1NHSA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 137
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhsA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA02
3DJJA 3B3RA 3QFAA 3AE8A 5HYMA 5CKUA 3CN8A 1JNRA 2GB0A 3C4AA 2YM1A 3JSKA 1JU2A 4Z2RA 1EL9A 3BNUA 4U8JA 2A8XA 1VQWA 4TLZA 2E1MA 3NHOX 2OLNA 2Z5XA 2R0CA 4AP1A 4H4QA 1K0IA 3GWDA 2EQ9A 4K5RA 1LTXR 3LXDA 4EQSA 2WPFA 2WESA 2YR5A 5KOWA 1K0JA 1E6EA 4D04A 5LV9A 1P2HA 2GR1A 4A5LA 2RGOA 5IQ1A 4EQRA 4AT2A 1VRQB 5GSNA 1DXLA 3CGEA 4H4XA 2A89A 3P1WA 4GRTA 4GF7A 3K7MX 4TM3A 4UDRA 4NEWA 1GOSA 2VRMA 1CJ2A 3D1CA 3RNMA 2JK6A 1PBBA 4XWRA 3GYJA 4ZCDA 5U63A 1F3PA 2Q7VA 3NYCA 2ZZCA 4H4ZA 4ADWA 1OJDA 3K7QX 1GSNA 4J56A 4CY6A 4DSGA 3LOVA 3QVRA 5FS8A 1LV0A 1Q9IA 1QJDA 2H88A 2TMDA 3C96A 3I6DA 1BZLA 3LJPA 4KX6A 3RP7A 4J2WA 1JRXA 1N4UA 3GWFA 2GR3A 1TYTA 1ZX9A 2OAMA 2WS3A 4AT0A 2YLSA 3NYEA 3QVPA 4CBQA 2C3DA 4FK1A 2WDRA 1DNCA 1JNZA 4YKFA 2V6OA 4U8NA 3OZ2A 5C3JA 5U1OA 1KF6A 2BS3A 2GMHA 3CTYA 4H4PA 1H7XA 4K7ZA 2VVLA 1IUWA 5GRTA 1LQTA 3DJDA 4TM4A 4YXDA 2VVMA 3REDA 5L46A 3URHA 4I58A 1YQ3A 4RG3A 4ICYA 3UOVA 2W0HA 3UTEA 1JOAA 4J31A 1XDIA 2GF3A 4H4YA 2YLRA 4U8PA 1ELIA 4YSXA 2VQ7A 3CNPA 3KA7A 3GSIA 3SM8A 4X9NA 4BK3A 2RABA 4H2RA 2YLXA 3DH9A 4USRA 5BULA 1F8WA 2XLTA 1W4XA 4O5UA 3KU9A 5BRTA 1YY5A 1MXTA 2I0ZA 3UKFA 2RGJA 4JY3A 3AD8B 2Q6UA 3VRAA 4Y4MA 2NPXA 3DMEA 3DK8A 3VRBA 1HYUA 3NK1X 2YAUA 4LIIA 1CC6A 1DJQA 3L8KA 3ALJA 2C72A 2OALA 4Z2TA 2C66A 4JDRA 3BI2A 1KNPA 1D4DA 2WOWA 1DOBA 1Z6LA 3NN6X 4OPIA 2Y6RA 3SFEA 2AR8A 5IPYA 2GEWA 3P4SA 3AE4A 1DODA 3AE5A 1PXAA 1Y0PA 4N9XA 4OPGA 2B9XA 1OJAA 1P2EA 3BHFA 3M13A 3UKHA 4GDPA 1QLBA 1ZDLA 2GAHB 3AYIA 2F5ZA 1RYIA 4JN9A 2X3NA 3UKQA 2WQYA 3AEFA 2RGHA 3BNMA 1VG9A 1PBFA 3NGCX 5JCMA 2EQ8A 1H7WA 3G5SA 3ITJA 2QA1A 2FJEA 3DJEA 5U25A 3QSMA 4GCMA 4AOXA 2YG7A 1H82A 4Z2UA 2JAEA 2QA2A 3QSEA 4YTMA 1VG0A 2XVEA 2XDOA 2R0GA 5J60A 1L9DA 4H2PA 3NT6A 4FDCB 3E1TA 2GV8A 5IQ4A 4EM3A 2YG5A 1E1LA 2XYOA 1LVLA 5M10A 3CNJA 3UKLA 3LZWA 4IA6A 1MOKA 2YQUA 1ZMDA 4DNAA 2DKHA 4I59A 4GR1A 4AOSA 2CFYA 2JB3A 3NLCA 1M64A 3M12A 1FEBA 1REOA 4K5SA 2AAQA 4UDQA 1IUVA 2FJBA 2YLWA 4BURA 3LADA 2C70A 4B69A 1IUSA 3UP5A 4RSLA 4YWOA 1UKVG 3D8XA 3UTGA 3VR8A 2Q0KA 4CRTA 4JNQA 4OPTA 1KFYA 1OJ9A 4OPUA 3NK0X 4J57A 2BK5A 1NG3A 3IC9A 2YLZA 1M6IA 4BV6A 1X31B 3IF9A 2PHHA 4CNKA 1EBDA 2X8CA 1IUTA 1NPXA 1FCDA 3CNDA 3PVCA 5CQFA 3G5QA 4J34A 4MJWA 2BABA 2R45A 3ZDNA 1GEUA 1PXBA 3Q9TA 4U8LA 1LPFA 1PJ6A 2WP9A 1EL7A 1GERA 1Q1RA 4CCRA 3AE2A 1F8RA 4UP3A 1LQUA 2NVKX 1PXCA 4JQ9A 1JEHA 4EQXA 2WDQA 2Y6QA 3GMBA 3AXBA 4U8IA 3UOZA 4A6NA 3GD3A 4A65A 4C74A 2B7SA 3ALMA 1ZP0A 1CJ3A 1PJ5A 5TR3A 1DOCA 5FS6A 4XWZA 4NTCA 3CNSA 3IHMA 4B64A 2DKIA 1IUXA 2WP6A 2WOVA 4ECHA 3DJGX 2BK3A 2QAEA 1TDEA 5EBKA 2GQFA 3Q6JA 4X4JA 1JRZA 4EMIA 2CVJA 3GMCA 3NRNA 3NTAA 4A79A 1TDNA 2V3AA 2FJAA 1CBOA 3ICRA 4A7AA 4YSHA 1OJCA 3NKSA 4TM1A 3O0HA 4Z26A 2CDUA 1PS9A 2XVHA 2OLOA 5JCIA 2UZZA 2EQ7A 3DA1A 3I3LA 3IWAA 2VOUA 1NHSA 4CNJA 1YQZA 2GAGB 1CF3A 1BGNA 4H2NA 3UCLA 4EIPA 3L1RA 1D4EA 1XHCA 3NYFA 1GNDA 2WPCA 1ONFA 1L9EA 1RP0A 1ZMCA 3CIRA 1Y56A 4U8MA 2JBVA 5HY5A 2C73A 5M0ZA 4TM0A 4WX1A 4YTNA 3CPHG 1B5QA 1CHUA 3ATQA 1GRHA 4NEVA 5JCKA 2YR6A 3KD9A 1H81A 4B63A 1KNRA 1D5TA 2E4GA 4FX9A 4LA1A 3AEBA 1TDKA 5KVHA 3NG7X 1H6VA 1NDAA 2C64A 1NHQA 2B9WA 3UTHA 1TDOA 3T37A 5FS7A 4OPLA 2YVGA 2YLTA 1LJ1A 2WPEA 2WDVA 4H4WA 2ACZA 5EB4A 1F6MA 1ZOVA 4U2TA 4A9WA 1GXFA 2V60A 3RP6A 4B67A 3CGBA 4EQWA 1ZOYA 1GRFA 1PJ7A 1QO8A 4EMWA 2XFNA 3KLJA 2C3CA 1L9CA 4NTEA 1D7LA 1CJCA 3AYLA 4TLXA 3II4A 5KXJA 4ZCCA 3C4NA 2WP5A 3AE9A 3BHKA 3LB8A 1IUUA 1K0LA 4IV9A 2V3BA 3LZXA 4U2LA 2GRTA 3SFDA 3ADAB 3KKJA 2IIDA 4P9SA 2YG6A 2XCGA 1XANA 3NN0X 5J7XA 2VRLA 4J33A 1DJNA 1O95A 2R46A 4JY2A 1GESA 4OPCA 1BF3A 4K8DA 4XXGA 3RP8A 2B7RA 1GREA 1OJTA 1N4WA 2YWLA 1PBEA 1GTHA 2V61A 1RSGA 2Q0LA 2V5ZA 1S3EA 3S61A 3VR9A 2GMJA 2GH5A 2XFQA 2ZBWA 1B8SA 3B6DA 3SQPA 1O5WA 2BACA 4U2SA 4H7UA 2GR2A 4X9MA 2WOIA 2IVDA 2IVEA 5FS9A 1IJHA 3F8DA 3NIXA 3G5RA 2XLUA 3ALLA 3KVEA 2R0PA 5EOWA 3V3NA 2X8GA 4BK2A 3S5WA 1S2YA 4B66A 3M0OA 1TYPA 3P4QA 3AB1A 3ZYXA 2BK4A 4EIQA 3ATRA 2WETA 3H8LA 2VZ2A 3NTDA 4DSHA 1N1PA 1FEAA 1ZKQA 3CGDA 4Z24A 3UOYA 3DK9A 2Z5YA 2PYXA 1GALA 2XVFA 1NENA 3P9UA 1N4VA 3GD4A 3P4PA 2JKCA 3DK4A 4PABA 1GTEA 4C77A 4B1BA 1KSUA 2WHDA 5HHFA 5KVIA 5FMHA 1PN0A 2C65A 1H86A 2BC1A 1EL5A 2A87A 4CCQA 3QSSA 1B4VA 4EM4A 3EPTA 3COXA 3HZLA 3UTFA 2BA9A 3AEAA 1CJ4A 1PDHA 2ZZBA 3ICTA 1TRBA 3QJ4A 4J36A 3FPZA 3AE1A 4DGKA 1FECA 3GRSA 3KPFA 4IVMB 5JCNA 4REKA 3F8RA 4O5QA 4YT0A 1E1NA 5KOXA 2YVJA 1GT8A 2CULA 4Z43A 4IVOB 1NG4A 4D03A 3AD7B 2XVJA 2WU5A 3PO7A 1GPEA 4H4VA 1COYA 1CC4A 3AEGA 5KWFA 4A99A 2BS4A 2WU2A 2XVIA 3VQRA 3K30A 4HA6A 3EF6A 3AEDA 4RG4A 1GV4A 3P4RA 4GDEA 4A6NB 3UKKA 2YG3A 3FMWA 4H2QA 1XPQA 1D7YA 4LU6A 3AECA 4YKGA 1GRGA 3GRTA 1CL0A 1EL8A 1FOHA 2YVFA 3AD9B 1NHRA 3EANA 4M52A 2C67A 2XLRA 2XLSA 4UDPA 1BKWA 2FBWA 3R9UA 5BUKA 3UP4A 2E5VA 2R4EA 1JRYA 3NH3X 1YKJA 2ZZ0A 3SGLA 2APGA 1K4QA 2BS2A 2YM2A 4GUVA 4AP3A 4H4SA 4OVIA 1E1KA 2VQBA 4H4TA 3CNTA 1FL2A 3UKAA 2BYBA 2C75A 1PBCA 1H83A 2GR0A 4PAAA 4YSZA 2JB1A 3H4KA 2YR4A 3IHGA 1ZK7A 4C3YA 1ZY8A 2BXRA 2ARDA 2QCUA 3AE3A 3FIMB 3BI5A 4APNA 4CY8A 1BGJA 2XFPA 4OCGA 2WBAA 2HQMA 3EAOA 2C76A 1GRTA 1Y56B 1O94A 3AWIA 2YG4A 3ISHA 2BC0A 3CGCA 1KSSA 3GYIA 4JNAA 1B37A 4U8KA 1PBDA 3DGHA 3RHAA 4YTPA 1V59A 1NAAA 4NZHA 1NHPA 1F8SA 1PHHA 3PS9A 2VVLG 2FJDA 2X99A 2BCGG 4USQA 3H8IA 4WCTA 4EMJA 4C3XA 1GRAA 2B9YA 4BK1A 1E7PA 2R9ZA 1S3BA 1E1MA 1H84A 4OPDA 3AYJA 2R4JA 2C7GA 4YSYA 3AE6A 5HXIA 3UOXA 1MO9A 1S2QA 3F8PA 4Z44A 4NTDA 2GQWA 4H50A 2H89A 4Y4NA 4E0VA 3NNEA 4H4RA 3NK2X 3FBSA 1GETA 4H4UA 3AEEA 4B65A 5EB5A 3V76A 4Y4LA 4Z25A 1NEKA 2OA1A 3BI4A 3DGZA 5C2TA 4IA5A 1GRBA 1AOGA 1YQ4A 2X8HA 5KRQA 3QFBA 2XFUA 5JCLA 4HB9A 4BJZA 1SEZA 4K2XA 1L0VA 2BCPA 3ICSA 3UKPA 3V3OA 2TPRA 3WE0A 3ABVA 4ZN0A 2GVCA 4FK1C 3VRDB 5ER0A 1BWCA 3CPJG 3GDNA 3CPIG 2JB2A 4U8OA 4K22A 2WEUA 1KDGA 3GDPA 1E39A 1Q1WA 2B76A 1TDFA 2XLPA 2J3NA 3FG2P 4C5OA 2BXSA 1CC2A 3K7TA 4BJYA 1D4CA 2O9ZA 4B68A 3AE7A 5BVAA 3OC4A 5DBJA 1VDCA 2X50A 2XFOA 2AQJA 2EQ6A 4KPRA 1DOEA
chains in the Genus database with same CATH superfamily
