1NHSA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 137
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhsA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA02
2GR1A 2YR4A 3CPHG 2WP6A 2APGA 4C74A 4K8DA 3KVEA 3M12A 3AECA 3BNUA 2XLSA 3DGHA 3NN6X 4YTMA 1LQTA 2V6OA 4U8PA 3V76A 1K0IA 5KRQA 4FK1A 2CVJA 2XLTA 5ER0A 2XFUA 2GR2A 4K2XA 1L9EA 4TLXA 4ZCCA 4ECHA 4UDPA 2BK4A 4GDEA 2WP9A 3DK9A 3RHAA 4H4UA 3NTDA 4XWZA 2FJDA 4NTDA 2CFYA 1P2HA 3H8IA 3CNJA 1GOSA 3ICTA 4YTNA 1ZK7A 2WESA 3V3NA 1D4EA 2BC0A 2Y6RA 3AD7B 5BVAA 3LXDA 3SQPA 4CCQA 2BXSA 1H84A 4U2TA 2IVEA 1DXLA 3AYLA 2OLOA 3QSEA 2WU2A 2BS3A 3UTEA 3RNMA 1RYIA 2PHHA 1DOEA 2WBAA 5HXIA 1XANA 4U8LA 2C66A 3NK2X 3II4A 1CC4A 1ELIA 4PABA 1EBDA 2XLUA 3OZ2A 4MJWA 4KPRA 2C67A 4YXDA 2OA1A 4AP3A 4N9XA 4YT0A 2XDOA 4C3YA 3UTFA 5BUKA 1XPQA 4EQRA 3JSKA 3QVPA 4NTCA 5CKUA 5M0ZA 4ZCDA 5KOWA 2GR0A 2Q0KA 2B9XA 3GD4A 2JB2A 3QJ4A 4EMWA 1GNDA 2A87A 2C75A 3P4QA 4DSHA 3L8KA 1DJNA 2YG7A 1KNRA 1E7PA 4YSYA 3R9UA 3DMEA 1BZLA 4YKFA 3LADA 2YWLA 3KD9A 3BI2A 4B63A 1NG4A 3IWAA 2GV8A 1GETA 4B69A 3IF9A 2QCUA 3GDNA 3GSIA 1ZDLA 2C65A 3KKJA 1PBDA 4NEWA 3UOZA 2FJEA 2WDVA 1E39A 3P4SA 4CY8A 1H7WA 1GRBA 4J34A 4A6NB 4AT0A 2YLSA 1H7XA 4AOSA 1H83A 2YLZA 1Q9IA 1OJ9A 2AR8A 1IUXA 2H88A 3VR8A 3UCLA 1YQ3A 1L9DA 2JK6A 1D4CA 2WETA 1IUVA 1NG3A 3CIRA 4CRTA 1CL0A 1HYUA 4O5QA 2C73A 2V3BA 2BXRA 4Z2RA 3PS9A 1EL8A 3NHOX 4UP3A 1D5TA 2X8GA 4O5UA 2EQ8A 2WQYA 2XLRA 1NENA 2OAMA 4J57A 4APNA 1L0VA 3DJEA 3Q9TA 2Q6UA 5HY5A 4H4WA 2ZBWA 1GV4A 2YG5A 2WDRA 3ALLA 5U63A 4DGKA 3T37A 1JU2A 3UKPA 4YSZA 1SEZA 2F5ZA 2QAEA 2C7GA 3ITJA 3EANA 2BK3A 2YG3A 2R0PA 2BC1A 3UKAA 3AB1A 2A8XA 4Z43A 1M6IA 1QLBA 3BNMA 5BULA 2WOIA 1H82A 2CDUA 5TR3A 4K5SA 3NIXA 1X31B 3AEBA 1UKVG 5FS8A 3CNPA 3EAOA 4Z44A 4EQXA 3G5RA 3NKSA 2Z5YA 4A9WA 3F8DA 2BABA 2GEWA 4H2RA 3ADAB 3QVRA 3NT6A 2JKCA 3SFDA 4GR1A 2WHDA 2YAUA 3CPIG 4Z24A 4FX9A 5JCLA 3FG2P 2VZ2A 4GDPA 5CQFA 3UKLA 1H6VA 1ZX9A 2BCPA 2YLXA 3DK4A 3VRAA 2XVFA 3GDPA 4GUVA 4H2PA 4I59A 5EB5A 5U25A 2I0ZA 1NAAA 4H2QA 3NGCX 3RP6A 1IJHA 1GRHA 3SFEA 4Z26A 1PJ7A 1DJQA 4H4RA 3NTAA 3CPJG 3H8LA 1Y56B 4YSHA 1P2EA 2C76A 1ZOVA 4USQA 3GWDA 4EMIA 1V59A 2NVKX 3CGBA 4H4YA 2WPEA 2XFQA 3UKFA 4H4SA 1PN0A 2GAGB 3UTHA 3UOVA 3LB8A 4NEVA 4Z2UA 3BI5A 2EQ9A 1PBBA 3K7TA 2V5ZA 1FCDA 4GCMA 1GTHA 1LQUA 1YKJA 1TDEA 5DBJA 1MXTA 4U8KA 5C3JA 1QJDA 2QA2A 3RP8A 3D1CA 3AD9B 1N4UA 3FBSA 1OJTA 3G5QA 4OCGA 2VVLA 3UP5A 4YKGA 1GREA 2BACA 1FL2A 3KA7A 2RGHA 2XYOA 3ATRA 1O95A 4TM0A 2WOVA 1JRYA 2YQUA 1NHQA 2WDQA 3QFBA 3GYIA 4OPIA 5GRTA 3VR9A 1K0JA 5HHFA 3ISHA 4Y4MA 2JBVA 4BK3A 1F8SA 4X9NA 3UKHA 1REOA 1IUTA 5C2TA 1S2QA 2C64A 1GRGA 2ZZCA 3CGDA 4EM4A 2YLWA 3P4RA 4WCTA 4J56A 4ADWA 1DNCA 2GQFA 2YG6A 2R9ZA 4YTPA 2XFOA 3AD8B 5J7XA 3M13A 4D04A 4YSXA 2YR6A 2X99A 1S3BA 2X3NA 4REKA 1GRFA 3URHA 2GVCA 4B1BA 4B65A 1CJ4A 4BK1A 1PDHA 4OPTA 2IIDA 1F8RA 4JQ9A 2WS3A 1TRBA 3ATQA 3ICSA 4EM3A 5IPYA 2YVJA 3M0OA 4XWRA 4Y4NA 2R46A 1YQZA 3AE2A 4U2LA 5JCNA 1NDAA 3B6DA 1GTEA 3GWFA 1ZOYA 4JDRA 4UDQA 1LV0A 2HQMA 1E1MA 2AAQA 1H86A 1BF3A 2X8HA 1CJCA 2R0CA 3AYIA 4JY2A 1D4DA 2PYXA 4IVOB 2DKIA 4C77A 1KSSA 2R45A 2A89A 2BK5A 2V61A 1D7LA 4Z25A 5KXJA 2CULA 3ALMA 4IV9A 1JRZA 2Q0LA 3ZYXA 5JCKA 3AE5A 1TYPA 4U8MA 4CBQA 1B37A 2XVJA 1Y56A 4X9MA 1ZMDA 1TDNA 3NLCA 1CBOA 1XDIA 2RGJA 1YQ4A 3F8PA 5IQ4A 2B9WA 3QFAA 3AE4A 2XVIA 4IA5A 4HA6A 4CNKA 2YLTA 4D03A 2YVFA 2WP5A 4CCRA 1COYA 2DKHA 3CGCA 2O9ZA 3BHKA 4K5RA 4H2NA 2GQWA 2NPXA 4A5LA 2VOUA 1M64A 3F8RA 3K7MX 1PXBA 1L9CA 3PVCA 5IQ1A 3OC4A 1IUSA 1N1PA 4J36A 4BK2A 3REDA 1MOKA 1FEBA 4CY6A 4K22A 1OJDA 1PHHA 5L46A 1JOAA 1RSGA 2B7SA 4TM4A 3IC9A 3DA1A 3GMCA 3AYJA 3NK1X 3UTGA 1KFYA 4EMJA 3DGZA 2GMJA 3AEGA 2C3CA 5JCIA 4KX6A 2RGOA 2C3DA 1VG9A 3CN8A 5FS9A 2WEUA 4I58A 4LIIA 2C72A 3NH3X 1PXCA 4OVIA 1B5QA 1F8WA 4H4TA 4U8NA 1Z6LA 3PO7A 2WPCA 1ZKQA 2GAHB 4Z2TA 3DJGX 4BURA 1Y0PA 4A79A 4YWOA 1ZP0A 4EQWA 2BCGG 3VRBA 3ALJA 3C4NA 2AQJA 3LZWA 2ZZ0A 4ZN0A 2XVHA 1O94A 2Y6QA 2R4JA 2YLRA 3NN0X 3I6DA 4JY3A 4A65A 3UKQA 4A99A 1NEKA 4M52A 1RP0A 1PXAA 3ICRA 4U2SA 4U8JA 4K7ZA 1VDCA 1VRQB 3CTYA 1EL5A 4EIPA 3AE6A 4CNJA 1S2YA 2RABA 1TDOA 4RG4A 5KVIA 2QA1A 