2BK4A 4JY2A 3SYIA 1F3PA 5TR3A 4U8KA 2BC0A 2PHHA 3T31A 3V3OA 3NGCX 4HPNA 3ES8A 2PGEA 4A5LA 3DFYA 3IHGA 1BGNA 4A9WA 3ATRA 1LVLA 1VQZA 1P48A 2GR1A 3GD3A 1R6WA 3UJRA 3DESA 4J2WA 4JN8A 1KSUA 2NPXA 2OQHA 4EQWA 1JDFA 3SN4A 3QVRA 3UOZA 1BKHA 1GT8A 4OVIA 3T14A 1VDCA 2R45A 3CNJA 1DOEA 3UOYA 2C64A 1IUWA 3S5WA 3V76A 2B76A 3LB8A 2V5ZA 3VR9A 3E1TA 1IJHA 3AE2A 2GV8A 2VQBA 3AN1A 2XFNA 3B6DA 2BABA 1JNZA 4BURA 3H8AA 1PBEA 3RITA 3QKEA 1B8SA 4Y4NA 4H2NA 1Y56A 2WBAA 2NVKX 3CB3A 2AR8A 1JU2A 4K1WA 3LZXA 4USRA 3AECA 1E7PA 3P3BA 2GGEA 5J7XA 3UP4A 2ZZBA 3N4FA 2IVEA 4ZN0A 5ER0A 3DJDA 3R0UA 2Y6QA 2BS2A 1JNRA 2XLSA 1PHHA 1XS2A 3DGZA 4C74A 2XVHA 2GDQA 2OFJA 3S5SA 4BJZA 5KMQA 2NQLA 4YXDA 2YLWA 3K30A 3UP5A 1EBHA 2A87A 3FJ4A 3ZVIA 3OP2A 2OZ3A 2C73A 3NYFA 1TDKA 5FS8A 4H4VA 2X8GA 5KVHA 4KPRA 1F8WA 1IUSA 3AMZA 2JBVA 4XWZA 2QGYA 3NTAA 4TVYA 5BOEA 3AEFA 2GAHB 2XLPA 3EAOA 4OPLA 4YSHA 3V5FA 1PJ6A 3P9UA 4J34A 5DBJA 2J3NA 4X2PA 2BA9A 1S3BA 2GAGB 2GR3A 4KWSA 4YTMA 1D7LA 3ZDNA 1JEHA 3CIRA 3STPA 4GCMA 4H19A 1GESA 3CAWA 4ENLA 2QQ6A 4O5QA 4IZGA 4AP3A 4U8JA 3UJEA 1Q1RA 1MDLA 3LJPA 4DSHA 1CJ4A 1LTXR 3AEDA 2WDRA 2P8BA 4EIPA 3SZFA 3KD9A 2AQJA 3SJNA 1Y0PA 1L9CA 1IYXA 4U8LA 1KKRA 5BULA 4ZCCA 2XVJA 1NELA 5KVIA 1TYTA 1TDEA 2XH0A 2FJEA 2YG4A 5HHFA 4H4PA 1XHCA 3GYXA 1IUTA 4AT2A 2FYMA 3O0HA 2WPFA 1T3QC 2Z5XA 1JRPA 4Z43A 3GWDA 3ETRB 1GTHA 2GSHA 4II2A 1DJNA 4OCGA 3CNTA 4A35A 1RSGA 2R0GA 2BCGG 5KWFA 1PBBA 3QPEA 1FFVC 3MKCA 3PFRA 2GRTA 4H2HA 1GERA 3AEGA 3C4AA 3GWFA 5GSNA 3FPZA 1MO9A 1X2GA 4E4UA 4X9MA 4GDEA 4RSLA 3SX6A 3K7TA 3G5RA 1KF6A 1E9IA 4IP5A 5JRBA 4LIIA 3NK1X 3NG7X 3AB1A 4A6GA 1ZX9A 4NTCA 1CBOA 1GRTA 5KXJA 3ENLA 5FMHA 1H6VA 2EQ8A 1QJDA 4FK1C 5BRTA 3OZ2A 1O94A 4TM0A 2VVLG 4UDQA 3TOYA 4JDRA 3ABVA 3UJ2A 3KKJA 3ALMA 4ROPA 5LV9A 3CGEA 2PYXA 1PN0A 3HRDC 2PU1A 1TDFA 4FK1A 3EEZA 4G8TA 1REOA 2W0HA 1PJ7A 3F8DA 4K22A 2PTYA 1CJ2A 1BWCA 4DYEA 2WPCA 5IPYA 3MSYA 5U63A 5FJPA 1N1PA 4H4SA 3BHFA 4HNLA 2VVLA 1BKWA 2X50A 4APNA 3UKAA 3NRNA 1STZA 2WP6A 1O95A 4IHCA 2V6OA 3M0OA 4K5RA 2BXRA 6ENLA 2RDXA 1F9CA 1SJAA 2HQMA 2VZ2A 2W3SA 2BC1A 3V4BA 5IQ1A 2YM1A 2OLNA 3K1GA 4C77A 2PCEA 2XH2A 3NVVB 2GMHA 5C2TA 3RR1A 3UKQA 3VCNA 3SFEA 3R1ZA 1PDHA 3DDMA 3SZCA 4H50A 1GRFA 2R0CA 2PTZA 3MQTA 2YVJA 4HNCA 3T37A 1EBGA 4GGHA 2BK5A 3CGDA 1R0MA 2GQFA 1S2QA 1H7WA 3NK0X 2C3DA 1JRYA 3P4PA 1SEZA 3DEQA 5FJTA 3OZYA 4YTNA 3RP6A 2C65A 2GH5A 1PDZA 4NEVA 2PTXA 1H7XA 4GIRA 3NKSA 2QJNA 3DERA 3UCCA 2QDEA 3SQSA 4IP4A 4Z1YA 2CDUA 3V3WA 3DK9A 4HN8A 2XVIA 3MZNA 1MRAA 1VDVA 4B63A 2OO6A 2ZZCA 4EM3A 5KOXA 1RVKA 1ELIA 4OPUA 3NH3X 5GRTA 1JRXA 3K7QX 3FBSA 4HA6A 3PVCA 3BJSA 1TDNA 3N6HA 2OG9A 4E8GA 2AKZA 2ZBWA 2GGHA 1DODA 1MNSA 4H4WA 2VRLA 4NTDA 1EBDA 2WOVA 3P4QA 2UZZA 3TJ4A 3KU9A 2HXTA 2QA2A 1JRZA 3UTEA 3FVDA 3QSEA 1YQ3A 2ZADA 1EC7A 1ZMCA 4E6MA 3NYCA 1DOBA 1F8RA 4YSZA 2FJAA 4BJYA 3G5SA 1KCZA 2BS3A 3ICRA 2BCPA 4HCHA 2VRMA 1TRBA 4GDPA 1KFYA 5G5GB 3JW7A 1CL0A 1KN0A 2OVLA 4GMEA 3NVYB 3H12A 2XH4A 2WETA 4JN9A 4H4YA 1NDAA 4CRTA 2A89A 5BUKA 4CY8A 3P4SA 2BRYA 1K0JA 1QLBA 2YVGA 4IL0A 1D5TA 1XDIA 3QJ4A 4LU6A 3FXGA 4A6NB 2MNRA 3GRTA 4IL2A 2JAEA 3II4A 1GPEA 1MOKA 2RGJA 4XWRA 3T2YA 1JCTA 3TWAA 2C75A 3L1RA 4G73A 4JY3A 2GGGA 2CHRA 1TKKA 2YG5A 2BRAA 1D7YA 1CC2A 1GALA 1LJ1A 1PDYA 3UXLA 3H7VA 2B9XA 1CJCA 4F4RA 2WS3A 1FL2A 3CYJA 1KD0A 2AAQA 3UGVA 3H8LA 2YG3A 1N4UA 3DJGX 1Z6LA 3ITJA 4K7ZA 3FIMB 1BQGA 3R9UA 5HXIA 2QCUA 2FKPA 3DMEA 2C3CA 3BI5A 3SXIA 1VG9A 3SR6B 4TM4A 3UKPA 2C72A 4KEMA 5EBKA 2DKHA 1N63C 3HW2A 2H88A 3BNMA 1CC4A 3PG6A 1W4XA 2GEWA 1H83A 3QFBA 3AXBA 1S3EA 3DGBA 1E1LA 2GVCA 5CKUA 3EF6A 1TE6A 4O5UA 3T4WA 2EQ9A 2AL2B 3IF9A 3P4RA 3UXKA 1NEKA 1E1KA 3GMBA 5BOFA 1FEBA 4G74A 1N60C 3NO1A 2P88A 3KVEA 4J1OA 4PAAA 1CF3A 4YT0A 2I5QA 3CGCA 2IIDA 1FHUA 4FI4A 3CPHG 1LPFA 3VCCA 3KPKA 4GYPA 1JPMA 2W3RA 2WP5A 1BGJA 2O9ZA 1VRQB 3UJSA 4IVOB 1B37A 4A99A 3DJJA 1M6IA 2AL1A 5G5HB 2JB2A 4DXKA 1RYIA 3DIPA 4DNAA 2XDOA 3JZUA 3UCDA 3AE8A 4JNAA 1RP0A 4MGGA 1XANA 3TTEA 1H2IA 1NG4A 1OJTA 3AWIA 1NHPA 3UTFA 4WCTA 3D46A 4BK2A 2B7RA 1PS9A 4H4RA 2AKMA 3KLJA 2YR4A 3DFHA 2E5AA 3HYWA 3Q6JA 2WU5A 2YLRA 4G9KA 3H70A 4K5SA 1N5WC 2C7GA 2TPRA 3B9JB 3MWCA 4GF7A 2E3TA 3QLDA 1NHRA 3AD7B 1GRBA 3QTPA 3NT6A 3DH9A 3IC9A 4DWDA 2R46A 4UDPA 3NN6X 2OPJA 4AP1A 5J60A 3ZVHA 3CT2A 3H8IA 4MKSA 2Q0KA 3F8RA 3A7UA 2V3BA 3BOXA 4H4QA 2BXSA 2RGHA 1D4DA 4D04A 2PP1A 3EANA 2AL2A 4JNQA 3RP7A 4IA5A 3OW1A 4H83A 2C70A 1ONEA 4KT2A 3GD4A 4YKFA 5KNLA 4DGKA 2V3AA 3GC2A 3R0KA 3CPJG 3GD6A 4G7FA 1PXAA 1Q1WA 2PA6A 2PODA 4I58A 4M52A 5FS6A 3REDA 1GETA 1GEUA 3VRBA 3DGHA 3AE6A 3QSSA 2GB0A 1H81A 3DG6A 4AOSA 4K8GA 4YWSA 4AOXA 2XFQA 4Z24A 3GYIA 4Z44A 1FECA 1ZK7A 2V60A 2R9ZA 1GNDA 3UOVA 3DK4A 5EU9A 1NPXA 1FO4A 2BK3A 2YLSA 2GMJA 2RGOA 3AEBA 2QDDA 4C3XA 1VG0A 2YM2A 1GV4A 3RP8A 4KX6A 3CGBA 1FCDA 4H7UA 4GFIA 1ELSA 3SN1A 4REKA 2OZ8A 2XSXA 2OLAA 1N61C 3SZWA 3U4FA 3LZWA 5KMRA 4X9NA 3GRSA 3IHMA 4Z26A 2OKTA 1TZZA 4ZCDA 1E6EA 4J57A 4AT0A 3NVWB 2H89A 1V97A 4K8DA 2Q6UA 3UCLA 2OQYA 2OA1A 4B66A 2P0IA 4MMWA 1ZXIC 1GXFA 3SFDA 4E4FA 3CXBA 3C96A 1FIQB 2HNEA 2C4CA 5JCNA 2I0ZA 3V5CA 1ZKQA 3AE5A 4H4ZA 3FCPA 3OC4A 1H82A 4GGBA 4E5TA 1FFUC 4J31A 5KOWA 3NN0X 4HCLA 3BI2A 1GTEA 4NNJA 3NYEA 2X99A 3OZMA 2R0PA 2HZGA 3SQPA 4J33A 2YWLA 3T6CA 4RG3A 1NAAA 2IVDA 1IUVA 2WESA 2WHDA 4U2LA 3VFCA 4DHGA 3DK8A 3L5OA 1GRGA 1KNPA 1L0VA 4BK3A 4J3ZA 3R10A 2PSNA 4U8MA 3R11A 1BZLA 3AEAA 1RM6B 2GQWA 4GRTA 1P2HA 3M13A 3H4KA 2POZA 2XH7A 1CC6A 5JCLA 3CTYA 2CVJA 3Q9TA 4ZOHB 2CFYA 1HYUA 2PU0A 3AYLA 2BACA 4H4XA 1XPQA 4UDRA 3BSMA 1AOGA 2CULA 1OJCA 3AE7A 3UKFA 2GL5A 2O56A 1B5QA 4GISA 2PTWA 2VQ7A 2E1MA 3IWAA 4M6UA 2BYBA 3VR8A 3DG7A 3NXLA 2Y6RA 1KKOA 1Q9IA 5FJOA 1FEAA 4A6NA 1ZMDA 3RCYA 3OPSA 3JVAA 3NLCA 4RG4A 1K4QA 4EMIA 1EL7A 1GRHA 4Z17A 