3B3RA 2PU0A 1P48A 5EU9A 1VQWA 4TLZA 2E1MA 3NHOX 2XH0A 2R0CA 4AP1A 4H4QA 2EQ9A 4IT1A 1LTXR 5KOWA 4D04A 3T6CA 1P2HA 2AL2A 2RGOA 3CB3A 3ZLHA 4GRTA 3N4EA 3RNMA 4ZCDA 1F3PA 4ADWA 1GSNA 1JDFA 4DSGA 1N60C 3LOVA 1LV0A 1Q9IA 3RP7A 3LJPA 4FI4A 2WDRA 1JNZA 5C3JA 2MNRA 1KF6A 2GMHA 3CT2A 1IUWA 4TM4A 2OO6A 3REDA 2C4CA 1YQ3A 3UOVA 1JOAA 4J31A 2GF3A 2YLRA 4H4YA 3CNPA 3KA7A 3GSIA 3DERA 4G9KA 3ES8A 3UJEA 2P88A 5BRTA 4GIRA 2Q6UA 4Y4MA 4MMWA 3DMEA 3VRBA 3GYXA 1DJQA 3ALJA 2C66A 4JDRA 1MNSA 3BI2A 1Z6LA 4GGHA 1EBGA 3P4SA 1DODA 1PXAA 1Y0PA 3UKHA 4GDPA 1ZDLA 3UXKA 1RYIA 4KT2A 2X3NA 3UKQA 2RGHA 3R11A 1NELA 5JCMA 2PS2A 1R6WA 2FJEA 1H82A 3QSEA 4HCHA 4J1OA 2OQYA 3NT6A 3OZYA 4FDCB 3EUB3 3T14A 4EM3A 2YG5A 1E1LA 2GGGA 3VFCA 1WUFA 1TZZA 3DESA 1KN0A 1FEBA 3I6TA 5FJTA 2C70A 4B69A 1IUSA 1UKVG 3NK0X 3SN1A 4BV6A 1X31B 2XH7A 1EBDA 2X8CA 1IUTA 4HNLA 1VQZA 4JN8A 3H7VA 1GEUA 1S7MA 1Q1RA 2PP1A 2NVKX 3RGTA 2Y6QA 2WDQA 3T2ZA 4C74A 2WP6A 3DJGX 3AMZA 2BK3A 1IYXA 1CBOA 3ICRA 4TM1A 3HPFA 1ONFA 4U8MA 2OX4A 5M0ZA 1B5QA 3ATQA 4NEVA 3TTEA 3NRZB 2QJJA 3ZVHA 3TWAA 4E6MA 4H2HA 3T37A 5FS7A 2GSHA 3DFYA 1LJ1A 2ACZA 1ZOVA 4U2TA 1GXFA 3N6JA 1PJ7A 4NNJA 3AYLA 5KXJA 2GL5A 3OTRA 4U2LA 2GRTA 3SFDA 2OLAA 3KKJA 2PP0A 3PFRA 4JY2A 3R1ZA 4H83A 3P93A 1WUEA 3B6DA 4II2A 1O5WA 4X9MA 2WOIA 2IVEA 5FS9A 1FIQB 3NIXA 2XLUA 1N63C 3ALLA 2R0PA 4B66A 1TYPA 3AB1A 3ZYXA 3H8LA 3ZLFA 1FEAA 1ZKQA 3JW7A 2XVFA 1N4VA 3VA8A 2JKCA 1GTEA 2C65A 2BC1A 4CCQA 3MKCA 1CJ4A 4EWJA 3DDMA 1FECA 4IVMB 1N5XA 4REKA 2P3ZA 3TJ4A 4YT0A 1E1NA 4Z43A 4IVOB 2GDQA 2XVJA 3PO7A 1COYA 3AEGA 2WU2A 1MDRA 2XVIA 4HA6A 3AEDA 4G6HA 3P4RA 3FMWA 4H2QA 1XPQA 4LU6A 2OKTA 1GRGA 1EL8A 1FOHA 4M52A 2C67A 3NH3X 1YKJA 2ZZ0A 1K4QA 4GUVA 4AP3A 1KKRA 3NVZB 4C3YA 4F4RA 2QCUA 1FO4A 4OCGA 2C76A 1GRTA 3EKGA 3AWIA 3ISHA 3GYIA 4GMEA 1PBDA 3RHAA 2OZ3A 1F8SA 2FJDA 2BCGG 3N4FA 4EMJA 1GRAA 3MSYA 3THUA 3PG6A 3UJRA 3VCCA 4G74A 2PTWA 3VCNA 4Z25A 3T31A 4DWDA 3BI4A 2BCPA 3WE0A 3ABVA 3VRDB 5FJOA 4K22A 2QGYA 1KDGA 2B76A 1CC2A 1T3QC 3AE7A 5DBJA 5KMSA 4ZCWA 2AQJA 3SJNA 2HXUA 3QFAA 3AE8A 4K2SA 5CKUA 3C4AA 3JSKA 3BNUA 2OLNA 1FFUC 2Z5XA 3GWDA 2WPFA 1E6EA 2CHRA 2GR1A 3FYYA 3P1WA 4UDRA 3K7MX 4TM3A 4NEWA 1CJ2A 4XWRA 3RO6A 2Q7VA 3NYCA 3Q4DA 3STPA 3I6DA 1BZLA 4J2WA 1EBHA 2GR3A 2OAMA 1ZX9A 2WS3A 3QVPA 1DNCA 4U8NA 3OZ2A 3CTYA 3QN3A 4A6GA 5GRTA 4YXDA 2I5QA 4I58A 4ICYA 3UTEA 1XDIA 3SM8A 2RABA 2YLXA 4O5UA 1YY5A 1MXTA 2I0ZA 2HXTA 2PP3A 3DK8A 1HYUA 3NK1X 4LIIA 3L8KA 2OALA 3VC5A 1KNPA 1DOBA 4K1WA 2Y6RA 3SFEA 5IPYA 1PDYA 1OJAA 3BHFA 2AKZA 3D46A 5G5HB 1QLBA 2F5ZA 5JRBA 4JN9A 4GGBA 3NVYB 3BNMA 3HYXA 1PBFA 3NFUA 2EQ8A 2W3SA 3ITJA 4YWSA 4GCMA 3DJEA 5U25A 3TQPA 2XH4A 2QA2A 1VG0A 2XVEA 5FJRA 2GV8A 4II3A 3VC6A 1ZMDA 1TKKA 4IP4A 2JB3A 3NLCA 1M64A 3T0KA 1REOA 4K5SA 2AAQA 4ENLA 4UDQA 2FJBA 4CRTA 3VR8A 4JNQA 3CYJA 1KFYA 1OJ9A 1KKOA 2BK5A 1NG3A 2PHHA 1FCDA 4GAPA 4H19A 1ELSA 5IDZA 3ZDNA 3Q9TA 4U8LA 2QVHA 1EL7A 1GERA 1MRAA 1F8RA 2QJMA 1JEHA 4EQXA 3GMBA 4A6NA 4A65A 1BQGA 3ALMA 1CJ3A 4XWZA 4NTCA 3IHMA 2WOVA 1TDEA 4X4JA 1JRZA 2CVJA 3U4FA 4A79A 2V3AA 4YSHA 2XVHA 2EQ7A 1NHSA 1YQZA 2GAGB 1JPDX 1CF3A 5J04A 1BGNA 4H2NA 3H8AA 2WPCA 4Z1YA 1L9EA 1ZMCA 1Y56A 4YTNA 1CHUA 5JCKA 2XH2A 2QQ6A 2E4GA 4LA1A 3AEBA 5KVHA 1H6VA 2C64A 1NHQA 2B9WA 2YVGA 2GGIA 2WDVA 4KWSA 4A9WA 3CMMA 2NQLA 1GRFA 4EMWA 3KLJA 1L9CA 4NTEA 3SQSA 1CJCA 1EC8A 3NS1B 4KEMA 3KPKA 3BHKA 5KMPA 2PTZA 1W6TA 3ADAB 4P9SA 3SN4A 5J7XA 1BF3A 3GY1A 4XXGA 2B7RA 3I4KA 2V61A 1NU5A 2Q0LA 1SJBA 2GMJA 2ZBWA 2XFQA 3BJSA 2BACA 4U2SA 4H7UA 1IJHA 3KVEA 3DG7A 5EOWA 4HYRA 3V3NA 2X8GA 7ENLA 3M0OA 3P4QA 3BSMA 1N5WC 2BK4A 4EIQA 3ATRA 2WETA 3NTDA 4Z24A 2PYXA 3DG6A 3GD4A 3CK5A 3U9IA 1H86A 3QSSA 2BA9A 4TVWA 1PDHA 2ZZBA 3ICTA 1JPMA 1TRBA 3ES7A 3AE1A 4DGKA 3HYWA 4MKSA 3ZLGA 3GRSA 3KPFA 3F8RA 5KOXA 2YVJA 1GT8A 3R07C 2CULA 4E4FA 3MY9A 1CC4A 4DN1A 2AL1A 3VQRA 4IP5A 3EF6A 4RG4A 1GV4A 3CXOA 4H1ZA 1H2IA 4YKGA 2XLSA 1BKWA 2PPGA 1JRYA 3SGLA 1KCZA 2YM2A 1E1KA 3MQTA 1FL2A 3UKAA 2BYBA 3SX6A 1H83A 3GO2A 2JB1A 3H4KA 2YR4A 3IHGA 2W54A 1RM6B 1BGJA 3R10A 1O94A 3CGCA 1B37A 3DGHA 4YTPA 4NZHA 2X99A 4BK1A 1E1MA 3AYJA 2C7GA 4YSYA 1MO9A 1S2QA 2H89A 4Y4NA 4E0VA 3R25A 4H4RA 4A35A 3FBSA 4H4UA 4B65A 4GFIA 4Y4LA 1NEKA 3UGVA 5C2TA 3QFBA 4BJZA 1SEZA 1L0VA 1F9CA 3ICSA 2TPRA 2GVCA 5ER0A 3CPIG 4U8OA 3FG2P 2W55A 4B68A 5BVAA 2EQ6A 4KPRA 1RVKA 3DJJA 4KPLA 5HYMA 3CN8A 2YM1A 1JU2A 1EL9A 3AN1A 2YR5A 4EQSA 1K0JA 4A5LA 5IQ1A 1P43A 1VRQB 5GSNA 1VDVA 3SY4A 1GOSA 4HCLA 3UJSA 5U63A 2ZZCA 4H4ZA 1DTNA 4J56A 5G5GB 1SJDA 4E5TA 5BOFA 3QVRA 1QJDA 2TMDA 3C96A 4KX6A 1JRXA 3GWFA 4AT0A 2YLSA 4CBQA 4YKFA 5U1OA 2BS3A 4H4PA 1H7XA 2VVLA 1LQTA 1E9IA 3DJDA 1XS2A 3V5FA 2ONEA 3URHA 2PCEA 1ZXIC 4U8PA 1KD0A 2FKPA 4G7FA 1ELIA 4YSXA 2VQ7A 4H2RA 4GYPC 2PTXA 1W4XA 2XLTA 3KU9A 1EC9A 3D47A 3UKFA 3VRAA 4IZGA 2YAUA 4MGGA 3AM9A 1CC6A 2C72A 2OPJA 3S5SA 2QJNA 4GAVA 2WOWA 3NN6X 3SN0A 5KMRA 3SBFA 2DW7A 2GEWA 4N9XA 3AE5A 4OPGA 3BOXA 2B9XA 1P2EA 5FJPA 4E8GA 2WQYA 3AEFA 1VG9A 1H7WA 4AOXA 4Z2UA 2JAEA 2XDOA 3E1TA 5IQ4A 3TWBA 3RITA 1LVLA 5M10A 3CNJA 3UKLA 2ZADA 1MOKA 2YQUA 4DNAA 4NWZA 4I59A 4GR1A 2PMQA 2CFYA 3M12A 2PTYA 5BOEA 4M0XA 2YLWA 4BURA 3LADA 4YWOA 3D8XA 4GYPA 2Q0KA 3UXLA 4OPTA 4OPUA 3FJ4A 4J57A 3FVDA 2YLZA 4CNKA 4HNCA 1NPXA 3CNDA 3PVCA 4J34A 4MJWA 1WYGA 2BABA 2R45A 3K1GA 1PXCA 2PGEA 3AXBA 3GD3A 3RR1A 2B7SA 1MUCA 1PJ5A 1DOCA 3CNSA 4B64A 2DKIA 1IUXA 2QAEA 6ENLA 3Q6JA 3GMCA 4HCDA 4A7AA 3NKSA 3O0HA 4Z26A 2CDUA 3CAWA 2OLOA 5JCIA 3DA1A 3IWAA 3I3LA 2VOUA 4CNJA 4A3RA 4IL0A 3L1RA 1GNDA 3MZNA 3IJIA 2JBVA 5HY5A 2C73A 2P8BA 1GRHA 2YR6A 3T2KA 2ZC8A 1H81A 3SYIA 1D5TA 4FX9A 1TDKA 2GGHA 2OZTA 3NG7X 1NDAA 3UTHA 2WPEA 1MDLA 2P8CA 4H4WA 3ZVIA 1F6MA 2V60A 3I6EA 4B67A 1ZOYA 1QO8A 2XFNA 2BRYA 1D7LA 4TLXA 3KUMA 2OFJA 3C4NA 2WP5A 3LB8A 1ONEA 2IIDA 2YG6A 2XCGA 1XANA 3OP2A 1DJNA 4HPNA 2R46A 1GESA 3RP8A 1GREA 1OJTA 1N4WA 5FJUA 2YWLA 3H12A 3VR9A 3PWGA 2GH5A 3SQPA 2IVDA 2GR2A 3F8DA 1BKHA 3G5RA 4BK2A 2PA6A 1S2YA 3TJIA 2OZ8A 3RRAA 2DW6A 2VZ2A 3OW1A 2AKMA 1L8PA 1N1PA 3DEQA 3UOYA 3JVAA 2Z5YA 1GALA 3P9UA 1YEYA 4M6UA 3DK4A 4PABA 4C77A 4B1BA 1KSUA 2WHDA 5HHFA 5KVIA 5FMHA 1PN0A 1B4VA 4EM4A 3EPTA 3COXA 3HZLA 3UTFA 1N62C 3EEZA 3FV9A 4J36A 3FPZA 2AL2B 2O56A 2WU5A 3PK7A 3SXIA 4H4VA 5KWFA 4A99A 2BS4A 4A6NB 4G73A 1X2HA 3UKKA 3L5OA 4ROPA 4IL2A 1D7YA 1CL0A 4X2PA 2YVFA 3EANA 2XLRA 2FBWA 4ZOHB 2E5VA 2APGA 2BS2A 3SR6B 2VQBA 1JRPA 4H4TA 1PBCA 4PAAA 3V4BA 1ZY8A 3FIMB 4CY8A 3BI5A 4APNA 3GD6A 2WBAA 5ENLA 3EAOA 3QKEA 1Y56B 1FFVC 2BC0A 1KSSA 4JNAA 4G8TA 3SZFA 4U8KA 4HN8A 3SSZA 1NAAA 3HW2A 1NHPA 3PS9A 2VVLG 3H8IA 4WCTA 2B9YA 2R9ZA 3NO1A 1S3BA 4OPDA 2R4JA 3AE6A 3F8PA 4Z44A 2GQWA 4H50A 1GETA 5EB5A 3V76A 3FXGA 1AOGA 1YQ4A 3QLDA 5KRQA 4K2XA 3UKPA 4J3ZA 4ZN0A 4FK1C 3RCYA 1BWCA 4FP1A 4DHGA 1E39A 3IK4A 1TDFA 2J3NA 3TCSA 3OZMA 4BJYA 1JROA 3A7UA 1FHUA 3MWCA 3OC4A 2X50A 3T4WA 2XFOA 1DOEA 3H70A 2HNEA 4DYEA 1JNRA 2GB0A 4Z2RA 4U8JA 2A8XA 3UJ2A 1OEPA 1K0IA 4K5RA 3LXDA 2WESA 2HZGA 5LV9A 3B9JB 4EQRA 4AT2A 1DXLA 3CGEA 4H4XA 2A89A 4GF7A 2VRMA 3D1CA 2JK6A 1PBBA 2RDXA 3GYJA 1OJDA 3K7QX 3NZGA 4CY6A 2PU1A 3Q45A 5FS8A 2H88A 2PGWA 3QPEA 3JZUA 1N4UA 1TYTA 3B97A 