4JNQA 4JNAA 2GF3A 1NHSA 3DJJA 2XCGA 4TM1A 4AT2A 1JNRA 4H4PA 5U1OA 4GRTA 3UP4A 1JRXA 2C70A 1FECA 3FPZA 2IVDA 1LJ1A 4DNAA 3LZXA 3AEAA 1TDFA 3LJPA 1MO9A 3AEFA 3CGEA 1Q1WA 1XHCA 3AWIA 3NRNA 4C3XA 2Z5XA 2B9YA 3LOVA 4TLZA 3COXA 1ZMCA 1DOCA 1PJ6A 3KU9A 3FIMB 3AEEA 4U8IA 1QO8A 3GYJA 3NK0X 1NHRA 2GB0A 1E6EA 1PJ5A 2ACZA 3AEDA 5GSNA 4H7UA 3K30A 3AXBA 3DJDA 2ZZBA 4J2WA 1DOBA 2FJAA 3ABVA 1PBEA 1GALA 2XVEA 3K7QX 1F3PA 1S3EA 4RG3A 4BJYA 3NNEA 2VVLG 4OPUA 5KWFA 4FDCB 3AE8A 3Q6JA 2FBWA 3S61A 1TYTA 1PBCA 4UDRA 5M10A 1DODA 2XFPA 3QSSA 2X50A 1GRAA 4H4ZA 1N4WA 2YR5A 3UOXA 2BS2A 1K0LA 2EQ6A 1EL9A 4H4XA 1CHUA 3B3RA 3IHGA 3BHFA 5J60A 2VRLA 4U8OA 3NYEA 2JB3A 3KLJA 4J31A 3RP7A 2BS4A 3CNDA 3NYCA 1F6MA 1YY5A 2BA9A 2JB1A 4OPLA 3ZDNA 1OJAA 1ZY8A 2OALA 3GD3A 1TDKA 3CNSA 3NYFA 4ICYA 2YM1A 4EIQA 4TM3A 3UOYA 1Q1RA 2YG4A 3KPFA 1FOHA 2VRMA 3CNTA 1N4VA 2R4EA 3SGLA 3C96A 4B64A 5EB4A 1PS9A 4BV6A 3AE7A 2E1MA 1IUUA 3GRSA 4GF7A 4RSLA 3V3OA 4AOXA 4BJZA 2WOWA 4E0VA 1OJCA 3EF6A 3GMBA 4H50A 4P9SA 2VQBA 4HB9A 2W0HA 3O0HA 1ONFA 3HZLA 4IVMB 1O5WA 3D8XA 1W4XA 2ARDA 2GMHA 2GRTA 2R0GA 4J33A 4LU6A 4B66A 1LVLA 3WE0A 1GEUA 3DH9A 2H89A 2YVGA 3EPTA 2JAEA 4JN9A 4USRA 3S5WA 1K4QA 3VRDB 5LV9A 4X4JA 1GXFA 2B7RA 1CJ2A 1VQWA 3P4PA 2YM2A 1KNPA 2E5VA 5FMHA 1H81A 1GESA 1KDGA 3G5SA 4NZHA 1JEHA 5BRTA 1LTXR 3E1TA 4H4VA 2V3AA 3NG7X 2B76A 4A7AA 1GSNA 2GR3A 1CC6A 4Y4LA 4C5OA 2J3NA 1NHPA 5JCMA 3SM8A 4DSGA 4B67A 2VVMA 2WPFA 4OPDA 5KOXA 2GH5A 1NPXA 1B8SA 1IUWA 1E1NA 1KSUA 1BGJA 3AE3A 3H4KA 1CF3A 3C4AA 4NTEA 4B68A 3P9UA 4PAAA 5EBKA 1GPEA 5KVHA 2WU5A 2X8CA 2EQ7A 5FS7A 1FEAA 2XLPA 2OLNA 1BGNA 1JNZA 2Q7VA 1CJ3A 2BYBA 1GRTA 1GT8A 3BI4A 2V60A 4WX1A 1D7YA 2E4GA 1E1KA 2FJBA 4XXGA 1GERA 5HYMA 5EOWA 1CC2A 4FK1C 3QSMA 1E1LA 1EL7A 2TPRA 2TMDA 3AE1A 3FMWA 2XFNA 4IA6A 4AP1A 3I3LA 3GRTA 4H4QA 1PBFA 4OPGA 4A6NA 3VQRA 5FS6A 3DK8A 1AOGA 1BKWA 3IHMA 3P1WA 1BWCA 3L1RA 3AE9A 4EQSA 1KF6A 3UKKA 1LPFA 1VG0A 1B4VA 2VQ7A 4LA1A 2UZZA 4OPCA
chains in the Genus database with same CATH superfamily
2GR1A 3CPHG 2GGJA 4K8DA 3M12A 2XLSA 3JVAA 3DGHA 1LQTA 3V76A 4FK1A 4K2XA 3D47A 3DG6A 3RHAA 4NTDA 2CFYA 1P2HA 3TQPA 4HPNA 3H8IA 5BVAA 3AD7B 3LXDA 3AYLA 2OLOA 5EU9A 2WBAA 3SJNA 1JCTA 4U8LA 3NK2X 3ETRB 3TW9A 2OA1A 4N9XA 3T31A 3UTFA 5BUKA 3H70A 4EQRA 5M0ZA 4ZCDA 2Q0KA 3U4FA 4EMWA 1GNDA 2YG7A 3KD9A 1WYGA 5IDZA 3IWAA 3N6HA 3IF9A 2XH7A 3KKJA 3UOZA 2FJEA 4GIRA 4AT0A 1EC9A 3VDGA 4F4RA 1YQ3A 3AMZA 3MUCA 3PS9A 1EL8A 4EWJA 3TWBA 3NHOX 3T6CA 4UP3A 4KT2A 2PS2A 2XLRA 4APNA 1ECQA 3QLDA 1GV4A 4A6GA 2WDRA 2YG5A 3ZLHA 2BRAA 3STPA 3ITJA 1PDZA 3EANA 2BC1A 2PU0A 4Z43A 3I4KA 1X2HA 1NU5A 3CNPA 3EAOA 1TE6A 2Z5YA 2JKCA 3SXIA 1EC7A 4Z24A 4GDPA 3FG2P 1ZX9A 4ZA0A 2BCPA 3VRAA 4I59A 1NAAA 4IL2A 1IJHA 3SFEA 3CPJG 4G73A 3DG3A 3B97A 3KPKA 2WPEA 3UOVA 2V5ZA 1GTHA 2HXTA 3S5SA 3R11A 3RP8A 3D1CA 2GGGA 2VVLA 2W55A 3V3WA 2RGHA 1JRYA 1NHQA 3Q4DA 1XPYA 4K8GA 4Y4MA 1REOA 1S2QA 4WCTA 4J56A 2GQFA 5KMQA 3M13A 3GY1A 1GRFA 4BK1A 3SN4A 2YVJA 4XWRA 4E4UA 3T2YA 3B6DA 3PFRA 3FVDA 4UDQA 2HZGA 2HQMA 2R0CA 4IVOB 2DKIA 1KSSA 2A89A 1D7LA 3ALMA 2Q0LA 3AE5A 4U8MA 3DERA 3HW2A 1B37A 2XVJA 1Y56A 4MKSA 3RITA 2RGJA 5FJOA 1YQ4A 2XVIA 4D03A 3BHKA 4K5RA 4H2NA 7ENLA 4A5LA 3F8RA 4M6UA 3PVCA 5IQ1A 3D46A 3SY4A 1JOAA 1RSGA 4TM4A 4EMJA 2GMJA 2C3CA 5JCIA 5FS9A 4IP5A 3TJIA 3FXGA 2GGIA 1Z6LA 1Y0PA 1KN0A 4ZOHB 2ZZ0A 4ZN0A 2R4JA 3UKQA 1RP0A 4EIPA 3AE6A 5KVIA 2QA1A 4JNQA 1NHSA 4TM1A 3FJ4A 3SZWA 1JRXA 1LJ1A 3LZXA 2QDDA 3EUB3 1MO9A 3AEFA 3AN1A 4C3XA 3V4BA 4GMEA 1DOCA 2PODA 3KU9A 3FIMB 2PGEA 3AEEA 4DWDA 3IJLA 1QO8A 3GYJA 3NK0X 5GSNA 3AXBA 3V5CA 2XVEA 1F3PA 1S3EA 4G74A 4OPUA 5KWFA 3NO1A 4UDRA 3OZMA 5FJRA 5M10A 4HYRA 2YR5A 3UOXA 2BS2A 1K0LA 2EQ6A 2E5AA 4H4XA 3IHGA 3ZLFA 4U8OA 2JB3A 4J31A 3NXLA 1F6MA 3NRZB 2YM1A 3UJEA 2VRMA 1N4VA 2GGHA 5G5HB 4B64A 1PS9A 4BV6A 3JZUA 3GRSA 5FJTA 4RSLA 1H2IA 3V3OA 3O0HA 1N62C 4HCHA 4IVMB 3FYYA 3WE0A 1GEUA 2H89A 3EPTA 5LV9A 2DW7A 1JPMA 2PTXA 1GXFA 3P4PA 2E5VA 5FMHA 3E1TA 4H4VA 1GSNA 4Y4LA 4OPDA 2OZ3A 2GH5A 3OP2A 1B8SA 1E1NA 1BGJA 3H4KA 2QGYA 5KVHA 2XLPA 1JNZA 4WX1A 5BOFA 5EOWA 1EL7A 4IL0A 1BKWA 3AE9A 2ONEA 1VG0A 4LA1A 3DFHA 2WP6A 