1NHSA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 137
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhsA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA02
2OLOA 3BHFA 4H2PA 1GPEA 4X9MA 1Y0PA 2GAGB 2YLZA 2BS3A 4JNQA 3UKPA 3UKHA 3DGZA 2YLWA 3BI4A 3ZDNA 3UOXA 5KVIA 1PXCA 2R0CA 1XHCA 5FS6A 1IUXA 3UTEA 1KDGA 1M64A 2Q0KA 2XVIA 1IUUA 2PYXA 5BVAA 1NHSA 2BC1A 2BC0A 4EIQA 4WX1A 2Z5YA 2EQ7A 3I6DA 3LADA 1VDCA 5C3JA 4JDRA 3AE9A 4K2XA 2XDOA 4A99A 2XVJA 3DJGX 2F5ZA 5EBKA 1IUWA 4K5SA 3AEEA 1TYTA 2Q6UA 3FBSA 1Q9IA 4EQWA 1H83A 4USQA 3VR9A 4NTCA 3QVRA 4U8MA 4BJZA 2JKCA 2PHHA 1GV4A 2X99A 2C67A 2RGOA 3PO7A 2RABA 3Q6JA 2GB0A 2B7SA 4I59A 1PJ6A 3P1WA 2NPXA 4U8OA 2C72A 3HZLA 1GXFA 4JQ9A 3NRNA 4CRTA 1CC4A 1GTEA 2OAMA 2WESA 4Y4LA 3ZYXA 2B9XA 4B68A 1SEZA 3CGBA 3AEGA 5KOWA 3GRTA 2IVDA 2C66A 2YR4A 3NTAA 4GF7A 3SGLA 4CBQA 4H4TA 5EB4A 1MOKA 2YQUA 1LTXR 4H4SA 3BI5A 3RP7A 5BUKA 2QCUA 2ZZCA 4J2WA 3GRSA 3DJJA 3NLCA 4H7UA 1H7XA 1S2QA 4NZHA 2EQ9A 4OPIA 2EQ6A 2DKHA 3NTDA 1LQTA 2GF3A 2UZZA 3IHMA 3KLJA 1B8SA 3AE8A 4GUVA 3ICSA 3BNMA 4KX6A 2XLRA 4U8IA 4Y4NA 1NDAA 2CVJA 3KA7A 3ALJA 4XWZA 1N4UA 2RGJA 3M13A 4Z43A 4JN9A 1DXLA 2A87A 2V3AA 1N4VA 4OCGA 4TLXA 2WETA 3SFDA 2VVLG 3CGCA 3NIXA 3GD3A 2B9WA 4K7ZA 1BWCA 3AE2A 3AE6A 4Z2UA 3DK8A 4NEWA 2W0HA 1GOSA 2EQ8A 3GDNA 3KKJA 1GRBA 1H81A 4FK1C 4GDEA 2WEUA 1JRYA 1BGJA 1JNRA 1TYPA 2YR5A 3BHKA 2E5VA 3AD8B 4HA6A 3LOVA 1CC2A 1YQ3A 4OPUA 2O9ZA 4OPCA 5CKUA 1YQ4A 3K30A 2X8CA 2YLRA 4YSZA 3UTGA 4H4WA 2Q7VA 3KVEA 3UKKA 3UTFA 1D7LA 1PJ7A 2VRMA 4AOXA 1CL0A 1Y56A 1PN0A 3UKLA 4YXDA 5FMHA 2NVKX 2CDUA 1NAAA 1PXAA 2R45A 1KFYA 2WPCA 3QJ4A 3ATRA 3KU9A 3C96A 2WP6A 3RP6A 1YQZA 2C75A 2GVCA 2TPRA 2H88A 1LVLA 4H50A 4UDPA 1JRXA 1FL2A 1GRHA 2APGA 2XVEA 1IJHA 2R4JA 1OJDA 2OLNA 4HB9A 2YVJA 3NH3X 5M10A 1JRZA 1FEAA 3IC9A 1QO8A 1FECA 2XYOA 2OA1A 4Z24A 3S61A 4JNAA 3F8RA 2XLSA 4B63A 3CPJG 1KF6A 2BS4A 2R4EA 1DODA 1NG3A 3CN8A 1F3PA 1RP0A 4LA1A 3ADAB 2WDVA 3EANA 2E4GA 3UP5A 1OJ9A 5KWFA 2YG3A 4Z2RA 2VQ7A 3AD9B 4J56A 4B67A 2WHDA 2Y6RA 1H6VA 2WDQA 2XCGA 3ISHA 2ACZA 3UOVA 1CJ4A 4J34A 2XLUA 3UOZA 1TDKA 3GDPA 1DJQA 1ZK7A 3P4SA 4CCQA 4DGKA 4CNJA 2JAEA 3AWIA 3S5WA 4U2TA 4ECHA 1VQWA 3KPFA 1ZOVA 4NTEA 5J60A 4K8DA 4B1BA 1L9EA 1GTHA 1DOEA 2VOUA 2H89A 2XFUA 3AE4A 1JU2A 1E39A 2X8HA 1K0LA 3RNMA 3CPHG 4OPLA 2OALA 3EAOA 4EIPA 5KRQA 1RSGA 2XFQA 3F8DA 3OZ2A 4AP3A 4CCRA 2WPEA 1E6EA 4GRTA 1F6MA 4D03A 2FJAA 3GYIA 4GR1A 3QSSA 5GRTA 1KNPA 3M12A 1NHPA 3AYJA 3G5RA 3DK9A 4U8LA 4YTMA 4H4RA 4H4QA 4Z26A 1NPXA 1GESA 1H7WA 2CULA 3IWAA 2GAHB 3AECA 4XXGA 4CY8A 1XDIA 2A89A 3AE3A 2YLTA 3NT6A 1ZY8A 1ZMCA 3ICTA 1VG9A 4H4PA 2BYBA 1L0VA 2AQJA 1NG4A 4TM0A 4AP1A 3DK4A 4H2QA 2GH5A 1CJ3A 4IV9A 3AE1A 4B65A 3QSMA 3NGCX 3RP8A 4REKA 2R46A 3P4RA 2QA1A 1GRTA 1FCDA 1GSNA 3QFAA 3AEDA 3FMWA 3NN6X 3AD7B 1S3EA 2V60A 4H2NA 2YVFA 3GD4A 5HXIA 1EL9A 2GV8A 1N4WA 1BZLA 4NEVA 1TDFA 3COXA 2V6OA 1EBDA 1O94A 1O95A 2YR6A 2GQFA 1O5WA 3CNDA 3FPZA 3M0OA 1ZKQA 1OJTA 1AOGA 5JCKA 3LZXA 1XPQA 4GCMA 3VQRA 1NHQA 4B64A 3DJEA 1N1PA 3AE5A 3CGDA 1NEKA 4ADWA 2GQWA 4TM1A 4Z2TA 2YG7A 1ZP0A 1M6IA 4K22A 2C3CA 3PVCA 1ELIA 4J33A 4OPGA 2C76A 4IVMB 4H2RA 3CNPA 3AEAA 3UTHA 2V3BA 3PS9A 4Z44A 3VRBA 3AE7A 4IA5A 4J57A 4EQSA 4O5QA 5DBJA 1Z6LA 2BA9A 3VRDB 1V59A 4USRA 1F8SA 2YAUA 5HHFA 3I3LA 4A7AA 4U2SA 1YY5A 4DNAA 4YTPA 3AXBA 1MO9A 2C70A 1TRBA 1TDEA 4A5LA 1X31B 4UDQA 4APNA 2B76A 1GETA 3FIMB 1YKJA 3GSIA 4ZCDA 4YTNA 3CNJA 1E1KA 1HYUA 2BK5A 2J3NA 1REOA 2BXSA 1H86A 2BCPA 3R9UA 4A6NA 3P9UA 2YG5A 4H4UA 5CQFA 2YG6A 5KOXA 2ARDA 5KXJA 2X8GA 4A9WA 2WPFA 3CTYA 1JOAA 3UOYA 3NG7X 3L8KA 1K0JA 2WDRA 1Q1RA 3BI2A 2YG4A 2R9ZA 3D8XA 1CC6A 3Q9TA 4U8PA 1ZOYA 3K7QX 2FBWA 1CJ2A 2JB1A 3NK0X 1PDHA 1K4QA 1GRFA 4NTDA 3GYJA 3LB8A 2WBAA 4H4YA 3BNUA 4GDPA 2BCGG 1BKWA 4XWRA 1QLBA 3ATQA 1FEBA 4TM4A 4X9NA 2C3DA 3T37A 4BURA 1IUVA 1NENA 4E0VA 1D4DA 3CGEA 1IUSA 4BK1A 3F8PA 2QAEA 5TR3A 2RGHA 3NYFA 4DSGA 2AR8A 1LPFA 4JY3A 3REDA 3G5SA 3IHGA 3LJPA 5ER0A 1F8RA 2CFYA 5JCIA 4WCTA 1PBBA 2DKIA 4A6NB 2WS3A 5HYMA 4UP3A 3GMCA 2BXRA 3CNTA 3O0HA 5KVHA 3ABVA 1BGNA 2Y6QA 4OPDA 2HQMA 2R0GA 4BJYA 1E1LA 2BACA 1ZMDA 4FX9A 1ZX9A 4PABA 1ONFA 3H4KA 2ZZBA 1P2EA 1EL8A 2XVFA 3H8LA 5HY5A 1RYIA 2WU5A 1D7YA 2Z5XA 5U25A 3B3RA 3QSEA 2C73A 3NK2X 1XANA 1GALA 4YKFA 5BULA 1IUTA 3UCLA 1S3BA 4J36A 4LU6A 3P4PA 4K5RA 4EMJA 2VQBA 4AT0A 1H84A 2WOIA 4I58A 4C74A 1LQUA 4BK2A 3AYLA 1KNRA 2ZBWA 3B6DA 4YSHA 4AT2A 1ZDLA 4RSLA 2A8XA 3ALLA 4KPRA 3EF6A 3OC4A 2GEWA 1PJ5A 4YSXA 4YKGA 5JCMA 2B9YA 5FS7A 2I0ZA 1TDNA 2VVLA 1B5QA 4C3YA 4JY2A 1PBDA 3FG2P 2X50A 2JK6A 2YVGA 1D4CA 1MXTA 1PBCA 2GRTA 3AEFA 3UKFA 1UKVG 5GSNA 2GR3A 3L1RA 3QVPA 4U8KA 2GMJA 2VRLA 4YSYA 4RG3A 4D04A 4U2LA 4IA6A 3AYIA 1KSSA 1S2YA 1DJNA 3V3NA 4BK3A 5JCNA 3NKSA 1L9CA 1CHUA 3DMEA 2C65A 2YM1A 4C5OA 1COYA 5EB5A 2AAQA 3ALMA 2R0PA 3GWDA 2BS2A 2IVEA 4U8NA 5EOWA 5IPYA 3QFBA 2BK3A 4YWOA 4B66A 1PHHA 2JBVA 2E1MA 2XLPA 3IF9A 5FS9A 4ZN0A 3NK1X 1GNDA 3LXDA 1OJAA 1GT8A 2FJDA 1F8WA 1LV0A 4H4ZA 5U63A 3UKAA 4CY6A 2WP5A 2V61A 3ICRA 3VR8A 1DNCA 3GWFA 5IQ1A 2WOWA 2XFPA 2X3NA 4X4JA 4A65A 1PBEA 4UDRA 2XLTA 5IQ4A 1PS9A 4P9SA 2IIDA 2YM2A 1GEUA 3AEBA 4H4XA 4EMWA 1QJDA 4J31A 4RG4A 2XFOA 1E1MA 3V76A 1OJCA 3EPTA 3SQPA 1VRQB 2FJEA 1H82A 3NNEA 4BV6A 3H8IA 4Y4MA 2TMDA 4MJWA 3SFEA 2VZ2A 1B37A 1CJCA 1P2HA 5JCLA 2GMHA 1PXBA 3CNSA 3GMBA 2WOVA 3VRAA 1W4XA 3CPIG 4A79A 4DSHA 4U8JA 3II4A 1EL7A 4OVIA 3NHOX 3G5QA 1BF3A 2YWLA 3K7TA 3RHAA 3JSKA 1GERA 2BABA 4O5UA 1CBOA 4Z25A 2JB3A 3DGHA 1EL5A 3E1TA 4TM3A 2XFNA 2BK4A 4N9XA 1L9DA 3C4NA 1E1NA 1DOCA 1FOHA 1KSUA 3NYCA 4TLZA 3LZWA 1JEHA 4AOSA 2Q0LA 5FS8A 4PAAA 1Y56B 5U1OA 5L46A 2C7GA 2WU2A 3SM8A 3UKQA 4EQXA 4C3XA 5M0ZA 1B4VA 1GRAA 4FDCB 1E7PA 2YLSA 2WP9A 4H4VA 1VG0A 1Q1WA 4EM4A 4EQRA 3C4AA 5LV9A 5J7XA 2VVMA 3NN0X 4ICYA 3ITJA 1CF3A 3KD9A 3V3OA 1GREA 4ZCCA 4CNKA 2GR0A 3K7MX 3DJDA 3D1CA 2JB2A 1DOBA 2GR1A 1D4EA 2C64A 3DA1A 1JNZA 1PBFA 2YLXA 4IVOB 4YT0A 4M52A 4C77A 2GR2A 2ZZ0A 4OPTA 3URHA 2WQYA 4EMIA 2QA2A 2B7RA 1D5TA 2V5ZA 4EM3A 4B69A 3WE0A 4LIIA 2FJBA 5C2TA 3UP4A 1LJ1A 3P4QA 1GRGA 1TDOA 3CIRA 4FK1A 1K0IA 5BRTA 1NHRA 2XVHA 3NYEA 3DH9A 3AB1A
chains in the Genus database with same CATH superfamily