3NYEA 2C3DA 4FK1A 2V6OA 4DXKA 4K7ZA 3UCDA 3NXLA 4DX3A 2VVMA 5L46A 4RG3A 2W0HA 4X9NA 4BK3A 3R0KA 3DH9A 4USRA 5BULA 1F8WA 5KMQA 2RGJA 4JY3A 3AD8B 2NPXA 3ZVHB 4TVYA 3NVWB 4Z2TA 3A7AA 3GC2A 1D4DA 2POZA 4OPIA 2AR8A 3AE4A 3NVVB 1JCTA 3M13A 3A7RA 2OQHA 2GAHB 3AYIA 3ENLA 3FCPA 5KNLA 3T8QA 3NGCX 3TOYA 3G5SA 3PWIA 2QA1A 3QSMA 3VDGA 2YG7A 4YTMA 2R0GA 5J60A 1L9DA 4H2PA 1N61C 2E3TA 2XYOA 3LZWA 4K8GA 4IA6A 2E5AA 1X2GA 4Z17A 2DKHA 4AOSA 1XPYA 1IUVA 4G6GA 3UP5A 4RSLA 3UTGA 4JN7A 1SJCA 3T9PA 1ECQA 2XSXA 3IC9A 1M6IA 3IF9A 5CQFA 3G5QA 3ETRB 1SJAA 3V5CA 1PXBA 1LPFA 1PJ6A 2WP9A 3P3BA 4CCRA 3AE2A 4UP3A 1LQUA 4JQ9A 3HYVA 4U8IA 3UOZA 2XGZA 1ZP0A 5TR3A 5FS6A 4ECHA 2GQFA 2GGEA 5EBKA 3NRNA 4EMIA 3NTAA 1TDNA 2FJAA 1OJCA 1PS9A 2UZZA 1SB3B 3UCLA 4EIPA 1D4EA 1XHCA 3NYFA 3UJFA 1RP0A 3CIRA 3UCCA 1V97A 3MUCA 3R0UA 4TM0A 4WX1A 3CPHG 3KD9A 1TE6A 4B63A 1KNRA 4ZA0A 2P0IA 1TDOA 4OPLA 2QDDA 2YLTA 3QTPA 5EB4A 1STZA 3RP6A 3CGBA 4EQWA 2C3CA 3V3WA 3II4A 4ZCCA 1R0MA 3AE9A 4IV9A 3OPSA 1IUUA 1K0LA 2V3BA 3LZXA 3NN0X 2VRLA 4J33A 1O95A 4OPCA 3DG3A 4K8DA 1PBEA 1GTHA 1RSGA 2V5ZA 1S3EA 3S61A 2FYMA 1B8SA 2GGJA 3S5WA 3SZ0A 4DSHA 3CGDA 3DK9A 1NENA 3P4PA 3DGBA 1EL5A 2A87A 3D9XA 3TW9A 3AEAA 2OVLA 3DFHA 3QJ4A 4IHCA 5JCNA 2BRAA 4O5QA 4GISA 3P0WA 1NG4A 4D03A 3AD7B 1GPEA 1FHVA 3K30A 2OG9A 4GDEA 2PODA 3S47A 2YG3A 3AECA 3GRTA 3AD9B 1NHRA 4UDPA 3IJLA 5BUKA 3R9UA 3UP4A 2R4EA 1EC7A 3DIPA 4H4SA 4OVIA 3CNTA 2W3RA 2C75A 2GR0A 4YSZA 1ZK7A 2BXRA 2ARDA 3AE3A 3T2YA 2XFPA 2PSNA 3IJQA 2HQMA 2YG4A 2QDEA 3SZCA 1PDZA 1V59A 1PHHA 3N6HA 4USQA 3HRDC 4C3XA 1E7PA 1H84A 3SZWA 5HXIA 3UOXA 4NTDA 3NNEA 3NK2X 3AEEA 2OA1A 3DGZA 4IA5A 1GRBA 2X8HA 2XFUA 5JCLA 4HB9A 2MUCA 3V3OA 4JHMA 3CPJG 3GDNA 2JB2A 3CXBA 2WEUA 3GDPA 1Q1WA 2XLPA 4C5OA 2BXSA 3K7TA 1D4CA 2O9ZA 1VDCA 4E4UA
chains in the Genus database with same CATH topology
3DJJA 3B3RA 3QFAA 3AE8A 5HYMA 5CKUA 3CN8A 1JNRA 2GB0A 3C4AA 2YM1A 3JSKA 1JU2A 4Z2RA 1EL9A 3BNUA 4U8JA 2A8XA 1VQWA 4TLZA 2E1MA 3NHOX 2OLNA 2Z5XA 2R0CA 4AP1A 4H4QA 1K0IA 3GWDA 2EQ9A 4K5RA 1LTXR 3LXDA 4EQSA 2WPFA 2WESA 2YR5A 5KOWA 1K0JA 1E6EA 4D04A 5LV9A 1P2HA 2GR1A 4A5LA 2RGOA 5IQ1A 4EQRA 4AT2A 1VRQB 5GSNA 1DXLA 3CGEA 4H4XA 2A89A 3P1WA 4GRTA 4GF7A 3K7MX 4TM3A 4UDRA 4NEWA 1GOSA 2VRMA 3SY4A 1CJ2A 3D1CA 3RNMA 2JK6A 1PBBA 4XWRA 3GYJA 4ZCDA 5U63A 1F3PA 2Q7VA 3NYCA 2ZZCA 4H4ZA 4ADWA 1OJDA 3K7QX 1GSNA 4J56A 4CY6A 4DSGA 3LOVA 3QVRA 5FS8A 1LV0A 1Q9IA 1QJDA 2H88A 2TMDA 3C96A 3I6DA 1BZLA 3LJPA 4KX6A 3RP7A 4J2WA 1JRXA 1N4UA 3GWFA 2GR3A 1TYTA 1ZX9A 2OAMA 2WS3A 4AT0A 2YLSA 3NYEA 3QVPA 4CBQA 2C3DA 4FK1A 2WDRA 1DNCA 1JNZA 4YKFA 2V6OA 4U8NA 3OZ2A 5C3JA 5U1OA 1KF6A 2BS3A 2GMHA 3CTYA 4H4PA 1H7XA 4K7ZA 2VVLA 1IUWA 5GRTA 1LQTA 3DJDA 4TM4A 4YXDA 2VVMA 3REDA 2C4CA 5L46A 3URHA 4I58A 1YQ3A 4RG3A 4ICYA 3UOVA 2W0HA 3UTEA 1JOAA 4J31A 1XDIA 2GF3A 4H4YA 2YLRA 4U8PA 1ELIA 4YSXA 2VQ7A 3CNPA 3KA7A 3GSIA 3SM8A 4X9NA 4BK3A 2RABA 4H2RA 2YLXA 4G9KA 3DH9A 4USRA 5BULA 1F8WA 2XLTA 1W4XA 4O5UA 3KU9A 5BRTA 5KMQA 1YY5A 1MXTA 2I0ZA 3UKFA 2RGJA 4JY3A 3AD8B 2Q6UA 3VRAA 4Y4MA 2NPXA 3DMEA 3DK8A 3VRBA 3GYXA 1HYUA 3NK1X 2YAUA 4LIIA 1CC6A 1DJQA 3L8KA 3ALJA 2C72A 2OALA 4Z2TA 2C66A 4JDRA 3BI2A 1KNPA 1D4DA 2WOWA 1DOBA 1Z6LA 3NN6X 4GAVA 4OPIA 5KMRA 2Y6RA 3SFEA 2AR8A 5IPYA 2GEWA 3P4SA 3AE4A 1DODA 3AE5A 1PXAA 1Y0PA 4N9XA 4OPGA 2B9XA 1OJAA 1P2EA 3BHFA 3M13A 3UKHA 4GDPA 1QLBA 1ZDLA 2GAHB 3AYIA 2F5ZA 5JRBA 1RYIA 4JN9A 2X3NA 3UKQA 2WQYA 3AEFA 2RGHA 3BNMA 1VG9A 5KNLA 3HYXA 1PBFA 3NGCX 5JCMA 2EQ8A 1H7WA 3G5SA 3ITJA 2QA1A 2FJEA 3DJEA 5U25A 3QSMA 4GCMA 4AOXA 2YG7A 1H82A 4Z2UA 2JAEA 2QA2A 3QSEA 4YTMA 1VG0A 2XVEA 2XDOA 2R0GA 5J60A 1L9DA 4H2PA 3NT6A 4FDCB 3E1TA 2GV8A 3T14A 4EM3A 5IQ4A 2YG5A 4II3A 1E1LA 2XYOA 1LVLA 5M10A 3CNJA 3UKLA 3LZWA 4IA6A 1MOKA 2YQUA 1ZMDA 4DNAA 4NWZA 2DKHA 4I59A 4GR1A 4AOSA 2CFYA 1KN0A 2JB3A 3NLCA 1M64A 3M12A 1FEBA 3T0KA 1REOA 4K5SA 2AAQA 4UDQA 1IUVA 2FJBA 2YLWA 4BURA 3LADA 2C70A 4G6GA 1IUSA 3UP5A 4RSLA 4YWOA 1UKVG 3D8XA 3UTGA 3VR8A 2Q0KA 4CRTA 4JNQA 4OPTA 1KFYA 1OJ9A 4OPUA 3NK0X 4J57A 2BK5A 1NG3A 3IC9A 2YLZA 1M6IA 4BV6A 1X31B 3IF9A 2PHHA 4CNKA 1EBDA 2X8CA 1IUTA 1NPXA 1FCDA 3CNDA 3PVCA 4GAPA 5CQFA 3G5QA 4J34A 4MJWA 2BABA 2R45A 3ZDNA 1GEUA 1S7MA 1PXBA 3Q9TA 4U8LA 1LPFA 1PJ6A 2WP9A 1EL7A 1GERA 1Q1RA 4CCRA 3AE2A 1F8RA 4UP3A 1LQUA 2NVKX 1PXCA 4JQ9A 1JEHA 4EQXA 2WDQA 2Y6QA 3GMBA 3AXBA 3HYVA 4U8IA 3T2ZA 3UOZA 3GD3A 4A65A 4A6NA 2B7SA 4C74A 3ALMA 1ZP0A 1CJ3A 1PJ5A 5TR3A 1DOCA 5FS6A 4XWZA 4NTCA 3CNSA 3IHMA 4B64A 2DKIA 1IUXA 2WP6A 2WOVA 4ECHA 3DJGX 2BK3A 2QAEA 1TDEA 5EBKA 2GQFA 3Q6JA 4X4JA 1JRZA 4EMIA 2CVJA 3GMCA 3NRNA 3NTAA 4A79A 1TDNA 2V3AA 2FJAA 1CBOA 3ICRA 4A7AA 4YSHA 1OJCA 3NKSA 4TM1A 3O0HA 4Z26A 2CDUA 1PS9A 2XVHA 2OLOA 5JCIA 2UZZA 2EQ7A 3DA1A 3I3LA 3IWAA 2VOUA 1NHSA 4CNJA 1YQZA 2GAGB 1CF3A 1BGNA 4H2NA 3UCLA 4EIPA 3L1RA 1D4EA 1XHCA 3NYFA 1GNDA 2WPCA 1ONFA 1L9EA 1RP0A 1ZMCA 3CIRA 1Y56A 4U8MA 2JBVA 5HY5A 2C73A 5M0ZA 4TM0A 4WX1A 4YTNA 3CPHG 1B5QA 1CHUA 3ATQA 1GRHA 4NEVA 5JCKA 2YR6A 3KD9A 3T2KA 1H81A 3SYIA 4B63A 1KNRA 1D5TA 2E4GA 4FX9A 4LA1A 3AEBA 1TDKA 5KVHA 3NG7X 1H6VA 1NDAA 2C64A 1NHQA 2B9WA 3UTHA 1TDOA 3T37A 5FS7A 4OPLA 2YVGA 2YLTA 1LJ1A 2WPEA 2WDVA 4H4WA 2ACZA 5EB4A 1F6MA 1ZOVA 4U2TA 4A9WA 1GXFA 2V60A 3CMMA 3RP6A 4B69A 4B67A 3CGBA 4EQWA 1ZOYA 1GRFA 1PJ7A 1QO8A 4EMWA 4NNJA 2XFNA 2BRYA 3KLJA 2C3CA 1L9CA 4NTEA 1D7LA 1CJCA 3AYLA 3KPKA 3II4A 4TLXA 5KXJA 4ZCCA 3C4NA 2WP5A 3AE9A 3BHKA 3LB8A 1IUUA 1K0LA 4IV9A 2V3BA 3LZXA 4U2LA 5KMPA 2GRTA 3SFDA 3ADAB 3KKJA 2IIDA 4P9SA 2YG6A 2XCGA 1XANA 3NN0X 5J7XA 2VRLA 4J33A 1DJNA 1O95A 2R46A 4JY2A 1GESA 4OPCA 1BF3A 4K8DA 4XXGA 3RP8A 2B7RA 1GREA 1OJTA 1N4WA 2YWLA 1PBEA 1GTHA 2V61A 1RSGA 2Q0LA 2V5ZA 1S3EA 3S61A 3VR9A 2GMJA 2GH5A 2XFQA 2ZBWA 1B8SA 3B6DA 4II2A 3SQPA 1O5WA 2BACA 4U2SA 4H7UA 2GR2A 4X9MA 2WOIA 2IVDA 2IVEA 5FS9A 1IJHA 3F8DA 3NIXA 3G5RA 2XLUA 3ALLA 3KVEA 2R0PA 5EOWA 3V3NA 2X8GA 4BK2A 3S5WA 1S2YA 4B66A 3M0OA 1TYPA 3P4QA 3AB1A 3ZYXA 2BK4A 4EIQA 3ATRA 2WETA 3SZ0A 3H8LA 2VZ2A 3NTDA 4DSHA 1FEAA 1ZKQA 3CGDA 1N1PA 4Z24A 3UOYA 3DK9A 2Z5YA 2PYXA 1GALA 2XVFA 1NENA 3P9UA 1N4VA 3GD4A 3P4PA 2JKCA 3DK4A 4PABA 1GTEA 4C77A 4B1BA 1KSUA 2WHDA 5HHFA 5KVIA 5FMHA 1PN0A 2C65A 1H86A 2BC1A 1EL5A 2A87A 4CCQA 3QSSA 1B4VA 4EM4A 3EPTA 3D9XA 3COXA 3HZLA 3UTFA 2BA9A 3AEAA 1CJ4A 1PDHA 2ZZBA 3ICTA 1TRBA 3QJ4A 4J36A 3FPZA 3AE1A 4DGKA 1FECA 3HYWA 3GRSA 3KPFA 4IVMB 5JCNA 4REKA 2BRAA 3F8RA 4O5QA 1E1NA 4YT0A 5KOXA 2YVJA 1GT8A 2CULA 4Z43A 4IVOB 1NG4A 4D03A 3AD7B 2XVJA 2WU5A 3PO7A 3SXIA 1GPEA 4H4VA 1COYA 1CC4A 3AEGA 5KWFA 4A99A 2BS4A 2WU2A 2XVIA 3VQRA 3K30A 4HA6A 3EF6A 3AEDA 4G6HA 4RG4A 1GV4A 3P4RA 4G73A 4GDEA 4A6NB 3UKKA 3L5OA 