3KVEA 3PG6A 4YTMA 5JRBA 2GR2A 4ECHA 2BK4A 3CK5A 5ENLA 2DW6A 4XWZA 3OZYA 2OQHA 3N6JA 3ICTA 1D4EA 2BXSA 4HN8A 2BS3A 2OX4A 1RYIA 4KEMA 1CC4A 3JW7A 2XLUA 3OZ2A 4KPRA 2C67A 4AP3A 2XDOA 3DIPA 4NTCA 2AL2B 2B9XA 3QJ4A 3U9IA 4DSHA 2P3ZA 1MRAA 1E7PA 3R9UA 4YKFA 3LADA 2OLAA 4B63A 1NG4A 3SZFA 2GV8A 1N61C 3GSIA 4J1OA 3P4SA 4CY8A 1GRBA 4A6NB 3T2ZA 1OJ9A 2AR8A 2H88A 1IUVA 1NG3A 4CRTA 1CL0A 4O5QA 4Z2RA 1ELSA 4ROPA 1D5TA 2X8GA 4O5UA 2WQYA 1NENA 2OAMA 3QTPA 4J57A 5J04A 2Q6UA 4YSZA 3UXLA 1SEZA 4JN7A 2QAEA 2BK3A 2YG3A 2R0PA 1H82A 3NIXA 5FS8A 3BSMA 4G7FA 1NELA 1FHVA 4H2RA 4GR1A 1P48A 4FX9A 5JCLA 5CQFA 3UKLA 2XVFA 2I0ZA 4H2QA 3NTAA 1Y56B 1P2EA 3A7AA 3OTRA 2NVKX 3CGBA 3I6EA 2XFQA 3UKFA 1VQZA 1PN0A 3T14A 4II2A 4NEVA 3BI5A 1PBBA 3MSYA 3K7TA 1FCDA 4NWZA 2QQ6A 1LQUA 1TDEA 1MXTA 4U8KA 1QJDA 2QA2A 2OQYA 3FBSA 1OJTA 2BACA 3TOYA 3KA7A 4GAPA 3ATRA 1O95A 2P8BA 3ISHA 4FI4A 3UKHA 1IUTA 4IT1A 5C2TA 3CGDA 4EM4A 3P4RA 1DNCA 4IP4A 4D04A 4YSXA 2X3NA 4B65A 3URHA 4JN8A 4OPTA 1F8RA 3ATQA 4Y4NA 1YQZA 1ZOYA 1LV0A 2AAQA 2X8HA 3SN0A 4C77A 1VDVA 2R45A 2V61A 4Z25A 5KXJA 4GGBA 3R07C 1JRZA 5JCKA 1MUCA 4CBQA 2GL5A 3SZ0A 3CAWA 4X9MA 2OVLA 3NLCA 5KMRA 1XDIA 4DXKA 4IA5A 4CNKA 3R0KA 2YLTA 2WP5A 4CCRA 1COYA 2O9ZA 3CGCA 2VOUA 1M64A 1PXBA 4BK2A 3OC4A 1N1PA 3RCYA 1MOKA 3A7RA 1FFVC 1OJDA 5L46A 3DA1A 3AYJA 3UTGA 3AEGA 2RGOA 4DYEA 2C3DA 1ZXIC 1VG9A 3CN8A 3P3BA 4I58A 4LIIA 1B5QA 1F8WA 4DX3A 4H4TA 3CB3A 4YWOA 3VRBA 3ALJA 3C4NA 2YLRA 2Y6QA 1TZZA 4A99A 3NN0X 1RM6B 3ICRA 1DTNA 2FYMA 4U8JA 1X2GA 3CTYA 4KWSA 4RG4A 2GF3A 3SBFA 4II3A 2C70A 4IHCA 1TDFA 3CGEA 3ZVIA 2Z5XA 3LOVA 3COXA 1PJ6A 3RRAA 1V97A 1E6EA 2PTWA 3IJIA 3ZVHA 4GYPA 3DJDA 2ZZBA 1DOBA 2FJAA 1YEYA 1PBEA 1GALA 3ABVA 4BJYA 2VVLG 3Q6JA 3QSSA 4H4ZA 3B3RA 5J60A 1N63C 2VRLA 4K1WA 3CNDA 1YY5A 2BA9A 1OJAA 3CNSA 3H7VA 4TM3A 3KPFA 2YG4A 3CNTA 3SGLA 5EB4A 1IUUA 3PK7A 4E0VA 3GMBA 3R25A 2QVHA 3N4EA 2GMHA 3CXBA 2R0GA 3MQTA 1LVLA 4ENLA 1WUEA 4USRA 4JN9A 3VRDB 3B9JB 1KCZA 2B7RA 2OZ8A 4TVYA 1R0MA 1H81A 3G5SA 4NZHA 1JEHA 1LTXR 2V3AA 3BJSA 4H83A 5G5GB 3TCSA 1CF3A 4B68A 3P9UA 5FS7A 1FEAA 2OLNA 1BGNA 4GAVA 2BYBA 1GRTA 1GT8A 3BI4A 3KUMA 1CC2A 4FK1C 3QSMA 1E1LA 2TMDA 3SYIA 1EC8A 4IA6A 3NVVB 3GRTA 5FS6A 3VCCA 3IHMA 3L1RA 3UCCA 3ZLGA 2XSXA 3VCNA 2YR4A 2APGA 4A35A 2AL2A 4Z1YA 3AECA 3BNUA 1N60C 2V6OA 4U8PA 1K0IA 5KRQA 2CVJA 1L9EA 4ZCCA 4UDPA 4GDEA 4H4UA 4NNJA 2FJDA 2E3TA 2XH2A 1L8PA 3SZCA 3V3NA 3IJQA 2Y6RA 4U2TA 2IVEA 1DXLA 5KMPA 3QSEA 3CT2A 2WU2A 3UTEA 1DOEA 3II4A 1EBDA 2C4CA 3FV9A 4YT0A 3JSKA 5CKUA 5KOWA 2GR0A 4YWSA 2JB2A 1MDRA 2A87A 3L8KA 4G6HA 1KNRA 4YSYA 3DMEA 1BZLA 3UJFA 3GDNA 2C65A 1PBDA 1E39A 2ZADA 1H7WA 4J34A 2FKPA 2YLSA 1H7XA 1H83A 1SJDA 3VR8A 3UCLA 3TWAA 1L9DA 1D4CA 2WETA 1HYUA 2C73A 2V3BA 2OKTA 3SR6B 3VC5A 3TJ4A 2EQ8A 4HNCA 1L0VA 3Q9TA 2AL1A 4H4WA 1JROA 1R6WA 1KKRA 1JU2A 3K1GA 2PMQA 3UKAA 3BNMA 2CDUA 3UXKA 1X31B 3AEBA 1N5WC 3CXOA 4Z44A 3G5RA 3NKSA 3F8DA 2GEWA 3NT6A 3CPIG 1FFUC 2VZ2A 3DK4A 4H2PA 3GDPA 4GUVA 5EB5A 1S7MA 5U25A 3OPSA 3NGCX 3RP6A 1GRHA 4Z26A 1PJ7A 3H8LA 4YSHA 1MNSA 5FJUA 1ZOVA 3GWDA 4EMIA 1V59A 3T9PA 3UGVA 1JPDX 3LB8A 1STZA 2EQ9A 3T8QA 4GCMA 1YKJA 2OO6A 3AD9B 3G5QA 3HYXA 2CHRA 1GREA 1FL2A 3CYJA 4TM0A 2YQUA 2GSHA 3QFBA 3GYIA 3VR9A 2PCEA 5HHFA 4BK3A 1W6TA 2C64A 2ZZCA 3BOXA 2PP1A 2YG6A 4YTPA 1OEPA 2YR6A 3QPEA 4REKA 4B1BA 2GVCA 1CJ4A 1PDHA 3FCPA 2IIDA 4JQ9A 2WS3A 1TRBA 2QJNA 3ICSA 5IPYA 4KPLA 3AE2A 4U2LA 5JCNA 1NDAA 3GWFA 3MWCA 4JY2A 1E1MA 1H86A 3A7UA 3DG7A 2BK5A 2CULA 1TYPA 4E6MA 1PDYA 2I5QA 1TDNA 1IYXA 3F8PA 3P0WA 2B9WA 2W54A 2GQWA 2NPXA 3K7MX 1SJAA 4GISA 1IUSA 3REDA 1FEBA 1EBGA 3GYXA 1PHHA 3NVWB 4H1ZA 3IC9A 3GMCA 3NK1X 1KFYA 2P88A 3DEQA 2WEUA 4MGGA 3NH3X 4M0XA 4OVIA 4U8NA 3GO2A 2WPCA 4Z2TA 3DJGX 4BURA 2PGWA 3L5OA 4A79A 4EQWA 2AQJA 2AKMA 4A65A 1O94A 4JY3A 1NEKA 1S2YA 4AT2A 2XCGA 1JNRA 4H4PA 2AKZA 3I6TA 3UP4A 1FECA 3FPZA 3N4FA 1Q1WA 3NRNA 2B9YA 3CMMA 4U8IA 1PJ5A 3K30A 4E5TA 3R10A 3NNEA 3EKGA 2FBWA 2XGZA 2X50A 1GRAA 1EL9A 4HNLA 3BHFA 3RP7A 2BS4A 3NYCA 2JB1A 4OPLA 4A3RA 3ZDNA 2OALA 2PU1A 3GD3A 1TDKA 3NYFA 4ICYA 4EIQA 3UOYA 1Q1RA 3R0UA 4GF7A 4BJZA 2WOWA 1OJCA 3EF6A 2W0HA 1SJBA 1ONFA 3D8XA 