4X9MA 3UKPA 3DGZA 3V5CA 1EBGA 5BVAA 4EIQA 1XPYA 3R0KA 3LADA 4JN8A 4A99A 3DJGX 1IUWA 3AEEA 1V97A 3FBSA 4EQWA 1H83A 3VR9A 4U8MA 2X99A 4I59A 3Q6JA 1PJ6A 3P1WA 4JQ9A 1EC8A 1GTEA 4Y4LA 2B9XA 4B68A 3JZUA 2P88A 4NWZA 2YR4A 1FFUC 3RP7A 4H4SA 3STPA 2QCUA 2ZZCA 3UCCA 4H7UA 2AL2B 2OKTA 3IHMA 4GUVA 3ICSA 3BNMA 3T8QA 4KX6A 3ALJA 3EUB3 2A87A 2V3AA 1N4VA 3SFDA 2VVLG 4K7ZA 4Z2UA 2PA6A 3GDNA 1BGJA 1JNRA 2YR5A 3LOVA 1E9IA 3T6CA 2YLRA 3UTGA 3NZGA 1Y56A 3UKLA 3QLDA 1NAAA 1PXAA 4HCLA 1YQZA 2ONEA 4MGGA 3NS1B 3CB3A 1JRZA 3IC9A 3CAWA 4JNAA 1X2GA 2XLSA 4B63A 1F3PA 1N61C 1OJ9A 4GFIA 2YG3A 3AD9B 2Y6RA 2ACZA 2GGEA 2XLUA 3GDPA 3CMMA 1EC7A 3S5WA 4U2TA 2OLAA 1H2IA 1ZOVA 1L9EA 1DOEA 1YEYA 1E39A 2PTYA 3RNMA 5KRQA 3EAOA 4GRTA 3SX6A 4D03A 2FJAA 3GYIA 3SN4A 3D9XA 3RGTA 2CULA 3IWAA 4XXGA 3AECA 2PODA 2A89A 3V5FA 1L0VA 1VG9A 4H4PA 4H2QA 4ZCWA 1CJ3A 4IV9A 3AE1A 3RP8A 3IJQA 4REKA 3GC2A 3NN6X 3QTPA 2PS2A 3GD4A 2GV8A 1N4WA 1BZLA 3PWGA 2QGYA 1ZKQA 2W3RA 1AOGA 1XPQA 1NHQA 4B64A 3DJEA 3CGDA 3GY1A 4ADWA 1NEKA 4TM1A 3NFUA 4H19A 1ZP0A 2GGIA 4J33A 3PS9A 2XH4A 1V59A 4USRA 3K1GA 4U2SA 3NVYB 1YY5A 4A3RA 3ETRB 2OZ8A 3H7VA 4DNAA 4A5LA 3MY9A 4APNA 3KUMA 4YTNA 2BK5A 1N62C 2J3NA 3OZMA 1MUCA 4GIRA 2ARDA 3UOYA 1ZOYA 1K4QA 4NTDA 4H4YA 2PP0A 3MQTA 4E0VA 2RGHA 3NYFA 1LPFA 4JY3A 3H70A 3REDA 5ER0A 4WCTA 3O0HA 3Q45A 2Y6QA 2R0GA 1E1LA 1ZMDA 1ZX9A 3D47A 3A7UA 2WU5A 5U25A 1N5WC 3CK5A 1XANA 2P8CA 4YKFA 5BULA 2PMQA 1IUTA 2QDEA 4LU6A 2OZ3A 3SSZA 1H84A 5FJTA 4I58A 3AYLA 3FXGA 4AT2A 4YSHA 4KPRA 3OC4A 1PJ5A 4YKGA 3VDGA 4JY2A 2YVGA 4U8KA 4U2LA 4IA6A 1KSSA 2W54A 7ENLA 3ALMA 3MWCA 2BK3A 3HRDC 4HN8A 1PHHA 3IF9A 2E3TA 3NK1X 4GMEA 1LV0A 4H4ZA 2WP5A 2MUCA 5FJUA 4F4RA 2WOWA 2P8BA 1PBEA 4UDRA 2IIDA 2ZADA 4J1OA 4RG4A 3UJEA 3EPTA 3SQPA 2GL5A 3H8IA 3SFEA 5BOEA 5KMRA 1P2HA 2GMHA 3H12A 3CXBA 3TWAA 3II4A 4OVIA 1BF3A 3K7TA 4FP1A 3RHAA 4Z25A 2POZA 2OZTA 2OFJA 5KMPA 1L9DA 5FS8A 4PAAA 5L46A 4TVWA 4C3XA 5M0ZA 4FDCB 3UJSA 2WP9A 1VG0A 5LV9A 5J7XA 3ITJA 1CF3A 4MMWA 3DJDA 3SQSA 2JB2A 3R0UA 1D4EA 1JNZA 1PBFA 4IVOB 4YT0A 3QPEA 2WQYA 3SYIA 1D5TA 4EM3A 4B69A 2PTZA 5C2TA 1LJ1A 4G7FA 3AB1A 2OLOA 3BHFA 4H2PA 2GAGB 2BS3A 2PP3A 5KVIA 2R0CA 3UTEA 1KDGA 2XVIA 1NHSA 2BC1A 4IT1A 4H1ZA 3VCCA 1VDCA 3AE9A 2Q6UA 3AN1A 4USQA 2JKCA 1GV4A 2C67A 1T3QC 2B7SA 2NPXA 2C72A 1CC4A 2OAMA 3A7AA 1TZZA 2RDXA 5KOWA 3GRTA 3NTAA 3SGLA 3UCDA 5EB4A 2YQUA 4Z1YA 4J2WA 3DJJA 4DXKA 4NZHA 4OPIA 3NTDA 1LQTA 4Z43A 4JN9A 1DXLA 4OCGA 4TLXA 2WETA 1F9CA 3CGCA 4DYEA 3I6EA 1BWCA 3FJ4A 2W0HA 4FK1C 2EQ8A 4GDEA 3RO6A 5DBJA 3BHKA 4HA6A 2P0IA 2E5VA 3AD8B 4OPCA 1CC2A 3IJIA 5KMSA 2HXUA 4YSZA 2Q7VA 3UKKA 1D7LA 1PN0A 4UDPA 1JRXA 1GRHA 2FYMA 1IJHA 2OLNA 1KKOA 1FECA 3CPJG 3CN8A 3ZLGA 3ADAB 4LA1A 3EANA 1NU5A 4HCDA 4KWSA 4J56A 2WHDA 3ISHA 1EBHA 3QN3A 3P4SA 4CCQA 3AWIA 2AL1A 2DW6A 4NTEA 3DESA 3TCSA 3UGVA 4IZGA 2PP1A 5IDZA 5GRTA 1RM6B 3FVDA 4G74A 3M12A 3AYJA 3G5RA 4YTMA 3HW2A 4H4RA 4Z26A 3PWIA 1GESA 2GAHB 1XDIA 3NT6A 1ZMCA 4Z17A 4TM0A 3SZCA 2QJJA 2QA1A 1GRTA 1FCDA 3DERA 3QFAA 3AD7B 1S3EA 2V60A 4NEVA 1O95A 2GQFA 1SJDA 3ES7A 3N4EA 4GCMA 3I6TA 3AE5A 3GD6A 2YG7A 2CHRA 4K22A 2E5AA 4OPGA 3OZYA 4H2RA 3AEAA 4HNCA 3B9JB 3HYXA 3AE7A 4IA5A 2HXTA 5FJOA 1BKHA 2W55A 1F8SA 2YAUA 2PCEA 4A7AA 3MSYA 4G6HA 1PDYA 4YTPA 3AXBA 4UDQA 2B76A 4DN1A 3CNJA 1E1KA 1FHVA 2BCPA 4A6NA 4IL2A 2WDRA 3BI2A 4NNJA 1DTNA 3Q9TA 1CC6A 3K7QX 3A7RA 2WBAA 4GDPA 3ATQA 4X9NA 3T37A 1NENA 1IUVA 1IUSA 3F8PA 5TR3A 4ZA0A 4GGBA 2DKIA 4A6NB 1ONEA 2BXRA 3ABVA 5KVHA 4OPDA 1BGNA 2HQMA 4BJYA 1RVKA 4PABA 3L5OA 2Z5XA 3RITA 3VC5A 2C73A 4E4UA 2XGZA 1S3BA 4J36A 4K5RA 2VQBA 4C74A 1FHUA 3B6DA 3EF6A 2GEWA 5JCMA 2B9YA 5EU9A 3N6JA 1WUEA 2OX4A 3V4BA 4C3YA 3P93A 1D4CA 1MXTA 3AEFA 1UKVG 3QVPA 3PFRA 4HNLA 1DJNA 3NKSA 1L9CA 3N6HA 4KT2A 3GWDA 2BS2A 2IVEA 4U8NA 5IPYA 3NO1A 4YWOA 4JHMA 4B66A 2JBVA 2E1MA 1GNDA 3LXDA 1OJAA 3UKAA 2GGGA 3FYYA 2XH7A 5JRBA 3TJIA 4A65A 2YM2A 3AEBA 3T2KA 4H4XA 1E1MA 3V76A 1H82A 2QDDA 4Y4MA 2TMDA 1PXBA 3CNSA 3GMBA 2WOVA 3VRAA 1W4XA 1SB3B 1EL7A 3JSKA 2BABA 4O5UA 2QQ6A 1FOHA 1KSUA 3LZWA 4AOSA 4HCHA 3SR6B 3OPSA 1B4VA 1E7PA 3U9IA 2VVMA 3NN0X 3V3OA 4HYRA 4ZCCA 3K7MX 3DA1A 4GISA 4C77A 4GGHA 4IL0A 2B7RA 1VQZA 4M0XA 5G5HB 3AMZA 3CIRA 5BRTA 6ENLA 1P43A 1GPEA 4JNQA 2GGHA 2YLWA 3ZDNA 4G6GA 1PXCA 1XHCA 5FS6A 2Q0KA 2BC0A 2EQ7A 3I6DA 5C3JA 4K2XA 5EBKA 2GSHA 1S7MA 4FI4A 2OQHA 3CT2A 3OTRA 2RGOA 3PO7A 4U8OA 3SN0A 3NRNA 1SEZA 1ELSA 3CGBA 2IVDA 2C66A 3TTEA 4H4TA 1LTXR 3HPFA 3BI5A 3GRSA 1H7XA 4ROPA 2DW7A 2EQ9A 2EQ6A 2DKHA 2GF3A 3KLJA 1B8SA 4MKSA 2XLRA 2PU0A 3BOXA 1NDAA 2XSXA 2O56A 3KA7A 4XWZA 4Y4NA 1N4UA 3GD3A 2B9WA 4A35A 3DK8A 4NEWA 3ZVIA 3KKJA 1H81A 2WEUA 1JRYA 4II2A 1TYPA 3MZNA 3VFCA 4H4WA 3KVEA 3UTFA 1PJ7A 2VRMA 1CL0A 5FMHA 2NVKX 2R45A 1KFYA 4GYPA 2WPCA 3QJ4A 2WP6A 3RP6A 2GVCA 3D46A 1OJDA 4HB9A 2YVJA 3SZFA 5M10A 3HYVA 4E8GA 4Z24A 1KF6A 2R4EA 1DODA 1NG3A 1RP0A 2WDVA 3UP5A 4Z2RA 1H6VA 3UOVA 4J34A 1TDKA 1ECQA 3DFYA 3DG6A 1ZK7A 4ECHA 3KPFA 5J60A 4K8DA 3SZWA 1GTHA 2VOUA 2XFUA 2H89A 3AE4A 1K0LA 2NQLA 4OPLA 2OALA 1RSGA 3OZ2A 2WPEA 1E6EA 1F6MA 4GR1A 1N5XA 1KNPA 3DK9A 4U8LA 2QJMA 1N63C 1NPXA 1KD0A 2YLTA 1IYXA 2BYBA 2AQJA 4AP1A 3DIPA 2GH5A 4GAVA 4B65A 3NGCX 3KPKA 3P4RA 3AEDA 4H2NA 1WYGA 5HXIA 1EL9A 1MDLA 1EC9A 4J3ZA 1EBDA 3CNDA 3DFHA 3OW1A 4DWDA 3FPZA 2C4CA 1OJTA 5JCKA 3LZXA 2OO6A 1MNSA 1N1PA 3THUA 2GQWA 4Z2TA 3T4WA 3NRZB 2C3CA 3PVCA 3R07C 4GAPA 2V3BA 2GDQA 2ZC8A 4G9KA 1Z6LA 3N4FA 2BA9A 3VRDB 3NVVB 3DEQA 3I3LA 3B97A 3R11A 2AL2A 1TRBA 1TDEA 2C70A 1HYUA 1REOA 1H86A 3R9UA 3P9UA 3P0WA 3FV9A 5CQFA 5KOXA 3BJSA 1JROA 4A9WA 2WPFA 1JOAA 3NG7X 3L8KA 1Q1RA 2R9ZA 3D8XA 1STZA 2MNRA 4U8PA 2FBWA 3NK0X 1PDHA 3CYJA 3GYJA 4DHGA 1BKWA 1QLBA 1FEBA 4TM4A 4BURA 5FJRA 3T14A 3HYWA 4DSGA 1X2HA 3G5SA 2CFYA 5JCIA 3V3WA 1PBBA 2WS3A 2OPJA 4UP3A 3CNTA 5ENLA 1TKKA 4FX9A 3PK7A 3H4KA 2ZZBA 1P2EA 1EL8A 5HY5A 3GO2A 3QSEA 1D7YA 3B3RA 3NK2X 1GALA 2AKZA 4EMJA 1LQUA 4BK2A 1KNRA 2ZBWA 3RRAA 4RSLA 4YSXA 2I0ZA 3VC6A 2VVLA 1PBDA 3FG2P 2PSNA 3UKFA 5GSNA 3EEZA 2VRLA 4YSYA 4D04A 3NVZB 3T2YA 3AYIA 4BK3A 4K1WA 1FO4A 3CXOA 1CHUA 3DMEA 4C5OA 3MUCA 2AAQA 2AKMA 3QKEA 3QFBA 3SY4A 5FS9A 4ZN0A 3IJLA 2FJDA 5U63A 3JVAA 2V61A 2XFPA 4X4JA 2PTWA 5IQ4A 4P9SA 1GEUA 1QJDA 4J31A 2XFOA 1OJCA 1JCTA 1VRQB 4K2SA 2FJEA 3NNEA 4BV6A 3UJRA 1JDFA 4MJWA 4IP5A 3VCNA 1B37A 1CJCA 5JCLA 4A79A 3NHOX 2PGEA 2YWLA 3SXIA 1CBOA 2JB3A 1EL5A 3JW7A 3C4NA 3TWBA 3Q4DA 3NYCA 2Q0LA 4H2HA 1Y56B 5U1OA 2C7GA 2WU2A 3SM8A 3UKQA 4EQXA 2YLSA 3C4AA 4EM4A 4EQRA 4M6UA 4CNKA 1FFVC 3D1CA 3DGBA 2C64A 2YLXA 2GR2A 4EMIA 2FKPA 1SJCA 3WE0A 3SJNA 2PTXA 3P4QA 1K0IA 1NHRA 3AM9A 3U4FA 3DDMA 1Y0PA 2YLZA 3ES8A 3UKHA 3BI4A 3UOXA 1IUXA 3SZ0A 1M64A 3EKGA 3T9PA 1IUUA 2PYXA 4II3A 4E5TA 4WX1A 2Z5YA 4JDRA 2XDOA 2XVJA 2F5ZA 4K5SA 1TYTA 3OP2A 1OEPA 1Q9IA 4NTCA 3QVRA 4DX3A 4BJZA 2PHHA 2QVHA 2RABA 2GB0A 4KEMA 3HZLA 1GXFA 2PPGA 4CRTA 2WESA 3ZYXA 3ENLA 3AEGA 4GF7A 1VDVA 4CBQA 1NELA 1SJAA 1MOKA 5BUKA 3ZLFA 4G73A 1R0MA 3NLCA 1S2QA 2UZZA 3AE8A 4U8IA 2CVJA 2RGJA 3M13A 3NIXA 3AE2A 3AE6A 1GOSA 3UJ2A 1GRBA 4X2PA 4OPUA 5CKUA 3BSMA 1YQ3A 2O9ZA 1YQ4A 3K30A 2X8CA 3SBFA 1L8PA 1ZXIC 4AOXA 4HPNA 1PDZA 1W6TA 4YXDA 2CDUA 