1H2IA 2YG3A 3FMWA 4H2QA 1XPQA 1D7YA 4LU6A 3AECA 4YKGA 1GRGA 3GRTA 1CL0A 1EL8A 1FOHA 2YVFA 3AD9B 1NHRA 3EANA 4M52A 2C67A 2XLRA 2XLSA 4UDPA 1BKWA 2FBWA 3R9UA 5BUKA 3UP4A 2E5VA 2R4EA 1JRYA 3NH3X 1YKJA 2ZZ0A 3SGLA 2APGA 1K4QA 2BS2A 2YM2A 4GUVA 4AP3A 4H4SA 4OVIA 1E1KA 2VQBA 4H4TA 3CNTA 1FL2A 3UKAA 2BYBA 2C75A 1PBCA 3SX6A 1H83A 2GR0A 4PAAA 4YSZA 2JB1A 3H4KA 2YR4A 3IHGA 1ZK7A 4C3YA 1ZY8A 2BXRA 2ARDA 2QCUA 3AE3A 3FIMB 3BI5A 4APNA 4CY8A 1BGJA 3T2YA 2XFPA 4OCGA 2WBAA 2HQMA 3EAOA 2C76A 1GRTA 1Y56B 1O94A 3AWIA 2YG4A 3ISHA 2BC0A 3CGCA 1KSSA 3GYIA 4JNAA 3SZCA 1B37A 3SZFA 4U8KA 1PBDA 3DGHA 3RHAA 4YTPA 1V59A 1NAAA 4NZHA 1NHPA 1F8SA 1PHHA 3PS9A 2VVLG 2FJDA 2X99A 2BCGG 4USQA 3H8IA 4WCTA 4EMJA 4C3XA 1GRAA 2B9YA 4BK1A 1E7PA 2R9ZA 1S3BA 1E1MA 1H84A 3PG6A 4OPDA 3AYJA 2R4JA 2C7GA 3SZWA 4YSYA 3AE6A 5HXIA 3UOXA 1MO9A 1S2QA 3F8PA 4Z44A 4NTDA 2GQWA 4H50A 2H89A 4Y4NA 4E0VA 3NNEA 4H4RA 3NK2X 4G74A 3FBSA 1GETA 4H4UA 3AEEA 4B65A 5EB5A 3T31A 4Y4LA 3V76A 1NEKA 2OA1A 4Z25A 3BI4A 3DGZA 5C2TA 4IA5A 1GRBA 1AOGA 1YQ4A 2X8HA 5KRQA 3QFBA 2XFUA 5JCLA 4HB9A 4BJZA 1SEZA 4K2XA 1L0VA 2BCPA 3ICSA 3UKPA 3V3OA 2TPRA 3WE0A 3ABVA 4ZN0A 2GVCA 4FK1C 3VRDB 5ER0A 1BWCA 3CPJG 3GDNA 3CPIG 2JB2A 4U8OA 4K22A 2WEUA 1KDGA 3GDPA 1E39A 1Q1WA 2B76A 1TDFA 2XLPA 2J3NA 3FG2P 4C5OA 2BXSA 1CC2A 3K7TA 4BJYA 1D4CA 2O9ZA 4B68A 3AE7A 5BVAA 3OC4A 5DBJA 1VDCA 5KMSA 2X50A 2XFOA 2AQJA 2EQ6A 4KPRA 1DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJJ A;  3B3R A;  3QFA A;  3AE8 A;  5HYM A;  5CKU A;  3CN8 A;  1JNR A;  2GB0 A;  3C4A A;  2YM1 A;  3JSK A;  1JU2 A;  4Z2R A;  1EL9 A;  3BNU A;  4U8J A;  2A8X A;  1VQW A;  4TLZ A;  2E1M A;  3NHO X;  2OLN A;  2Z5X A;  2R0C A;  4AP1 A;  4H4Q A;  1K0I A;  3GWD A;  2EQ9 A;  4K5R A;  1LTX R;  3LXD A;  4EQS A;  2WPF A;  2WES A;  2YR5 A;  5KOW A;  1K0J A;  1E6E A;  4D04 A;  5LV9 A;  1P2H A;  2GR1 A;  4A5L A;  2RGO A;  5IQ1 A;  4EQR A;  4AT2 A;  1VRQ B;  5GSN A;  1DXL A;  3CGE A;  4H4X A;  2A89 A;  3P1W A;  4GRT A;  4GF7 A;  3K7M X;  4TM3 A;  4UDR A;  4NEW A;  1GOS A;  2VRM A;  1CJ2 A;  3D1C A;  3RNM A;  2JK6 A;  1PBB A;  4XWR A;  3GYJ A;  4ZCD A;  5U63 A;  1F3P A;  2Q7V A;  3NYC A;  2ZZC A;  4H4Z A;  4ADW A;  1OJD A;  3K7Q X;  1GSN A;  4J56 A;  4CY6 A;  4DSG A;  3LOV A;  3QVR A;  5FS8 A;  1LV0 A;  1Q9I A;  1QJD A;  2H88 A;  2TMD A;  3C96 A;  3I6D A;  1BZL A;  3LJP A;  4KX6 A;  3RP7 A;  4J2W A;  1JRX A;  1N4U A;  3GWF A;  2GR3 A;  1TYT A;  1ZX9 A;  2OAM A;  2WS3 A;  4AT0 A;  2YLS A;  3NYE A;  3QVP A;  4CBQ A;  2C3D A;  4FK1 A;  2WDR A;  1DNC A;  1JNZ A;  4YKF A;  2V6O A;  4U8N A;  3OZ2 A;  5C3J A;  5U1O A;  1KF6 A;  2BS3 A;  2GMH A;  3CTY A;  4H4P A;  1H7X A;  4K7Z A;  2VVL A;  1IUW A;  5GRT A;  1LQT A;  3DJD A;  4TM4 A;  4YXD A;  2VVM A;  3RED A;  5L46 A;  3URH A;  4I58 A;  1YQ3 A;  4RG3 A;  4ICY A;  3UOV A;  2W0H A;  3UTE A;  1JOA A;  4J31 A;  1XDI A;  2GF3 A;  4H4Y A;  2YLR A;  4U8P A;  1ELI A;  4YSX A;  2VQ7 A;  3CNP A;  3KA7 A;  3GSI A;  3SM8 A;  4X9N A;  4BK3 A;  2RAB A;  4H2R A;  2YLX A;  3DH9 A;  4USR A;  5BUL A;  1F8W A;  2XLT A;  1W4X A;  4O5U A;  3KU9 A;  5BRT A;  1YY5 A;  1MXT A;  2I0Z A;  3UKF A;  2RGJ A;  4JY3 A;  3AD8 B;  2Q6U A;  3VRA A;  4Y4M A;  2NPX A;  3DME A;  3DK8 A;  3VRB A;  1HYU A;  3NK1 X;  2YAU A;  4LII A;  1CC6 A;  1DJQ A;  3L8K A;  3ALJ A;  2C72 A;  2OAL A;  4Z2T A;  2C66 A;  4JDR A;  3BI2 A;  1KNP A;  1D4D A;  2WOW A;  1DOB A;  1Z6L A;  3NN6 X;  4OPI A;  2Y6R A;  3SFE A;  2AR8 A;  5IPY A;  2GEW A;  3P4S A;  3AE4 A;  1DOD A;  3AE5 A;  1PXA A;  1Y0P A;  4N9X A;  4OPG A;  2B9X A;  1OJA A;  1P2E A;  3BHF A;  3M13 A;  3UKH A;  4GDP A;  1QLB A;  1ZDL A;  2GAH B;  3AYI A;  2F5Z A;  1RYI A;  4JN9 A;  2X3N A;  3UKQ A;  2WQY A;  3AEF A;  2RGH A;  3BNM A;  1VG9 A;  1PBF A;  3NGC X;  5JCM A;  2EQ8 A;  1H7W A;  3G5S A;  3ITJ A;  2QA1 A;  2FJE A;  3DJE A;  5U25 A;  3QSM A;  4GCM A;  4AOX A;  2YG7 A;  1H82 A;  4Z2U A;  2JAE A;  2QA2 A;  3QSE A;  4YTM A;  1VG0 A;  2XVE A;  2XDO A;  2R0G A;  5J60 A;  1L9D A;  4H2P A;  3NT6 A;  4FDC B;  3E1T A;  2GV8 A;  5IQ4 A;  4EM3 A;  2YG5 A;  1E1L A;  2XYO A;  1LVL A;  5M10 A;  3CNJ A;  3UKL A;  3LZW A;  4IA6 A;  1MOK A;  2YQU A;  1ZMD A;  4DNA A;  2DKH A;  4I59 A;  4GR1 A;  4AOS A;  2CFY A;  2JB3 A;  3NLC A;  1M64 A;  3M12 A;  1FEB A;  1REO A;  4K5S A;  2AAQ A;  4UDQ A;  1IUV A;  2FJB A;  2YLW A;  4BUR A;  3LAD A;  2C70 A;  4B69 A;  1IUS A;  3UP5 A;  4RSL A;  4YWO A;  1UKV G;  3D8X A;  3UTG A;  3VR8 A;  2Q0K A;  4CRT A;  4JNQ A;  4OPT A;  1KFY A;  1OJ9 A;  4OPU A;  3NK0 X;  4J57 A;  2BK5 A;  1NG3 A;  3IC9 A;  2YLZ A;  1M6I A;  4BV6 A;  1X31 B;  3IF9 A;  2PHH A;  4CNK A;  1EBD A;  2X8C A;  1IUT A;  1NPX A;  1FCD A;  3CND A;  3PVC A;  5CQF A;  3G5Q A;  4J34 A;  4MJW A;  2BAB A;  2R45 A;  3ZDN A;  1GEU A;  1PXB A;  3Q9T A;  4U8L A;  1LPF A;  1PJ6 A;  2WP9 A;  1EL7 A;  1GER A;  1Q1R A;  4CCR A;  3AE2 A;  1F8R A;  4UP3 A;  1LQU A;  2NVK X;  1PXC A;  4JQ9 A;  1JEH A;  4EQX A;  2WDQ A;  2Y6Q A;  3GMB A;  3AXB A;  4U8I A;  3UOZ A;  4A6N A;  3GD3 A;  4A65 A;  4C74 A;  2B7S A;  3ALM A;  1ZP0 A;  1CJ3 A;  1PJ5 A;  5TR3 A;  1DOC A;  5FS6 A;  4XWZ A;  4NTC A;  3CNS A;  3IHM A;  4B64 A;  2DKI A;  1IUX A;  2WP6 A;  2WOV A;  4ECH A;  3DJG X;  2BK3 A;  2QAE A;  1TDE A;  5EBK A;  2GQF A;  3Q6J A;  4X4J A;  1JRZ A;  4EMI A;  2CVJ A;  3GMC A;  3NRN A;  3NTA A;  4A79 A;  1TDN A;  2V3A A;  2FJA A;  1CBO A;  3ICR A;  4A7A A;  4YSH A;  1OJC A;  3NKS A;  4TM1 A;  3O0H A;  4Z26 A;  2CDU A;  1PS9 A;  2XVH A;  2OLO A;  5JCI A;  2UZZ A;  2EQ7 A;  3DA1 A;  3I3L A;  3IWA A;  2VOU A;  1NHS A;  4CNJ A;  1YQZ A;  2GAG B;  1CF3 A;  1BGN A;  4H2N A;  3UCL A;  4EIP A;  3L1R A;  1D4E A;  1XHC A;  3NYF A;  1GND A;  2WPC A;  1ONF A;  1L9E A;  1RP0 A;  1ZMC A;  3CIR A;  1Y56 A;  4U8M A;  2JBV A;  5HY5 A;  2C73 A;  5M0Z A;  4TM0 A;  4WX1 A;  4YTN A;  3CPH G;  1B5Q A;  1CHU A;  3ATQ A;  1GRH A;  4NEV A;  5JCK A;  2YR6 A;  3KD9 A;  1H81 A;  4B63 A;  1KNR A;  1D5T A;  2E4G A;  4FX9 A;  4LA1 A;  3AEB A;  1TDK A;  5KVH A;  3NG7 X;  1H6V A;  1NDA A;  2C64 A;  1NHQ A;  2B9W A;  3UTH A;  1TDO A;  3T37 A;  5FS7 A;  4OPL A;  2YVG A;  2YLT A;  1LJ1 A;  2WPE A;  2WDV A;  4H4W A;  2ACZ A;  5EB4 A;  1F6M A;  1ZOV A;  4U2T A;  4A9W A;  1GXF A;  2V60 A;  3RP6 A;  4B67 A;  3CGB A;  4EQW A;  1ZOY A;  1GRF A;  1PJ7 A;  1QO8 A;  4EMW A;  2XFN A;  3KLJ A;  2C3C A;  1L9C A;  4NTE A;  1D7L A;  1CJC A;  3AYL A;  4TLX A;  3II4 A;  5KXJ A;  4ZCC A;  3C4N A;  2WP5 A;  3AE9 A;  3BHK A;  3LB8 A;  1IUU A;  1K0L A;  4IV9 A;  2V3B A;  3LZX A;  4U2L A;  2GRT