2ARDA 2GRTA 4B66A 4J33A 4LU6A 3T0KA 3DH9A 2YVGA 2JAEA 3S5WA 1F9CA 4X4JA 3NZGA 1SB3B 2YM2A 4J3ZA 1KNPA 4G9KA 5BRTA 4A7AA 2GR3A 1CC6A 4X2PA 5JCMA 1NHPA 1JDFA 3SM8A 4DSGA 2PPGA 2VVMA 5KOXA 1NPXA 4JHMA 1IUWA 4K2SA 3C4AA 4NTEA 3UJRA 5EBKA 1GPEA 2WU5A 1BQGA 5FJPA 2V60A 1D7YA 2E4GA 5HYMA 4AP1A 2TPRA 3FMWA 2XFNA 1PBFA 3P1WA 4EQSA 3NS1B 1KF6A 3UKKA 1LPFA 1B4VA 2VQ7A 2W3SA 4C74A 3NN6X 2O56A 2XLTA 5ER0A 2XFUA 2PP0A 4TLXA 2WP9A 3DK9A 3DDMA 3NTDA 5KMSA 3CNJA 1GOSA 4YTNA 1ZK7A 2WESA 2BC0A 3SQPA 4CCQA 1JRPA 1H84A 3RNMA 2PHHA 5HXIA 1XANA 2GDQA 3ES8A 2C66A 1ELIA 4PABA 4MJWA 3VA8A 1FIQB 4YXDA 4C3YA 1XPQA 3QVPA 3GD4A 3P4QA 2C75A 1DJNA 1T3QC 2YWLA 4IZGA 3BI2A 3ENLA 1GETA 3UJSA 4B69A 2QCUA 3T4WA 1ZDLA 4NEWA 2WDVA 2HNEA 3DFYA 3OW1A 1FO4A 4G8TA 3HRDC 1WUFA 4AOSA 2YLZA 1Q9IA 1IUXA 3V5FA 2JK6A 2OG9A 3CIRA 2PA6A 1RVKA 2BXRA 4GYPC 4DHGA 3DJEA 4E8GA 5HY5A 4TVWA 2ZBWA 3ALLA 3IK4A 5U63A 4DGKA 3T37A 4H19A 3UKPA 2F5ZA 2C7GA 3RR1A 3VC6A 3AB1A 2A8XA 1M6IA 3GD6A 1QLBA 5BULA 2WOIA 4K5SA 5TR3A 1UKVG 2W3RA 3GC2A 4EQXA 2GGEA 3NVYB 4A9WA 2BABA 1SJCA 2QJMA 4HCDA 3ADAB 3QVRA 3SFDA 2WHDA 2YAUA 1H6VA 2YLXA 3RO6A 1DJQA 4H4RA 4GFIA 2C76A 4USQA 3SQSA 4H4YA 4H4SA 1EBHA 1P43A 2GAGB 3UTHA 2QJJA 4Z2UA 3T2KA 3MKCA 5DBJA 5C3JA 1KD0A 3ZVHB 1N4UA 4OCGA 3MZNA 3UP5A 4YKGA 4H2HA 1BKHA 2XYOA 2WOVA 2WDQA 4OPIA 5GRTA 1K0JA 3HYVA 1MDLA 2JBVA 1F8SA 4X9NA 1GRGA 2YLWA 4ADWA 2R9ZA 2XFOA 3AD8B 5J7XA 2X99A 1S3BA 3HYWA 1E9IA 3ES7A 4EM3A 3M0OA 2R46A 2BRYA 1GTEA 1N5XA 4JDRA 1BF3A 3HPFA 3AYIA 1CJCA 4HCLA 3R1ZA 1XS2A 1D4DA 2PYXA 4IV9A 3ZYXA 3UCDA 2XH4A 1ZMDA 3Q45A 1CBOA 3RGTA 5BOEA 4Z17A 5IQ4A 3QFAA 3AE4A 4HA6A 2YVFA 3NFUA 2DKHA 1TKKA 1L9CA 4J36A 4CY6A 3QN3A 4K22A 2PTYA 2B7SA 3DGZA 4KX6A 4MMWA 3NVZB 2C72A 1PXCA 3PO7A 1ZKQA 2GAHB 1KKOA 5KNLA 1ZP0A 2BCGG 6ENLA 3LZWA 3H8AA 2XVHA 3I6DA 3SSZA 3PWGA 2ZC8A 4M52A 1PXAA 4U2SA 2HXUA 4K7ZA 1VDCA 1VRQB 1ONEA 1EL5A 3DESA 4CNJA 2RABA 3THUA 1TDOA 3S47A 4JNAA 3DJJA 3D9XA 3SX6A 5U1OA 4GRTA 2IVDA 4DNAA 3AEAA 3LJPA 1XHCA 3AWIA 2PP3A 3SN1A 4TLZA 2PSNA 1ZMCA 2OZTA 2NQLA 1NHRA 2GB0A 3QKEA 2ACZA 3AEDA 2PTZA 4H7UA 2RDXA 4FP1A 4J2WA 3K7QX 4RG3A 4FDCB 3AE8A 3S61A 1TYTA 1PBCA 1DODA 2XFPA 1N4WA 4DN1A 2OPJA 1CHUA 3PWIA 3NYEA 3DGBA 3KLJA 2MNRA 1ZY8A 2QDEA 2MUCA 2OFJA 3UJ2A 1FOHA 2R4EA 3C96A 3VFCA 3AE7A 2E1MA 3TTEA 4AOXA 4P9SA 4H50A 2XH0A 2VQBA 4HB9A 3HZLA 4GGHA 1O5WA 2P8CA 4G6GA 4ZCWA 1W4XA 1K4QA 1CJ2A 1VQWA 3AM9A 1GESA 1KDGA 3NG7X 2B76A 2POZA 4C5OA 4E4FA 2J3NA 4B67A 2WPFA 3EEZA 2P0IA 3H12A 1KSUA 3P93A 3AE3A 4PAAA 2X8CA 2EQ7A 2Q7VA 1CJ3A 1E1KA 2FJBA 4XXGA 1GERA 3AE1A 3I3LA 4H4QA 4OPGA 4A6NA 3VQRA 3DK8A 1AOGA 1FHUA 1BWCA 3MY9A 2UZZA 4OPCA
chains in the Genus database with same CATH topology
2GR1A 2YR4A 3CPHG 2WP6A 2APGA 4C74A 4K8DA 3KVEA 3PG6A 3M12A 3AECA 3BNUA 2XLSA 3DGHA 3NN6X 4YTMA 1LQTA 2V6OA 4U8PA 3V76A 1K0IA 5KRQA 4FK1A 5JRBA 2CVJA 2XLTA 5ER0A 2XFUA 2GR2A 4K2XA 1L9EA 4TLXA 4ZCCA 4ECHA 4UDPA 2BK4A 4GDEA 2WP9A 3DK9A 3RHAA 4H4UA 3NTDA 4NNJA 2FJDA 4XWZA 4NTDA 5KMSA 2CFYA 1P2HA 3H8IA 3CNJA 1GOSA 3ICTA 3SZCA 4YTNA 1ZK7A 2WESA 3V3NA 1D4EA 2BC0A 2Y6RA 3AD7B 5BVAA 3LXDA 3SQPA 4CCQA 2BXSA 1H84A 4U2TA 2IVEA 1DXLA 3AYLA 2OLOA 5KMPA 3QSEA 2WU2A 2BS3A 3UTEA 3RNMA 1RYIA 2PHHA 1DOEA 2WBAA 5HXIA 1XANA 4U8LA 2C66A 3NK2X 3II4A 1CC4A 1ELIA 4PABA 1EBDA 2XLUA 2C4CA 3OZ2A 4MJWA 4KPRA 2C67A 4YXDA 2OA1A 4AP3A 4N9XA 4YT0A 2XDOA 4C3YA 3T31A 3UTFA 5BUKA 1XPQA 4EQRA 3JSKA 3QVPA 4NTCA 5CKUA 5M0ZA 4ZCDA 5KOWA 2GR0A 2Q0KA 2B9XA 3GD4A 2JB2A 3QJ4A 4EMWA 1GNDA 2A87A 2C75A 3P4QA 4DSHA 3L8KA 4G6HA 1DJNA 2YG7A 1KNRA 1E7PA 4YSYA 3R9UA 3DMEA 1BZLA 4YKFA 3LADA 2YWLA 3KD9A 3BI2A 4B63A 1NG4A 3IWAA 3SZFA 2GV8A 1GETA 4B69A 3IF9A 2QCUA 3GDNA 3GSIA 1ZDLA 2C65A 3KKJA 1PBDA 4NEWA 3UOZA 2FJEA 2WDVA 1E39A 3P4SA 4CY8A 1H7WA 1GRBA 4J34A 4A6NB 4AT0A 2YLSA 1H7XA 3T2ZA 1H83A 2YLZA 1Q9IA 4AOSA 1OJ9A 2AR8A 1IUXA 2H88A 3VR8A 3UCLA 1YQ3A 1L9DA 2JK6A 1D4CA 2WETA 1IUVA 1NG3A 3CIRA 4CRTA 1CL0A 1HYUA 4O5QA 2C73A 2V3BA 2BXRA 4Z2RA 3PS9A 1EL8A 3NHOX 4UP3A 1D5TA 2X8GA 4O5UA 2EQ8A 2WQYA 2XLRA 1NENA 2OAMA 4J57A 4APNA 1L0VA 3DJEA 3Q9TA 2Q6UA 5HY5A 4H4WA 2ZBWA 1GV4A 2YG5A 2WDRA 3ALLA 