4ZA0A 3GDNA 3D47A 5KMSA 4X4JA 1M64A 2BS4A 4IV9A 2FBWA 4JN7A 4PABA 1IUXA 3D9XA 3NHOX 1XPYA 1N62C 4IVMB 3K7MX 2B9WA 4YSXA 2PGWA 3RO6A 3R25A 3QN3A 1NENA 1L9EA 2B9YA 1EL5A 3DA1A 2Q0LA 2R4JA 1X2HA 3LADA 3SSZA 2ZC8A 4H2QA 1KSSA 4J36A 2DKIA 1QO8A 1P43A 2WP9A 2XFUA 2OALA 1ECQA 2Z5YA 3BI4A 2WPEA 2ACZA 2OLOA 2WDVA 3ES7A 3GMCA 4G6GA 1W6TA 4TM3A 4YTPA 4FX9A 3URHA 2DW6A 1FHVA 4A3RA 3GSIA 4H4UA 2WU2A 4UP3A 4EM4A 2X3NA 2E5VA 3R07C 4TLZA 2GR2A 3ZYXA 2W54A 4M0XA 3EUB3 5U1OA 2JB1A 3VRDB 1NHQA 3CPIG 1YKJA 2WEUA 1JROA 3B97A 3CNPA 4EIQA 3COXA 2FJDA 3KPFA 4JHMA 3SGLA 1ZP0A 3A7AA 4D03A 3I6EA 3AD9B 2B7SA 4NZHA 2XLRA 2EQ6A 2APGA 3TQPA 4H2RA 4K2SA 1JPDX 1H84A 1DOCA 4U8OA 3VA8A 3FMWA 2YG6A 4BV6A 4GR1A 3EPTA 2WQYA 4GYPC 5JCMA 4DSGA 3Q45A 1YQ4A 3UTHA 3P0WA 7ENLA 1EC8A 3CNSA 3GDPA 3I3LA 1S2YA 3AE9A 2WOIA 5FJRA 3TCSA 2R4EA 2YG7A 4CCQA 1SB3B 3NIXA 5BVAA 2OAMA 3BNUA 1NG3A 3DJEA 4K2XA 2JKCA 3SZ0A 3ZLGA 2DW7A 1EL8A 1LQUA 4MJWA 1GOSA 2XYOA 5EB5A 1O5WA 2C67A 3GO2A 4NWZA 4B1BA 3T2KA 1WUFA 2QJJA 3VDGA 2WDQA 1P2EA 4A7AA 3TWBA 3AEEA 3QVPA 1PXBA 3ALJA 3HYXA 4GAPA 3QFAA 4HCDA 3UTGA 1N4WA 2F5ZA 5HY5A 3AE3A 3CNDA 4U2TA 1WUEA 3B3RA 3VQRA 1YQZA 3FV9A 2XGZA 3U9IA 4OPDA 4YWOA 3DG3A 4C5OA 3NS1B 2P3ZA 4HB9A 1LV0A 4Z2TA 5J04A 4II3A 3P93A 3MUCA 3NZGA 4OPCA 2C76A 3AYIA 4ADWA 5JCIA 3GY1A 1OJ9A 2E4GA 3IJQA 2PP0A 2XCGA 3KUMA 2YR5A 3SY4A 3N6JA 1VQWA 2HXUA 1F8SA 1LQTA 3T2ZA 3ATQA 1FOHA 3IK4A 1MUCA 4YSYA 1PXCA 1DTNA 2XVEA 4OPTA 2P8CA 2X8CA 3SBFA 1E1NA 3NVZB 3D8XA 4J56A 4BK1A 3F8PA 4NTEA 4EMJA 3WE0A 2ONEA 5CQFA 3NFUA 3NK2X 1F6MA 4FDCB 4B68A 2JK6A 3T9PA 5FS7A 3QSMA 3NRZB 3S61A 3SM8A 3ZVHB 3RHAA 4CY6A 3C4NA 3JSKA 1JOAA 5C3JA 2ZZ0A 3Q4DA 3RRAA 3HYVA 4Z2RA 2A8XA 1DXLA 1YEYA 3AM9A 4Z2UA 2XFOA 3D1CA 1N4VA 1SJCA 4B64A 4YKGA 4Y4LA 4EMWA 3EKGA 1V59A 1PBFA 1D4EA 4P9SA 3NTDA 1OEPA 1MXTA 2PP3A 1TYPA 1ZOVA 3ZLHA 4CBQA 2ARDA 2GGIA 5IQ4A 4CCRA 1ZOYA 4JQ9A 1GRAA 3L8KA 3FG2P 2XLUA 1ZDLA 5FS9A 3S47A 4B65A 4U2SA 5EB4A 4A79A 2PPGA 3RNMA 1E1MA 1CHUA 2VOUA 3PS9A 2QA1A 2XFPA 3N4EA 5JCKA 4ICYA 4U8IA 1OJDA 3ZLFA 3AE1A 1BF3A 4U8PA 3T0KA 5HYMA
chains in the Genus database with same CATH topology
2YLXA 2C3CA 3BI5A 3I6DA 4A6NA 1ZMDA 4Y4MA 3UKLA 4EIPA 3SXIA 1VG9A 2TMDA 4TM4A 3UKPA 1H86A 3NLCA 2C72A 4RG4A 3SZFA 1K4QA 5EBKA 2DKHA 3KD9A 4EMIA 1EL7A 1B4VA 2YLZA 3BHKA 2H88A 3BNMA 1GRHA 1E39A 2AQJA 1CC4A 4A65A 4EQXA 3LXDA 1Y0PA 1L9CA 3GDNA 4U8LA 5KMSA 3PG6A 1W4XA 4X4JA 5BULA 1M64A 2BS4A 4ZCCA 2XVJA 2GEWA 4IV9A 1H83A 2FBWA 5KVIA 1YY5A 1TYTA 1TDEA 1IUXA 2FJEA 2YG4A 4PABA 5HHFA 3D9XA 3QFBA 2JB3A 3ISHA 3NHOX 4H4PA 1XHCA 3AXBA 3GYXA 1IUTA 1S3EA 3CN8A 3G5QA 4IVMB 3K7MX 2B9WA 4AT2A 4YSXA 1E1LA 4U8NA 1COYA 3O0HA 2GVCA 5CKUA 2X8HA 2WPFA 3EF6A 4O5UA 1NENA 1L9EA 2EQ9A 2V61A 2B9YA 3IF9A 1EL5A 1DNCA 2Z5XA 3P4RA 3DA1A 2Q0LA 3PO7A 4Z43A 1NEKA 3GWDA 1E1KA 1GTHA 2R4JA 3LADA 2WOWA 4NEWA 3GMBA 4II2A 1DJNA 4OCGA 4N9XA 1FEBA 3CNTA 4H2QA 1RSGA 2R0GA 4G74A 2BCGG 1KSSA 3NNEA 4IA6A 5KWFA 4XXGA 1PBBA 1D4CA 4G6HA 4J36A 2DKIA 3KVEA 1QO8A 4PAAA 4TM1A 1CF3A 4YT0A 2WP9A 2GRTA 3CGCA 2IIDA 3P1WA 2XFUA 2OALA 1GERA 1ZY8A 2Z5YA 3BI4A 2WPEA 5L46A 1NHSA 2ACZA 2OLOA 3AEGA 1LPFA 3C4AA 3CPHG 3GWFA 3KPKA 2WDVA 5GSNA 1DJQA 3FPZA 1MO9A 3GMCA 4G6GA 2WP5A 2GR0A 1BGJA 2O9ZA 1VRQB 4TM3A 4YTPA 4X9MA 4CNJA 4FX9A 4H4TA 1B37A 4GDEA 3AYJA 3ALLA 3CMMA 4IVOB 4RSLA 4WX1A 3SX6A 4A99A 2VVMA 3K7TA 3DJJA 3G5RA 3URHA 1KF6A 4C3YA 1M6IA 3GSIA 4H4UA 2WU2A 4UP3A 5JRBA 2JB2A 4LIIA 4EM4A 1RYIA 3NK1X 2X3NA 4DNAA 2E5VA 3NG7X 3AB1A 3V3NA 2XDOA 1ZX9A 1KDGA 3AD8B 4NTCA 3AE8A 2FJBA 4JNAA 4USQA 1CBOA 1RP0A 4TLZA 3UKHA 1XANA 2GR2A 1GRTA 4TLXA 3ZYXA 5KXJA 1UKVG 5FMHA 1H2IA 3M12A 1H6VA 2EQ8A 1NG4A 5U1OA 1OJTA 2JB1A 3AWIA 1IUUA 1NHPA 3UTFA 3VRDB 1NHQA 4WCTA 2QAEA 2XVFA 1QJDA 3CPIG 4BK2A 3AE4A 4FK1C 4B67A 1YKJA 2B7RA 5BRTA 1PS9A 4H4RA 2WEUA 1O94A 3OZ2A 4TM0A 5M10A 2YVFA 3KLJA 2VVLG 3CNPA 4UDQA 2YR4A 2Q7VA 4EIQA 1PBDA 3ABVA 4JDRA 3COXA 3HYWA 4I59A 2FJDA 3KPFA 5EOWA 4B69A 1S7MA 3Q6JA 2WU5A 3KKJA 2YLRA 3ALMA 3SGLA 1ZP0A 4G9KA 5LV9A 3CGEA 4K5SA 1K0IA 2PYXA 4D03A 1PN0A 3AD9B 2C7GA 2TPRA 2B7SA 4GF7A 1TDFA 4NZHA 2XLTA 5U25A 2XLRA 1NHRA 2EQ6A 1GRBA 3AD7B 4FK1A 3NT6A 3DH9A 1CJ3A 1REOA 2W0HA 3IC9A 1PJ7A 3F8DA 2APGA 4K22A 3KA7A 4GUVA 1CJ2A 1BWCA 2R46A 4H2RA 4UDPA 2YAUA 1X31B 3NN6X 1H84A 2WPCA 2EQ7A 3UOXA 5IPYA 4AP1A 5J60A 1DOCA 5U63A 4U8OA 2RABA 1N1PA 2YG6A 3FMWA 3H8IA 4H4SA 2Q0KA 3F8RA 4ECHA 5KRQA 4H4QA 2V3BA 3BHFA 2VVLA 1KNRA 2BXSA 4BV6A 4GR1A 3EPTA 1L9DA 2RGHA 2WQYA 1BKWA 1D4DA 4D04A 3ICTA 1Y56B 2YR6A 5JCMA 3GYJA 3UKKA 4DSGA 1YQ4A 2X50A 3UTHA 4APNA 3UKAA 1OJAA 3EANA 4GAVA 3NRNA 1GSNA 3ADAB 3CNSA 2WP6A 3GDPA 3LOVA 1O95A 3I3LA 4JNQA 2V6OA 3RP7A 4IA5A 2C70A 3HZLA 1S2YA 3M0OA 4H2PA 4K5RA 3AE9A 2WOIA 4OPIA 4OPGA 4EQSA 2BXRA 3GD4A 2GF3A 4YKFA 1GREA 1TDOA 1ONFA 2HQMA 2R4EA 2YG7A 2VZ2A 3ICSA 5KNLA 4DGKA 1PJ5A 4CCQA 2C66A 4LA1A 2BC1A 2V3AA 4EQRA 2YLTA 3NIXA 5IQ1A 4Z25A 2YM1A 2OLNA 4CNKA 5KMPA 5BVAA 2OAMA 3BNUA 3CPJG 1NG3A 3DJEA 4C77A 1PXAA 1Q1WA 3VRAA 2GMHA 4I58A 4M52A 5FS6A 4K2XA 5C2TA 2YQUA 2JKCA 3REDA 3SZ0A 1GETA 1GEUA 1EL8A 1LQUA 3VRBA 4MJWA 3DGHA 1GOSA 3AE6A 5M0ZA 3UKQA 2XYOA 5EB5A 3QSSA 3SFEA 1PDHA 1O5WA 4E0VA 2C67A 1EL9A 1K0LA 2GB0A 1PBCA 1H81A 2BK4A 4JY2A 3SZCA 3SYIA 4H50A 1F3PA 1GRFA 2R0CA 4NWZA 5TR3A 4U8KA 4B1BA 2BC0A 2YVJA 2PHHA 3T31A 4AOSA 3T2KA 3V3OA 3T37A 3NGCX 2BK5A 2WDQA 3CGDA 1P2EA 4A5LA 4AOXA 3IHGA 2XFQA 4A7AA 2GQFA 1BGNA 4Z24A 1S2QA 3AEEA 4A9WA 3GYIA 1H7WA 3QVPA 4Z44A 3NK0X 3ATRA 1FECA 1PXBA 3ALJA 2C3DA 3HYXA 1JRYA 1LVLA 4GAPA 1ZK7A 2GR1A 3QFAA 3UTGA 3P4PA 3GD3A 2V60A 1N4WA 2F5ZA 1SEZA 2R9ZA 1GNDA 3UOVA 5HY5A 3AE3A 4YTNA 3CNDA 3RP6A 3DK4A 4U2TA 2C65A 2GH5A 4NEVA 3B3RA 4J2WA 3VQRA 1NPXA 2BK3A 1H7XA 2YLSA 2GMJA 1KSUA 1YQZA 2RGOA 