3ATRA 3KU9A 3C96A 2C75A 2TPRA 3H8AA 2H88A 2OG9A 1LVLA 4H50A 1FL2A 2APGA 2XVEA 2R4JA 3NH3X 1FEAA 1QO8A 2XYOA 2OA1A 3S61A 3F8RA 3UXKA 3RCYA 2BS4A 1WUFA 5J04A 2E4GA 5KWFA 2VQ7A 4B67A 2WDQA 2XCGA 1CJ4A 3UOZA 3S5SA 1DJQA 4DGKA 3UXLA 4CNJA 2JAEA 1VQWA 3UJFA 4B1BA 1JU2A 2X8HA 3CPHG 2PGWA 3VA8A 4EIPA 2XFQA 3F8DA 4AP3A 4CCRA 2OQYA 3QSSA 1NHPA 2PU1A 3GYXA 3ZVHA 4H4QA 1H7WA 4CY8A 3AE3A 1ZY8A 1N60C 5FJPA 3ICTA 1NG4A 3DG3A 3TJ4A 3DK4A 3FCPA 3QSMA 2R46A 1MDRA 1GSNA 4ZOHB 3FMWA 2YVFA 3R25A 3ZVHB 3COXA 1TDFA 2V6OA 1O94A 2YR6A 1O5WA 3M0OA 3VQRA 3IK4A 4EWJA 4IP4A 1M6IA 1ELIA 2C76A 4IVMB 2HNEA 4JN7A 3CNPA 3UTHA 4Z44A 3VRBA 3MKCA 4J57A 4EQSA 4O5QA 3NVWB 5HHFA 2BRAA 2QJNA 4K8GA 1MO9A 2OVLA 1X31B 1GETA 3FIMB 1YKJA 3GSIA 4ZCDA 1KKRA 2HZGA 1BQGA 3PG6A 4KPLA 3TOYA 2BXSA 1P48A 2YG5A 4H4UA 4H83A 2YG6A 3DG7A 5G5GB 5KXJA 2X8GA 3CTYA 3I4KA 1K0JA 3P3BA 2YG4A 3T31A 2I5QA 1CJ2A 2JB1A 1GRFA 3LB8A 3BNUA 4XWRA 2BCGG 1MRAA 4YWSA 2BRYA 2C3DA 1D4DA 3CGEA 4BK1A 4E4FA 2QAEA 2AR8A 2XH0A 4E6MA 3LJPA 3IHGA 1F8RA 1JPMA 5HYMA 5KNLA 3GMCA 2W3SA 1TE6A 1R6WA 2BACA 1ONFA 2XVFA 2P3ZA 3H8LA 1RYIA 1JPDX 3UCLA 4IHCA 3P4PA 4AT0A 1JRPA 4G8TA 2WOIA 3SN1A 1ZDLA 2A8XA 3ALLA 5FS7A 1SJBA 4TVYA 1TDNA 1B5QA 2X50A 2JK6A 1PBCA 2GRTA 2GR3A 4GYPC 3L1RA 2GMJA 4RG3A 1XS2A 1S2YA 3V3NA 5JCNA 1FIQB 2C65A 2YM1A 1COYA 5EB5A 2R0PA 5EOWA 2XLPA 5KMQA 1GT8A 1F8WA 4CY6A 4ENLA 3ICRA 3VR8A 1DNCA 3GWFA 5IQ1A 2X3NA 3T2ZA 2XLTA 5BOFA 1PS9A 4EMWA 3S47A 2XH2A 2VZ2A 3T0KA 3CPIG 3TW9A 4DSHA 4U8JA 3TQPA 3G5QA 1GERA 3DGHA 3E1TA 4TM3A 2XFNA 2BK4A 4N9XA 3R10A 1E1NA 1DOCA 4TLZA 1JEHA 1GRAA 4H4VA 1Q1WA 4ICYA 3KD9A 1GREA 2GR0A 3ZLHA 2GGJA 1DOBA 2GR1A 3R1ZA 1KCZA 3NXLA 4M52A 2ZZ0A 4OPTA 3URHA 2QA2A 2V5ZA 4LIIA 2FJBA 1KN0A 3UP4A 1GRGA 1TDOA 4FK1A 3RR1A 4A6GA 2XVHA 3NYEA 3DH9A
chains in the Genus database with same CATH topology
2OLOA 3BHFA 4H2PA 1GPEA 4X9MA 1Y0PA 2GAGB 2YLZA 2BS3A 4JNQA 3UKPA 3UKHA 3DGZA 2YLWA 3BI4A 3ZDNA 3UOXA 5KVIA 1PXCA 2R0CA 1XHCA 5FS6A 1IUXA 4G6GA 3UTEA 3SZ0A 1KDGA 1M64A 2Q0KA 2XVIA 1IUUA 2PYXA 5BVAA 4II3A 1NHSA 2BC1A 2BC0A 4EIQA 4WX1A 2Z5YA 2EQ7A 3I6DA 3LADA 1VDCA 5C3JA 4JDRA 3AE9A 4K2XA 2XDOA 4A99A 2XVJA 3DJGX 2F5ZA 5EBKA 1IUWA 4K5SA 3AEEA 1TYTA 2Q6UA 3FBSA 1Q9IA 4EQWA 1S7MA 1H83A 4USQA 3VR9A 4NTCA 3QVRA 4U8MA 4BJZA 2JKCA 2PHHA 1GV4A 2X99A 2C67A 2RGOA 3PO7A 2RABA 3Q6JA 2GB0A 2B7SA 4I59A 1PJ6A 3P1WA 2NPXA 4U8OA 2C72A 3HZLA 1GXFA 4JQ9A 3NRNA 4CRTA 1CC4A 1GTEA 2OAMA 2WESA 4Y4LA 3ZYXA 2B9XA 4B68A 1SEZA 3CGBA 3AEGA 5KOWA 4NWZA 3GRTA 2IVDA 2C66A 2YR4A 3NTAA 4GF7A 3SGLA 4CBQA 4H4TA 5EB4A 1MOKA 2YQUA 1LTXR 4H4SA 3BI5A 3RP7A 5BUKA 4G73A 2QCUA 2ZZCA 4J2WA 3GRSA 3DJJA 3NLCA 4H7UA 1H7XA 1S2QA 4NZHA 2EQ9A 4OPIA 2EQ6A 2DKHA 3NTDA 1LQTA 2GF3A 2UZZA 3IHMA 3KLJA 1B8SA 3AE8A 4GUVA 3ICSA 3BNMA 4KX6A 2XLRA 4U8IA 4Y4NA 1NDAA 2CVJA 3KA7A 3ALJA 4XWZA 1N4UA 2RGJA 3M13A 4Z43A 4JN9A 1DXLA 2A87A 2V3AA 1N4VA 4OCGA 4TLXA 2WETA 3SFDA 2VVLG 3CGCA 3NIXA 3GD3A 2B9WA 4K7ZA 1BWCA 3AE2A 3AE6A 4Z2UA 3DK8A 4NEWA 2W0HA 1GOSA 2EQ8A 3GDNA 3KKJA 1GRBA 1H81A 4FK1C 4GDEA 2WEUA 1JRYA 1BGJA 1JNRA 1TYPA 2YR5A 3BHKA 2E5VA 3AD8B 4HA6A 3LOVA 1CC2A 1YQ3A 4OPUA 2O9ZA 4OPCA 5CKUA 1YQ4A 5KMSA 3K30A 2X8CA 2YLRA 4YSZA 3UTGA 4H4WA 2Q7VA 3KVEA 3UKKA 3UTFA 1D7LA 1PJ7A 2VRMA 4AOXA 1CL0A 1Y56A 1PN0A 3UKLA 4YXDA 5FMHA 2NVKX 2CDUA 1NAAA 1PXAA 2R45A 1KFYA 2WPCA 3QJ4A 3ATRA 3KU9A 3C96A 2WP6A 3RP6A 1YQZA 2C75A 2GVCA 2TPRA 2H88A 1LVLA 4H50A 4UDPA 1JRXA 1FL2A 1GRHA 2APGA 2XVEA 1IJHA 2R4JA 1OJDA 2OLNA 4HB9A 2YVJA 3SZFA 3NH3X 5M10A 3HYVA 1JRZA 1FEAA 3IC9A 1QO8A 1FECA 2XYOA 2OA1A 4Z24A 3S61A 4JNAA 3F8RA 2XLSA 4B63A 3CPJG 1KF6A 2BS4A 2R4EA 1DODA 1NG3A 3CN8A 1F3PA 1RP0A 4LA1A 3ADAB 2WDVA 3EANA 4II2A 2E4GA 3UP5A 1OJ9A 5KWFA 2YG3A 4Z2RA 2VQ7A 3AD9B 4J56A 4B67A 2WHDA 2Y6RA 1H6VA 2WDQA 2XCGA 3ISHA 2ACZA 3UOVA 1CJ4A 4J34A 2XLUA 3UOZA 1TDKA 3GDPA 1DJQA 1ZK7A 3P4SA 3CMMA 4CCQA 4DGKA 4CNJA 2JAEA 3AWIA 3S5WA 4U2TA 4ECHA 1VQWA 3KPFA 1H2IA 1ZOVA 4NTEA 5J60A 4K8DA 4B1BA 3SZWA 1L9EA 1GTHA 1DOEA 2VOUA 2H89A 2XFUA 3AE4A 1JU2A 1E39A 2X8HA 1K0LA 3RNMA 3CPHG 4OPLA 2OALA 3EAOA 4EIPA 5KRQA 1RSGA 2XFQA 3F8DA 3OZ2A 4AP3A 4CCRA 2WPEA 1E6EA 4GRTA 3SX6A 1F6MA 4D03A 2FJAA 3GYIA 4GR1A 3QSSA 5GRTA 3D9XA 1KNPA 3M12A 4G74A 1NHPA 3AYJA 3GYXA 3G5RA 3DK9A 4U8LA 4YTMA 4H4RA 4H4QA 4Z26A 1NPXA 1GESA 1H7WA 2CULA 3IWAA 2GAHB 3AECA 4XXGA 4CY8A 1XDIA 2A89A 3AE3A 2YLTA 3NT6A 1ZY8A 1ZMCA 3ICTA 1VG9A 4H4PA 2BYBA 1L0VA 2AQJA 1NG4A 4TM0A 4AP1A 3SZCA 3DK4A 4H2QA 2GH5A 1CJ3A 4IV9A 3AE1A 4GAVA 4B65A 3QSMA 3NGCX 3RP8A 3KPKA 2R46A 4REKA 3P4RA 2QA1A 1GRTA 1FCDA 1GSNA 3QFAA 3AEDA 3FMWA 3NN6X 3AD7B 1S3EA 2V60A 4H2NA 2YVFA 3GD4A 5HXIA 1EL9A 2GV8A 1N4WA 1BZLA 4NEVA 1TDFA 3COXA 2V6OA 1EBDA 1O94A 1O95A 2YR6A 2GQFA 1O5WA 3CNDA 2C4CA 3FPZA 1ZKQA 1OJTA 3M0OA 1AOGA 5JCKA 3LZXA 1XPQA 4GCMA 3VQRA 1NHQA 4B64A 3DJEA 1N1PA 3AE5A 3CGDA 1NEKA 4ADWA 2GQWA 4TM1A 4Z2TA 2YG7A 1ZP0A 1M6IA 4K22A 2C3CA 3PVCA 1ELIA 4J33A 4OPGA 2C76A 4IVMB 4H2RA 4GAPA 3CNPA 3AEAA 3UTHA 2V3BA 3PS9A 4Z44A 3HYXA 3VRBA 3AE7A 4IA5A 4J57A 4EQSA 4O5QA 4G9KA 5DBJA 1Z6LA 2BA9A 3VRDB 1V59A 4USRA 1F8SA 2YAUA 5HHFA 2BRAA 3I3LA 4A7AA 4U2SA 1YY5A 4G6HA 4DNAA 4YTPA 3AXBA 1MO9A 2C70A 1TRBA 1TDEA 4A5LA 1X31B 4UDQA 4APNA 2B76A 1GETA 3FIMB 1YKJA 3GSIA 4ZCDA 4YTNA 3CNJA 1E1KA 1HYUA 2BK5A 2J3NA 3PG6A 1REOA 2BXSA 1H86A 2BCPA 3R9UA 4A6NA 3P9UA 2YG5A 4H4UA 5CQFA 2YG6A 5KOXA 2ARDA 5KXJA 2X8GA 4A9WA 2WPFA 3CTYA 1JOAA 3UOYA 3NG7X 3L8KA 1K0JA 2WDRA 1Q1RA 3BI2A 2YG4A 4NNJA 2R9ZA 3D8XA 1CC6A 3Q9TA 4U8PA 3T31A 1ZOYA 3K7QX 2FBWA 1CJ2A 2JB1A 3NK0X 1PDHA 1K4QA 1GRFA 4NTDA 3GYJA 3LB8A 2WBAA 4H4YA 3BNUA 4GDPA 2BCGG 1BKWA 4XWRA 1QLBA 3ATQA 1FEBA 4TM4A 4X9NA 2BRYA 2C3DA 3T37A 4BURA 1IUVA 1NENA 4E0VA 1D4DA 3CGEA 1IUSA 3T14A 4BK1A 3F8PA 2QAEA 5TR3A 2RGHA 3HYWA 3NYFA 2AR8A 4DSGA 1LPFA 4JY3A 3REDA 3G5SA 3IHGA 3LJPA 5ER0A 1F8RA 2CFYA 5JCIA 4WCTA 1PBBA 2DKIA 4A6NB 2WS3A 5HYMA 4UP3A 3GMCA 2BXRA 5KNLA 3CNTA 3O0HA 5KVHA 3ABVA 1BGNA 2Y6QA 4OPDA 2HQMA 2R0GA 4BJYA 1E1LA 2BACA 1ZMDA 4FX9A 1ZX9A 4PABA 1ONFA 3H4KA 2ZZBA 1P2EA 1EL8A 2XVFA 3L5OA 3H8LA 5HY5A 1RYIA 2WU5A 1D7YA 2Z5XA 5U25A 3B3RA 3QSEA 2C73A 3NK2X 1XANA 1GALA 4YKFA 5BULA 1IUTA 3UCLA 1S3BA 4J36A 4LU6A 3P4PA 4K5RA 4EMJA 2VQBA 4AT0A 1H84A 2WOIA 4I58A 4C74A 1LQUA 4BK2A 3AYLA 1KNRA 2ZBWA 3B6DA 4YSHA 4AT2A 1ZDLA 4RSLA 2A8XA 3ALLA 4KPRA 3EF6A 3OC4A 2GEWA 1PJ5A 4YSXA 4YKGA 5JCMA 2B9YA 5FS7A 2I0ZA 1TDNA 2VVLA 1B5QA 4C3YA 4JY2A 1PBDA 3FG2P 2X50A 2JK6A 2YVGA 1D4CA 1MXTA 1PBCA 2GRTA 3AEFA 3UKFA 1UKVG 5GSNA 2GR3A 3L1RA 3QVPA 4U8KA 2GMJA 2VRLA 4YSYA 4RG3A 4D04A 4U2LA 4IA6A 3T2YA 3AYIA 1KSSA 1S2YA 1DJNA 3V3NA 4BK3A 5JCNA 3NKSA 1L9CA 1CHUA 3DMEA 