A;  3SFD A;  3ADA B;  3KKJ A;  2IID A;  4P9S A;  2YG6 A;  2XCG A;  1XAN A;  3NN0 X;  5J7X A;  2VRL A;  4J33 A;  1DJN A;  1O95 A;  2R46 A;  4JY2 A;  1GES A;  4OPC A;  1BF3 A;  4K8D A;  4XXG A;  3RP8 A;  2B7R A;  1GRE A;  1OJT A;  1N4W A;  2YWL A;  1PBE A;  1GTH A;  2V61 A;  1RSG A;  2Q0L A;  2V5Z A;  1S3E A;  3S61 A;  3VR9 A;  2GMJ A;  2GH5 A;  2XFQ A;  2ZBW A;  1B8S A;  3B6D A;  3SQP A;  1O5W A;  2BAC A;  4U2S A;  4H7U A;  2GR2 A;  4X9M A;  2WOI A;  2IVD A;  2IVE A;  5FS9 A;  1IJH A;  3F8D A;  3NIX A;  3G5R A;  2XLU A;  3ALL A;  3KVE A;  2R0P A;  5EOW A;  3V3N A;  2X8G A;  4BK2 A;  3S5W A;  1S2Y A;  4B66 A;  3M0O A;  1TYP A;  3P4Q A;  3AB1 A;  3ZYX A;  2BK4 A;  4EIQ A;  3ATR A;  2WET A;  3H8L A;  2VZ2 A;  3NTD A;  4DSH A;  1N1P A;  1FEA A;  1ZKQ A;  3CGD A;  4Z24 A;  3UOY A;  3DK9 A;  2Z5Y A;  2PYX A;  1GAL A;  2XVF A;  1NEN A;  3P9U A;  1N4V A;  3GD4 A;  3P4P A;  2JKC A;  3DK4 A;  4PAB A;  1GTE A;  4C77 A;  4B1B A;  1KSU A;  2WHD A;  5HHF A;  5KVI A;  5FMH A;  1PN0 A;  2C65 A;  1H86 A;  2BC1 A;  1EL5 A;  2A87 A;  4CCQ A;  3QSS A;  1B4V A;  4EM4 A;  3EPT A;  3COX A;  3HZL A;  3UTF A;  2BA9 A;  3AEA A;  1CJ4 A;  1PDH A;  2ZZB A;  3ICT A;  1TRB A;  3QJ4 A;  4J36 A;  3FPZ A;  3AE1 A;  4DGK A;  1FEC A;  3GRS A;  3KPF A;  4IVM B;  5JCN A;  4REK A;  3F8R A;  4O5Q A;  4YT0 A;  1E1N A;  5KOX A;  2YVJ A;  1GT8 A;  2CUL A;  4Z43 A;  4IVO B;  1NG4 A;  4D03 A;  3AD7 B;  2XVJ A;  2WU5 A;  3PO7 A;  1GPE A;  4H4V A;  1COY A;  1CC4 A;  3AEG A;  5KWF A;  4A99 A;  2BS4 A;  2WU2 A;  2XVI A;  3VQR A;  3K30 A;  4HA6 A;  3EF6 A;  3AED A;  4RG4 A;  1GV4 A;  3P4R A;  4GDE A;  4A6N B;  3UKK A;  2YG3 A;  3FMW A;  4H2Q A;  1XPQ A;  1D7Y A;  4LU6 A;  3AEC A;  4YKG A;  1GRG A;  3GRT A;  1CL0 A;  1EL8 A;  1FOH A;  2YVF A;  3AD9 B;  1NHR A;  3EAN A;  4M52 A;  2C67 A;  2XLR A;  2XLS A;  4UDP A;  1BKW A;  2FBW A;  3R9U A;  5BUK A;  3UP4 A;  2E5V A;  2R4E A;  1JRY A;  3NH3 X;  1YKJ A;  2ZZ0 A;  3SGL A;  2APG A;  1K4Q A;  2BS2 A;  2YM2 A;  4GUV A;  4AP3 A;  4H4S A;  4OVI A;  1E1K A;  2VQB A;  4H4T A;  3CNT A;  1FL2 A;  3UKA A;  2BYB A;  2C75 A;  1PBC A;  1H83 A;  2GR0 A;  4PAA A;  4YSZ A;  2JB1 A;  3H4K A;  2YR4 A;  3IHG A;  1ZK7 A;  4C3Y A;  1ZY8 A;  2BXR A;  2ARD A;  2QCU A;  3AE3 A;  3FIM B;  3BI5 A;  4APN A;  4CY8 A;  1BGJ A;  2XFP A;  4OCG A;  2WBA A;  2HQM A;  3EAO A;  2C76 A;  1GRT A;  1Y56 B;  1O94 A;  3AWI A;  2YG4 A;  3ISH A;  2BC0 A;  3CGC A;  1KSS A;  3GYI A;  4JNA A;  1B37 A;  4U8K A;  1PBD A;  3DGH A;  3RHA A;  4YTP A;  1V59 A;  1NAA A;  4NZH A;  1NHP A;  1F8S A;  1PHH A;  3PS9 A;  2VVL G;  2FJD A;  2X99 A;  2BCG G;  4USQ A;  3H8I A;  4WCT A;  4EMJ A;  4C3X A;  1GRA A;  2B9Y A;  4BK1 A;  1E7P A;  2R9Z A;  1S3B A;  1E1M A;  1H84 A;  4OPD A;  3AYJ A;  2R4J A;  2C7G A;  4YSY A;  3AE6 A;  5HXI A;  3UOX A;  1MO9 A;  1S2Q A;  3F8P A;  4Z44 A;  4NTD A;  2GQW A;  4H50 A;  2H89 A;  4Y4N A;  4E0V A;  3NNE A;  4H4R A;  3NK2 X;  3FBS A;  1GET A;  4H4U A;  3AEE A;  4B65 A;  5EB5 A;  3V76 A;  4Y4L A;  4Z25 A;  1NEK A;  2OA1 A;  3BI4 A;  3DGZ A;  5C2T A;  4IA5 A;  1GRB A;  1AOG A;  1YQ4 A;  2X8H A;  5KRQ A;  3QFB A;  2XFU A;  5JCL A;  4HB9 A;  4BJZ A;  1SEZ A;  4K2X A;  1L0V A;  2BCP A;  3ICS A;  3UKP A;  3V3O A;  2TPR A;  3WE0 A;  3ABV A;  4ZN0 A;  2GVC A;  4FK1 C;  3VRD B;  5ER0 A;  1BWC A;  3CPJ G;  3GDN A;  3CPI G;  2JB2 A;  4U8O A;  4K22 A;  2WEU A;  1KDG A;  3GDP A;  1E39 A;  1Q1W A;  2B76 A;  1TDF A;  2XLP A;  2J3N A;  3FG2 P;  4C5O A;  2BXS A;  1CC2 A;  3K7T A;  4BJY A;  1D4C A;  2O9Z A;  4B68 A;  3AE7 A;  5BVA A;  3OC4 A;  5DBJ A;  1VDC A;  2X50 A;  2XFO A;  2AQJ A;  2EQ6 A;  4KPR A;  1DOE A; 
#chains in the Genus database with same CATH topology
 3B3R A;  2PU0 A;  1P48 A;  5EU9 A;  1VQW A;  4TLZ A;  2E1M A;  3NHO X;  2XH0 A;  2R0C A;  4AP1 A;  4H4Q A;  2EQ9 A;  4IT1 A;  1LTX R;  5KOW A;  4D04 A;  3T6C A;  1P2H A;  2AL2 A;  2RGO A;  3CB3 A;  3ZLH A;  4GRT A;  3N4E A;  3RNM A;  4ZCD A;  1F3P A;  4ADW A;  1GSN A;  1JDF A;  4DSG A;  1N60 C;  3LOV A;  1LV0 A;  1Q9I A;  3RP7 A;  3LJP A;  4FI4 A;  2WDR A;  1JNZ A;  5C3J A;  2MNR A;  1KF6 A;  2GMH A;  3CT2 A;  1IUW A;  4TM4 A;  2OO6 A;  3RED A;  2C4C A;  1YQ3 A;  3UOV A;  1JOA A;  4J31 A;  2GF3 A;  2YLR A;  4H4Y A;  3CNP A;  3KA7 A;  3GSI A;  3DER A;  4G9K A;  3ES8 A;  3UJE A;  2P88 A;  5BRT A;  4GIR A;  2Q6U A;  4Y4M A;  4MMW A;  3DME A;  3VRB A;  3GYX A;  1DJQ A;  3ALJ A;  2C66 A;  4JDR A;  1MNS A;  3BI2 A;  1Z6L A;  4GGH A;  1EBG A;  3P4S A;  1DOD A;  1PXA A;  1Y0P A;  3UKH A;  4GDP A;  1ZDL A;  3UXK A;  1RYI A;  4KT2 A;  2X3N A;  3UKQ A;  2RGH A;  3R11 A;  1NEL A;  5JCM A;  2PS2 A;  1R6W A;  2FJE A;  1H82 A;  3QSE A;  4HCH A;  4J1O A;  2OQY A;  3NT6 A;  3OZY A;  4FDC B;  3EUB 3;  3T14 A;  4EM3 A;  2YG5 A;  1E1L A;  2GGG A;  3VFC A;  1WUF A;  1TZZ A;  3DES A;  1KN0 A;  1FEB A;  3I6T A;  5FJT A;  2C70 A;  4B69 A;  1IUS A;  1UKV G;  3NK0 X;  3SN1 A;  4BV6 A;  1X31 B;  2XH7 A;  1EBD A;  2X8C A;  1IUT A;  4HNL A;  1VQZ A;  4JN8 A;  3H7V A;  1GEU A;  1S7M A;  1Q1R A;  2PP1 A;  2NVK X;  3RGT A;  2Y6Q A;  2WDQ A;  3T2Z A;  4C74 A;  2WP6 A;  3DJG X;  3AMZ A;  2BK3 A;  1IYX A;  1CBO A;  3ICR A;  4TM1 A;  3HPF A;  1ONF A;  4U8M A;  2OX4 A;  5M0Z A;  1B5Q A;  3ATQ A;  4NEV A;  3TTE A;  3NRZ B;  2QJJ A;  3ZVH A;  3TWA A;  4E6M A;  4H2H A;  3T37 A;  5FS7 A;  2GSH A;  3DFY A;  1LJ1 A;  2ACZ A;  1ZOV A;  4U2T A;  1GXF A;  3N6J A;  1PJ7 A;  4NNJ A;  3AYL A;  5KXJ A;  2GL5 A;  3OTR A;  4U2L A;  2GRT A;  3SFD A;  2OLA A;  3KKJ A;  2PP0 A;  3PFR A;  4JY2 A;  3R1Z A;  4H83 A;  3P93 A;  1WUE A;  3B6D A;  4II2 A;  1O5W A;  4X9M A;  2WOI A;  2IVE A;  5FS9 A;  1FIQ B;  3NIX A;  2XLU A;  1N63 C;  3ALL A;  2R0P A;  4B66 A;  1TYP A;  3AB1 A;  3ZYX A;  3H8L A;  3ZLF A;  1FEA A;  1ZKQ A;  3JW7 A;  2XVF A;  1N4V A;  3VA8 A;  2JKC A;  1GTE A;  2C65 A;  2BC1 A;  4CCQ A;  3MKC A;  1CJ4 A;  4EWJ A;  3DDM A;  1FEC A;  4IVM B;  1N5X A;  4REK A;  2P3Z A;  3TJ4 A;  4YT0 A;  1E1N A;  4Z43 A;  4IVO B;  2GDQ A;  2XVJ A;  3PO7 A;  1COY A;  3AEG A;  2WU2 A;  1MDR A;  2XVI A;  4HA6 A;  3AED A;  4G6H A;  3P4R A;  3FMW A;  4H2Q A;  1XPQ A;  4LU6 A;  2OKT A;  1GRG A;  1EL8 A;  1FOH A;  4M52 A;  2C67 A;  3NH3 X;  1YKJ A;  2ZZ0 A;  1K4Q A;  4GUV A;  4AP3 A;  1KKR A;  3NVZ B;  4C3Y A;  4F4R A;  2QCU A;  1FO4 A;  4OCG A;  2C76 A;  1GRT A;  3EKG A;  3AWI A;  3ISH A;  3GYI A;  4GME A;  1PBD A;  3RHA A;  2OZ3 A;  1F8S A;  2FJD A;  2BCG G;  3N4F A;  4EMJ A;  1GRA A;  3MSY A;  3THU A;  3PG6 A;  3UJR A;  3VCC A;  4G74 A;  2PTW A;  3VCN A;  