3AEBA 3NKSA 2NPXA 4OPDA 4YWOA 4C5OA 4C3XA 1VG0A 4EQWA 4HB9A 2YM2A 1LV0A 1GV4A 3QVRA 3RP8A 1GT8A 4KX6A 3UOZA 4Z2TA 4II3A 3CGBA 1FCDA 4OVIA 4H7UA 3T14A 2CDUA 1VDCA 2R45A 3CNJA 1DOEA 3DK9A 4REKA 3UOYA 4OPCA 2C64A 2XVIA 1IUWA 3S5WA 2C76A 3V76A 3AYIA 2B76A 4B63A 4ADWA 3LB8A 2ZZCA 2V5ZA 3SZWA 4EM3A 5JCIA 5KOXA 3LZWA 3VR9A 5KMRA 4X9NA 3E1TA 1ELIA 1IJHA 3GRSA 3AE2A 3IHMA 4OPUA 4Z26A 1OJ9A 2GV8A 3NH3X 5GRTA 2E4GA 2VQBA 2XFNA 4ZCDA 3B6DA 2BABA 1JRXA 1JNZA 1E6EA 3K7QX 3FBSA 4J57A 2XCGA 4HA6A 4AT0A 3PVCA 2YR5A 3SY4A 2H89A 4BURA 1TDNA 1PBEA 1VQWA 4K8DA 1F8SA 2Q6UA 1LQTA 1B8SA 4Y4NA 3UCLA 4H2NA 3T2ZA 1Y56A 2ZBWA 2WBAA 2OA1A 1DODA 2NVKX 1FOHA 3ATQA 2AR8A 4B66A 4YSYA 1PXCA 1JU2A 2XVEA 4OPTA 2X8CA 3LZXA 4H4WA 2VRLA 4USRA 1E1NA 3AECA 1GXFA 1E7PA 3D8XA 4NTDA 3SFDA 4J56A 3C96A 1EBDA 2C4CA 2WOVA 3P4QA 4BK1A 5J7XA 5JCNA 2I0ZA 3F8PA 4NTEA 2UZZA 1ZKQA 3UP4A 4EMJA 2ZZBA 3WE0A 3AE5A 2IVEA 4ZN0A 3KU9A 5ER0A 3DJDA 2Y6QA 2QA2A 1JRZA 4H4ZA 3UTEA 3QSEA 5CQFA 1YQ3A 2BS2A 3NK2X 1F6MA 1ZMCA 3OC4A 1JNRA 3NYCA 2XLSA 4FDCB 1DOBA 4B68A 1F8RA 4YSZA 2JK6A 1H82A 1PHHA 2FJAA 3DGZA 4BJYA 4C74A 2XVHA 3QSMA 5FS7A 3G5SA 2BS3A 4BJZA 3ICRA 2BCPA 5KMQA 2VRMA 1TRBA 3S61A 4YXDA 4GDPA 1KFYA 2YLWA 4J31A 5KOWA 3NN0X 3K30A 3UP5A 3SM8A 1CL0A 3BI2A 1KN0A 1GTEA 3RHAA 4NNJA 3NYEA 2A87A 4CY6A 3C4NA 2WETA 4JN9A 4H4YA 1NDAA 4CRTA 3JSKA 2C73A 2X99A 2A89A 3NYFA 1TDKA 1JOAA 4CY8A 5BUKA 3P4SA 2R0PA 5FS8A 5C3JA 2ZZ0A 4H4VA 3SQPA 2BRYA 4J33A 2YWLA 1K0JA 2X8GA 3HYVA 4Z2RA 5KVHA 2A8XA 1QLBA 1DXLA 2YVGA 4KPRA 4RG3A 4Z2UA 1F8WA 1IUSA 2XFOA 1NAAA 1N4VA 3D1CA 2IVDA 1IUVA 2WESA 2WHDA 4U2LA 1D5TA 1XDIA 2JBVA 3QJ4A 4LU6A 4XWZA 4B64A 4YKGA 4Y4LA 4EMWA 3DK8A 3L5OA 4A6NB 3GRTA 2JAEA 3NTAA 1GRGA 1V59A 3AEFA 1PBFA 1KNPA 1D4EA 4P9SA 1L0VA 4BK3A 3II4A 3NTDA 1GPEA 1MOKA 2GAHB 1MXTA 2XLPA 4U8MA 2RGJA 1TYPA 3EAOA 4XWRA 4OPLA 3T2YA 1ZOVA 1BZLA 2ARDA 4CBQA 3AEAA 4YSHA 2C75A 1PJ6A 3P9UA 3L1RA 4J34A 5DBJA 4G73A 4JY3A 5IQ4A 4CCRA 1ZOYA 2J3NA 2GQWA 2BA9A 4JQ9A 4GRTA 1P2HA 1S3BA 2GAGB 2GR3A 1GRAA 3L8KA 1D7LA 3FG2P 2XLUA 1ZDLA 3H4KA 5FS9A 3M13A 4YTMA 1CC6A 2YG5A 2BRAA 3ZDNA 1JEHA 5JCLA 3CIRA 1D7YA 4GCMA 3CTYA 4B65A 2CVJA 1GESA 3Q9TA 2CFYA 4U2SA 1CC2A 1HYUA 1GALA 1LJ1A 3AYLA 2BACA 4H4XA 5EB4A 1XPQA 4O5QA 4A79A 4UDRA 1AOGA 2B9XA 1CJCA 2CULA 3RNMA 1E1MA 1OJCA 3AE7A 3UKFA 4AP3A 1CHUA 2VOUA 3PS9A 2WS3A 1B5QA 1FL2A 2QA1A 2VQ7A 4U8JA 1Q1RA 2AAQA 2E1MA 3H8LA 2YG3A 3IWAA 2XFPA 1N4UA 3DJGX 1Z6LA 5JCKA 2BYBA 3LJPA 3ITJA 4ICYA 3VR8A 4U8IA 1OJDA 4DSHA 2Y6RA 1Q9IA 4K7ZA 1CJ4A 3AE1A 3FIMB 1LTXR 3AEDA 2WDRA 3R9UA 1BF3A 4U8PA 1FEAA 3T0KA 5HXIA 2QCUA 5HYMA 3DMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLX A;  2C3C A;  3BI5 A;  3I6D A;  4A6N A;  1ZMD A;  4Y4M A;  3UKL A;  4EIP A;  1VG9 A;  2TMD A;  4TM4 A;  3UKP A;  1H86 A;  3NLC A;  2C72 A;  4RG4 A;  1K4Q A;  5EBK A;  2DKH A;  3KD9 A;  4EMI A;  1EL7 A;  1B4V A;  2YLZ A;  3BHK A;  2H88 A;  3BNM A;  1GRH A;  1E39 A;  2AQJ A;  1CC4 A;  4A65 A;  4EQX A;  3LXD A;  1Y0P A;  1L9C A;  3GDN A;  4U8L A;  1W4X A;  4X4J A;  5BUL A;  1M64 A;  2BS4 A;  4ZCC A;  2XVJ A;  2GEW A;  4IV9 A;  1H83 A;  2FBW A;  5KVI A;  1YY5 A;  1TYT A;  1TDE A;  1IUX A;  2FJE A;  2YG4 A;  4PAB A;  5HHF A;  3ISH A;  3QFB A;  2JB3 A;  3NHO X;  4H4P A;  1XHC A;  3AXB A;  1IUT A;  1S3E A;  3CN8 A;  3G5Q A;  4IVM B;  3K7M X;  2B9W A;  4AT2 A;  4YSX A;  1E1L A;  4U8N A;  1COY A;  3O0H A;  2GVC A;  5CKU A;  2X8H A;  2WPF A;  3EF6 A;  4O5U A;  1NEN A;  1L9E A;  2EQ9 A;  2V61 A;  2B9Y A;  3IF9 A;  1EL5 A;  1DNC A;  2Z5X A;  3P4R A;  3DA1 A;  2Q0L A;  3PO7 A;  4Z43 A;  1NEK A;  3GWD A;  1E1K A;  1GTH A;  2R4J A;  3LAD A;  2WOW A;  4NEW A;  3GMB A;  1DJN A;  4OCG A;  4N9X A;  1FEB A;  3CNT A;  4H2Q A;  1RSG A;  2R0G A;  2BCG G;  1KSS A;  3NNE A;  4IA6 A;  5KWF A;  4XXG A;  1PBB A;  1D4C A;  4J36 A;  2DKI A;  3KVE A;  1QO8 A;  4PAA A;  4TM1 A;  1CF3 A;  4YT0 A;  2WP9 A;  2GRT A;  3CGC A;  2IID A;  3P1W A;  2XFU A;  2OAL A;  1GER A;  1ZY8 A;  2Z5Y A;  3BI4 A;  2WPE A;  5L46 A;  1NHS A;  2ACZ A;  2OLO A;  3AEG A;  1LPF A;  3C4A A;  3CPH G;  3GWF A;  2WDV A;  5GSN A;  1DJQ A;  3FPZ A;  1MO9 A;  3GMC A;  2WP5 A;  2GR0 A;  1BGJ A;  2O9Z A;  1VRQ B;  4TM3 A;  4YTP A;  4X9M A;  4CNJ A;  4FX9 A;  4H4T A;  1B37 A;  4GDE A;  3AYJ A;  3ALL A;  4IVO B;  4RSL A;  4WX1 A;  4A99 A;  2VVM A;  3K7T A;  3DJJ A;  3G5R A;  3URH A;  1KF6 A;  4C3Y A;  1M6I A;  3GSI A;  4H4U A;  2WU2 A;  4UP3 A;  2JB2 A;  4LII A;  4EM4 A;  1RYI A;  3NK1 X;  2X3N A;  4DNA A;  2E5V A;  3NG7 X;  3AB1 A;  3V3N A;  2XDO A;  1ZX9 A;  1KDG A;  3AD8 B;  4NTC A;  3AE8 A;  2FJB A;  4JNA A;  4USQ A;  1CBO A;  1RP0 A;  4TLZ A;  3UKH A;  1XAN A;  2GR2 A;  1GRT A;  4TLX A;  3ZYX A;  5KXJ A;  1UKV G;  5FMH A;  3M12 A;  1H6V A;  2EQ8 A;  1NG4 A;  5U1O A;  1OJT A;  2JB1 A;  3AWI A;  1IUU A;  1NHP A;  3UTF A;  3VRD B;  1NHQ A;  4WCT A;  2QAE A;  2XVF A;  1QJD A;  3CPI G;  4BK2 A;  3AE4 A;  4FK1 C;  4B67 A;  1YKJ A;  2B7R A;  5BRT A;  1PS9 A;  4H4R A;  2WEU A;  1O94 A;  3OZ2 A;  4TM0 A;  5M10 A;  2YVF A;  3KLJ A;  2VVL G;  3CNP A;  4UDQ A;  2YR4 A;  2Q7V A;  4EIQ A;  1PBD A;  3ABV A;  4JDR A;  3COX A;  4I59 A;  5EOW A;  2FJD A;  3KPF A;  4B69 A;  3Q6J A;  2WU5 A;  3KKJ A;  2YLR A;  3ALM A;  3SGL A;  1ZP0 A;  5LV9 A;  3CGE A;  4K5S A;  1K0I A;  2PYX A;  4D03 A;  1PN0 A;  3AD9 B;  2C7G A;  2TPR A;  2B7S A;  4GF7 A;  1TDF A;  4NZH A;  2XLT A;  5U25 A;  2XLR A;  1NHR A;  2EQ6 A;  1GRB A;  3AD7 B;  4FK1 A;  3NT6 A;  3DH9 A;  1CJ3 A;  1REO A;  2W0H A;  3IC9 A;  1PJ7 A;  3F8D A;  2APG A;  4K22 A;  3KA7 A;  4GUV A;  1CJ2 A;  1BWC A;  2R46 A;  4H2R A;  4UDP A;  2YAU A;  1X31 B;  3NN6 X;  1H84 A;  2WPC A;  2EQ7 A;  3UOX