2C65A 2YM1A 4C5OA 1COYA 5EB5A 2AAQA 3ALMA 2R0PA 3GWDA 2BS2A 2IVEA 4U8NA 5EOWA 5IPYA 3QFBA 2BK3A 4YWOA 4B66A 1PHHA 2JBVA 2E1MA 2XLPA 3IF9A 5FS9A 3SY4A 4ZN0A 3NK1X 1GNDA 3LXDA 1OJAA 5KMQA 1GT8A 2FJDA 1F8WA 1LV0A 4H4ZA 5U63A 3UKAA 4CY6A 2WP5A 2V61A 3ICRA 3VR8A 1DNCA 3GWFA 5IQ1A 2WOWA 2XFPA 5JRBA 2X3NA 4X4JA 3T2ZA 4A65A 1PBEA 4UDRA 2XLTA 5IQ4A 1PS9A 4P9SA 2IIDA 2YM2A 1GEUA 3AEBA 3T2KA 4H4XA 4EMWA 1QJDA 4J31A 4RG4A 2XFOA 1E1MA 3V76A 1OJCA 3EPTA 3SQPA 1VRQB 2FJEA 1H82A 3NNEA 4BV6A 3H8IA 4Y4MA 2TMDA 4MJWA 3SFEA 5KMRA 2VZ2A 1B37A 1CJCA 1P2HA 5JCLA 2GMHA 1PXBA 3CNSA 3GMBA 2WOVA 3T0KA 1W4XA 3CPIG 3VRAA 4A79A 4DSHA 4U8JA 3II4A 1EL7A 4OVIA 3NHOX 3G5QA 1BF3A 2YWLA 3K7TA 3RHAA 3JSKA 1GERA 2BABA 4O5UA 3SXIA 1CBOA 4Z25A 2JB3A 3DGHA 1EL5A 3E1TA 4TM3A 2XFNA 2BK4A 5KMPA 4N9XA 1L9DA 3C4NA 1E1NA 1DOCA 1FOHA 1KSUA 3NYCA 4TLZA 3LZWA 1JEHA 4AOSA 2Q0LA 5FS8A 4PAAA 1Y56B 5U1OA 5L46A 2C7GA 2WU2A 3SM8A 3UKQA 4EQXA 4C3XA 5M0ZA 1B4VA 1GRAA 4FDCB 1E7PA 2YLSA 2WP9A 4H4VA 1VG0A 1Q1WA 4EM4A 4EQRA 3C4AA 5LV9A 5J7XA 2VVMA 3NN0X 4ICYA 3ITJA 1CF3A 3KD9A 3V3OA 1GREA 4ZCCA 4CNKA 2GR0A 3K7MX 3DJDA 3D1CA 2JB2A 1DOBA 2GR1A 1D4EA 2C64A 3DA1A 1JNZA 1PBFA 2YLXA 4IVOB 4YT0A 4M52A 4C77A 2GR2A 2ZZ0A 4OPTA 3URHA 2WQYA 3SYIA 4EMIA 2QA2A 2B7RA 1D5TA 2V5ZA 4EM3A 4B69A 3WE0A 4LIIA 2FJBA 1KN0A 5C2TA 3UP4A 1LJ1A 3P4QA 1GRGA 1TDOA 3CIRA 4FK1A 1K0IA 5BRTA 1NHRA 2XVHA 3NYEA 3DH9A 3AB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLO A;  3BHF A;  4H2P A;  1GPE A;  4X9M A;  1Y0P A;  2GAG B;  2YLZ A;  2BS3 A;  4JNQ A;  3UKP A;  3UKH A;  3DGZ A;  2YLW A;  3BI4 A;  3ZDN A;  3UOX A;  5KVI A;  1PXC A;  2R0C A;  1XHC A;  5FS6 A;  1IUX A;  3UTE A;  1KDG A;  1M64 A;  2Q0K A;  2XVI A;  1IUU A;  2PYX A;  5BVA A;  1NHS A;  2BC1 A;  2BC0 A;  4EIQ A;  4WX1 A;  2Z5Y A;  2EQ7 A;  3I6D A;  3LAD A;  1VDC A;  5C3J A;  4JDR A;  3AE9 A;  4K2X A;  2XDO A;  4A99 A;  2XVJ A;  3DJG X;  2F5Z A;  5EBK A;  1IUW A;  4K5S A;  3AEE A;  1TYT A;  2Q6U A;  3FBS A;  1Q9I A;  4EQW A;  1H83 A;  4USQ A;  3VR9 A;  4NTC A;  3QVR A;  4U8M A;  4BJZ A;  2JKC A;  2PHH A;  1GV4 A;  2X99 A;  2C67 A;  2RGO A;  3PO7 A;  2RAB A;  3Q6J A;  2GB0 A;  2B7S A;  4I59 A;  1PJ6 A;  3P1W A;  2NPX A;  4U8O A;  2C72 A;  3HZL A;  1GXF A;  4JQ9 A;  3NRN A;  4CRT A;  1CC4 A;  1GTE A;  2OAM A;  2WES A;  4Y4L A;  3ZYX A;  2B9X A;  4B68 A;  1SEZ A;  3CGB A;  3AEG A;  5KOW A;  3GRT A;  2IVD A;  2C66 A;  2YR4 A;  3NTA A;  4GF7 A;  3SGL A;  4CBQ A;  4H4T A;  5EB4 A;  1MOK A;  2YQU A;  1LTX R;  4H4S A;  3BI5 A;  3RP7 A;  5BUK A;  2QCU A;  2ZZC A;  4J2W A;  3GRS A;  3DJJ A;  3NLC A;  4H7U A;  1H7X A;  1S2Q A;  4NZH A;  2EQ9 A;  4OPI A;  2EQ6 A;  2DKH A;  3NTD A;  1LQT A;  2GF3 A;  2UZZ A;  3IHM A;  3KLJ A;  1B8S A;  3AE8 A;  4GUV A;  3ICS A;  3BNM A;  4KX6 A;  2XLR A;  4U8I A;  4Y4N A;  1NDA A;  2CVJ A;  3KA7 A;  3ALJ A;  4XWZ A;  1N4U A;  2RGJ A;  3M13 A;  4Z43 A;  4JN9 A;  1DXL A;  2A87 A;  2V3A A;  1N4V A;  4OCG A;  4TLX A;  2WET A;  3SFD A;  2VVL G;  3CGC A;  3NIX A;  3GD3 A;  2B9W A;  4K7Z A;  1BWC A;  3AE2 A;  3AE6 A;  4Z2U A;  3DK8 A;  4NEW A;  2W0H A;  1GOS A;  2EQ8 A;  3GDN A;  3KKJ A;  1GRB A;  1H81 A;  4FK1 C;  4GDE A;  2WEU A;  1JRY A;  1BGJ A;  1JNR A;  1TYP A;  2YR5 A;  3BHK A;  2E5V A;  3AD8 B;  4HA6 A;  3LOV A;  1CC2 A;  1YQ3 A;  4OPU A;  2O9Z A;  4OPC A;  5CKU A;  1YQ4 A;  3K30 A;  2X8C A;  2YLR A;  4YSZ A;  3UTG A;  4H4W A;  2Q7V A;  3KVE A;  3UKK A;  3UTF A;  1D7L A;  1PJ7 A;  2VRM A;  4AOX A;  1CL0 A;  1Y56 A;  1PN0 A;  3UKL A;  4YXD A;  5FMH A;  2NVK X;  2CDU A;  1NAA A;  1PXA A;  2R45 A;  1KFY A;  2WPC A;  3QJ4 A;  3ATR A;  3KU9 A;  3C96 A;  2WP6 A;  3RP6 A;  1YQZ A;  2C75 A;  2GVC A;  2TPR A;  2H88 A;  1LVL A;  4H50 A;  4UDP A;  1JRX A;  1FL2 A;  1GRH A;  2APG A;  2XVE A;  1IJH A;  2R4J A;  1OJD A;  2OLN A;  4HB9 A;  2YVJ A;  3NH3 X;  5M10 A;  1JRZ A;  1FEA A;  3IC9 A;  1QO8 A;  1FEC A;  2XYO A;  2OA1 A;  4Z24 A;  3S61 A;  4JNA A;  3F8R A;  2XLS A;  4B63 A;  3CPJ G;  1KF6 A;  2BS4 A;  2R4E A;  1DOD A;  1NG3 A;  3CN8 A;  1F3P A;  1RP0 A;  4LA1 A;  3ADA B;  2WDV A;  3EAN A;  2E4G A;  3UP5 A;  1OJ9 A;  5KWF A;  2YG3 A;  4Z2R A;  2VQ7 A;  3AD9 B;  4J56 A;  4B67 A;  2WHD A;  2Y6R A;  1H6V A;  2WDQ A;  2XCG A;  3ISH A;  2ACZ A;  3UOV A;  1CJ4 A;  4J34 A;  2XLU A;  3UOZ A;  1TDK A;  3GDP A;  1DJQ A;  1ZK7 A;  3P4S A;  4CCQ A;  4DGK A;  4CNJ A;  2JAE A;  3AWI A;  3S5W A;  4U2T A;  4ECH A;  1VQW A;  3KPF A;  1ZOV A;  4NTE A;  5J60 A;  4K8D A;  4B1B A;  1L9E A;  1GTH A;  1DOE A;  2VOU A;  2H89 A;  2XFU A;  3AE4 A;  1JU2 A;  1E39 A;  2X8H A;  1K0L A;  3RNM A;  3CPH G;  4OPL A;  2OAL A;  3EAO A;  4EIP A;  5KRQ A;  1RSG A;  2XFQ A;  3F8D A;  3OZ2 A;  4AP3 A;  4CCR A;  2WPE A;  1E6E A;  4GRT A;  1F6M A;  4D03 A;  2FJA A;  3GYI A;  4GR1 A;  3QSS A;  5GRT A;  1KNP A;  3M12 A;  1NHP A;  3AYJ A;  3G5R A;  3DK9 A;  4U8L A;  4YTM A;  4H4R A;  4H4Q A;  4Z26 A;  1NPX A;  1GES A;  1H7W A;  2CUL A;  3IWA A;  2GAH B;  3AEC A;  4XXG A;  4CY8 A;  1XDI A;  2A89 A;  3AE3 A;  2YLT A;  3NT6 A;  1ZY8 A;  1ZMC A;  3ICT A;  1VG9 A;  4H4P A;  2BYB A;  1L0V A;  2AQJ A;  1NG4 A;  4TM0 A;  4AP1 A;  3DK4 A;  4H2Q A;  2GH5 A;  1CJ3 A;  4IV9 A;  3AE1 A;  4B65 A;  3QSM A;  3NGC X;  3RP8 A;  4REK A;  2R46 A;  3P4R A;  2QA1 A;  1GRT A;  1FCD A;  1GSN A;  3QFA A;  3AED A;  3FMW A;  3NN6 X;  3AD7 B;  1S3E A;  2V60 A;  4H2N A;  2YVF A;  3GD4 A;  5HXI A;  1EL9 A;  2GV8 A;  1N4W A;  1BZL A;  4NEV A;  1TDF A;  3COX A;  2V6O A;  1EBD A;  1O94 A;  1O95 A;  2YR6 A;  2GQF A;  1O5W A;  3CND A;  3FPZ A;  3M0O A;  1ZKQ A;  1OJT A;  1AOG A;  5JCK A;  3LZX A;  1XPQ A;  4GCM A;  3VQR A;  1NHQ A;  4B64 A;  3DJE A;  1N1P A;  3AE5 A;  3CGD A;  1NEK A;  4ADW A;  2GQW A;  4TM1 A;  4Z2T A;  2YG7 A;  1ZP0 A;  1M6I A;  4K22 A;  2C3C A;  3PVC A;  1ELI A;  4J33 A;  4OPG A;  2C76 A;  4IVM B;  4H2R A;  3CNP A;  3AEA A;  3UTH A;  2V3B A;  3PS9 A;  4Z44 A;  3VRB A;  3AE7 A;  4IA5 A;  4J57 A;  4EQS A;  4O5Q A;  5DBJ A;  1Z6L A;  2BA9 A;  3VRD B;  1V59 A;  4USR A;  1F8S A;  2YAU A;  5HHF A;  3I3L A;  4A7A A;  4U2S A;  1YY5 A;  4DNA A;  4YTP A;  3AXB A;  1MO9 A;  2C70 A;  1TRB A;  1TDE A;  4A5L A;  1X31 B;  4UDQ A;  4APN A;  2B76 A;  1GET A;  3FIM B;  1YKJ A;  3GSI A;  4ZCD A;  4YTN A;  3CNJ A;  1E1K A;  1HYU A;  2BK5 A;  2J3N A;  1REO A;  2BXS A;  1H86 A;  2BCP A;  3R9U A;  4A6N A;  3P9U A;  2YG5 A;  4H4U A;  5CQF A;  2YG6 A;  5KOX A;  2ARD A;  5KXJ A;  2X8G A;  4A9W A;  2WPF A;  3CTY A;  1JOA A;  3UOY A;  3NG7 X;  3L8K A;  1K0J A;  2WDR A;  1Q1R A;  3BI2 A;  2YG4 A;  2R9Z