4Z25 A;  3T31 A;  4DWD A;  3BI4 A;  2BCP A;  3WE0 A;  3ABV A;  3VRD B;  5FJO A;  4K22 A;  2QGY A;  1KDG A;  2B76 A;  1CC2 A;  1T3Q C;  3AE7 A;  5DBJ A;  5KMS A;  4ZCW A;  2AQJ A;  3SJN A;  2HXU A;  3QFA A;  3AE8 A;  4K2S A;  5CKU A;  3C4A A;  3JSK A;  3BNU A;  2OLN A;  1FFU C;  2Z5X A;  3GWD A;  2WPF A;  1E6E A;  2CHR A;  2GR1 A;  3FYY A;  3P1W A;  4UDR A;  3K7M X;  4TM3 A;  4NEW A;  1CJ2 A;  4XWR A;  3RO6 A;  2Q7V A;  3NYC A;  3Q4D A;  3STP A;  3I6D A;  1BZL A;  4J2W A;  1EBH A;  2GR3 A;  2OAM A;  1ZX9 A;  2WS3 A;  3QVP A;  1DNC A;  4U8N A;  3OZ2 A;  3CTY A;  3QN3 A;  4A6G A;  5GRT A;  4YXD A;  2I5Q A;  4I58 A;  4ICY A;  3UTE A;  1XDI A;  3SM8 A;  2RAB A;  2YLX A;  4O5U A;  1YY5 A;  1MXT A;  2I0Z A;  2HXT A;  2PP3 A;  3DK8 A;  1HYU A;  3NK1 X;  4LII A;  3L8K A;  2OAL A;  3VC5 A;  1KNP A;  1DOB A;  4K1W A;  2Y6R A;  3SFE A;  5IPY A;  1PDY A;  1OJA A;  3BHF A;  2AKZ A;  3D46 A;  5G5H B;  1QLB A;  2F5Z A;  5JRB A;  4JN9 A;  4GGB A;  3NVY B;  3BNM A;  3HYX A;  1PBF A;  3NFU A;  2EQ8 A;  2W3S A;  3ITJ A;  4YWS A;  4GCM A;  3DJE A;  5U25 A;  3TQP A;  2XH4 A;  2QA2 A;  1VG0 A;  2XVE A;  5FJR A;  2GV8 A;  4II3 A;  3VC6 A;  1ZMD A;  1TKK A;  4IP4 A;  2JB3 A;  3NLC A;  1M64 A;  3T0K A;  1REO A;  4K5S A;  2AAQ A;  4ENL A;  4UDQ A;  2FJB A;  4CRT A;  3VR8 A;  4JNQ A;  3CYJ A;  1KFY A;  1OJ9 A;  1KKO A;  2BK5 A;  1NG3 A;  2PHH A;  1FCD A;  4GAP A;  4H19 A;  1ELS A;  5IDZ A;  3ZDN A;  3Q9T A;  4U8L A;  2QVH A;  1EL7 A;  1GER A;  1MRA A;  1F8R A;  2QJM A;  1JEH A;  4EQX A;  3GMB A;  4A6N A;  4A65 A;  1BQG A;  3ALM A;  1CJ3 A;  4XWZ A;  4NTC A;  3IHM A;  2WOV A;  1TDE A;  4X4J A;  1JRZ A;  2CVJ A;  3U4F A;  4A79 A;  2V3A A;  4YSH A;  2XVH A;  2EQ7 A;  1NHS A;  1YQZ A;  2GAG B;  1JPD X;  1CF3 A;  5J04 A;  1BGN A;  4H2N A;  3H8A A;  2WPC A;  4Z1Y A;  1L9E A;  1ZMC A;  1Y56 A;  4YTN A;  1CHU A;  5JCK A;  2XH2 A;  2QQ6 A;  2E4G A;  4LA1 A;  3AEB A;  5KVH A;  1H6V A;  2C64 A;  1NHQ A;  2B9W A;  2YVG A;  2GGI A;  2WDV A;  4KWS A;  4A9W A;  3CMM A;  2NQL A;  1GRF A;  4EMW A;  3KLJ A;  1L9C A;  4NTE A;  3SQS A;  1CJC A;  1EC8 A;  3NS1 B;  4KEM A;  3KPK A;  3BHK A;  5KMP A;  2PTZ A;  1W6T A;  3ADA B;  4P9S A;  3SN4 A;  5J7X A;  1BF3 A;  3GY1 A;  4XXG A;  2B7R A;  3I4K A;  2V61 A;  1NU5 A;  2Q0L A;  1SJB A;  2GMJ A;  2ZBW A;  2XFQ A;  3BJS A;  2BAC A;  4U2S A;  4H7U A;  1IJH A;  3KVE A;  3DG7 A;  5EOW A;  4HYR A;  3V3N A;  2X8G A;  7ENL A;  3M0O A;  3P4Q A;  3BSM A;  1N5W C;  2BK4 A;  4EIQ A;  3ATR A;  2WET A;  3NTD A;  4Z24 A;  2PYX A;  3DG6 A;  3GD4 A;  3CK5 A;  3U9I A;  1H86 A;  3QSS A;  2BA9 A;  4TVW A;  1PDH A;  2ZZB A;  3ICT A;  1JPM A;  1TRB A;  3ES7 A;  3AE1 A;  4DGK A;  3HYW A;  4MKS A;  3ZLG A;  3GRS A;  3KPF A;  3F8R A;  5KOX A;  2YVJ A;  1GT8 A;  3R07 C;  2CUL A;  4E4F A;  3MY9 A;  1CC4 A;  4DN1 A;  2AL1 A;  3VQR A;  4IP5 A;  3EF6 A;  4RG4 A;  1GV4 A;  3CXO A;  4H1Z A;  1H2I A;  4YKG A;  2XLS A;  1BKW A;  2PPG A;  1JRY A;  3SGL A;  1KCZ A;  2YM2 A;  1E1K A;  3MQT A;  1FL2 A;  3UKA A;  2BYB A;  3SX6 A;  1H83 A;  3GO2 A;  2JB1 A;  3H4K A;  2YR4 A;  3IHG A;  2W54 A;  1RM6 B;  1BGJ A;  3R10 A;  1O94 A;  3CGC A;  1B37 A;  3DGH A;  4YTP A;  4NZH A;  2X99 A;  4BK1 A;  1E1M A;  3AYJ A;  2C7G A;  4YSY A;  1MO9 A;  1S2Q A;  2H89 A;  4Y4N A;  4E0V A;  3R25 A;  4H4R A;  4A35 A;  3FBS A;  4H4U A;  4B65 A;  4GFI A;  4Y4L A;  1NEK A;  3UGV A;  5C2T A;  3QFB A;  4BJZ A;  1SEZ A;  1L0V A;  1F9C A;  3ICS A;  2TPR A;  2GVC A;  5ER0 A;  3CPI G;  4U8O A;  3FG2 P;  2W55 A;  4B68 A;  5BVA A;  2EQ6 A;  4KPR A;  1RVK A;  3DJJ A;  4KPL A;  5HYM A;  3CN8 A;  2YM1 A;  1JU2 A;  1EL9 A;  3AN1 A;  2YR5 A;  4EQS A;  1K0J A;  4A5L A;  5IQ1 A;  1P43 A;  1VRQ B;  5GSN A;  1VDV A;  3SY4 A;  1GOS A;  4HCL A;  3UJS A;  5U63 A;  2ZZC A;  4H4Z A;  1DTN A;  4J56 A;  5G5G B;  1SJD A;  4E5T A;  5BOF A;  3QVR A;  1QJD A;  2TMD A;  3C96 A;  4KX6 A;  1JRX A;  3GWF A;  4AT0 A;  2YLS A;  4CBQ A;  4YKF A;  5U1O A;  2BS3 A;  4H4P A;  1H7X A;  2VVL A;  1LQT A;  1E9I A;  3DJD A;  1XS2 A;  3V5F A;  2ONE A;  3URH A;  2PCE A;  1ZXI C;  4U8P A;  1KD0 A;  2FKP A;  4G7F A;  1ELI A;  4YSX A;  2VQ7 A;  4H2R A;  4GYP C;  2PTX A;  1W4X A;  2XLT A;  3KU9 A;  1EC9 A;  3D47 A;  3UKF A;  3VRA A;  4IZG A;  2YAU A;  4MGG A;  3AM9 A;  1CC6 A;  2C72 A;  2OPJ A;  3S5S A;  2QJN A;  4GAV A;  2WOW A;  3NN6 X;  3SN0 A;  5KMR A;  3SBF A;  2DW7 A;  2GEW A;  4N9X A;  3AE5 A;  4OPG A;  3BOX A;  2B9X A;  1P2E A;  5FJP A;  4E8G A;  2WQY A;  3AEF A;  1VG9 A;  1H7W A;  4AOX A;  4Z2U A;  2JAE A;  2XDO A;  3E1T A;  5IQ4 A;  3TWB A;  3RIT A;  1LVL A;  5M10 A;  3CNJ A;  3UKL A;  2ZAD A;  1MOK A;  2YQU A;  4DNA A;  4NWZ A;  4I59 A;  4GR1 A;  2PMQ A;  2CFY A;  3M12 A;  2PTY A;  5BOE A;  4M0X A;  2YLW A;  4BUR A;  3LAD A;  4YWO A;  3D8X A;  4GYP A;  2Q0K A;  3UXL A;  4OPT A;  4OPU A;  3FJ4 A;  4J57 A;  3FVD A;  2YLZ A;  4CNK A;  4HNC A;  1NPX A;  3CND A;  3PVC A;  4J34 A;  4MJW A;  1WYG A;  2BAB A;  2R45 A;  3K1G A;  1PXC A;  2PGE A;  3AXB A;  3GD3 A;  3RR1 A;  2B7S A;  1MUC A;  1PJ5 A;  1DOC A;  3CNS A;  4B64 A;  2DKI A;  1IUX A;  2QAE A;  6ENL A;  3Q6J A;  3GMC A;  4HCD A;  4A7A A;  3NKS A;  3O0H A;  4Z26 A;  2CDU A;  3CAW A;  2OLO A;  5JCI A;  3DA1 A;  3IWA A;  3I3L A;  2VOU A;  4CNJ A;  4A3R A;  4IL0 A;  3L1R A;  1GND A;  3MZN A;  3IJI A;  2JBV A;  5HY5 A;  2C73 A;  2P8B A;  1GRH A;  2YR6 A;  3T2K A;  2ZC8 A;  1H81 A;  3SYI A;  1D5T A;  4FX9 A;  1TDK A;  2GGH A;  2OZT A;  3NG7 X;  1NDA A;  3UTH A;  2WPE A;  1MDL A;  2P8C A;  4H4W A;  3ZVI A;  1F6M A;  2V60 A;  3I6E A;  4B67 A;  1ZOY A;  1QO8 A;  2XFN A;  2BRY A;  1D7L A;  4TLX A;  3KUM A;  2OFJ A;  3C4N A;  2WP5 A;  3LB8 A;  1ONE A;  2IID A;  2YG6 A;  2XCG A;  1XAN A;  3OP2 A;  1DJN A;  4HPN A;  2R46 A;  1GES A;  3RP8 A;  1GRE A;  1OJT A;  1N4W A;  5FJU A;  2YWL A;  3H12 A;  3VR9 A;  3PWG A;  2GH5 A;  3SQP A;  2IVD A;  2GR2 A;  3F8D A;  1BKH A;  3G5R A;  4BK2 A;  2PA6 A;  1S2Y A;  3TJI A;  2OZ8 A;  3RRA A;  2DW6 A;  2VZ2 A;  3OW1 A;  2AKM A;  1L8P A;  1N1P A;  3DEQ A;  3UOY A;  3JVA A;  2Z5Y A;  1GAL A;  3P9U A;  1YEY A;  4M6U A;  3DK4 A;  4PAB A;  4C77 A;  4B1B A;  1KSU A;  2WHD A;  5HHF A;  5KVI A;  5FMH A;  1PN0 A;  1B4V A;  4EM4 A;  3EPT A;  3COX A;  3HZL A;  3UTF A;  1N62 C;  3EEZ A;  3FV9 A;  4J36 A;  3FPZ A;  2AL2 B;  2O56 A;  2WU5 A;  3PK7 A;  3SXI A;  4H4V A;  5KWF A;  4A99 A;  2BS4 A;  4A6N B;  4G73 A;  1X2H A;  3UKK A;  3L5O A;  4ROP A;  4IL2 A;  1D7Y A;  1CL0 A;  4X2P A;  2YVF A;  3EAN A;  2XLR A;  2FBW A;  4ZOH B;  2E5V A;  2APG A;  