A;  5IPY A;  4AP1 A;  5J60 A;  1DOC A;  5U63 A;  4U8O A;  2RAB A;  1N1P A;  2YG6 A;  3FMW A;  3H8I A;  4H4S A;  2Q0K A;  3F8R A;  4ECH A;  5KRQ A;  4H4Q A;  2V3B A;  3BHF A;  2VVL A;  1KNR A;  2BXS A;  4BV6 A;  4GR1 A;  3EPT A;  1L9D A;  2RGH A;  2WQY A;  1BKW A;  1D4D A;  4D04 A;  3ICT A;  1Y56 B;  2YR6 A;  5JCM A;  3GYJ A;  3UKK A;  4DSG A;  1YQ4 A;  2X50 A;  3UTH A;  4APN A;  3UKA A;  1OJA A;  3EAN A;  3NRN A;  1GSN A;  3ADA B;  3CNS A;  2WP6 A;  3GDP A;  3LOV A;  1O95 A;  3I3L A;  4JNQ A;  2V6O A;  3RP7 A;  4IA5 A;  2C70 A;  3HZL A;  1S2Y A;  3M0O A;  4H2P A;  4K5R A;  3AE9 A;  2WOI A;  4OPI A;  4OPG A;  4EQS A;  2BXR A;  3GD4 A;  2GF3 A;  4YKF A;  1GRE A;  1TDO A;  1ONF A;  2HQM A;  2R4E A;  2YG7 A;  2VZ2 A;  3ICS A;  4DGK A;  1PJ5 A;  4CCQ A;  2C66 A;  4LA1 A;  2BC1 A;  2V3A A;  4EQR A;  2YLT A;  3NIX A;  5IQ1 A;  4Z25 A;  2YM1 A;  2OLN A;  4CNK A;  5BVA A;  2OAM A;  3BNU A;  3CPJ G;  1NG3 A;  3DJE A;  4C77 A;  1PXA A;  1Q1W A;  3VRA A;  2GMH A;  4I58 A;  4M52 A;  5FS6 A;  4K2X A;  5C2T A;  2YQU A;  2JKC A;  3RED A;  1GET A;  1GEU A;  1EL8 A;  1LQU A;  3VRB A;  4MJW A;  3DGH A;  1GOS A;  3AE6 A;  5M0Z A;  3UKQ A;  2XYO A;  5EB5 A;  3QSS A;  3SFE A;  1PDH A;  1O5W A;  4E0V A;  2C67 A;  1EL9 A;  1K0L A;  2GB0 A;  1PBC A;  1H81 A;  2BK4 A;  4JY2 A;  4H50 A;  1F3P A;  1GRF A;  2R0C A;  5TR3 A;  4U8K A;  4B1B A;  2BC0 A;  2YVJ A;  2PHH A;  4AOS A;  3V3O A;  3T37 A;  3NGC X;  2BK5 A;  2WDQ A;  3CGD A;  1P2E A;  4A5L A;  4AOX A;  3IHG A;  2XFQ A;  4A7A A;  2GQF A;  1BGN A;  4Z24 A;  1S2Q A;  3AEE A;  4A9W A;  3GYI A;  1H7W A;  3QVP A;  4Z44 A;  3NK0 X;  3ATR A;  1FEC A;  1PXB A;  3ALJ A;  2C3D A;  1JRY A;  1LVL A;  1ZK7 A;  2GR1 A;  3QFA A;  3UTG A;  3P4P A;  3GD3 A;  2V60 A;  1N4W A;  2F5Z A;  1SEZ A;  2R9Z A;  1GND A;  3UOV A;  5HY5 A;  3AE3 A;  4YTN A;  3CND A;  3RP6 A;  3DK4 A;  4U2T A;  2C65 A;  2GH5 A;  4NEV A;  3B3R A;  4J2W A;  3VQR A;  1NPX A;  2BK3 A;  1H7X A;  2YLS A;  2GMJ A;  1KSU A;  1YQZ A;  2RGO A;  3AEB A;  3NKS A;  2NPX A;  4OPD A;  4YWO A;  4C5O A;  4C3X A;  1VG0 A;  4EQW A;  4HB9 A;  2YM2 A;  1LV0 A;  1GV4 A;  3QVR A;  3RP8 A;  1GT8 A;  4KX6 A;  3UOZ A;  4Z2T A;  3CGB A;  1FCD A;  4OVI A;  4H7U A;  2CDU A;  1VDC A;  2R45 A;  3CNJ A;  1DOE A;  3DK9 A;  4REK A;  3UOY A;  4OPC A;  2C64 A;  2XVI A;  1IUW A;  3S5W A;  2C76 A;  3V76 A;  3AYI A;  2B76 A;  4B63 A;  4ADW A;  3LB8 A;  2ZZC A;  2V5Z A;  4EM3 A;  5JCI A;  5KOX A;  3LZW A;  3VR9 A;  4X9N A;  3E1T A;  1ELI A;  1IJH A;  3GRS A;  3AE2 A;  3IHM A;  4OPU A;  4Z26 A;  1OJ9 A;  2GV8 A;  3NH3 X;  5GRT A;  2E4G A;  2VQB A;  2XFN A;  4ZCD A;  3B6D A;  2BAB A;  1JRX A;  1JNZ A;  1E6E A;  3K7Q X;  3FBS A;  4J57 A;  2XCG A;  4HA6 A;  4AT0 A;  3PVC A;  2YR5 A;  2H89 A;  4BUR A;  1TDN A;  1PBE A;  1VQW A;  4K8D A;  1F8S A;  2Q6U A;  1LQT A;  1B8S A;  4Y4N A;  3UCL A;  4H2N A;  1Y56 A;  2ZBW A;  2WBA A;  2OA1 A;  1DOD A;  2NVK X;  1FOH A;  3ATQ A;  2AR8 A;  4B66 A;  4YSY A;  1PXC A;  1JU2 A;  2XVE A;  4OPT A;  2X8C A;  3LZX A;  4H4W A;  2VRL A;  4USR A;  1E1N A;  3AEC A;  1GXF A;  1E7P A;  3D8X A;  4NTD A;  3SFD A;  4J56 A;  3C96 A;  1EBD A;  2WOV A;  3P4Q A;  4BK1 A;  5J7X A;  5JCN A;  2I0Z A;  3F8P A;  4NTE A;  2UZZ A;  1ZKQ A;  3UP4 A;  4EMJ A;  2ZZB A;  3WE0 A;  3AE5 A;  2IVE A;  4ZN0 A;  3KU9 A;  5ER0 A;  3DJD A;  2Y6Q A;  2QA2 A;  1JRZ A;  4H4Z A;  3UTE A;  3QSE A;  5CQF A;  1YQ3 A;  2BS2 A;  3NK2 X;  1F6M A;  1ZMC A;  3OC4 A;  1JNR A;  3NYC A;  2XLS A;  4FDC B;  1DOB A;  4B68 A;  1F8R A;  4YSZ A;  2JK6 A;  1H82 A;  1PHH A;  2FJA A;  3DGZ A;  4BJY A;  4C74 A;  2XVH A;  3QSM A;  5FS7 A;  3G5S A;  2BS3 A;  4BJZ A;  3ICR A;  2BCP A;  2VRM A;  1TRB A;  3S61 A;  4YXD A;  4GDP A;  1KFY A;  2YLW A;  4J31 A;  5KOW A;  3NN0 X;  3K30 A;  3UP5 A;  3SM8 A;  1CL0 A;  3BI2 A;  1GTE A;  3RHA A;  3NYE A;  2A87 A;  4CY6 A;  3C4N A;  2WET A;  4JN9 A;  4H4Y A;  1NDA A;  4CRT A;  3JSK A;  2C73 A;  2X99 A;  2A89 A;  3NYF A;  1TDK A;  1JOA A;  4CY8 A;  5BUK A;  3P4S A;  2R0P A;  5FS8 A;  5C3J A;  2ZZ0 A;  4H4V A;  3SQP A;  4J33 A;  2YWL A;  1K0J A;  2X8G A;  4Z2R A;  5KVH A;  2A8X A;  1QLB A;  1DXL A;  2YVG A;  4KPR A;  4RG3 A;  4Z2U A;  1F8W A;  1IUS A;  2XFO A;  1NAA A;  1N4V A;  3D1C A;  2IVD A;  1IUV A;  2WES A;  2WHD A;  4U2L A;  1D5T A;  1XDI A;  2JBV A;  3QJ4 A;  4LU6 A;  4XWZ A;  4B64 A;  4YKG A;  4Y4L A;  4EMW A;  3DK8 A;  4A6N B;  3GRT A;  2JAE A;  3NTA A;  1GRG A;  1V59 A;  3AEF A;  1PBF A;  1KNP A;  1D4E A;  4P9S A;  1L0V A;  4BK3 A;  3II4 A;  3NTD A;  1GPE A;  1MOK A;  2GAH B;  1MXT A;  2XLP A;  4U8M A;  2RGJ A;  1TYP A;  3EAO A;  4XWR A;  4OPL A;  1ZOV A;  1BZL A;  2ARD A;  4CBQ A;  3AEA A;  4YSH A;  2C75 A;  1PJ6 A;  3P9U A;  3L1R A;  4J34 A;  5DBJ A;  5IQ4 A;  4JY3 A;  4CCR A;  1ZOY A;  2J3N A;  2GQW A;  2BA9 A;  4JQ9 A;  4GRT A;  1P2H A;  1S3B A;  2GAG B;  2GR3 A;  1GRA A;  3L8K A;  1D7L A;  3FG2 P;  2XLU A;  1ZDL A;  3H4K A;  5FS9 A;  3M13 A;  4YTM A;  1CC6 A;  2YG5 A;  3ZDN A;  1JEH A;  5JCL A;  3CIR A;  1D7Y A;  4GCM A;  3CTY A;  4B65 A;  2CVJ A;  1GES A;  3Q9T A;  2CFY A;  4U2S A;  1CC2 A;  1HYU A;  1GAL A;  1LJ1 A;  3AYL A;  2BAC A;  4H4X A;  5EB4 A;  1XPQ A;  4O5Q A;  4A79 A;  4UDR A;  1AOG A;  2B9X A;  1CJC A;  2CUL A;  3RNM A;  1E1M A;  1OJC A;  3AE7 A;  3UKF A;  4AP3 A;  1CHU A;  2VOU A;  3PS9 A;  2WS3 A;  1B5Q A;  1FL2 A;  2QA1 A;  2VQ7 A;  4U8J A;  1Q1R A;  2AAQ A;  2E1M A;  3H8L A;  2YG3 A;  3IWA A;  2XFP A;  1N4U A;  3DJG X;  1Z6L A;  5JCK A;  2BYB A;  3LJP A;  3ITJ A;  4ICY A;  3VR8 A;  4U8I A;  1OJD A;  4DSH A;  2Y6R A;  1Q9I A;  4K7Z A;  1CJ4 A;  3AE1 A;  3FIM B;  1LTX R;  3AED A;  2WDR A;  3R9U A;  1BF3 A;  4U8P A;  1FEA A;  5HXI A;  2QCU A;  5HYM A;  3DME A; 