A;  3D8X A;  1CC6 A;  3Q9T A;  4U8P A;  1ZOY A;  3K7Q X;  2FBW A;  1CJ2 A;  2JB1 A;  3NK0 X;  1PDH A;  1K4Q A;  1GRF A;  4NTD A;  3GYJ A;  3LB8 A;  2WBA A;  4H4Y A;  3BNU A;  4GDP A;  2BCG G;  1BKW A;  4XWR A;  1QLB A;  3ATQ A;  1FEB A;  4TM4 A;  4X9N A;  2C3D A;  3T37 A;  4BUR A;  1IUV A;  1NEN A;  4E0V A;  1D4D A;  3CGE A;  1IUS A;  4BK1 A;  3F8P A;  2QAE A;  5TR3 A;  2RGH A;  3NYF A;  4DSG A;  2AR8 A;  1LPF A;  4JY3 A;  3RED A;  3G5S A;  3IHG A;  3LJP A;  5ER0 A;  1F8R A;  2CFY A;  5JCI A;  4WCT A;  1PBB A;  2DKI A;  4A6N B;  2WS3 A;  5HYM A;  4UP3 A;  3GMC A;  2BXR A;  3CNT A;  3O0H A;  5KVH A;  3ABV A;  1BGN A;  2Y6Q A;  4OPD A;  2HQM A;  2R0G A;  4BJY A;  1E1L A;  2BAC A;  1ZMD A;  4FX9 A;  1ZX9 A;  4PAB A;  1ONF A;  3H4K A;  2ZZB A;  1P2E A;  1EL8 A;  2XVF A;  3H8L A;  5HY5 A;  1RYI A;  2WU5 A;  1D7Y A;  2Z5X A;  5U25 A;  3B3R A;  3QSE A;  2C73 A;  3NK2 X;  1XAN A;  1GAL A;  4YKF A;  5BUL A;  1IUT A;  3UCL A;  1S3B A;  4J36 A;  4LU6 A;  3P4P A;  4K5R A;  4EMJ A;  2VQB A;  4AT0 A;  1H84 A;  2WOI A;  4I58 A;  4C74 A;  1LQU A;  4BK2 A;  3AYL A;  1KNR A;  2ZBW A;  3B6D A;  4YSH A;  4AT2 A;  1ZDL A;  4RSL A;  2A8X A;  3ALL A;  4KPR A;  3EF6 A;  3OC4 A;  2GEW A;  1PJ5 A;  4YSX A;  4YKG A;  5JCM A;  2B9Y A;  5FS7 A;  2I0Z A;  1TDN A;  2VVL A;  1B5Q A;  4C3Y A;  4JY2 A;  1PBD A;  3FG2 P;  2X50 A;  2JK6 A;  2YVG A;  1D4C A;  1MXT A;  1PBC A;  2GRT A;  3AEF A;  3UKF A;  1UKV G;  5GSN A;  2GR3 A;  3L1R A;  3QVP A;  4U8K A;  2GMJ A;  2VRL A;  4YSY A;  4RG3 A;  4D04 A;  4U2L A;  4IA6 A;  3AYI A;  1KSS A;  1S2Y A;  1DJN A;  3V3N A;  4BK3 A;  5JCN A;  3NKS A;  1L9C A;  1CHU A;  3DME A;  2C65 A;  2YM1 A;  4C5O A;  1COY A;  5EB5 A;  2AAQ A;  3ALM A;  2R0P A;  3GWD A;  2BS2 A;  2IVE A;  4U8N A;  5EOW A;  5IPY A;  3QFB A;  2BK3 A;  4YWO A;  4B66 A;  1PHH A;  2JBV A;  2E1M A;  2XLP A;  3IF9 A;  5FS9 A;  4ZN0 A;  3NK1 X;  1GND A;  3LXD A;  1OJA A;  1GT8 A;  2FJD A;  1F8W A;  1LV0 A;  4H4Z A;  5U63 A;  3UKA A;  4CY6 A;  2WP5 A;  2V61 A;  3ICR A;  3VR8 A;  1DNC A;  3GWF A;  5IQ1 A;  2WOW A;  2XFP A;  2X3N A;  4X4J A;  4A65 A;  1PBE A;  4UDR A;  2XLT A;  5IQ4 A;  1PS9 A;  4P9S A;  2IID A;  2YM2 A;  1GEU A;  3AEB A;  4H4X A;  4EMW A;  1QJD A;  4J31 A;  4RG4 A;  2XFO A;  1E1M A;  3V76 A;  1OJC A;  3EPT A;  3SQP A;  1VRQ B;  2FJE A;  1H82 A;  3NNE A;  4BV6 A;  3H8I A;  4Y4M A;  2TMD A;  4MJW A;  3SFE A;  2VZ2 A;  1B37 A;  1CJC A;  1P2H A;  5JCL A;  2GMH A;  1PXB A;  3CNS A;  3GMB A;  2WOV A;  3VRA A;  1W4X A;  3CPI G;  4A79 A;  4DSH A;  4U8J A;  3II4 A;  1EL7 A;  4OVI A;  3NHO X;  3G5Q A;  1BF3 A;  2YWL A;  3K7T A;  3RHA A;  3JSK A;  1GER A;  2BAB A;  4O5U A;  1CBO A;  4Z25 A;  2JB3 A;  3DGH A;  1EL5 A;  3E1T A;  4TM3 A;  2XFN A;  2BK4 A;  4N9X A;  1L9D A;  3C4N A;  1E1N A;  1DOC A;  1FOH A;  1KSU A;  3NYC A;  4TLZ A;  3LZW A;  1JEH A;  4AOS A;  2Q0L A;  5FS8 A;  4PAA A;  1Y56 B;  5U1O A;  5L46 A;  2C7G A;  2WU2 A;  3SM8 A;  3UKQ A;  4EQX A;  4C3X A;  5M0Z A;  1B4V A;  1GRA A;  4FDC B;  1E7P A;  2YLS A;  2WP9 A;  4H4V A;  1VG0 A;  1Q1W A;  4EM4 A;  4EQR A;  3C4A A;  5LV9 A;  5J7X A;  2VVM A;  3NN0 X;  4ICY A;  3ITJ A;  1CF3 A;  3KD9 A;  3V3O A;  1GRE A;  4ZCC A;  4CNK A;  2GR0 A;  3K7M X;  3DJD A;  3D1C A;  2JB2 A;  1DOB A;  2GR1 A;  1D4E A;  2C64 A;  3DA1 A;  1JNZ A;  1PBF A;  2YLX A;  4IVO B;  4YT0 A;  4M52 A;  4C77 A;  2GR2 A;  2ZZ0 A;  4OPT A;  3URH A;  2WQY A;  4EMI A;  2QA2 A;  2B7R A;  1D5T A;  2V5Z A;  4EM3 A;  4B69 A;  3WE0 A;  4LII A;  2FJB A;  5C2T A;  3UP4 A;  1LJ1 A;  3P4Q A;  1GRG A;  1TDO A;  3CIR A;  4FK1 A;  1K0I A;  5BRT A;  1NHR A;  2XVH A;  3NYE A;  3DH9 A;  3AB1 A; 
#chains in the Genus database with same CATH topology
 4X9M A;  3UKP A;  3DGZ A;  3V5C A;  1EBG A;  5BVA A;  4EIQ A;  1XPY A;  3R0K A;  3LAD A;  4JN8 A;  4A99 A;  3DJG X;  1IUW A;  3AEE A;  1V97 A;  3FBS A;  4EQW A;  1H83 A;  3VR9 A;  4U8M A;  2X99 A;  4I59 A;  3Q6J A;  1PJ6 A;  3P1W A;  4JQ9 A;  1EC8 A;  1GTE A;  4Y4L A;  2B9X A;  4B68 A;  3JZU A;  2P88 A;  4NWZ A;  2YR4 A;  1FFU C;  3RP7 A;  4H4S A;  3STP A;  2QCU A;  2ZZC A;  3UCC A;  4H7U A;  2AL2 B;  2OKT A;  3IHM A;  4GUV A;  3ICS A;  3BNM A;  3T8Q A;  4KX6 A;  3ALJ A;  3EUB 3;  2A87 A;  2V3A A;  1N4V A;  3SFD A;  2VVL G;  4K7Z A;  4Z2U A;  2PA6 A;  3GDN A;  1BGJ A;  1JNR A;  2YR5 A;  3LOV A;  1E9I A;  3T6C A;  2YLR A;  3UTG A;  3NZG A;  1Y56 A;  3UKL A;  3QLD A;  1NAA A;  1PXA A;  4HCL A;  1YQZ A;  2ONE A;  4MGG A;  3NS1 B;  3CB3 A;  1JRZ A;  3IC9 A;  3CAW A;  4JNA A;  1X2G A;  2XLS A;  4B63 A;  1F3P A;  1N61 C;  1OJ9 A;  4GFI A;  2YG3 A;  3AD9 B;  2Y6R A;  2ACZ A;  2GGE A;  2XLU A;  3GDP A;  3CMM A;  1EC7 A;  3S5W A;  4U2T A;  2OLA A;  1H2I A;  1ZOV A;  1L9E A;  1DOE A;  1YEY A;  1E39 A;  2PTY A;  3RNM A;  5KRQ A;  3EAO A;  4GRT A;  3SX6 A;  4D03 A;  2FJA A;  3GYI A;  3SN4 A;  3D9X A;  3RGT A;  2CUL A;  3IWA A;  4XXG A;  3AEC A;  2POD A;  2A89 A;  3V5F A;  1L0V A;  1VG9 A;  4H4P A;  4H2Q A;  4ZCW A;  1CJ3 A;  4IV9 A;  3AE1 A;  3RP8 A;  3IJQ A;  4REK A;  3GC2 A;  3NN6 X;  3QTP A;  2PS2 A;  3GD4 A;  2GV8 A;  1N4W A;  1BZL A;  3PWG A;  2QGY A;  1ZKQ A;  2W3R A;  1AOG A;  1XPQ A;  1NHQ A;  4B64 A;  3DJE A;  3CGD A;  3GY1 A;  4ADW A;  1NEK A;  4TM1 A;  3NFU A;  4H19 A;  1ZP0 A;  2GGI A;  4J33 A;  3PS9 A;  2XH4 A;  1V59 A;  4USR A;  3K1G A;  4U2S A;  3NVY B;  1YY5 A;  4A3R A;  3ETR B;  2OZ8 A;  3H7V A;  4DNA A;  4A5L A;  3MY9 A;  4APN A;  3KUM A;  4YTN A;  2BK5 A;  1N62 C;  2J3N A;  3OZM A;  1MUC A;  4GIR A;  2ARD A;  3UOY A;  1ZOY A;  1K4Q A;  4NTD A;  4H4Y A;  2PP0 A;  3MQT A;  4E0V A;  2RGH A;  3NYF A;  1LPF A;  4JY3 A;  3H70 A;  3RED A;  5ER0 A;  4WCT A;  3O0H A;  3Q45 A;  2Y6Q A;  2R0G A;  1E1L A;  1ZMD A;  1ZX9 A;  3D47 A;  3A7U A;  2WU5 A;  5U25 A;  1N5W C;  3CK5 A;  1XAN A;  2P8C A;  4YKF A;  5BUL A;  2PMQ A;  1IUT A;  2QDE A;  4LU6 A;  2OZ3 A;  3SSZ A;  1H84 A;  5FJT A;  4I58 A;  3AYL A;  3FXG A;  4AT2 A;  4YSH A;  4KPR A;  3OC4 A;  1PJ5 A;  4YKG A;  3VDG A;  4JY2 A;  2YVG A;  4U8K A;  4U2L A;  4IA6 A;  1KSS A;  2W54 A;  7ENL A;  3ALM A;  3MWC A;  2BK3 A;  3HRD C;  4HN8 A;  1PHH A;  3IF9 A;  2E3T A;  3NK1 X;  4GME A;  1LV0 A;  4H4Z A;  2WP5 A;  2MUC A;  5FJU A;  4F4R A;  2WOW A;  2P8B A;  1PBE A;  4UDR A;  2IID A;  2ZAD A;  4J1O A;  4RG4 A;  3UJE A;  3EPT A;  3SQP A;  2GL5 A;  3H8I A;  3SFE A;  5BOE A;  5KMR A;  1P2H A;  2GMH A;  3H12 A;  3CXB A;  3TWA A;  3II4 A;  4OVI A;  1BF3 A;  3K7T A;  4FP1 A;  3RHA A;  4Z25 A;  2POZ A;  2OZT A;  2OFJ A;  5KMP A;  1L9D A;  5FS8 A;  4PAA A;  