2BS2 A;  3SR6 B;  2VQB A;  1JRP A;  4H4T A;  1PBC A;  4PAA A;  3V4B A;  1ZY8 A;  3FIM B;  4CY8 A;  3BI5 A;  4APN A;  3GD6 A;  2WBA A;  5ENL A;  3EAO A;  3QKE A;  1Y56 B;  1FFV C;  2BC0 A;  1KSS A;  4JNA A;  4G8T A;  3SZF A;  4U8K A;  4HN8 A;  3SSZ A;  1NAA A;  3HW2 A;  1NHP A;  3PS9 A;  2VVL G;  3H8I A;  4WCT A;  2B9Y A;  2R9Z A;  3NO1 A;  1S3B A;  4OPD A;  2R4J A;  3AE6 A;  3F8P A;  4Z44 A;  2GQW A;  4H50 A;  1GET A;  5EB5 A;  3V76 A;  3FXG A;  1AOG A;  1YQ4 A;  3QLD A;  5KRQ A;  4K2X A;  3UKP A;  4J3Z A;  4ZN0 A;  4FK1 C;  3RCY A;  1BWC A;  4FP1 A;  4DHG A;  1E39 A;  3IK4 A;  1TDF A;  2J3N A;  3TCS A;  3OZM A;  4BJY A;  1JRO A;  3A7U A;  1FHU A;  3MWC A;  3OC4 A;  2X50 A;  3T4W A;  2XFO A;  1DOE A;  3H70 A;  2HNE A;  4DYE A;  1JNR A;  2GB0 A;  4Z2R A;  4U8J A;  2A8X A;  3UJ2 A;  1OEP A;  1K0I A;  4K5R A;  3LXD A;  2WES A;  2HZG A;  5LV9 A;  3B9J B;  4EQR A;  4AT2 A;  1DXL A;  3CGE A;  4H4X A;  2A89 A;  4GF7 A;  2VRM A;  3D1C A;  2JK6 A;  1PBB A;  2RDX A;  3GYJ A;  1OJD A;  3K7Q X;  3NZG A;  4CY6 A;  2PU1 A;  3Q45 A;  5FS8 A;  2H88 A;  2PGW A;  3QPE A;  3JZU A;  1N4U A;  1TYT A;  3B97 A;  3NYE A;  2C3D A;  4FK1 A;  2V6O A;  4DXK A;  4K7Z A;  3UCD A;  3NXL A;  4DX3 A;  2VVM A;  5L46 A;  4RG3 A;  2W0H A;  4X9N A;  4BK3 A;  3R0K A;  3DH9 A;  4USR A;  5BUL A;  1F8W A;  5KMQ A;  2RGJ A;  4JY3 A;  3AD8 B;  2NPX A;  3ZVH B;  4TVY A;  3NVW B;  4Z2T A;  3A7A A;  3GC2 A;  1D4D A;  2POZ A;  4OPI A;  2AR8 A;  3AE4 A;  3NVV B;  1JCT A;  3M13 A;  3A7R A;  2OQH A;  2GAH B;  3AYI A;  3ENL A;  3FCP A;  5KNL A;  3T8Q A;  3NGC X;  3TOY A;  3G5S A;  3PWI A;  2QA1 A;  3QSM A;  3VDG A;  2YG7 A;  4YTM A;  2R0G A;  5J60 A;  1L9D A;  4H2P A;  1N61 C;  2E3T A;  2XYO A;  3LZW A;  4K8G A;  4IA6 A;  2E5A A;  1X2G A;  4Z17 A;  2DKH A;  4AOS A;  1XPY A;  1IUV A;  4G6G A;  3UP5 A;  4RSL A;  3UTG A;  4JN7 A;  1SJC A;  3T9P A;  1ECQ A;  2XSX A;  3IC9 A;  1M6I A;  3IF9 A;  5CQF A;  3G5Q A;  3ETR B;  1SJA A;  3V5C A;  1PXB A;  1LPF A;  1PJ6 A;  2WP9 A;  3P3B A;  4CCR A;  3AE2 A;  4UP3 A;  1LQU A;  4JQ9 A;  3HYV A;  4U8I A;  3UOZ A;  2XGZ A;  1ZP0 A;  5TR3 A;  5FS6 A;  4ECH A;  2GQF A;  2GGE A;  5EBK A;  3NRN A;  4EMI A;  3NTA A;  1TDN A;  2FJA A;  1OJC A;  1PS9 A;  2UZZ A;  1SB3 B;  3UCL A;  4EIP A;  1D4E A;  1XHC A;  3NYF A;  3UJF A;  1RP0 A;  3CIR A;  3UCC A;  1V97 A;  3MUC A;  3R0U A;  4TM0 A;  4WX1 A;  3CPH G;  3KD9 A;  1TE6 A;  4B63 A;  1KNR A;  4ZA0 A;  2P0I A;  1TDO A;  4OPL A;  2QDD A;  2YLT A;  3QTP A;  5EB4 A;  1STZ A;  3RP6 A;  3CGB A;  4EQW A;  2C3C A;  3V3W A;  3II4 A;  4ZCC A;  1R0M A;  3AE9 A;  4IV9 A;  3OPS A;  1IUU A;  1K0L A;  2V3B A;  3LZX A;  3NN0 X;  2VRL A;  4J33 A;  1O95 A;  4OPC A;  3DG3 A;  4K8D A;  1PBE A;  1GTH A;  1RSG A;  2V5Z A;  1S3E A;  3S61 A;  2FYM A;  1B8S A;  2GGJ A;  3S5W A;  3SZ0 A;  4DSH A;  3CGD A;  3DK9 A;  1NEN A;  3P4P A;  3DGB A;  1EL5 A;  2A87 A;  3D9X A;  3TW9 A;  3AEA A;  2OVL A;  3DFH A;  3QJ4 A;  4IHC A;  5JCN A;  2BRA A;  4O5Q A;  4GIS A;  3P0W A;  1NG4 A;  4D03 A;  3AD7 B;  1GPE A;  1FHV A;  3K30 A;  2OG9 A;  4GDE A;  2POD A;  3S47 A;  2YG3 A;  3AEC A;  3GRT A;  3AD9 B;  1NHR A;  4UDP A;  3IJL A;  5BUK A;  3R9U A;  3UP4 A;  2R4E A;  1EC7 A;  3DIP A;  4H4S A;  4OVI A;  3CNT A;  2W3R A;  2C75 A;  2GR0 A;  4YSZ A;  1ZK7 A;  2BXR A;  2ARD A;  3AE3 A;  3T2Y A;  2XFP A;  2PSN A;  3IJQ A;  2HQM A;  2YG4 A;  2QDE A;  3SZC A;  1PDZ A;  1V59 A;  1PHH A;  3N6H A;  4USQ A;  3HRD C;  4C3X A;  1E7P A;  1H84 A;  3SZW A;  5HXI A;  3UOX A;  4NTD A;  3NNE A;  3NK2 X;  3AEE A;  2OA1 A;  3DGZ A;  4IA5 A;  1GRB A;  2X8H A;  2XFU A;  5JCL A;  4HB9 A;  2MUC A;  3V3O A;  4JHM A;  3CPJ G;  3GDN A;  2JB2 A;  3CXB A;  2WEU A;  3GDP A;  1Q1W A;  2XLP A;  4C5O A;  2BXS A;  3K7T A;  1D4C A;  2O9Z A;  1VDC A;  4E4U A; 
#chains in the Genus database with same CATH homology
 3DJJ A;  3B3R A;  3QFA A;  3AE8 A;  5HYM A;  5CKU A;  3CN8 A;  1JNR A;  2GB0 A;  3C4A A;  2YM1 A;  3JSK A;  1JU2 A;  4Z2R A;  1EL9 A;  3BNU A;  4U8J A;  2A8X A;  1VQW A;  4TLZ A;  2E1M A;  3NHO X;  2OLN A;  2Z5X A;  2R0C A;  4AP1 A;  4H4Q A;  1K0I A;  3GWD A;  2EQ9 A;  4K5R A;  1LTX R;  3LXD A;  4EQS A;  2WPF A;  2WES A;  2YR5 A;  5KOW A;  1K0J A;  1E6E A;  4D04 A;  5LV9 A;  1P2H A;  2GR1 A;  4A5L A;  2RGO A;  5IQ1 A;  4EQR A;  4AT2 A;  1VRQ B;  5GSN A;  1DXL A;  3CGE A;  4H4X A;  2A89 A;  3P1W A;  4GRT A;  4GF7 A;  3K7M X;  4TM3 A;  4UDR A;  4NEW A;  1GOS A;  2VRM A;  3SY4 A;  1CJ2 A;  3D1C A;  3RNM A;  2JK6 A;  1PBB A;  4XWR A;  3GYJ A;  4ZCD A;  5U63 A;  1F3P A;  2Q7V A;  3NYC A;  2ZZC A;  4H4Z A;  4ADW A;  1OJD A;  3K7Q X;  1GSN A;  4J56 A;  4CY6 A;  4DSG A;  3LOV A;  3QVR A;  5FS8 A;  1LV0 A;  1Q9I A;  1QJD A;  2H88 A;  2TMD A;  3C96 A;  3I6D A;  1BZL A;  3LJP A;  4KX6 A;  3RP7 A;  4J2W A;  1JRX A;  1N4U A;  3GWF A;  2GR3 A;  1TYT A;  1ZX9 A;  2OAM A;  2WS3 A;  4AT0 A;  2YLS A;  3NYE A;  3QVP A;  4CBQ A;  2C3D A;  4FK1 A;  2WDR A;  1DNC A;  1JNZ A;  4YKF A;  2V6O A;  4U8N A;  3OZ2 A;  5C3J A;  5U1O A;  1KF6 A;  2BS3 A;  2GMH A;  3CTY A;  4H4P A;  1H7X A;  4K7Z A;  2VVL A;  1IUW A;  5GRT A;  1LQT A;  3DJD A;  4TM4 A;  4YXD A;  2VVM A;  3RED A;  2C4C A;  5L46 A;  3URH A;  4I58 A;  1YQ3 A;  4RG3 A;  4ICY A;  3UOV A;  2W0H A;  3UTE A;  1JOA A;  4J31 A;  1XDI A;  2GF3 A;  4H4Y A;  2YLR A;  4U8P A;  1ELI A;  4YSX A;  2VQ7 A;  3CNP A;  3KA7 A;  3GSI A;  3SM8 A;  4X9N A;  4BK3 A;  2RAB A;  4H2R A;  2YLX A;  4G9K A;  3DH9 A;  4USR A;  5BUL A;  1F8W A;  2XLT A;  1W4X A;  4O5U A;  3KU9 A;  5BRT A;  5KMQ A;  1YY5 A;  1MXT A;  2I0Z A;  3UKF A;  2RGJ A;  4JY3 A;  3AD8 B;  2Q6U A;  3VRA A;  4Y4M A;  2NPX A;  3DME A;  3DK8 A;  3VRB A;  3GYX A;  1HYU A;  3NK1 X;  2YAU A;  4LII A;  1CC6 A;  1DJQ A;  3L8K A;  3ALJ A;  2C72 A;  2OAL A;  4Z2T A;  2C66 A;  4JDR A;  3BI2 A;  1KNP A;  1D4D A;  2WOW A;  1DOB A;  1Z6L A;  3NN6 X;  4GAV A;  4OPI A;  5KMR A;  2Y6R A;  3SFE A;  2AR8 A;  5IPY A;  2GEW A;  3P4S A;  3AE4 A;  1DOD A;  3AE5 A;  1PXA A;  1Y0P A;  4N9X A;  4OPG A;  2B9X A;  1OJA A;  1P2E A;  3BHF A;  3M13 A;  3UKH A;  4GDP A;  1QLB A;  1ZDL A;  2GAH B;  3AYI A;  2F5Z A;  5JRB A;  1RYI A;  4JN9 A;  2X3N A;  3UKQ A;  2WQY A;  3AEF A;  2RGH A;  3BNM A;  1VG9 A;  5KNL A;  3HYX A;  1PBF A;  3NGC X;  5JCM A;  2EQ8 A;  1H7W A;  3G5S A;  3ITJ A;  2QA1 A;  2FJE A;  3DJE A;  5U25 A;  3QSM A;  4GCM A;  4AOX A;  2YG7 A;  1H82 A;  4Z2U A;  2JAE A;  2QA2 A;  3QSE A;  4YTM A;  1VG0 A;  2XVE A;  2XDO A;  2R0G A;  5J60 A;  1L9D A;  4H2P A;  3NT6 A;  4FDC B;  3E1T A;  2GV8 A;  