#chains in the Genus database with same CATH topology
 2YLX A;  3VC6 A;  3I6D A;  4Y4M A;  3UKL A;  3CK5 A;  2TMD A;  1H86 A;  3IJL A;  4FP1 A;  3I4K A;  1B4V A;  2YLZ A;  3BHK A;  5ENL A;  1E39 A;  4A65 A;  4EQX A;  3LXD A;  1SJB A;  3OTR A;  1YY5 A;  3ISH A;  2JB3 A;  3CN8 A;  3G5Q A;  4U8N A;  1COY A;  2X8H A;  4DN1 A;  2V61 A;  3TJI A;  1DNC A;  3I6T A;  3PO7 A;  3THU A;  2WOW A;  2MUC A;  4NEW A;  2OZT A;  4N9X A;  2QJM A;  3VC5 A;  3NNE A;  4IA6 A;  4XXG A;  4G6H A;  1D4C A;  3RGT A;  4TM1 A;  3P1W A;  1ZY8 A;  5L46 A;  1NHS A;  1NU5 A;  1MDR A;  1DJQ A;  2PS2 A;  2GR0 A;  4CNJ A;  4H4T A;  4WX1 A;  3AYJ A;  3ALL A;  3CMM A;  2VVM A;  3PWI A;  4C3Y A;  3V3N A;  1KDG A;  3AD8 B;  4KPL A;  2FJB A;  4USQ A;  2QVH A;  3UKH A;  4TLX A;  1UKV G;  3M12 A;  4DX3 A;  3UJF A;  3SN0 A;  1IUU A;  2QAE A;  2XVF A;  3AE4 A;  4B67 A;  4TVW A;  5M10 A;  4IT1 A;  2YVF A;  2Q7V A;  1PBD A;  5EOW A;  4I59 A;  4B69 A;  1S7M A;  4EWJ A;  1K0I A;  1L8P A;  2XLT A;  5U25 A;  2W55 A;  1CJ3 A;  3KA7 A;  4GUV A;  3MY9 A;  2YAU A;  1X31 B;  2EQ7 A;  3UOX A;  3FYY A;  5FJU A;  3TW9 A;  2RAB A;  4ECH A;  5KRQ A;  3IJI A;  1KNR A;  2PMQ A;  4ZCW A;  1L9D A;  3ICT A;  3PWG A;  1Y56 B;  2YR6 A;  3GYJ A;  3UKK A;  4HYR A;  1OJA A;  4GAV A;  1GSN A;  3ADA B;  3LOV A;  5IDZ A;  3HZL A;  4H2P A;  3T8Q A;  1SJD A;  4OPI A;  4OPG A;  4EQS A;  3A7R A;  4H1Z A;  2GF3 A;  3CXO A;  1GRE A;  1TDO A;  1ONF A;  3ICS A;  1PJ5 A;  2GGJ A;  2C66 A;  4LA1 A;  2YLT A;  4EQR A;  4Z25 A;  4CNK A;  5KMP A;  1EC9 A;  3VRA A;  2YQU A;  3HPF A;  1N5X A;  5M0Z A;  2OX4 A;  4E0V A;  1EL9 A;  1K0L A;  1PBC A;  1WYG A;  3PK7 A;  2BK4 A;  4JY2 A;  3SYI A;  1F3P A;  5TR3 A;  4U8K A;  2BC0 A;  2PHH A;  3T31 A;  3V3O A;  3NGC X;  4HPN A;  3ES8 A;  2PGE A;  4A5L A;  3DFY A;  3IHG A;  1BGN A;  4A9W A;  3ATR A;  1LVL A;  1VQZ A;  1P48 A;  2GR1 A;  3GD3 A;  1R6W A;  3UJR A;  3DES A;  4J2W A;  4JN8 A;  1KSU A;  2NPX A;  2OQH A;  4EQW A;  1JDF A;  3SN4 A;  3QVR A;  3UOZ A;  1BKH A;  1GT8 A;  4OVI A;  3T14 A;  1VDC A;  2R45 A;  3CNJ A;  1DOE A;  3UOY A;  2C64 A;  1IUW A;  3S5W A;  3V76 A;  2B76 A;  3LB8 A;  2V5Z A;  3VR9 A;  3E1T A;  1IJH A;  3AE2 A;  2GV8 A;  2VQB A;  3AN1 A;  2XFN A;  3B6D A;  2BAB A;  1JNZ A;  4BUR A;  3H8A A;  1PBE A;  3RIT A;  3QKE A;  1B8S A;  4Y4N A;  4H2N A;  1Y56 A;  2WBA A;  2NVK X;  3CB3 A;  2AR8 A;  1JU2 A;  4K1W A;  3LZX A;  4USR A;  3AEC A;  1E7P A;  3P3B A;  2GGE A;  5J7X A;  3UP4 A;  2ZZB A;  3N4F A;  2IVE A;  4ZN0 A;  5ER0 A;  3DJD A;  3R0U A;  2Y6Q A;  2BS2 A;  1JNR A;  2XLS A;  1PHH A;  1XS2 A;  3DGZ A;  4C74 A;  2XVH A;  2GDQ A;  2OFJ A;  3S5S A;  4BJZ A;  5KMQ A;  2NQL A;  4YXD A;  2YLW A;  3K30 A;  3UP5 A;  1EBH A;  2A87 A;  3FJ4 A;  3ZVI A;  3OP2 A;  2OZ3 A;  2C73 A;  3NYF A;  1TDK A;  5FS8 A;  4H4V A;  2X8G A;  5KVH A;  4KPR A;  1F8W A;  1IUS A;  3AMZ A;  2JBV A;  4XWZ A;  2QGY A;  3NTA A;  4TVY A;  5BOE A;  3AEF A;  2GAH B;  2XLP A;  3EAO A;  4OPL A;  4YSH A;  3V5F A;  1PJ6 A;  3P9U A;  4J34 A;  5DBJ A;  2J3N A;  4X2P A;  2BA9 A;  1S3B A;  2GAG B;  2GR3 A;  4KWS A;  4YTM A;  1D7L A;  3ZDN A;  1JEH A;  3CIR A;  3STP A;  4GCM A;  4H19 A;  1GES A;  3CAW A;  4ENL A;  2QQ6 A;  4O5Q A;  4IZG A;  4AP3 A;  4U8J A;  3UJE A;  1Q1R A;  1MDL A;  3LJP A;  4DSH A;  1CJ4 A;  1LTX R;  3AED A;  2WDR A;  2P8B A;  4EIP A;  3SZF A;  3KD9 A;  2AQJ A;  3SJN A;  1Y0P A;  1L9C A;  1IYX A;  4U8L A;  1KKR A;  5BUL A;  4ZCC A;  2XVJ A;  1NEL A;  5KVI A;  1TYT A;  1TDE A;  2XH0 A;  2FJE A;  2YG4 A;  5HHF A;  4H4P A;  1XHC A;  3GYX A;  1IUT A;  4AT2 A;  2FYM A;  3O0H A;  2WPF A;  1T3Q C;  2Z5X A;  1JRP A;  4Z43 A;  3GWD A;  3ETR B;  1GTH A;  2GSH A;  4II2 A;  1DJN A;  4OCG A;  3CNT A;  4A35 A;  1RSG A;  2R0G A;  2BCG G;  5KWF A;  1PBB A;  3QPE A;  1FFV C;  3MKC A;  3PFR A;  2GRT A;  4H2H A;  1GER A;  3AEG A;  3C4A A;  3GWF A;  5GSN A;  3FPZ A;  1MO9 A;  1X2G A;  4E4U A;  4X9M A;  4GDE A;  4RSL A;  3SX6 A;  3K7T A;  3G5R A;  1KF6 A;  1E9I A;  4IP5 A;  5JRB A;  4LII A;  3NK1 X;  3NG7 X;  3AB1 A;  4A6G A;  1ZX9 A;  4NTC A;  1CBO A;  1GRT A;  5KXJ A;  3ENL A;  5FMH A;  1H6V A;  2EQ8 A;  1QJD A;  4FK1 C;  5BRT A;  3OZ2 A;  1O94 A;  4TM0 A;  2VVL G;  4UDQ A;  3TOY A;  4JDR A;  3ABV A;  3UJ2 A;  3KKJ A;  3ALM A;  4ROP A;  5LV9 A;  3CGE A;  2PYX A;  1PN0 A;  3HRD C;  2PU1 A;  1TDF A;  4FK1 A;  3EEZ A;  4G8T A;  1REO A;  2W0H A;  1PJ7 A;  3F8D A;  4K22 A;  2PTY A;  1CJ2 A;  1BWC A;  4DYE A;  2WPC A;  5IPY A;  3MSY A;  5U63 A;  5FJP A;  1N1P A;  4H4S A;  3BHF A;  4HNL A;  2VVL A;  1BKW A;  2X50 A;  4APN A;  3UKA A;  3NRN A;  1STZ A;  2WP6 A;  1O95 A;  4IHC A;  2V6O A;  3M0O A;  4K5R A;  2BXR A;  6ENL A;  2RDX A;  1F9C A;  1SJA A;  2HQM A;  2VZ2 A;  2W3S A;  2BC1 A;  3V4B A;  5IQ1 A;  2YM1 A;  2OLN A;  3K1G A;  4C77 A;  2PCE A;  2XH2 A;  3NVV B;  2GMH A;  5C2T A;  3RR1 A;  3UKQ A;  3VCN A;  3SFE A;  3R1Z A;  1PDH A;  3DDM A;  3SZC A;  4H50 A;  1GRF A;  2R0C A;  2PTZ A;  3MQT A;  2YVJ A;  4HNC A;  3T37 A;  1EBG A;  4GGH A;  2BK5 A;  3CGD A;  1R0M A;  2GQF A;  1S2Q A;  1H7W A;  3NK0 X;  2C3D A;  1JRY A;  3P4P A;  1SEZ A;  3DEQ A;  5FJT A;  3OZY A;  4YTN A;  3RP6 A;  2C65 A;  2GH5 A;  1PDZ A;  4NEV A;  2PTX A;  1H7X A;  4GIR A;  3NKS A;  2QJN A;  3DER A;  3UCC A;  2QDE A;  3SQS A;  4IP4 A;  4Z1Y A;  2CDU A;  3V3W A;  3DK9 A;  4HN8 A;  2XVI A;  3MZN A;  1MRA A;  1VDV A;  4B63 A;  2OO6 A;  2ZZC A;  4EM3 A;  5KOX A;  1RVK A;  1ELI A;  4OPU A;  3NH3 X;  5GRT A;  1JRX A;  3K7Q X;  3FBS A;  4HA6 A;  3PVC A;  3BJS A;  1TDN A;  3N6H A;  2OG9 A;  4E8G