5L46 A;  4TVW A;  4C3X A;  5M0Z A;  4FDC B;  3UJS A;  2WP9 A;  1VG0 A;  5LV9 A;  5J7X A;  3ITJ A;  1CF3 A;  4MMW A;  3DJD A;  3SQS A;  2JB2 A;  3R0U A;  1D4E A;  1JNZ A;  1PBF A;  4IVO B;  4YT0 A;  3QPE A;  2WQY A;  3SYI A;  1D5T A;  4EM3 A;  4B69 A;  2PTZ A;  5C2T A;  1LJ1 A;  4G7F A;  3AB1 A;  2OLO A;  3BHF A;  4H2P A;  2GAG B;  2BS3 A;  2PP3 A;  5KVI A;  2R0C A;  3UTE A;  1KDG A;  2XVI A;  1NHS A;  2BC1 A;  4IT1 A;  4H1Z A;  3VCC A;  1VDC A;  3AE9 A;  2Q6U A;  3AN1 A;  4USQ A;  2JKC A;  1GV4 A;  2C67 A;  1T3Q C;  2B7S A;  2NPX A;  2C72 A;  1CC4 A;  2OAM A;  3A7A A;  1TZZ A;  2RDX A;  5KOW A;  3GRT A;  3NTA A;  3SGL A;  3UCD A;  5EB4 A;  2YQU A;  4Z1Y A;  4J2W A;  3DJJ A;  4DXK A;  4NZH A;  4OPI A;  3NTD A;  1LQT A;  4Z43 A;  4JN9 A;  1DXL A;  4OCG A;  4TLX A;  2WET A;  1F9C A;  3CGC A;  4DYE A;  3I6E A;  1BWC A;  3FJ4 A;  2W0H A;  4FK1 C;  2EQ8 A;  4GDE A;  3RO6 A;  5DBJ A;  3BHK A;  4HA6 A;  2P0I A;  2E5V A;  3AD8 B;  4OPC A;  1CC2 A;  3IJI A;  5KMS A;  2HXU A;  4YSZ A;  2Q7V A;  3UKK A;  1D7L A;  1PN0 A;  4UDP A;  1JRX A;  1GRH A;  2FYM A;  1IJH A;  2OLN A;  1KKO A;  1FEC A;  3CPJ G;  3CN8 A;  3ZLG A;  3ADA B;  4LA1 A;  3EAN A;  1NU5 A;  4HCD A;  4KWS A;  4J56 A;  2WHD A;  3ISH A;  1EBH A;  3QN3 A;  3P4S A;  4CCQ A;  3AWI A;  2AL1 A;  2DW6 A;  4NTE A;  3DES A;  3TCS A;  3UGV A;  4IZG A;  2PP1 A;  5IDZ A;  5GRT A;  1RM6 B;  3FVD A;  4G74 A;  3M12 A;  3AYJ A;  3G5R A;  4YTM A;  3HW2 A;  4H4R A;  4Z26 A;  3PWI A;  1GES A;  2GAH B;  1XDI A;  3NT6 A;  1ZMC A;  4Z17 A;  4TM0 A;  3SZC A;  2QJJ A;  2QA1 A;  1GRT A;  1FCD A;  3DER A;  3QFA A;  3AD7 B;  1S3E A;  2V60 A;  4NEV A;  1O95 A;  2GQF A;  1SJD A;  3ES7 A;  3N4E A;  4GCM A;  3I6T A;  3AE5 A;  3GD6 A;  2YG7 A;  2CHR A;  4K22 A;  2E5A A;  4OPG A;  3OZY A;  4H2R A;  3AEA A;  4HNC A;  3B9J B;  3HYX A;  3AE7 A;  4IA5 A;  2HXT A;  5FJO A;  1BKH A;  2W55 A;  1F8S A;  2YAU A;  2PCE A;  4A7A A;  3MSY A;  4G6H A;  1PDY A;  4YTP A;  3AXB A;  4UDQ A;  2B76 A;  4DN1 A;  3CNJ A;  1E1K A;  1FHV A;  2BCP A;  4A6N A;  4IL2 A;  2WDR A;  3BI2 A;  4NNJ A;  1DTN A;  3Q9T A;  1CC6 A;  3K7Q X;  3A7R A;  2WBA A;  4GDP A;  3ATQ A;  4X9N A;  3T37 A;  1NEN A;  1IUV A;  1IUS A;  3F8P A;  5TR3 A;  4ZA0 A;  4GGB A;  2DKI A;  4A6N B;  1ONE A;  2BXR A;  3ABV A;  5KVH A;  4OPD A;  1BGN A;  2HQM A;  4BJY A;  1RVK A;  4PAB A;  3L5O A;  2Z5X A;  3RIT A;  3VC5 A;  2C73 A;  4E4U A;  2XGZ A;  1S3B A;  4J36 A;  4K5R A;  2VQB A;  4C74 A;  1FHU A;  3B6D A;  3EF6 A;  2GEW A;  5JCM A;  2B9Y A;  5EU9 A;  3N6J A;  1WUE A;  2OX4 A;  3V4B A;  4C3Y A;  3P93 A;  1D4C A;  1MXT A;  3AEF A;  1UKV G;  3QVP A;  3PFR A;  4HNL A;  1DJN A;  3NKS A;  1L9C A;  3N6H A;  4KT2 A;  3GWD A;  2BS2 A;  2IVE A;  4U8N A;  5IPY A;  3NO1 A;  4YWO A;  4JHM A;  4B66 A;  2JBV A;  2E1M A;  1GND A;  3LXD A;  1OJA A;  3UKA A;  2GGG A;  3FYY A;  2XH7 A;  5JRB A;  3TJI A;  4A65 A;  2YM2 A;  3AEB A;  3T2K A;  4H4X A;  1E1M A;  3V76 A;  1H82 A;  2QDD A;  4Y4M A;  2TMD A;  1PXB A;  3CNS A;  3GMB A;  2WOV A;  3VRA A;  1W4X A;  1SB3 B;  1EL7 A;  3JSK A;  2BAB A;  4O5U A;  2QQ6 A;  1FOH A;  1KSU A;  3LZW A;  4AOS A;  4HCH A;  3SR6 B;  3OPS A;  1B4V A;  1E7P A;  3U9I A;  2VVM A;  3NN0 X;  3V3O A;  4HYR A;  4ZCC A;  3K7M X;  3DA1 A;  4GIS A;  4C77 A;  4GGH A;  4IL0 A;  2B7R A;  1VQZ A;  4M0X A;  5G5H B;  3AMZ A;  3CIR A;  5BRT A;  6ENL A;  1P43 A;  1GPE A;  4JNQ A;  2GGH A;  2YLW A;  3ZDN A;  4G6G A;  1PXC A;  1XHC A;  5FS6 A;  2Q0K A;  2BC0 A;  2EQ7 A;  3I6D A;  5C3J A;  4K2X A;  5EBK A;  2GSH A;  1S7M A;  4FI4 A;  2OQH A;  3CT2 A;  3OTR A;  2RGO A;  3PO7 A;  4U8O A;  3SN0 A;  3NRN A;  1SEZ A;  1ELS A;  3CGB A;  2IVD A;  2C66 A;  3TTE A;  4H4T A;  1LTX R;  3HPF A;  3BI5 A;  3GRS A;  1H7X A;  4ROP A;  2DW7 A;  2EQ9 A;  2EQ6 A;  2DKH A;  2GF3 A;  3KLJ A;  1B8S A;  4MKS A;  2XLR A;  2PU0 A;  3BOX A;  1NDA A;  2XSX A;  2O56 A;  3KA7 A;  4XWZ A;  4Y4N A;  1N4U A;  3GD3 A;  2B9W A;  4A35 A;  3DK8 A;  4NEW A;  3ZVI A;  3KKJ A;  1H81 A;  2WEU A;  1JRY A;  4II2 A;  1TYP A;  3MZN A;  3VFC A;  4H4W A;  3KVE A;  3UTF A;  1PJ7 A;  2VRM A;  1CL0 A;  5FMH A;  2NVK X;  2R45 A;  1KFY A;  4GYP A;  2WPC A;  3QJ4 A;  2WP6 A;  3RP6 A;  2GVC A;  3D46 A;  1OJD A;  4HB9 A;  2YVJ A;  3SZF A;  5M10 A;  3HYV A;  4E8G A;  4Z24 A;  1KF6 A;  2R4E A;  1DOD A;  1NG3 A;  1RP0 A;  2WDV A;  3UP5 A;  4Z2R A;  1H6V A;  3UOV A;  4J34 A;  1TDK A;  1ECQ A;  3DFY A;  3DG6 A;  1ZK7 A;  4ECH A;  3KPF A;  5J60 A;  4K8D A;  3SZW A;  1GTH A;  2VOU A;  2XFU A;  2H89 A;  3AE4 A;  1K0L A;  2NQL A;  4OPL A;  2OAL A;  1RSG A;  3OZ2 A;  2WPE A;  1E6E A;  1F6M A;  4GR1 A;  1N5X A;  1KNP A;  3DK9 A;  4U8L A;  2QJM A;  1N63 C;  1NPX A;  1KD0 A;  2YLT A;  1IYX A;  2BYB A;  2AQJ A;  4AP1 A;  3DIP A;  2GH5 A;  4GAV A;  4B65 A;  3NGC X;  3KPK A;  3P4R A;  3AED A;  4H2N A;  1WYG A;  5HXI A;  1EL9 A;  1MDL A;  1EC9 A;  4J3Z A;  1EBD A;  3CND A;  3DFH A;  3OW1 A;  4DWD A;  3FPZ A;  2C4C A;  1OJT A;  5JCK A;  3LZX A;  2OO6 A;  1MNS A;  1N1P A;  3THU A;  2GQW A;  4Z2T A;  3T4W A;  3NRZ B;  2C3C A;  3PVC A;  3R07 C;  4GAP A;  2V3B A;  2GDQ A;  2ZC8 A;  4G9K A;  1Z6L A;  3N4F A;  2BA9 A;  3VRD B;  3NVV B;  3DEQ A;  3I3L A;  3B97 A;  3R11 A;  2AL2 A;  1TRB A;  1TDE A;  2C70 A;  1HYU A;  1REO A;  1H86 A;  3R9U A;  3P9U A;  3P0W A;  3FV9 A;  5CQF A;  5KOX A;  3BJS A;  1JRO A;  4A9W A;  2WPF A;  1JOA A;  3NG7 X;  3L8K A;  1Q1R A;  2R9Z A;  3D8X A;  1STZ A;  2MNR A;  4U8P A;  2FBW A;  3NK0 X;  1PDH A;  3CYJ A;  3GYJ A;  4DHG A;  1BKW A;  1QLB A;  1FEB A;  4TM4 A;  4BUR A;  5FJR A;  3T14 A;  3HYW A;  4DSG A;  1X2H A;  3G5S A;  2CFY A;  5JCI A;  3V3W A;  1PBB A;  2WS3 A;  2OPJ A;  4UP3 A;  3CNT A;  5ENL A;  1TKK A;  4FX9 A;  3PK7 A;  3H4K A;  2ZZB A;  1P2E A;  1EL8 A;  5HY5 A;  3GO2 A;  3QSE A;  1D7Y A;  3B3R A;  3NK2 X;  1GAL A;  2AKZ A;  4EMJ A;  1LQU A;  4BK2 A;  1KNR A;  2ZBW A;  3RRA A;  4RSL A;  4YSX A;  2I0Z A;  3VC6 A;  2VVL A;  1PBD A;  3FG2 P;  2PSN A;  3UKF A;  5GSN A;  3EEZ A;  2VRL A;  4YSY A;  4D04 A;  3NVZ B;  3T2Y A;  3AYI A;  4BK3 A;  4K1W A;  1FO4 A;  3CXO A;  1CHU A;  3DME A;  4C5O A;  3MUC A;  2AAQ A;  2AKM A;  3QKE A;  3QFB A;  3SY4 A;  5FS9 A;  4ZN0 A;  3IJL A;  2FJD A;  5U63 A;  3JVA A;  2V61 A;  2XFP A;  4X4J A;  2PTW A;  5IQ4 A;  4P9S A;  1GEU A;  1QJD A;  4J31 A;  2XFO A;  1OJC A;  1JCT A;  1VRQ B;  4K2S A;  2FJE A;  3NNE A;  4BV6 A;  3UJR A;  1JDF A;  4MJW A;  4IP5 A;  3VCN A;  1B37 A;  1CJC A;  5JCL A;  4A79 A;  3NHO X;  2PGE A;  2YWL A;  3SXI A;  1CBO A;  2JB3 A;  1EL5 A;  