5U63A 4DGKA 3T37A 1JU2A 3UKPA 4YSZA 1SEZA 2F5ZA 2BRAA 2QAEA 2C7GA 3ITJA 3EANA 2BK3A 2YG3A 2R0PA 2BC1A 3UKAA 3AB1A 2A8XA 4Z43A 1M6IA 1QLBA 3BNMA 5BULA 2WOIA 1H82A 2CDUA 5TR3A 4K5SA 3NIXA 1X31B 3AEBA 1UKVG 5FS8A 3CNPA 3EAOA 4Z44A 4EQXA 3G5RA 3NKSA 2Z5YA 4A9WA 3F8DA 2BABA 2GEWA 4H2RA 3ADAB 3QVRA 3NT6A 2JKCA 3SFDA 3SXIA 4GR1A 2WHDA 2YAUA 3CPIG 4Z24A 4FX9A 5JCLA 3FG2P 2VZ2A 4GDPA 5CQFA 3UKLA 1H6VA 1ZX9A 2BCPA 2YLXA 3DK4A 3VRAA 2XVFA 3GDPA 4GUVA 4H2PA 4I59A 5EB5A 1S7MA 5U25A 2I0ZA 1NAAA 4H2QA 3NGCX 3RP6A 1IJHA 1GRHA 3SFEA 4Z26A 1PJ7A 1DJQA 4H4RA 3NTAA 3CPJG 3H8LA 1Y56B 4YSHA 1P2EA 2C76A 1ZOVA 4G73A 4USQA 3GWDA 4EMIA 3KPKA 1V59A 2NVKX 3CGBA 4H4YA 2WPEA 2XFQA 3UKFA 4H4SA 1PN0A 2GAGB 3UTHA 3UOVA 3T14A 3LB8A 4NEVA 4II2A 4Z2UA 3BI5A 2EQ9A 1PBBA 3K7TA 3T2KA 2V5ZA 1FCDA 4GCMA 4NWZA 1GTHA 1LQUA 1YKJA 1TDEA 5DBJA 1MXTA 4U8KA 5C3JA 1QJDA 2QA2A 3RP8A 3D1CA 3AD9B 1N4UA 3FBSA 1OJTA 3G5QA 4OCGA 2VVLA 3HYXA 3UP5A 4YKGA 1GREA 2BACA 1FL2A 3KA7A 2RGHA 2XYOA 3ATRA 1O95A 4GAPA 4TM0A 2WOVA 1JRYA 2YQUA 1NHQA 2WDQA 3QFBA 3GYIA 4OPIA 5GRTA 3VR9A 1K0JA 3HYVA 5HHFA 3ISHA 4Y4MA 2JBVA 4BK3A 1F8SA 4X9NA 3UKHA 1REOA 1IUTA 5C2TA 1S2QA 2C64A 1GRGA 2ZZCA 3CGDA 4EM4A 2YLWA 3P4RA 4WCTA 4J56A 4ADWA 1DNCA 2GQFA 2YG6A 2R9ZA 4YTPA 2XFOA 5KMQA 3AD8B 5J7XA 3M13A 4D04A 4YSXA 2YR6A 2X99A 1S3BA 2X3NA 4REKA 1GRFA 3URHA 2GVCA 4B1BA 4B65A 1CJ4A 4BK1A 1PDHA 3HYWA 4OPTA 2IIDA 1F8RA 4JQ9A 2WS3A 1TRBA 3ATQA 3ICSA 4EM3A 5IPYA 2YVJA 3M0OA 4XWRA 4Y4NA 2R46A 1YQZA 3AE2A 4U2LA 2BRYA 3T2YA 5JCNA 1NDAA 3B6DA 1GTEA 3GWFA 1ZOYA 4JDRA 4UDQA 1LV0A 2HQMA 1E1MA 2AAQA 1H86A 1BF3A 2X8HA 1CJCA 2R0CA 3AYIA 4JY2A 1D4DA 2PYXA 4IVOB 2DKIA 4C77A 1KSSA 2R45A 2A89A 2BK5A 2V61A 1D7LA 4Z25A 5KXJA 2CULA 3ALMA 4IV9A 1JRZA 2Q0LA 3ZYXA 5JCKA 3AE5A 1TYPA 4U8MA 4CBQA 1B37A 2XVJA 1Y56A 3SZ0A 4X9MA 1ZMDA 1TDNA 3NLCA 5KMRA 1CBOA 1XDIA 2RGJA 1YQ4A 3F8PA 5IQ4A 2B9WA 3QFAA 3AE4A 2XVIA 4IA5A 4HA6A 4CNKA 2YLTA 4D03A 2YVFA 2WP5A 4CCRA 1COYA 2DKHA 3CGCA 2O9ZA 3BHKA 4K5RA 4H2NA 2GQWA 2NPXA 4A5LA 2VOUA 1M64A 3F8RA 3K7MX 1PXBA 1L9CA 3PVCA 5IQ1A 3OC4A 1IUSA 1N1PA 4J36A 4BK2A 3REDA 1MOKA 1FEBA 4CY6A 4K22A 1OJDA 3GYXA 1PHHA 5L46A 3SY4A 1JOAA 1RSGA 2B7SA 4TM4A 3IC9A 3DA1A 3GMCA 3AYJA 3NK1X 3UTGA 1KFYA 4EMJA 3DGZA 2GMJA 3AEGA 2C3CA 5JCIA 4KX6A 2RGOA 2C3DA 1VG9A 3CN8A 5FS9A 2WEUA 4I58A 4LIIA 2C72A 3NH3X 1PXCA 4OVIA 1B5QA 1F8WA 4H4TA 4U8NA 1Z6LA 3PO7A 2WPCA 1ZKQA 2GAHB 4Z2TA 3DJGX 4BURA 3L5OA 1Y0PA 4A79A 5KNLA 4YWOA 1ZP0A 4EQWA 2BCGG 3VRBA 1KN0A 3ALJA 3C4NA 2AQJA 3LZWA 2ZZ0A 4ZN0A 2XVHA 1O94A 2Y6QA 2R4JA 2YLRA 3NN0X 3I6DA 4JY3A 4A65A 3UKQA 4A99A 1NEKA 4M52A 1RP0A 1PXAA 3ICRA 4U2SA 4U8JA 4K7ZA 1VDCA 1VRQB 3CTYA 1EL5A 4EIPA 3AE6A 4CNJA 1S2YA 2RABA 1TDOA 4RG4A 5KVIA 2QA1A 4JNQA 4JNAA 2GF3A 1NHSA 3DJJA 2XCGA 4TM1A 3D9XA 4AT2A 1JNRA 3SX6A 4H4PA 5U1OA 4GRTA 3SZWA 4II3A 3UP4A 1JRXA 2C70A 1FECA 3FPZA 2IVDA 1LJ1A 4DNAA 3LZXA 3AEAA 1TDFA 3LJPA 1MO9A 3AEFA 3CGEA 1Q1WA 1XHCA 3AWIA 3NRNA 4C3XA 2Z5XA 2B9YA 3LOVA 4TLZA 3COXA 1ZMCA 1DOCA 1PJ6A 3CMMA 3KU9A 3FIMB 3AEEA 4U8IA 1QO8A 3GYJA 3NK0X 1NHRA 2GB0A 1E6EA 1PJ5A 2ACZA 3AEDA 5GSNA 4H7UA 3K30A 3AXBA 3DJDA 2ZZBA 4J2WA 1DOBA 2FJAA 3ABVA 1PBEA 1GALA 2XVEA 3K7QX 1F3PA 1S3EA 4G74A 4RG3A 3NNEA 4BJYA 2VVLG 4OPUA 5KWFA 4FDCB 3AE8A 3Q6JA 2FBWA 3S61A 1TYTA 1PBCA 4UDRA 5M10A 1DODA 2XFPA 3QSSA 2X50A 1GRAA 4H4ZA 1N4WA 2YR5A 3UOXA 2BS2A 1K0LA 2EQ6A 1EL9A 4H4XA 1CHUA 3B3RA 3IHGA 3BHFA 5J60A 2VRLA 4U8OA 3NYEA 2JB3A 3KLJA 4J31A 3RP7A 2BS4A 3CNDA 3NYCA 1F6MA 1YY5A 2BA9A 2JB1A 4OPLA 3ZDNA 1OJAA 1ZY8A 2OALA 3GD3A 1TDKA 3CNSA 3NYFA 4ICYA 2YM1A 4EIQA 4TM3A 3UOYA 1Q1RA 2YG4A 3KPFA 1FOHA 2VRMA 3CNTA 1N4VA 2R4EA 3SGLA 3C96A 4B64A 5EB4A 1PS9A 4BV6A 3AE7A 2E1MA 1IUUA 3GRSA 4GF7A 1H2IA 4RSLA 3V3OA 4AOXA 2WOWA 4BJZA 4E0VA 1OJCA 3EF6A 3GMBA 4H50A 4P9SA 2VQBA 4HB9A 2W0HA 3O0HA 1ONFA 3HZLA 4IVMB 1O5WA 4G6GA 3D8XA 1W4XA 2ARDA 2GMHA 2GRTA 2R0GA 4J33A 4LU6A 3T0KA 4B66A 1LVLA 3WE0A 1GEUA 3DH9A 2H89A 2YVGA 3EPTA 2JAEA 4JN9A 4USRA 3S5WA 1K4QA 3VRDB 5LV9A 4X4JA 1GXFA 2B7RA 1CJ2A 1VQWA 3P4PA 2YM2A 1KNPA 2E5VA 5FMHA 1H81A 1GESA 1KDGA 3G5SA 4G9KA 4NZHA 1JEHA 5BRTA 1LTXR 3E1TA 