A;  2AKZ A;  2ZBW A;  2GGH A;  1DOD A;  1MNS A;  4H4W A;  2VRL A;  4NTD A;  1EBD A;  2WOV A;  3P4Q A;  2UZZ A;  3TJ4 A;  3KU9 A;  2HXT A;  2QA2 A;  1JRZ A;  3UTE A;  3FVD A;  3QSE A;  1YQ3 A;  2ZAD A;  1EC7 A;  1ZMC A;  4E6M A;  3NYC A;  1DOB A;  1F8R A;  4YSZ A;  2FJA A;  4BJY A;  3G5S A;  1KCZ A;  2BS3 A;  3ICR A;  2BCP A;  4HCH A;  2VRM A;  1TRB A;  4GDP A;  1KFY A;  5G5G B;  3JW7 A;  1CL0 A;  1KN0 A;  2OVL A;  4GME A;  3NVY B;  3H12 A;  2XH4 A;  2WET A;  4JN9 A;  4H4Y A;  1NDA A;  4CRT A;  2A89 A;  5BUK A;  4CY8 A;  3P4S A;  2BRY A;  1K0J A;  1QLB A;  2YVG A;  4IL0 A;  1D5T A;  1XDI A;  3QJ4 A;  4LU6 A;  3FXG A;  4A6N B;  2MNR A;  3GRT A;  4IL2 A;  2JAE A;  3II4 A;  1GPE A;  1MOK A;  2RGJ A;  4XWR A;  3T2Y A;  1JCT A;  3TWA A;  2C75 A;  3L1R A;  4G73 A;  4JY3 A;  2GGG A;  2CHR A;  1TKK A;  2YG5 A;  2BRA A;  1D7Y A;  1CC2 A;  1GAL A;  1LJ1 A;  1PDY A;  3UXL A;  3H7V A;  2B9X A;  1CJC A;  4F4R A;  2WS3 A;  1FL2 A;  3CYJ A;  1KD0 A;  2AAQ A;  3UGV A;  3H8L A;  2YG3 A;  1N4U A;  3DJG X;  1Z6L A;  3ITJ A;  4K7Z A;  3FIM B;  1BQG A;  3R9U A;  5HXI A;  2QCU A;  2FKP A;  3DME A;  2C3C A;  3BI5 A;  3SXI A;  1VG9 A;  3SR6 B;  4TM4 A;  3UKP A;  2C72 A;  4KEM A;  5EBK A;  2DKH A;  1N63 C;  3HW2 A;  2H88 A;  3BNM A;  1CC4 A;  3PG6 A;  1W4X A;  2GEW A;  1H83 A;  3QFB A;  3AXB A;  1S3E A;  3DGB A;  1E1L A;  2GVC A;  5CKU A;  3EF6 A;  1TE6 A;  4O5U A;  3T4W A;  2EQ9 A;  2AL2 B;  3IF9 A;  3P4R A;  3UXK A;  1NEK A;  1E1K A;  3GMB A;  5BOF A;  1FEB A;  4G74 A;  1N60 C;  3NO1 A;  2P88 A;  3KVE A;  4J1O A;  4PAA A;  1CF3 A;  4YT0 A;  2I5Q A;  3CGC A;  2IID A;  1FHU A;  4FI4 A;  3CPH G;  1LPF A;  3VCC A;  3KPK A;  4GYP A;  1JPM A;  2W3R A;  2WP5 A;  1BGJ A;  2O9Z A;  1VRQ B;  3UJS A;  4IVO B;  1B37 A;  4A99 A;  3DJJ A;  1M6I A;  2AL1 A;  5G5H B;  2JB2 A;  4DXK A;  1RYI A;  3DIP A;  4DNA A;  2XDO A;  3JZU A;  3UCD A;  3AE8 A;  4JNA A;  1RP0 A;  4MGG A;  1XAN A;  3TTE A;  1H2I A;  1NG4 A;  1OJT A;  3AWI A;  1NHP A;  3UTF A;  4WCT A;  3D46 A;  4BK2 A;  2B7R A;  1PS9 A;  4H4R A;  2AKM A;  3KLJ A;  2YR4 A;  3DFH A;  2E5A A;  3HYW A;  3Q6J A;  2WU5 A;  2YLR A;  4G9K A;  3H70 A;  4K5S A;  1N5W C;  2C7G A;  2TPR A;  3B9J B;  3MWC A;  4GF7 A;  2E3T A;  3QLD A;  1NHR A;  3AD7 B;  1GRB A;  3QTP A;  3NT6 A;  3DH9 A;  3IC9 A;  4DWD A;  2R46 A;  4UDP A;  3NN6 X;  2OPJ A;  4AP1 A;  5J60 A;  3ZVH A;  3CT2 A;  3H8I A;  4MKS A;  2Q0K A;  3F8R A;  3A7U A;  2V3B A;  3BOX A;  4H4Q A;  2BXS A;  2RGH A;  1D4D A;  4D04 A;  2PP1 A;  3EAN A;  2AL2 A;  4JNQ A;  3RP7 A;  4IA5 A;  3OW1 A;  4H83 A;  2C70 A;  1ONE A;  4KT2 A;  3GD4 A;  4YKF A;  5KNL A;  4DGK A;  2V3A A;  3GC2 A;  3R0K A;  3CPJ G;  3GD6 A;  4G7F A;  1PXA A;  1Q1W A;  2PA6 A;  2POD A;  4I58 A;  4M52 A;  5FS6 A;  3RED A;  1GET A;  1GEU A;  3VRB A;  3DGH A;  3AE6 A;  3QSS A;  2GB0 A;  1H81 A;  3DG6 A;  4AOS A;  4K8G A;  4YWS A;  4AOX A;  2XFQ A;  4Z24 A;  3GYI A;  4Z44 A;  1FEC A;  1ZK7 A;  2V60 A;  2R9Z A;  1GND A;  3UOV A;  3DK4 A;  5EU9 A;  1NPX A;  1FO4 A;  2BK3 A;  2YLS A;  2GMJ A;  2RGO A;  3AEB A;  2QDD A;  4C3X A;  1VG0 A;  2YM2 A;  1GV4 A;  3RP8 A;  4KX6 A;  3CGB A;  1FCD A;  4H7U A;  4GFI A;  1ELS A;  3SN1 A;  4REK A;  2OZ8 A;  2XSX A;  2OLA A;  1N61 C;  3SZW A;  3U4F A;  3LZW A;  5KMR A;  4X9N A;  3GRS A;  3IHM A;  4Z26 A;  2OKT A;  1TZZ A;  4ZCD A;  1E6E A;  4J57 A;  4AT0 A;  3NVW B;  2H89 A;  1V97 A;  4K8D A;  2Q6U A;  3UCL A;  2OQY A;  2OA1 A;  4B66 A;  2P0I A;  4MMW A;  1ZXI C;  1GXF A;  3SFD A;  4E4F A;  3CXB A;  3C96 A;  1FIQ B;  2HNE A;  2C4C A;  5JCN A;  2I0Z A;  3V5C A;  1ZKQ A;  3AE5 A;  4H4Z A;  3FCP A;  3OC4 A;  1H82 A;  4GGB A;  4E5T A;  1FFU C;  4J31 A;  5KOW A;  3NN0 X;  4HCL A;  3BI2 A;  1GTE A;  4NNJ A;  3NYE A;  2X99 A;  3OZM A;  2R0P A;  2HZG A;  3SQP A;  4J33 A;  2YWL A;  3T6C A;  4RG3 A;  1NAA A;  2IVD A;  1IUV A;  2WES A;  2WHD A;  4U2L A;  3VFC A;  4DHG A;  3DK8 A;  3L5O A;  1GRG A;  1KNP A;  1L0V A;  4BK3 A;  4J3Z A;  3R10 A;  2PSN A;  4U8M A;  3R11 A;  1BZL A;  3AEA A;  1RM6 B;  2GQW A;  4GRT A;  1P2H A;  3M13 A;  3H4K A;  2POZ A;  2XH7 A;  1CC6 A;  5JCL A;  3CTY A;  2CVJ A;  3Q9T A;  4ZOH B;  2CFY A;  1HYU A;  2PU0 A;  3AYL A;  2BAC A;  4H4X A;  1XPQ A;  4UDR A;  3BSM A;  1AOG A;  2CUL A;  1OJC A;  3AE7 A;  3UKF A;  2GL5 A;  2O56 A;  1B5Q A;  4GIS A;  2PTW A;  2VQ7 A;  2E1M A;  3IWA A;  4M6U A;  2BYB A;  3VR8 A;  3DG7 A;  3NXL A;  2Y6R A;  1KKO A;  1Q9I A;  5FJO A;  1FEA A;  4A6N A;  1ZMD A;  3RCY A;  3OPS A;  3JVA A;  3NLC A;  4RG4 A;  1K4Q A;  4EMI A;  1EL7 A;  1GRH A;  4Z17 A;  4ZA0 A;  3GDN A;  3D47 A;  5KMS A;  4X4J A;  1M64 A;  2BS4 A;  4IV9 A;  2FBW A;  4JN7 A;  4PAB A;  1IUX A;  3D9X A;  3NHO X;  1XPY A;  1N62 C;  4IVM B;  3K7M X;  2B9W A;  4YSX A;  2PGW A;  3RO6 A;  3R25 A;  3QN3 A;  1NEN A;  1L9E A;  2B9Y A;  1EL5 A;  3DA1 A;  2Q0L A;  2R4J A;  1X2H A;  3LAD A;  3SSZ A;  2ZC8 A;  4H2Q A;  1KSS A;  4J36 A;  2DKI A;  1QO8 A;  1P43 A;  2WP9 A;  2XFU A;  2OAL A;  1ECQ A;  2Z5Y A;  3BI4 A;  2WPE A;  2ACZ A;  2OLO A;  2WDV A;  3ES7 A;  3GMC A;  4G6G A;  1W6T A;  4TM3 A;  4YTP A;  4FX9 A;  3URH A;  2DW6 A;  1FHV A;  4A3R A;  3GSI A;  4H4U A;  2WU2 A;  4UP3 A;  4EM4 A;  2X3N A;  2E5V A;  3R07 C;  4TLZ A;  2GR2 A;  3ZYX A;  2W54 A;  4M0X A;  3EUB 3;  5U1O A;  2JB1 A;  3VRD B;  1NHQ A;  3CPI G;  1YKJ A;  2WEU A;  1JRO A;  3B97 A;  3CNP A;  4EIQ A;  3COX A;  2FJD A;  3KPF A;  4JHM A;  3SGL A;  1ZP0 A;  3A7A A;  4D03 A;  3I6E A;  3AD9 B;  2B7S A;  4NZH A;  2XLR A;  2EQ6 A;  2APG A;  3TQP A;  4H2R A;  4K2S A;  1JPD X;  1H84 A;  1DOC A;  4U8O A;  3VA8 A;  3FMW A;  2YG6 A;  4BV6 A;  4GR1 A;  3EPT A;  2WQY A;  