3JW7 A;  3C4N A;  3TWB A;  3Q4D A;  3NYC A;  2Q0L A;  4H2H A;  1Y56 B;  5U1O A;  2C7G A;  2WU2 A;  3SM8 A;  3UKQ A;  4EQX A;  2YLS A;  3C4A A;  4EM4 A;  4EQR A;  4M6U A;  4CNK A;  1FFV C;  3D1C A;  3DGB A;  2C64 A;  2YLX A;  2GR2 A;  4EMI A;  2FKP A;  1SJC A;  3WE0 A;  3SJN A;  2PTX A;  3P4Q A;  1K0I A;  1NHR A;  3AM9 A;  3U4F A;  3DDM A;  1Y0P A;  2YLZ A;  3ES8 A;  3UKH A;  3BI4 A;  3UOX A;  1IUX A;  3SZ0 A;  1M64 A;  3EKG A;  3T9P A;  1IUU A;  2PYX A;  4II3 A;  4E5T A;  4WX1 A;  2Z5Y A;  4JDR A;  2XDO A;  2XVJ A;  2F5Z A;  4K5S A;  1TYT A;  3OP2 A;  1OEP A;  1Q9I A;  4NTC A;  3QVR A;  4DX3 A;  4BJZ A;  2PHH A;  2QVH A;  2RAB A;  2GB0 A;  4KEM A;  3HZL A;  1GXF A;  2PPG A;  4CRT A;  2WES A;  3ZYX A;  3ENL A;  3AEG A;  4GF7 A;  1VDV A;  4CBQ A;  1NEL A;  1SJA A;  1MOK A;  5BUK A;  3ZLF A;  4G73 A;  1R0M A;  3NLC A;  1S2Q A;  2UZZ A;  3AE8 A;  4U8I A;  2CVJ A;  2RGJ A;  3M13 A;  3NIX A;  3AE2 A;  3AE6 A;  1GOS A;  3UJ2 A;  1GRB A;  4X2P A;  4OPU A;  5CKU A;  3BSM A;  1YQ3 A;  2O9Z A;  1YQ4 A;  3K30 A;  2X8C A;  3SBF A;  1L8P A;  1ZXI C;  4AOX A;  4HPN A;  1PDZ A;  1W6T A;  4YXD A;  2CDU A;  3ATR A;  3KU9 A;  3C96 A;  2C75 A;  2TPR A;  3H8A A;  2H88 A;  2OG9 A;  1LVL A;  4H50 A;  1FL2 A;  2APG A;  2XVE A;  2R4J A;  3NH3 X;  1FEA A;  1QO8 A;  2XYO A;  2OA1 A;  3S61 A;  3F8R A;  3UXK A;  3RCY A;  2BS4 A;  1WUF A;  5J04 A;  2E4G A;  5KWF A;  2VQ7 A;  4B67 A;  2WDQ A;  2XCG A;  1CJ4 A;  3UOZ A;  3S5S A;  1DJQ A;  4DGK A;  3UXL A;  4CNJ A;  2JAE A;  1VQW A;  3UJF A;  4B1B A;  1JU2 A;  2X8H A;  3CPH G;  2PGW A;  3VA8 A;  4EIP A;  2XFQ A;  3F8D A;  4AP3 A;  4CCR A;  2OQY A;  3QSS A;  1NHP A;  2PU1 A;  3GYX A;  3ZVH A;  4H4Q A;  1H7W A;  4CY8 A;  3AE3 A;  1ZY8 A;  1N60 C;  5FJP A;  3ICT A;  1NG4 A;  3DG3 A;  3TJ4 A;  3DK4 A;  3FCP A;  3QSM A;  2R46 A;  1MDR A;  1GSN A;  4ZOH B;  3FMW A;  2YVF A;  3R25 A;  3ZVH B;  3COX A;  1TDF A;  2V6O A;  1O94 A;  2YR6 A;  1O5W A;  3M0O A;  3VQR A;  3IK4 A;  4EWJ A;  4IP4 A;  1M6I A;  1ELI A;  2C76 A;  4IVM B;  2HNE A;  4JN7 A;  3CNP A;  3UTH A;  4Z44 A;  3VRB A;  3MKC A;  4J57 A;  4EQS A;  4O5Q A;  3NVW B;  5HHF A;  2BRA A;  2QJN A;  4K8G A;  1MO9 A;  2OVL A;  1X31 B;  1GET A;  3FIM B;  1YKJ A;  3GSI A;  4ZCD A;  1KKR A;  2HZG A;  1BQG A;  3PG6 A;  4KPL A;  3TOY A;  2BXS A;  1P48 A;  2YG5 A;  4H4U A;  4H83 A;  2YG6 A;  3DG7 A;  5G5G B;  5KXJ A;  2X8G A;  3CTY A;  3I4K A;  1K0J A;  3P3B A;  2YG4 A;  3T31 A;  2I5Q A;  1CJ2 A;  2JB1 A;  1GRF A;  3LB8 A;  3BNU A;  4XWR A;  2BCG G;  1MRA A;  4YWS A;  2BRY A;  2C3D A;  1D4D A;  3CGE A;  4BK1 A;  4E4F A;  2QAE A;  2AR8 A;  2XH0 A;  4E6M A;  3LJP A;  3IHG A;  1F8R A;  1JPM A;  5HYM A;  5KNL A;  3GMC A;  2W3S A;  1TE6 A;  1R6W A;  2BAC A;  1ONF A;  2XVF A;  2P3Z A;  3H8L A;  1RYI A;  1JPD X;  3UCL A;  4IHC A;  3P4P A;  4AT0 A;  1JRP A;  4G8T A;  2WOI A;  3SN1 A;  1ZDL A;  2A8X A;  3ALL A;  5FS7 A;  1SJB A;  4TVY A;  1TDN A;  1B5Q A;  2X50 A;  2JK6 A;  1PBC A;  2GRT A;  2GR3 A;  4GYP C;  3L1R A;  2GMJ A;  4RG3 A;  1XS2 A;  1S2Y A;  3V3N A;  5JCN A;  1FIQ B;  2C65 A;  2YM1 A;  1COY A;  5EB5 A;  2R0P A;  5EOW A;  2XLP A;  5KMQ A;  1GT8 A;  1F8W A;  4CY6 A;  4ENL A;  3ICR A;  3VR8 A;  1DNC A;  3GWF A;  5IQ1 A;  2X3N A;  3T2Z A;  2XLT A;  5BOF A;  1PS9 A;  4EMW A;  3S47 A;  2XH2 A;  2VZ2 A;  3T0K A;  3CPI G;  3TW9 A;  4DSH A;  4U8J A;  3TQP A;  3G5Q A;  1GER A;  3DGH A;  3E1T A;  4TM3 A;  2XFN A;  2BK4 A;  4N9X A;  3R10 A;  1E1N A;  1DOC A;  4TLZ A;  1JEH A;  1GRA A;  4H4V A;  1Q1W A;  4ICY A;  3KD9 A;  1GRE A;  2GR0 A;  3ZLH A;  2GGJ A;  1DOB A;  2GR1 A;  3R1Z A;  1KCZ A;  3NXL A;  4M52 A;  2ZZ0 A;  4OPT A;  3URH A;  2QA2 A;  2V5Z A;  4LII A;  2FJB A;  1KN0 A;  3UP4 A;  1GRG A;  1TDO A;  4FK1 A;  3RR1 A;  4A6G A;  2XVH A;  3NYE A;  3DH9 A; 
#chains in the Genus database with same CATH homology
 2OLO A;  3BHF A;  4H2P A;  1GPE A;  4X9M A;  1Y0P A;  2GAG B;  2YLZ A;  2BS3 A;  4JNQ A;  3UKP A;  3UKH A;  3DGZ A;  2YLW A;  3BI4 A;  3ZDN A;  3UOX A;  5KVI A;  1PXC A;  2R0C A;  1XHC A;  5FS6 A;  1IUX A;  4G6G A;  3UTE A;  3SZ0 A;  1KDG A;  1M64 A;  2Q0K A;  2XVI A;  1IUU A;  2PYX A;  5BVA A;  4II3 A;  1NHS A;  2BC1 A;  2BC0 A;  4EIQ A;  4WX1 A;  2Z5Y A;  2EQ7 A;  3I6D A;  3LAD A;  1VDC A;  5C3J A;  4JDR A;  3AE9 A;  4K2X A;  2XDO A;  4A99 A;  2XVJ A;  3DJG X;  2F5Z A;  5EBK A;  1IUW A;  4K5S A;  3AEE A;  1TYT A;  2Q6U A;  3FBS A;  1Q9I A;  4EQW A;  1S7M A;  1H83 A;  4USQ A;  3VR9 A;  4NTC A;  3QVR A;  4U8M A;  4BJZ A;  2JKC A;  2PHH A;  1GV4 A;  2X99 A;  2C67 A;  2RGO A;  3PO7 A;  2RAB A;  3Q6J A;  2GB0 A;  2B7S A;  4I59 A;  1PJ6 A;  3P1W A;  2NPX A;  4U8O A;  2C72 A;  3HZL A;  1GXF A;  4JQ9 A;  3NRN A;  4CRT A;  1CC4 A;  1GTE A;  2OAM A;  2WES A;  4Y4L A;  3ZYX A;  2B9X A;  4B68 A;  1SEZ A;  3CGB A;  3AEG A;  5KOW A;  4NWZ A;  3GRT A;  2IVD A;  2C66 A;  2YR4 A;  3NTA A;  4GF7 A;  3SGL A;  4CBQ A;  4H4T A;  5EB4 A;  1MOK A;  2YQU A;  1LTX R;  4H4S A;  3BI5 A;  3RP7 A;  5BUK A;  4G73 A;  2QCU A;  2ZZC A;  4J2W A;  3GRS A;  3DJJ A;  3NLC A;  4H7U A;  1H7X A;  1S2Q A;  4NZH A;  2EQ9 A;  4OPI A;  2EQ6 A;  2DKH A;  3NTD A;  1LQT A;  2GF3 A;  2UZZ A;  3IHM A;  3KLJ A;  1B8S A;  3AE8 A;  4GUV A;  3ICS A;  3BNM A;  4KX6 A;  2XLR A;  4U8I A;  4Y4N A;  1NDA A;  2CVJ A;  3KA7 A;  3ALJ A;  4XWZ A;  1N4U A;  2RGJ A;  3M13 A;  4Z43 A;  4JN9 A;  1DXL A;  2A87 A;  2V3A A;  1N4V A;  4OCG A;  4TLX A;  2WET A;  3SFD A;  2VVL G;  3CGC A;  3NIX A;  3GD3 A;  2B9W A;  4K7Z A;  1BWC A;  3AE2 A;  3AE6 A;  4Z2U A;  3DK8 A;  4NEW A;  2W0H A;  1GOS A;  2EQ8 A;  3GDN A;  3KKJ A;  1GRB A;  1H81 A;  4FK1 C;  4GDE A;  2WEU A;  1JRY A;  1BGJ A;  1JNR A;  1TYP A;  2YR5 A;  3BHK A;  2E5V A;  3AD8 B;  4HA6 A;  3LOV A;  1CC2 A;  1YQ3 A;  4OPU A;  2O9Z A;  4OPC A;  5CKU A;  1YQ4 A;  5KMS A;  3K30 A;  2X8C A;  2YLR A;  4YSZ A;  3UTG A;  4H4W A;  2Q7V A;  3KVE A;  3UKK A;  3UTF A;  1D7L A;  1PJ7 A;  2VRM A;  4AOX A;  1CL0 A;  1Y56 A;  1PN0 A;  3UKL A;  4YXD A;  5FMH A;  2NVK X;  2CDU A;  1NAA A;  1PXA A;  2R45 A;  1KFY A;  2WPC A;  3QJ4 A;  3ATR A;  3KU9 A;  3C96 A;  2WP6 A;  3RP6 A;  1YQZ A;  2C75 A;  2GVC A;  2TPR A;  2H88 A;  1LVL A;  4H50 A;  4UDP A;  1JRX A;  1FL2 A;  1GRH A;  2APG A;  2XVE A;  1IJH A;  2R4J A;  1OJD A;  2OLN A;  4HB9 A;  2YVJ A;  3SZF A;  3NH3 X;  5M10 A;  3HYV A;  1JRZ A;  1FEA A;  3IC9 A;  1QO8 A;  1FEC A;  2XYO A;  2OA1 A;  4Z24 A;  3S61 A;  4JNA A;  3F8R A;  2XLS A;  4B63 A;  3CPJ G;  1KF6 A;  2BS4 A;  2R4E A;  1DOD A;  1NG3 A;  3CN8 A;  1F3P A;  1RP0 A;  4LA1 