2V3AA 4H4VA 3NG7X 2B76A 4A7AA 1GSNA 2GR3A 1CC6A 4Y4LA 4C5OA 2J3NA 1NHPA 5JCMA 3SM8A 4DSGA 4B67A 2VVMA 2WPFA 4OPDA 5KOXA 2GH5A 1NPXA 1B8SA 1IUWA 1E1NA 1KSUA 1BGJA 3AE3A 3H4KA 1CF3A 3C4AA 4NTEA 4B68A 3P9UA 4PAAA 5EBKA 1GPEA 5KVHA 2WU5A 2X8CA 2EQ7A 5FS7A 1FEAA 2XLPA 2OLNA 1BGNA 1JNZA 2Q7VA 1CJ3A 4GAVA 2BYBA 1GRTA 1GT8A 3BI4A 2V60A 4WX1A 1D7YA 2E4GA 1E1KA 2FJBA 4XXGA 1GERA 5HYMA 5EOWA 1CC2A 4FK1C 3QSMA 1E1LA 1EL7A 2TPRA 2TMDA 3AE1A 3FMWA 2XFNA 4IA6A 3SYIA 4AP1A 3I3LA 3GRTA 4H4QA 1PBFA 4OPGA 4A6NA 3VQRA 5FS6A 3DK8A 1AOGA 1BKWA 3IHMA 3P1WA 1BWCA 3L1RA 3AE9A 4EQSA 1KF6A 3UKKA 1LPFA 1VG0A 1B4VA 2VQ7A 4LA1A 2UZZA 4OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR1 A;  2YR4 A;  3CPH G;  2WP6 A;  2APG A;  4C74 A;  4K8D A;  3KVE A;  3M12 A;  3AEC A;  3BNU A;  2XLS A;  3DGH A;  3NN6 X;  4YTM A;  1LQT A;  2V6O A;  4U8P A;  3V76 A;  1K0I A;  5KRQ A;  4FK1 A;  2CVJ A;  2XLT A;  5ER0 A;  2XFU A;  2GR2 A;  4K2X A;  1L9E A;  4TLX A;  4ZCC A;  4ECH A;  4UDP A;  2BK4 A;  4GDE A;  2WP9 A;  3DK9 A;  3RHA A;  4H4U A;  3NTD A;  4XWZ A;  2FJD A;  4NTD A;  2CFY A;  1P2H A;  3H8I A;  3CNJ A;  1GOS A;  3ICT A;  4YTN A;  1ZK7 A;  2WES A;  3V3N A;  1D4E A;  2BC0 A;  2Y6R A;  3AD7 B;  5BVA A;  3LXD A;  3SQP A;  4CCQ A;  2BXS A;  1H84 A;  4U2T A;  2IVE A;  1DXL A;  3AYL A;  2OLO A;  3QSE A;  2WU2 A;  2BS3 A;  3UTE A;  3RNM A;  1RYI A;  2PHH A;  1DOE A;  2WBA A;  5HXI A;  1XAN A;  4U8L A;  2C66 A;  3NK2 X;  3II4 A;  1CC4 A;  1ELI A;  4PAB A;  1EBD A;  2XLU A;  3OZ2 A;  4MJW A;  4KPR A;  2C67 A;  4YXD A;  2OA1 A;  4AP3 A;  4N9X A;  4YT0 A;  2XDO A;  4C3Y A;  3UTF A;  5BUK A;  1XPQ A;  4EQR A;  3JSK A;  3QVP A;  4NTC A;  5CKU A;  5M0Z A;  4ZCD A;  5KOW A;  2GR0 A;  2Q0K A;  2B9X A;  3GD4 A;  2JB2 A;  3QJ4 A;  4EMW A;  1GND A;  2A87 A;  2C75 A;  3P4Q A;  4DSH A;  3L8K A;  1DJN A;  2YG7 A;  1KNR A;  1E7P A;  4YSY A;  3R9U A;  3DME A;  1BZL A;  4YKF A;  3LAD A;  2YWL A;  3KD9 A;  3BI2 A;  4B63 A;  1NG4 A;  3IWA A;  2GV8 A;  1GET A;  4B69 A;  3IF9 A;  2QCU A;  3GDN A;  3GSI A;  1ZDL A;  2C65 A;  3KKJ A;  1PBD A;  4NEW A;  3UOZ A;  2FJE A;  2WDV A;  1E39 A;  3P4S A;  4CY8 A;  1H7W A;  1GRB A;  4J34 A;  4A6N B;  4AT0 A;  2YLS A;  1H7X A;  4AOS A;  1H83 A;  2YLZ A;  1Q9I A;  1OJ9 A;  2AR8 A;  1IUX A;  2H88 A;  3VR8 A;  3UCL A;  1YQ3 A;  1L9D A;  2JK6 A;  1D4C A;  2WET A;  1IUV A;  1NG3 A;  3CIR A;  4CRT A;  1CL0 A;  1HYU A;  4O5Q A;  2C73 A;  2V3B A;  2BXR A;  4Z2R A;  3PS9 A;  1EL8 A;  3NHO X;  4UP3 A;  1D5T A;  2X8G A;  4O5U A;  2EQ8 A;  2WQY A;  2XLR A;  1NEN A;  2OAM A;  4J57 A;  4APN A;  1L0V A;  3DJE A;  3Q9T A;  2Q6U A;  5HY5 A;  4H4W A;  2ZBW A;  1GV4 A;  2YG5 A;  2WDR A;  3ALL A;  5U63 A;  4DGK A;  3T37 A;  1JU2 A;  3UKP A;  4YSZ A;  1SEZ A;  2F5Z A;  2QAE A;  2C7G A;  3ITJ A;  3EAN A;  2BK3 A;  2YG3 A;  2R0P A;  2BC1 A;  3UKA A;  3AB1 A;  2A8X A;  4Z43 A;  1M6I A;  1QLB A;  3BNM A;  5BUL A;  2WOI A;  1H82 A;  2CDU A;  5TR3 A;  4K5S A;  3NIX A;  1X31 B;  3AEB A;  1UKV G;  5FS8 A;  3CNP A;  3EAO A;  4Z44 A;  4EQX A;  3G5R A;  3NKS A;  2Z5Y A;  4A9W A;  3F8D A;  2BAB A;  2GEW A;  4H2R A;  3ADA B;  3QVR A;  3NT6 A;  2JKC A;  3SFD A;  4GR1 A;  2WHD A;  2YAU A;  3CPI G;  4Z24 A;  4FX9 A;  5JCL A;  3FG2 P;  2VZ2 A;  4GDP A;  5CQF A;  3UKL A;  1H6V A;  1ZX9 A;  2BCP A;  2YLX A;  3DK4 A;  3VRA A;  2XVF A;  3GDP A;  4GUV A;  4H2P A;  4I59 A;  5EB5 A;  5U25 A;  2I0Z A;  1NAA A;  4H2Q A;  3NGC X;  3RP6 A;  1IJH A;  1GRH A;  3SFE A;  4Z26 A;  1PJ7 A;  1DJQ A;  4H4R A;  3NTA A;  3CPJ G;  3H8L A;  1Y56 B;  4YSH A;  1P2E A;  2C76 A;  1ZOV A;  4USQ A;  3GWD A;  4EMI A;  1V59 A;  2NVK X;  3CGB A;  4H4Y A;  2WPE A;  2XFQ A;  3UKF A;  4H4S A;  1PN0 A;  2GAG B;  3UTH A;  3UOV A;  3LB8 A;  4NEV A;  4Z2U A;  3BI5 A;  2EQ9 A;  1PBB A;  3K7T A;  2V5Z A;  1FCD A;  4GCM A;  1GTH A;  1LQU A;  1YKJ A;  1TDE A;  5DBJ A;  1MXT A;  4U8K A;  5C3J A;  1QJD A;  2QA2 A;  3RP8 A;  3D1C A;  3AD9 B;  1N4U A;  3FBS A;  1OJT A;  3G5Q A;  4OCG A;  2VVL A;  3UP5 A;  4YKG A;  1GRE A;  2BAC A;  1FL2 A;  3KA7 A;  2RGH A;  2XYO A;  3ATR A;  