4GYP C;  5JCM A;  4DSG A;  3Q45 A;  1YQ4 A;  3UTH A;  3P0W A;  7ENL A;  1EC8 A;  3CNS A;  3GDP A;  3I3L A;  1S2Y A;  3AE9 A;  2WOI A;  5FJR A;  3TCS A;  2R4E A;  2YG7 A;  4CCQ A;  1SB3 B;  3NIX A;  5BVA A;  2OAM A;  3BNU A;  1NG3 A;  3DJE A;  4K2X A;  2JKC A;  3SZ0 A;  3ZLG A;  2DW7 A;  1EL8 A;  1LQU A;  4MJW A;  1GOS A;  2XYO A;  5EB5 A;  1O5W A;  2C67 A;  3GO2 A;  4NWZ A;  4B1B A;  3T2K A;  1WUF A;  2QJJ A;  3VDG A;  2WDQ A;  1P2E A;  4A7A A;  3TWB A;  3AEE A;  3QVP A;  1PXB A;  3ALJ A;  3HYX A;  4GAP A;  3QFA A;  4HCD A;  3UTG A;  1N4W A;  2F5Z A;  5HY5 A;  3AE3 A;  3CND A;  4U2T A;  1WUE A;  3B3R A;  3VQR A;  1YQZ A;  3FV9 A;  2XGZ A;  3U9I A;  4OPD A;  4YWO A;  3DG3 A;  4C5O A;  3NS1 B;  2P3Z A;  4HB9 A;  1LV0 A;  4Z2T A;  5J04 A;  4II3 A;  3P93 A;  3MUC A;  3NZG A;  4OPC A;  2C76 A;  3AYI A;  4ADW A;  5JCI A;  3GY1 A;  1OJ9 A;  2E4G A;  3IJQ A;  2PP0 A;  2XCG A;  3KUM A;  2YR5 A;  3SY4 A;  3N6J A;  1VQW A;  2HXU A;  1F8S A;  1LQT A;  3T2Z A;  3ATQ A;  1FOH A;  3IK4 A;  1MUC A;  4YSY A;  1PXC A;  1DTN A;  2XVE A;  4OPT A;  2P8C A;  2X8C A;  3SBF A;  1E1N A;  3NVZ B;  3D8X A;  4J56 A;  4BK1 A;  3F8P A;  4NTE A;  4EMJ A;  3WE0 A;  2ONE A;  5CQF A;  3NFU A;  3NK2 X;  1F6M A;  4FDC B;  4B68 A;  2JK6 A;  3T9P A;  5FS7 A;  3QSM A;  3NRZ B;  3S61 A;  3SM8 A;  3ZVH B;  3RHA A;  4CY6 A;  3C4N A;  3JSK A;  1JOA A;  5C3J A;  2ZZ0 A;  3Q4D A;  3RRA A;  3HYV A;  4Z2R A;  2A8X A;  1DXL A;  1YEY A;  3AM9 A;  4Z2U A;  2XFO A;  3D1C A;  1N4V A;  1SJC A;  4B64 A;  4YKG A;  4Y4L A;  4EMW A;  3EKG A;  1V59 A;  1PBF A;  1D4E A;  4P9S A;  3NTD A;  1OEP A;  1MXT A;  2PP3 A;  1TYP A;  1ZOV A;  3ZLH A;  4CBQ A;  2ARD A;  2GGI A;  5IQ4 A;  4CCR A;  1ZOY A;  4JQ9 A;  1GRA A;  3L8K A;  3FG2 P;  2XLU A;  1ZDL A;  5FS9 A;  3S47 A;  4B65 A;  4U2S A;  5EB4 A;  4A79 A;  2PPG A;  3RNM A;  1E1M A;  1CHU A;  2VOU A;  3PS9 A;  2QA1 A;  2XFP A;  3N4E A;  5JCK A;  4ICY A;  4U8I A;  1OJD A;  3ZLF A;  3AE1 A;  1BF3 A;  4U8P A;  3T0K A;  5HYM A; 
#chains in the Genus database with same CATH homology
 2YLX A;  2C3C A;  3BI5 A;  3I6D A;  4A6N A;  1ZMD A;  4Y4M A;  3UKL A;  4EIP A;  3SXI A;  1VG9 A;  2TMD A;  4TM4 A;  3UKP A;  1H86 A;  3NLC A;  2C72 A;  4RG4 A;  3SZF A;  1K4Q A;  5EBK A;  2DKH A;  3KD9 A;  4EMI A;  1EL7 A;  1B4V A;  2YLZ A;  3BHK A;  2H88 A;  3BNM A;  1GRH A;  1E39 A;  2AQJ A;  1CC4 A;  4A65 A;  4EQX A;  3LXD A;  1Y0P A;  1L9C A;  3GDN A;  4U8L A;  5KMS A;  3PG6 A;  1W4X A;  4X4J A;  5BUL A;  1M64 A;  2BS4 A;  4ZCC A;  2XVJ A;  2GEW A;  4IV9 A;  1H83 A;  2FBW A;  5KVI A;  1YY5 A;  1TYT A;  1TDE A;  1IUX A;  2FJE A;  2YG4 A;  4PAB A;  5HHF A;  3D9X A;  3QFB A;  2JB3 A;  3ISH A;  3NHO X;  4H4P A;  1XHC A;  3AXB A;  3GYX A;  1IUT A;  1S3E A;  3CN8 A;  3G5Q A;  4IVM B;  3K7M X;  2B9W A;  4AT2 A;  4YSX A;  1E1L A;  4U8N A;  1COY A;  3O0H A;  2GVC A;  5CKU A;  2X8H A;  2WPF A;  3EF6 A;  4O5U A;  1NEN A;  1L9E A;  2EQ9 A;  2V61 A;  2B9Y A;  3IF9 A;  1EL5 A;  1DNC A;  2Z5X A;  3P4R A;  3DA1 A;  2Q0L A;  3PO7 A;  4Z43 A;  1NEK A;  3GWD A;  1E1K A;  1GTH A;  2R4J A;  3LAD A;  2WOW A;  4NEW A;  3GMB A;  4II2 A;  1DJN A;  4OCG A;  4N9X A;  1FEB A;  3CNT A;  4H2Q A;  1RSG A;  2R0G A;  4G74 A;  2BCG G;  1KSS A;  3NNE A;  4IA6 A;  5KWF A;  4XXG A;  1PBB A;  1D4C A;  4G6H A;  4J36 A;  2DKI A;  3KVE A;  1QO8 A;  4PAA A;  4TM1 A;  1CF3 A;  4YT0 A;  2WP9 A;  2GRT A;  3CGC A;  2IID A;  3P1W A;  2XFU A;  2OAL A;  1GER A;  1ZY8 A;  2Z5Y A;  3BI4 A;  2WPE A;  5L46 A;  1NHS A;  2ACZ A;  2OLO A;  3AEG A;  1LPF A;  3C4A A;  3CPH G;  3GWF A;  3KPK A;  2WDV A;  5GSN A;  1DJQ A;  3FPZ A;  1MO9 A;  3GMC A;  4G6G A;  2WP5 A;  2GR0 A;  1BGJ A;  2O9Z A;  1VRQ B;  4TM3 A;  4YTP A;  4X9M A;  4CNJ A;  4FX9 A;  4H4T A;  1B37 A;  4GDE A;  3AYJ A;  3ALL A;  3CMM A;  4IVO B;  4RSL A;  4WX1 A;  3SX6 A;  4A99 A;  2VVM A;  3K7T A;  3DJJ A;  3G5R A;  3URH A;  1KF6 A;  4C3Y A;  1M6I A;  3GSI A;  4H4U A;  2WU2 A;  4UP3 A;  5JRB A;  2JB2 A;  4LII A;  4EM4 A;  1RYI A;  3NK1 X;  2X3N A;  4DNA A;  2E5V A;  3NG7 X;  3AB1 A;  3V3N A;  2XDO A;  1ZX9 A;  1KDG A;  3AD8 B;  4NTC A;  3AE8 A;  2FJB A;  4JNA A;  4USQ A;  1CBO A;  1RP0 A;  4TLZ A;  3UKH A;  1XAN A;  2GR2 A;  1GRT A;  4TLX A;  3ZYX A;  5KXJ A;  1UKV G;  5FMH A;  1H2I A;  3M12 A;  1H6V A;  2EQ8 A;  1NG4 A;  5U1O A;  1OJT A;  2JB1 A;  3AWI A;  1IUU A;  1NHP A;  3UTF A;  3VRD B;  1NHQ A;  4WCT A;  2QAE A;  2XVF A;  1QJD A;  3CPI G;  4BK2 A;  3AE4 A;  4FK1 C;  4B67 A;  1YKJ A;  2B7R A;  5BRT A;  1PS9 A;  4H4R A;  2WEU A;  1O94 A;  3OZ2 A;  4TM0 A;  5M10 A;  2YVF A;  3KLJ A;  2VVL G;  3CNP A;  4UDQ A;  2YR4 A;  2Q7V A;  4EIQ A;  1PBD A;  3ABV A;  4JDR A;  3COX A;  3HYW A;  4I59 A;  2FJD A;  3KPF A;  5EOW A;  4B69 A;  1S7M A;  3Q6J A;  2WU5 A;  3KKJ A;  2YLR A;  3ALM A;  3SGL A;  1ZP0 A;  4G9K A;  5LV9 A;  3CGE A;  4K5S A;  1K0I A;  2PYX A;  4D03 A;  1PN0 A;  3AD9 B;  2C7G A;  2TPR A;  2B7S A;  4GF7 A;  1TDF A;  4NZH A;  2XLT A;  5U25 A;  2XLR A;  1NHR A;  2EQ6 A;  1GRB A;  3AD7 B;  4FK1 A;  3NT6 A;  3DH9 A;  1CJ3 A;  1REO A;  2W0H A;  3IC9 A;  1PJ7 A;  3F8D A;  2APG A;  4K22 A;  3KA7 A;  4GUV A;  1CJ2 A;  1BWC A;  2R46 A;  4H2R A;  4UDP A;  2YAU A;  1X31 B;  3NN6 X;  1H84 A;  2WPC A;  2EQ7 A;  3UOX A;  5IPY A;  4AP1 A;  5J60 A;  1DOC A;  5U63 A;  4U8O A;  2RAB A;  1N1P A;  2YG6 A;  3FMW A;  3H8I A;  4H4S A;  2Q0K A;  3F8R A;  4ECH A;  5KRQ A;  4H4Q A;  2V3B A;  3BHF A;  2VVL A;  1KNR A;  2BXS A;  4BV6 A;  4GR1 A;  3EPT A;  1L9D A;  2RGH A;  2WQY A;  1BKW A;  1D4D A;  4D04 A;  3ICT A;  1Y56 B;  2YR6 A;  5JCM A;  3GYJ A;  3UKK A;  4DSG A;  1YQ4 A;  2X50 A;  3UTH A;  4APN A;  