A;  3ADA B;  2WDV A;  3EAN A;  4II2 A;  2E4G A;  3UP5 A;  1OJ9 A;  5KWF A;  2YG3 A;  4Z2R A;  2VQ7 A;  3AD9 B;  4J56 A;  4B67 A;  2WHD A;  2Y6R A;  1H6V A;  2WDQ A;  2XCG A;  3ISH A;  2ACZ A;  3UOV A;  1CJ4 A;  4J34 A;  2XLU A;  3UOZ A;  1TDK A;  3GDP A;  1DJQ A;  1ZK7 A;  3P4S A;  3CMM A;  4CCQ A;  4DGK A;  4CNJ A;  2JAE A;  3AWI A;  3S5W A;  4U2T A;  4ECH A;  1VQW A;  3KPF A;  1H2I A;  1ZOV A;  4NTE A;  5J60 A;  4K8D A;  4B1B A;  3SZW A;  1L9E A;  1GTH A;  1DOE A;  2VOU A;  2H89 A;  2XFU A;  3AE4 A;  1JU2 A;  1E39 A;  2X8H A;  1K0L A;  3RNM A;  3CPH G;  4OPL A;  2OAL A;  3EAO A;  4EIP A;  5KRQ A;  1RSG A;  2XFQ A;  3F8D A;  3OZ2 A;  4AP3 A;  4CCR A;  2WPE A;  1E6E A;  4GRT A;  3SX6 A;  1F6M A;  4D03 A;  2FJA A;  3GYI A;  4GR1 A;  3QSS A;  5GRT A;  3D9X A;  1KNP A;  3M12 A;  4G74 A;  1NHP A;  3AYJ A;  3GYX A;  3G5R A;  3DK9 A;  4U8L A;  4YTM A;  4H4R A;  4H4Q A;  4Z26 A;  1NPX A;  1GES A;  1H7W A;  2CUL A;  3IWA A;  2GAH B;  3AEC A;  4XXG A;  4CY8 A;  1XDI A;  2A89 A;  3AE3 A;  2YLT A;  3NT6 A;  1ZY8 A;  1ZMC A;  3ICT A;  1VG9 A;  4H4P A;  2BYB A;  1L0V A;  2AQJ A;  1NG4 A;  4TM0 A;  4AP1 A;  3SZC A;  3DK4 A;  4H2Q A;  2GH5 A;  1CJ3 A;  4IV9 A;  3AE1 A;  4GAV A;  4B65 A;  3QSM A;  3NGC X;  3RP8 A;  3KPK A;  2R46 A;  4REK A;  3P4R A;  2QA1 A;  1GRT A;  1FCD A;  1GSN A;  3QFA A;  3AED A;  3FMW A;  3NN6 X;  3AD7 B;  1S3E A;  2V60 A;  4H2N A;  2YVF A;  3GD4 A;  5HXI A;  1EL9 A;  2GV8 A;  1N4W A;  1BZL A;  4NEV A;  1TDF A;  3COX A;  2V6O A;  1EBD A;  1O94 A;  1O95 A;  2YR6 A;  2GQF A;  1O5W A;  3CND A;  2C4C A;  3FPZ A;  1ZKQ A;  1OJT A;  3M0O A;  1AOG A;  5JCK A;  3LZX A;  1XPQ A;  4GCM A;  3VQR A;  1NHQ A;  4B64 A;  3DJE A;  1N1P A;  3AE5 A;  3CGD A;  1NEK A;  4ADW A;  2GQW A;  4TM1 A;  4Z2T A;  2YG7 A;  1ZP0 A;  1M6I A;  4K22 A;  2C3C A;  3PVC A;  1ELI A;  4J33 A;  4OPG A;  2C76 A;  4IVM B;  4H2R A;  4GAP A;  3CNP A;  3AEA A;  3UTH A;  2V3B A;  3PS9 A;  4Z44 A;  3HYX A;  3VRB A;  3AE7 A;  4IA5 A;  4J57 A;  4EQS A;  4O5Q A;  4G9K A;  5DBJ A;  1Z6L A;  2BA9 A;  3VRD B;  1V59 A;  4USR A;  1F8S A;  2YAU A;  5HHF A;  2BRA A;  3I3L A;  4A7A A;  4U2S A;  1YY5 A;  4G6H A;  4DNA A;  4YTP A;  3AXB A;  1MO9 A;  2C70 A;  1TRB A;  1TDE A;  4A5L A;  1X31 B;  4UDQ A;  4APN A;  2B76 A;  1GET A;  3FIM B;  1YKJ A;  3GSI A;  4ZCD A;  4YTN A;  3CNJ A;  1E1K A;  1HYU A;  2BK5 A;  2J3N A;  3PG6 A;  1REO A;  2BXS A;  1H86 A;  2BCP A;  3R9U A;  4A6N A;  3P9U A;  2YG5 A;  4H4U A;  5CQF A;  2YG6 A;  5KOX A;  2ARD A;  5KXJ A;  2X8G A;  4A9W A;  2WPF A;  3CTY A;  1JOA A;  3UOY A;  3NG7 X;  3L8K A;  1K0J A;  2WDR A;  1Q1R A;  3BI2 A;  2YG4 A;  4NNJ A;  2R9Z A;  3D8X A;  1CC6 A;  3Q9T A;  4U8P A;  3T31 A;  1ZOY A;  3K7Q X;  2FBW A;  1CJ2 A;  2JB1 A;  3NK0 X;  1PDH A;  1K4Q A;  1GRF A;  4NTD A;  3GYJ A;  3LB8 A;  2WBA A;  4H4Y A;  3BNU A;  4GDP A;  2BCG G;  1BKW A;  4XWR A;  1QLB A;  3ATQ A;  1FEB A;  4TM4 A;  4X9N A;  2BRY A;  2C3D A;  3T37 A;  4BUR A;  1IUV A;  1NEN A;  4E0V A;  1D4D A;  3CGE A;  1IUS A;  3T14 A;  4BK1 A;  3F8P A;  2QAE A;  5TR3 A;  2RGH A;  3HYW A;  3NYF A;  2AR8 A;  4DSG A;  1LPF A;  4JY3 A;  3RED A;  3G5S A;  3IHG A;  3LJP A;  5ER0 A;  1F8R A;  2CFY A;  5JCI A;  4WCT A;  1PBB A;  2DKI A;  4A6N B;  2WS3 A;  5HYM A;  4UP3 A;  3GMC A;  2BXR A;  5KNL A;  3CNT A;  3O0H A;  5KVH A;  3ABV A;  1BGN A;  2Y6Q A;  4OPD A;  2HQM A;  2R0G A;  4BJY A;  1E1L A;  2BAC A;  1ZMD A;  4FX9 A;  1ZX9 A;  4PAB A;  1ONF A;  3H4K A;  2ZZB A;  1P2E A;  1EL8 A;  2XVF A;  3L5O A;  3H8L A;  5HY5 A;  1RYI A;  2WU5 A;  1D7Y A;  2Z5X A;  5U25 A;  3B3R A;  3QSE A;  2C73 A;  3NK2 X;  1XAN A;  1GAL A;  4YKF A;  5BUL A;  1IUT A;  3UCL A;  1S3B A;  4J36 A;  4LU6 A;  3P4P A;  4K5R A;  4EMJ A;  2VQB A;  4AT0 A;  1H84 A;  2WOI A;  4I58 A;  4C74 A;  1LQU A;  4BK2 A;  3AYL A;  1KNR A;  2ZBW A;  3B6D A;  4YSH A;  4AT2 A;  1ZDL A;  4RSL A;  2A8X A;  3ALL A;  4KPR A;  3EF6 A;  3OC4 A;  2GEW A;  1PJ5 A;  4YSX A;  4YKG A;  5JCM A;  2B9Y A;  5FS7 A;  2I0Z A;  1TDN A;  2VVL A;  1B5Q A;  4C3Y A;  4JY2 A;  1PBD A;  3FG2 P;  2X50 A;  2JK6 A;  2YVG A;  1D4C A;  1MXT A;  1PBC A;  2GRT A;  3AEF A;  3UKF A;  1UKV G;  5GSN A;  2GR3 A;  3L1R A;  3QVP A;  4U8K A;  2GMJ A;  2VRL A;  4YSY A;  4RG3 A;  4D04 A;  4U2L A;  4IA6 A;  3T2Y A;  3AYI A;  1KSS A;  1S2Y A;  1DJN A;  3V3N A;  4BK3 A;  5JCN A;  3NKS A;  1L9C A;  1CHU A;  3DME A;  2C65 A;  2YM1 A;  4C5O A;  1COY A;  5EB5 A;  2AAQ A;  3ALM A;  2R0P A;  3GWD A;  2BS2 A;  2IVE A;  4U8N A;  5EOW A;  5IPY A;  3QFB A;  2BK3 A;  4YWO A;  4B66 A;  1PHH A;  2JBV A;  2E1M A;  2XLP A;  3IF9 A;  5FS9 A;  3SY4 A;  4ZN0 A;  3NK1 X;  1GND A;  3LXD A;  1OJA A;  5KMQ A;  1GT8 A;  2FJD A;  1F8W A;  1LV0 A;  4H4Z A;  5U63 A;  3UKA A;  4CY6 A;  2WP5 A;  2V61 A;  3ICR A;  3VR8 A;  1DNC A;  3GWF A;  5IQ1 A;  2WOW A;  2XFP A;  5JRB A;  2X3N A;  4X4J A;  3T2Z A;  4A65 A;  1PBE A;  4UDR A;  2XLT A;  5IQ4 A;  1PS9 A;  4P9S A;  2IID A;  2YM2 A;  1GEU A;  3AEB A;  3T2K A;  4H4X A;  4EMW A;  1QJD A;  4J31 A;  4RG4 A;  2XFO A;  1E1M A;  3V76 A;  1OJC A;  3EPT A;  3SQP A;  1VRQ B;  2FJE A;  1H82 A;  3NNE A;  4BV6 A;  3H8I A;  4Y4M A;  2TMD A;  4MJW A;  3SFE A;  5KMR A;  2VZ2 A;  1B37 A;  1CJC A;  1P2H A;  5JCL A;  2GMH A;  1PXB A;  3CNS A;  3GMB A;  2WOV A;  3T0K A;  1W4X A;  3CPI G;  3VRA A;  4A79 A;  4DSH A;  4U8J A;  3II4 A;  1EL7 A;  4OVI A;  3NHO X;  3G5Q A;  1BF3 A;  2YWL A;  3K7T A;  3RHA A;  3JSK A;  1GER A;  2BAB A;  4O5U A;  3SXI A;  1CBO A;  4Z25 A;  2JB3 A;  3DGH A;  1EL5 A;  3E1T A;  4TM3 A;  2XFN A;  2BK4 A;  5KMP A;  4N9X A;  1L9D A;  3C4N A;  1E1N A;  1DOC A;  1FOH A;  1KSU A;  3NYC A;  4TLZ A;  3LZW A;  1JEH A;  4AOS A;  2Q0L A;  5FS8 A;  4PAA A;  1Y56 B;  5U1O A;  5L46 A;  2C7G A;  2WU2 A;  3SM8 A;  3UKQ A;  4EQX A;  4C3X A;  5M0Z A;  1B4V A;  1GRA A;  4FDC B;  1E7P A;  2YLS A;  2WP9 A;  4H4V A;  1VG0 A;  1Q1W A;  4EM4 A;  4EQR A;  3C4A A;  5LV9 A;  5J7X A;  2VVM A;  3NN0 X;  4ICY A;  3ITJ A;  1CF3 A;  3KD9 A;  3V3O A;  1GRE A;  4ZCC A;  4CNK A;  2GR0 A;  3K7M X;  3DJD A;  3D1C A;  2JB2 A;  1DOB A;  2GR1 A;  1D4E A;  2C64 A;  3DA1 A;  1JNZ A;  1PBF A;  2YLX A;  4IVO B;  4YT0 A;  4M52 A;  4C77 A;  2GR2 A;  2ZZ0 A;  4OPT A;  3URH A;  2WQY A;  3SYI A;  4EMI A;  2QA2 A;  2B7R A;  1D5T A;  2V5Z A;  4EM3 A;  4B69 A;  3WE0 A;  4LII A;  2FJB A;  1KN0 A;  5C2T A;  3UP4 A;  1LJ1 A;  3P4Q A;  1GRG A;  1TDO A;  3CIR A;  4FK1 A;  1K0I A;  5BRT A;  1NHR A;  2XVH A;  3NYE A;  3DH9 A;  3AB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...