1O95 A;  4TM0 A;  2WOV A;  1JRY A;  2YQU A;  1NHQ A;  2WDQ A;  3QFB A;  3GYI A;  4OPI A;  5GRT A;  3VR9 A;  1K0J A;  5HHF A;  3ISH A;  4Y4M A;  2JBV A;  4BK3 A;  1F8S A;  4X9N A;  3UKH A;  1REO A;  1IUT A;  5C2T A;  1S2Q A;  2C64 A;  1GRG A;  2ZZC A;  3CGD A;  4EM4 A;  2YLW A;  3P4R A;  4WCT A;  4J56 A;  4ADW A;  1DNC A;  2GQF A;  2YG6 A;  2R9Z A;  4YTP A;  2XFO A;  3AD8 B;  5J7X A;  3M13 A;  4D04 A;  4YSX A;  2YR6 A;  2X99 A;  1S3B A;  2X3N A;  4REK A;  1GRF A;  3URH A;  2GVC A;  4B1B A;  4B65 A;  1CJ4 A;  4BK1 A;  1PDH A;  4OPT A;  2IID A;  1F8R A;  4JQ9 A;  2WS3 A;  1TRB A;  3ATQ A;  3ICS A;  4EM3 A;  5IPY A;  2YVJ A;  3M0O A;  4XWR A;  4Y4N A;  2R46 A;  1YQZ A;  3AE2 A;  4U2L A;  5JCN A;  1NDA A;  3B6D A;  1GTE A;  3GWF A;  1ZOY A;  4JDR A;  4UDQ A;  1LV0 A;  2HQM A;  1E1M A;  2AAQ A;  1H86 A;  1BF3 A;  2X8H A;  1CJC A;  2R0C A;  3AYI A;  4JY2 A;  1D4D A;  2PYX A;  4IVO B;  2DKI A;  4C77 A;  1KSS A;  2R45 A;  2A89 A;  2BK5 A;  2V61 A;  1D7L A;  4Z25 A;  5KXJ A;  2CUL A;  3ALM A;  4IV9 A;  1JRZ A;  2Q0L A;  3ZYX A;  5JCK A;  3AE5 A;  1TYP A;  4U8M A;  4CBQ A;  1B37 A;  2XVJ A;  1Y56 A;  4X9M A;  1ZMD A;  1TDN A;  3NLC A;  1CBO A;  1XDI A;  2RGJ A;  1YQ4 A;  3F8P A;  5IQ4 A;  2B9W A;  3QFA A;  3AE4 A;  2XVI A;  4IA5 A;  4HA6 A;  4CNK A;  2YLT A;  4D03 A;  2YVF A;  2WP5 A;  4CCR A;  1COY A;  2DKH A;  3CGC A;  2O9Z A;  3BHK A;  4K5R A;  4H2N A;  2GQW A;  2NPX A;  4A5L A;  2VOU A;  1M64 A;  3F8R A;  3K7M X;  1PXB A;  1L9C A;  3PVC A;  5IQ1 A;  3OC4 A;  1IUS A;  1N1P A;  4J36 A;  4BK2 A;  3RED A;  1MOK A;  1FEB A;  4CY6 A;  4K22 A;  1OJD A;  1PHH A;  5L46 A;  1JOA A;  1RSG A;  2B7S A;  4TM4 A;  3IC9 A;  3DA1 A;  3GMC A;  3AYJ A;  3NK1 X;  3UTG A;  1KFY A;  4EMJ A;  3DGZ A;  2GMJ A;  3AEG A;  2C3C A;  5JCI A;  4KX6 A;  2RGO A;  2C3D A;  1VG9 A;  3CN8 A;  5FS9 A;  2WEU A;  4I58 A;  4LII A;  2C72 A;  3NH3 X;  1PXC A;  4OVI A;  1B5Q A;  1F8W A;  4H4T A;  4U8N A;  1Z6L A;  3PO7 A;  2WPC A;  1ZKQ A;  2GAH B;  4Z2T A;  3DJG X;  4BUR A;  1Y0P A;  4A79 A;  4YWO A;  1ZP0 A;  4EQW A;  2BCG G;  3VRB A;  3ALJ A;  3C4N A;  2AQJ A;  3LZW A;  2ZZ0 A;  4ZN0 A;  2XVH A;  1O94 A;  2Y6Q A;  2R4J A;  2YLR A;  3NN0 X;  3I6D A;  4JY3 A;  4A65 A;  3UKQ A;  4A99 A;  1NEK A;  4M52 A;  1RP0 A;  1PXA A;  3ICR A;  4U2S A;  4U8J A;  4K7Z A;  1VDC A;  1VRQ B;  3CTY A;  1EL5 A;  4EIP A;  3AE6 A;  4CNJ A;  1S2Y A;  2RAB A;  1TDO A;  4RG4 A;  5KVI A;  2QA1 A;  4JNQ A;  4JNA A;  2GF3 A;  1NHS A;  3DJJ A;  2XCG A;  4TM1 A;  4AT2 A;  1JNR A;  4H4P A;  5U1O A;  4GRT A;  3UP4 A;  1JRX A;  2C70 A;  1FEC A;  3FPZ A;  2IVD A;  1LJ1 A;  4DNA A;  3LZX A;  3AEA A;  1TDF A;  3LJP A;  1MO9 A;  3AEF A;  3CGE A;  1Q1W A;  1XHC A;  3AWI A;  3NRN A;  4C3X A;  2Z5X A;  2B9Y A;  3LOV A;  4TLZ A;  3COX A;  1ZMC A;  1DOC A;  1PJ6 A;  3KU9 A;  3FIM B;  3AEE A;  4U8I A;  1QO8 A;  3GYJ A;  3NK0 X;  1NHR A;  2GB0 A;  1E6E A;  1PJ5 A;  2ACZ A;  3AED A;  5GSN A;  4H7U A;  3K30 A;  3AXB A;  3DJD A;  2ZZB A;  4J2W A;  1DOB A;  2FJA A;  3ABV A;  1PBE A;  1GAL A;  2XVE A;  3K7Q X;  1F3P A;  1S3E A;  4RG3 A;  4BJY A;  3NNE A;  2VVL G;  4OPU A;  5KWF A;  4FDC B;  3AE8 A;  3Q6J A;  2FBW A;  3S61 A;  1TYT A;  1PBC A;  4UDR A;  5M10 A;  1DOD A;  2XFP A;  3QSS A;  2X50 A;  1GRA A;  4H4Z A;  1N4W A;  2YR5 A;  3UOX A;  2BS2 A;  1K0L A;  2EQ6 A;  1EL9 A;  4H4X A;  1CHU A;  3B3R A;  3IHG A;  3BHF A;  5J60 A;  2VRL A;  4U8O A;  3NYE A;  2JB3 A;  3KLJ A;  4J31 A;  3RP7 A;  2BS4 A;  3CND A;  3NYC A;  1F6M A;  1YY5 A;  2BA9 A;  2JB1 A;  4OPL A;  3ZDN A;  1OJA A;  1ZY8 A;  2OAL A;  3GD3 A;  1TDK A;  3CNS A;  3NYF A;  4ICY A;  2YM1 A;  4EIQ A;  4TM3 A;  3UOY A;  1Q1R A;  2YG4 A;  3KPF A;  1FOH A;  2VRM A;  3CNT A;  1N4V A;  2R4E A;  3SGL A;  3C96 A;  4B64 A;  5EB4 A;  1PS9 A;  4BV6 A;  3AE7 A;  2E1M A;  1IUU A;  3GRS A;  4GF7 A;  4RSL A;  3V3O A;  4AOX A;  4BJZ A;  2WOW A;  4E0V A;  1OJC A;  3EF6 A;  3GMB A;  4H50 A;  4P9S A;  2VQB A;  4HB9 A;  2W0H A;  3O0H A;  1ONF A;  3HZL A;  4IVM B;  1O5W A;  3D8X A;  1W4X A;  2ARD A;  2GMH A;  2GRT A;  2R0G A;  