3UKA A;  1OJA A;  3EAN A;  4GAV A;  3NRN A;  1GSN A;  3ADA B;  3CNS A;  2WP6 A;  3GDP A;  3LOV A;  1O95 A;  3I3L A;  4JNQ A;  2V6O A;  3RP7 A;  4IA5 A;  2C70 A;  3HZL A;  1S2Y A;  3M0O A;  4H2P A;  4K5R A;  3AE9 A;  2WOI A;  4OPI A;  4OPG A;  4EQS A;  2BXR A;  3GD4 A;  2GF3 A;  4YKF A;  1GRE A;  1TDO A;  1ONF A;  2HQM A;  2R4E A;  2YG7 A;  2VZ2 A;  3ICS A;  5KNL A;  4DGK A;  1PJ5 A;  4CCQ A;  2C66 A;  4LA1 A;  2BC1 A;  2V3A A;  4EQR A;  2YLT A;  3NIX A;  5IQ1 A;  4Z25 A;  2YM1 A;  2OLN A;  4CNK A;  5KMP A;  5BVA A;  2OAM A;  3BNU A;  3CPJ G;  1NG3 A;  3DJE A;  4C77 A;  1PXA A;  1Q1W A;  3VRA A;  2GMH A;  4I58 A;  4M52 A;  5FS6 A;  4K2X A;  5C2T A;  2YQU A;  2JKC A;  3RED A;  3SZ0 A;  1GET A;  1GEU A;  1EL8 A;  1LQU A;  3VRB A;  4MJW A;  3DGH A;  1GOS A;  3AE6 A;  5M0Z A;  3UKQ A;  2XYO A;  5EB5 A;  3QSS A;  3SFE A;  1PDH A;  1O5W A;  4E0V A;  2C67 A;  1EL9 A;  1K0L A;  2GB0 A;  1PBC A;  1H81 A;  2BK4 A;  4JY2 A;  3SZC A;  3SYI A;  4H50 A;  1F3P A;  1GRF A;  2R0C A;  4NWZ A;  5TR3 A;  4U8K A;  4B1B A;  2BC0 A;  2YVJ A;  2PHH A;  3T31 A;  4AOS A;  3T2K A;  3V3O A;  3T37 A;  3NGC X;  2BK5 A;  2WDQ A;  3CGD A;  1P2E A;  4A5L A;  4AOX A;  3IHG A;  2XFQ A;  4A7A A;  2GQF A;  1BGN A;  4Z24 A;  1S2Q A;  3AEE A;  4A9W A;  3GYI A;  1H7W A;  3QVP A;  4Z44 A;  3NK0 X;  3ATR A;  1FEC A;  1PXB A;  3ALJ A;  2C3D A;  3HYX A;  1JRY A;  1LVL A;  4GAP A;  1ZK7 A;  2GR1 A;  3QFA A;  3UTG A;  3P4P A;  3GD3 A;  2V60 A;  1N4W A;  2F5Z A;  1SEZ A;  2R9Z A;  1GND A;  3UOV A;  5HY5 A;  3AE3 A;  4YTN A;  3CND A;  3RP6 A;  3DK4 A;  4U2T A;  2C65 A;  2GH5 A;  4NEV A;  3B3R A;  4J2W A;  3VQR A;  1NPX A;  2BK3 A;  1H7X A;  2YLS A;  2GMJ A;  1KSU A;  1YQZ A;  2RGO A;  3AEB A;  3NKS A;  2NPX A;  4OPD A;  4YWO A;  4C5O A;  4C3X A;  1VG0 A;  4EQW A;  4HB9 A;  2YM2 A;  1LV0 A;  1GV4 A;  3QVR A;  3RP8 A;  1GT8 A;  4KX6 A;  3UOZ A;  4Z2T A;  4II3 A;  3CGB A;  1FCD A;  4OVI A;  4H7U A;  3T14 A;  2CDU A;  1VDC A;  2R45 A;  3CNJ A;  1DOE A;  3DK9 A;  4REK A;  3UOY A;  4OPC A;  2C64 A;  2XVI A;  1IUW A;  3S5W A;  2C76 A;  3V76 A;  3AYI A;  2B76 A;  4B63 A;  4ADW A;  3LB8 A;  2ZZC A;  2V5Z A;  3SZW A;  4EM3 A;  5JCI A;  5KOX A;  3LZW A;  3VR9 A;  5KMR A;  4X9N A;  3E1T A;  1ELI A;  1IJH A;  3GRS A;  3AE2 A;  3IHM A;  4OPU A;  4Z26 A;  1OJ9 A;  2GV8 A;  3NH3 X;  5GRT A;  2E4G A;  2VQB A;  2XFN A;  4ZCD A;  3B6D A;  2BAB A;  1JRX A;  1JNZ A;  1E6E A;  3K7Q X;  3FBS A;  4J57 A;  2XCG A;  4HA6 A;  4AT0 A;  3PVC A;  2YR5 A;  3SY4 A;  2H89 A;  4BUR A;  1TDN A;  1PBE A;  1VQW A;  4K8D A;  1F8S A;  2Q6U A;  1LQT A;  1B8S A;  4Y4N A;  3UCL A;  4H2N A;  3T2Z A;  1Y56 A;  2ZBW A;  2WBA A;  2OA1 A;  1DOD A;  2NVK X;  1FOH A;  3ATQ A;  2AR8 A;  4B66 A;  4YSY A;  1PXC A;  1JU2 A;  2XVE A;  4OPT A;  2X8C A;  3LZX A;  4H4W A;  2VRL A;  4USR A;  1E1N A;  3AEC A;  1GXF A;  1E7P A;  3D8X A;  4NTD A;  3SFD A;  4J56 A;  3C96 A;  1EBD A;  2C4C A;  2WOV A;  3P4Q A;  4BK1 A;  5J7X A;  5JCN A;  2I0Z A;  3F8P A;  4NTE A;  2UZZ A;  1ZKQ A;  3UP4 A;  4EMJ A;  2ZZB A;  3WE0 A;  3AE5 A;  2IVE A;  4ZN0 A;  3KU9 A;  5ER0 A;  3DJD A;  2Y6Q A;  2QA2 A;  1JRZ A;  4H4Z A;  3UTE A;  3QSE A;  5CQF A;  1YQ3 A;  2BS2 A;  3NK2 X;  1F6M A;  1ZMC A;  3OC4 A;  1JNR A;  3NYC A;  2XLS A;  4FDC B;  1DOB A;  4B68 A;  1F8R A;  4YSZ A;  2JK6 A;  1H82 A;  1PHH A;  2FJA A;  3DGZ A;  4BJY A;  4C74 A;  2XVH A;  3QSM A;  5FS7 A;  3G5S A;  2BS3 A;  4BJZ A;  3ICR A;  2BCP A;  5KMQ A;  2VRM A;  1TRB A;  3S61 A;  4YXD A;  4GDP A;  1KFY A;  2YLW A;  4J31 A;  5KOW A;  3NN0 X;  3K30 A;  3UP5 A;  3SM8 A;  1CL0 A;  3BI2 A;  1KN0 A;  1GTE A;  3RHA A;  4NNJ A;  3NYE A;  2A87 A;  4CY6 A;  3C4N A;  2WET A;  4JN9 A;  4H4Y A;  1NDA A;  4CRT A;  3JSK A;  2C73 A;  2X99 A;  2A89 A;  3NYF A;  1TDK A;  1JOA A;  4CY8 A;  5BUK A;  3P4S A;  2R0P A;  5FS8 A;  5C3J A;  2ZZ0 A;  4H4V A;  3SQP A;  2BRY A;  4J33 A;  2YWL A;  1K0J A;  2X8G A;  3HYV A;  4Z2R A;  5KVH A;  2A8X A;  1QLB A;  1DXL A;  2YVG A;  4KPR A;  4RG3 A;  4Z2U A;  1F8W A;  1IUS A;  2XFO A;  1NAA A;  1N4V A;  3D1C A;  2IVD A;  1IUV A;  2WES A;  2WHD A;  4U2L A;  1D5T A;  1XDI A;  2JBV A;  3QJ4 A;  4LU6 A;  4XWZ A;  4B64 A;  4YKG A;  4Y4L A;  4EMW A;  3DK8 A;  3L5O A;  4A6N B;  3GRT A;  2JAE A;  3NTA A;  1GRG A;  1V59 A;  3AEF A;  1PBF A;  1KNP A;  1D4E A;  4P9S A;  1L0V A;  4BK3 A;  3II4 A;  3NTD A;  1GPE A;  1MOK A;  2GAH B;  1MXT A;  2XLP A;  4U8M A;  2RGJ A;  1TYP A;  3EAO A;  4XWR A;  4OPL A;  3T2Y A;  1ZOV A;  1BZL A;  2ARD A;  4CBQ A;  3AEA A;  4YSH A;  2C75 A;  1PJ6 A;  3P9U A;  3L1R A;  4J34 A;  5DBJ A;  4G73 A;  4JY3 A;  5IQ4 A;  4CCR A;  1ZOY A;  2J3N A;  2GQW A;  2BA9 A;  4JQ9 A;  4GRT A;  1P2H A;  1S3B A;  2GAG B;  2GR3 A;  1GRA A;  3L8K A;  1D7L A;  3FG2 P;  2XLU A;  1ZDL A;  3H4K A;  5FS9 A;  3M13 A;  4YTM A;  1CC6 A;  2YG5 A;  2BRA A;  3ZDN A;  1JEH A;  5JCL A;  3CIR A;  1D7Y A;  4GCM A;  3CTY A;  4B65 A;  2CVJ A;  1GES A;  3Q9T A;  2CFY A;  4U2S A;  1CC2 A;  1HYU A;  1GAL A;  1LJ1 A;  3AYL A;  2BAC A;  4H4X A;  5EB4 A;  1XPQ A;  4O5Q A;  4A79 A;  4UDR A;  1AOG A;  2B9X A;  1CJC A;  2CUL A;  3RNM A;  1E1M A;  1OJC A;  3AE7 A;  3UKF A;  4AP3 A;  1CHU A;  2VOU A;  3PS9 A;  2WS3 A;  1B5Q A;  1FL2 A;  2QA1 A;  2VQ7 A;  4U8J A;  1Q1R A;  2AAQ A;  2E1M A;  3H8L A;  2YG3 A;  3IWA A;  2XFP A;  1N4U A;  3DJG X;  1Z6L A;  5JCK A;  2BYB A;  3LJP A;  3ITJ A;  4ICY A;  3VR8 A;  4U8I A;  1OJD A;  4DSH A;  2Y6R A;  1Q9I A;  4K7Z A;  1CJ4 A;  3AE1 A;  3FIM B;  1LTX R;  3AED A;  2WDR A;  3R9U A;  1BF3 A;  4U8P A;  1FEA A;  3T0K A;  5HXI A;  2QCU A;  5HYM A;  3DME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...