3T14 A;  4EM3 A;  5IQ4 A;  2YG5 A;  4II3 A;  1E1L A;  2XYO A;  1LVL A;  5M10 A;  3CNJ A;  3UKL A;  3LZW A;  4IA6 A;  1MOK A;  2YQU A;  1ZMD A;  4DNA A;  4NWZ A;  2DKH A;  4I59 A;  4GR1 A;  4AOS A;  2CFY A;  1KN0 A;  2JB3 A;  3NLC A;  1M64 A;  3M12 A;  1FEB A;  3T0K A;  1REO A;  4K5S A;  2AAQ A;  4UDQ A;  1IUV A;  2FJB A;  2YLW A;  4BUR A;  3LAD A;  2C70 A;  4G6G A;  1IUS A;  3UP5 A;  4RSL A;  4YWO A;  1UKV G;  3D8X A;  3UTG A;  3VR8 A;  2Q0K A;  4CRT A;  4JNQ A;  4OPT A;  1KFY A;  1OJ9 A;  4OPU A;  3NK0 X;  4J57 A;  2BK5 A;  1NG3 A;  3IC9 A;  2YLZ A;  1M6I A;  4BV6 A;  1X31 B;  3IF9 A;  2PHH A;  4CNK A;  1EBD A;  2X8C A;  1IUT A;  1NPX A;  1FCD A;  3CND A;  3PVC A;  4GAP A;  5CQF A;  3G5Q A;  4J34 A;  4MJW A;  2BAB A;  2R45 A;  3ZDN A;  1GEU A;  1S7M A;  1PXB A;  3Q9T A;  4U8L A;  1LPF A;  1PJ6 A;  2WP9 A;  1EL7 A;  1GER A;  1Q1R A;  4CCR A;  3AE2 A;  1F8R A;  4UP3 A;  1LQU A;  2NVK X;  1PXC A;  4JQ9 A;  1JEH A;  4EQX A;  2WDQ A;  2Y6Q A;  3GMB A;  3AXB A;  3HYV A;  4U8I A;  3T2Z A;  3UOZ A;  3GD3 A;  4A65 A;  4A6N A;  2B7S A;  4C74 A;  3ALM A;  1ZP0 A;  1CJ3 A;  1PJ5 A;  5TR3 A;  1DOC A;  5FS6 A;  4XWZ A;  4NTC A;  3CNS A;  3IHM A;  4B64 A;  2DKI A;  1IUX A;  2WP6 A;  2WOV A;  4ECH A;  3DJG X;  2BK3 A;  2QAE A;  1TDE A;  5EBK A;  2GQF A;  3Q6J A;  4X4J A;  1JRZ A;  4EMI A;  2CVJ A;  3GMC A;  3NRN A;  3NTA A;  4A79 A;  1TDN A;  2V3A A;  2FJA A;  1CBO A;  3ICR A;  4A7A A;  4YSH A;  1OJC A;  3NKS A;  4TM1 A;  3O0H A;  4Z26 A;  2CDU A;  1PS9 A;  2XVH A;  2OLO A;  5JCI A;  2UZZ A;  2EQ7 A;  3DA1 A;  3I3L A;  3IWA A;  2VOU A;  1NHS A;  4CNJ A;  1YQZ A;  2GAG B;  1CF3 A;  1BGN A;  4H2N A;  3UCL A;  4EIP A;  3L1R A;  1D4E A;  1XHC A;  3NYF A;  1GND A;  2WPC A;  1ONF A;  1L9E A;  1RP0 A;  1ZMC A;  3CIR A;  1Y56 A;  4U8M A;  2JBV A;  5HY5 A;  2C73 A;  5M0Z A;  4TM0 A;  4WX1 A;  4YTN A;  3CPH G;  1B5Q A;  1CHU A;  3ATQ A;  1GRH A;  4NEV A;  5JCK A;  2YR6 A;  3KD9 A;  3T2K A;  1H81 A;  3SYI A;  4B63 A;  1KNR A;  1D5T A;  2E4G A;  4FX9 A;  4LA1 A;  3AEB A;  1TDK A;  5KVH A;  3NG7 X;  1H6V A;  1NDA A;  2C64 A;  1NHQ A;  2B9W A;  3UTH A;  1TDO A;  3T37 A;  5FS7 A;  4OPL A;  2YVG A;  2YLT A;  1LJ1 A;  2WPE A;  2WDV A;  4H4W A;  2ACZ A;  5EB4 A;  1F6M A;  1ZOV A;  4U2T A;  4A9W A;  1GXF A;  2V60 A;  3CMM A;  3RP6 A;  4B69 A;  4B67 A;  3CGB A;  4EQW A;  1ZOY A;  1GRF A;  1PJ7 A;  1QO8 A;  4EMW A;  4NNJ A;  2XFN A;  2BRY A;  3KLJ A;  2C3C A;  1L9C A;  4NTE A;  1D7L A;  1CJC A;  3AYL A;  3KPK A;  3II4 A;  4TLX A;  5KXJ A;  4ZCC A;  3C4N A;  2WP5 A;  3AE9 A;  3BHK A;  3LB8 A;  1IUU A;  1K0L A;  4IV9 A;  2V3B A;  3LZX A;  4U2L A;  5KMP A;  2GRT A;  3SFD A;  3ADA B;  3KKJ A;  2IID A;  4P9S A;  2YG6 A;  2XCG A;  1XAN A;  3NN0 X;  5J7X A;  2VRL A;  4J33 A;  1DJN A;  1O95 A;  2R46 A;  4JY2 A;  1GES A;  4OPC A;  1BF3 A;  4K8D A;  4XXG A;  3RP8 A;  2B7R A;  1GRE A;  1OJT A;  1N4W A;  2YWL A;  1PBE A;  1GTH A;  2V61 A;  1RSG A;  2Q0L A;  2V5Z A;  1S3E A;  3S61 A;  3VR9 A;  2GMJ A;  2GH5 A;  2XFQ A;  2ZBW A;  1B8S A;  3B6D A;  4II2 A;  3SQP A;  1O5W A;  2BAC A;  4U2S A;  4H7U A;  2GR2 A;  4X9M A;  2WOI A;  2IVD A;  2IVE A;  5FS9 A;  1IJH A;  3F8D A;  3NIX A;  3G5R A;  2XLU A;  3ALL A;  3KVE A;  2R0P A;  5EOW A;  3V3N A;  2X8G A;  4BK2 A;  3S5W A;  1S2Y A;  4B66 A;  3M0O A;  1TYP A;  3P4Q A;  3AB1 A;  3ZYX A;  2BK4 A;  4EIQ A;  3ATR A;  2WET A;  3SZ0 A;  3H8L A;  2VZ2 A;  3NTD A;  4DSH A;  1FEA A;  1ZKQ A;  3CGD A;  1N1P A;  4Z24 A;  3UOY A;  3DK9 A;  2Z5Y A;  2PYX A;  1GAL A;  2XVF A;  1NEN A;  3P9U A;  1N4V A;  3GD4 A;  3P4P A;  2JKC A;  3DK4 A;  4PAB A;  1GTE A;  4C77 A;  4B1B A;  1KSU A;  2WHD A;  5HHF A;  5KVI A;  5FMH A;  1PN0 A;  2C65 A;  1H86 A;  2BC1 A;  1EL5 A;  2A87 A;  4CCQ A;  3QSS A;  1B4V A;  4EM4 A;  3EPT A;  3D9X A;  3COX A;  3HZL A;  3UTF A;  2BA9 A;  3AEA A;  1CJ4 A;  1PDH A;  2ZZB A;  3ICT A;  1TRB A;  3QJ4 A;  4J36 A;  3FPZ A;  3AE1 A;  4DGK A;  1FEC A;  3HYW A;  3GRS A;  3KPF A;  4IVM B;  5JCN A;  4REK A;  2BRA A;  3F8R A;  4O5Q A;  1E1N A;  4YT0 A;  5KOX A;  2YVJ A;  1GT8 A;  2CUL A;  4Z43 A;  4IVO B;  1NG4 A;  4D03 A;  3AD7 B;  2XVJ A;  2WU5 A;  3PO7 A;  3SXI A;  1GPE A;  4H4V A;  1COY A;  1CC4 A;  3AEG A;  5KWF A;  4A99 A;  2BS4 A;  2WU2 A;  2XVI A;  3VQR A;  3K30 A;  4HA6 A;  3EF6 A;  3AED A;  4G6H A;  4RG4 A;  1GV4 A;  3P4R A;  4G73 A;  4GDE A;  4A6N B;  3UKK A;  3L5O A;  1H2I A;  2YG3 A;  3FMW A;  4H2Q A;  1XPQ A;  1D7Y A;  4LU6 A;  3AEC A;  4YKG A;  1GRG A;  3GRT A;  1CL0 A;  1EL8 A;  1FOH A;  2YVF A;  3AD9 B;  1NHR A;  3EAN A;  4M52 A;  2C67 A;  2XLR A;  2XLS A;  4UDP A;  1BKW A;  2FBW A;  3R9U A;  5BUK A;  3UP4 A;  2E5V A;  2R4E A;  1JRY A;  3NH3 X;  1YKJ A;  2ZZ0 A;  3SGL A;  2APG A;  1K4Q A;  2BS2 A;  2YM2 A;  4GUV A;  4AP3 A;  4H4S A;  4OVI A;  1E1K A;  2VQB A;  4H4T A;  3CNT A;  1FL2 A;  3UKA A;  2BYB A;  2C75 A;  1PBC A;  3SX6 A;  1H83 A;  2GR0 A;  4PAA A;  4YSZ A;  2JB1 A;  3H4K A;  2YR4 A;  3IHG A;  1ZK7 A;  4C3Y A;  1ZY8 A;  2BXR A;  2ARD A;  2QCU A;  3AE3 A;  3FIM B;  3BI5 A;  4APN A;  4CY8 A;  1BGJ A;  3T2Y A;  2XFP A;  4OCG A;  2WBA A;  2HQM A;  3EAO A;  2C76 A;  1GRT A;  1Y56 B;  1O94 A;  3AWI A;  2YG4 A;  3ISH A;  2BC0 A;  3CGC A;  1KSS A;  3GYI A;  4JNA A;  3SZC A;  1B37 A;  3SZF A;  4U8K A;  1PBD A;  3DGH A;  3RHA A;  4YTP A;  1V59 A;  1NAA A;  4NZH A;  1NHP A;  1F8S A;  1PHH A;  3PS9 A;  2VVL G;  2FJD A;  2X99 A;  2BCG G;  4USQ A;  3H8I A;  4WCT A;  4EMJ A;  4C3X A;  1GRA A;  2B9Y A;  4BK1 A;  1E7P A;  2R9Z A;  1S3B A;  1E1M A;  1H84 A;  3PG6 A;  4OPD A;  3AYJ A;  2R4J A;  2C7G A;  3SZW A;  4YSY A;  3AE6 A;  5HXI A;  3UOX A;  1MO9 A;  1S2Q A;  3F8P A;  4Z44 A;  4NTD A;  2GQW A;  4H50 A;  2H89 A;  4Y4N A;  4E0V A;  3NNE A;  4H4R A;  3NK2 X;  4G74 A;  3FBS A;  1GET A;  4H4U A;  3AEE A;  4B65 A;  5EB5 A;  3T31 A;  4Y4L A;  3V76 A;  1NEK A;  2OA1 A;  4Z25 A;  3BI4 A;  3DGZ A;  5C2T A;  4IA5 A;  1GRB A;  1AOG A;  1YQ4 A;  2X8H A;  5KRQ A;  3QFB A;  2XFU A;  5JCL A;  4HB9 A;  4BJZ A;  1SEZ A;  4K2X A;  1L0V A;  2BCP A;  3ICS A;  3UKP A;  3V3O A;  2TPR A;  3WE0 A;  3ABV A;  4ZN0 A;  2GVC A;  4FK1 C;  3VRD B;  5ER0 A;  1BWC A;  3CPJ G;  3GDN A;  3CPI G;  2JB2 A;  4U8O A;  4K22 A;  2WEU A;  1KDG A;  3GDP A;  1E39 A;  1Q1W A;  2B76 A;  1TDF A;  2XLP A;  2J3N A;  3FG2 P;  4C5O A;  2BXS A;  1CC2 A;  3K7T A;  4BJY A;  1D4C A;  2O9Z A;  4B68 A;  3AE7 A;  5BVA A;  3OC4 A;  5DBJ A;  1VDC A;  5KMS A;  2X50 A;  2XFO A;  2AQJ A;  2EQ6 A;  4KPR A;  1DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...