4J33 A;  4LU6 A;  4B66 A;  1LVL A;  3WE0 A;  1GEU A;  3DH9 A;  2H89 A;  2YVG A;  3EPT A;  2JAE A;  4JN9 A;  4USR A;  3S5W A;  1K4Q A;  3VRD B;  5LV9 A;  4X4J A;  1GXF A;  2B7R A;  1CJ2 A;  1VQW A;  3P4P A;  2YM2 A;  1KNP A;  2E5V A;  5FMH A;  1H81 A;  1GES A;  1KDG A;  3G5S A;  4NZH A;  1JEH A;  5BRT A;  1LTX R;  3E1T A;  4H4V A;  2V3A A;  3NG7 X;  2B76 A;  4A7A A;  1GSN A;  2GR3 A;  1CC6 A;  4Y4L A;  4C5O A;  2J3N A;  1NHP A;  5JCM A;  3SM8 A;  4DSG A;  4B67 A;  2VVM A;  2WPF A;  4OPD A;  5KOX A;  2GH5 A;  1NPX A;  1B8S A;  1IUW A;  1E1N A;  1KSU A;  1BGJ A;  3AE3 A;  3H4K A;  1CF3 A;  3C4A A;  4NTE A;  4B68 A;  3P9U A;  4PAA A;  5EBK A;  1GPE A;  5KVH A;  2WU5 A;  2X8C A;  2EQ7 A;  5FS7 A;  1FEA A;  2XLP A;  2OLN A;  1BGN A;  1JNZ A;  2Q7V A;  1CJ3 A;  2BYB A;  1GRT A;  1GT8 A;  3BI4 A;  2V60 A;  4WX1 A;  1D7Y A;  2E4G A;  1E1K A;  2FJB A;  4XXG A;  1GER A;  5HYM A;  5EOW A;  1CC2 A;  4FK1 C;  3QSM A;  1E1L A;  1EL7 A;  2TPR A;  2TMD A;  3AE1 A;  3FMW A;  2XFN A;  4IA6 A;  4AP1 A;  3I3L A;  3GRT A;  4H4Q A;  1PBF A;  4OPG A;  4A6N A;  3VQR A;  5FS6 A;  3DK8 A;  1AOG A;  1BKW A;  3IHM A;  3P1W A;  1BWC A;  3L1R A;  3AE9 A;  4EQS A;  1KF6 A;  3UKK A;  1LPF A;  1VG0 A;  1B4V A;  2VQ7 A;  4LA1 A;  2UZZ A;  4OPC A; 
#chains in the Genus database with same CATH topology
 2GR1 A;  3CPH G;  2GGJ A;  4K8D A;  3M12 A;  2XLS A;  3JVA A;  3DGH A;  1LQT A;  3V76 A;  4FK1 A;  4K2X A;  3D47 A;  3DG6 A;  3RHA A;  4NTD A;  2CFY A;  1P2H A;  3TQP A;  4HPN A;  3H8I A;  5BVA A;  3AD7 B;  3LXD A;  3AYL A;  2OLO A;  5EU9 A;  2WBA A;  3SJN A;  1JCT A;  4U8L A;  3NK2 X;  3ETR B;  3TW9 A;  2OA1 A;  4N9X A;  3T31 A;  3UTF A;  5BUK A;  3H70 A;  4EQR A;  5M0Z A;  4ZCD A;  2Q0K A;  3U4F A;  4EMW A;  1GND A;  2YG7 A;  3KD9 A;  1WYG A;  5IDZ A;  3IWA A;  3N6H A;  3IF9 A;  2XH7 A;  3KKJ A;  3UOZ A;  2FJE A;  4GIR A;  4AT0 A;  1EC9 A;  3VDG A;  4F4R A;  1YQ3 A;  3AMZ A;  3MUC A;  3PS9 A;  1EL8 A;  4EWJ A;  3TWB A;  3NHO X;  3T6C A;  4UP3 A;  4KT2 A;  2PS2 A;  2XLR A;  4APN A;  1ECQ A;  3QLD A;  1GV4 A;  4A6G A;  2WDR A;  2YG5 A;  3ZLH A;  2BRA A;  3STP A;  3ITJ A;  1PDZ A;  3EAN A;  2BC1 A;  2PU0 A;  4Z43 A;  3I4K A;  1X2H A;  1NU5 A;  3CNP A;  3EAO A;  1TE6 A;  2Z5Y A;  2JKC A;  3SXI A;  1EC7 A;  4Z24 A;  4GDP A;  3FG2 P;  1ZX9 A;  4ZA0 A;  2BCP A;  3VRA A;  4I59 A;  1NAA A;  4IL2 A;  1IJH A;  3SFE A;  3CPJ G;  4G73 A;  3DG3 A;  3B97 A;  3KPK A;  2WPE A;  3UOV A;  2V5Z A;  1GTH A;  2HXT A;  3S5S A;  3R11 A;  3RP8 A;  3D1C A;  2GGG A;  2VVL A;  2W55 A;  3V3W A;  2RGH A;  1JRY A;  1NHQ A;  3Q4D A;  1XPY A;  4K8G A;  4Y4M A;  1REO A;  1S2Q A;  4WCT A;  4J56 A;  2GQF A;  5KMQ A;  3M13 A;  3GY1 A;  1GRF A;  4BK1 A;  3SN4 A;  2YVJ A;  4XWR A;  4E4U A;  3T2Y A;  3B6D A;  3PFR A;  3FVD A;  4UDQ A;  2HZG A;  2HQM A;  2R0C A;  4IVO B;  2DKI A;  1KSS A;  2A89 A;  1D7L A;  3ALM A;  2Q0L A;  3AE5 A;  4U8M A;  3DER A;  3HW2 A;  1B37 A;  2XVJ A;  1Y56 A;  4MKS A;  3RIT A;  2RGJ A;  5FJO A;  1YQ4 A;  2XVI A;  4D03 A;  3BHK A;  4K5R A;  4H2N A;  7ENL A;  4A5L A;  3F8R A;  4M6U A;  3PVC A;  5IQ1 A;  3D46 A;  3SY4 A;  1JOA A;  1RSG A;  4TM4 A;  4EMJ A;  2GMJ A;  2C3C A;  5JCI A;  5FS9 A;  4IP5 A;  3TJI A;  3FXG A;  2GGI A;  1Z6L A;  1Y0P A;  1KN0 A;  4ZOH B;  2ZZ0 A;  4ZN0 A;  2R4J A;  3UKQ A;  1RP0 A;  4EIP A;  3AE6 A;  5KVI A;  2QA1 A;  4JNQ A;  1NHS A;  4TM1 A;  3FJ4 A;  3SZW A;  1JRX A;  1LJ1 A;  3LZX A;  2QDD A;  3EUB 3;  1MO9 A;  3AEF A;  3AN1 A;  4C3X A;  3V4B A;  4GME A;  1DOC A;  2POD A;  3KU9 A;  3FIM B;  2PGE A;  3AEE A;  4DWD A;  3IJL A;  1QO8 A;  3GYJ A;  3NK0 X;  5GSN A;  3AXB A;  3V5C A;  2XVE A;  1F3P A;  1S3E A;  4G74 A;  4OPU A;  5KWF A;  3NO1 A;  4UDR A;  3OZM A;  5FJR A;  5M10 A;  4HYR A;  2YR5 A;  3UOX A;  2BS2 A;  1K0L A;  2EQ6 A;  2E5A A;  4H4X A;  3IHG A;  3ZLF A;  4U8O A;  2JB3 A;  4J31 A;  3NXL A;  1F6M A;  3NRZ B;  2YM1 A;  3UJE A;  2VRM A;  1N4V A;  2GGH A;  5G5H B;  4B64 A;  1PS9 A;  4BV6 A;  3JZU A;  3GRS A;  5FJT A;  4RSL A;  1H2I A;  3V3O A;  3O0H A;  1N62 C;  4HCH A;  4IVM B;  3FYY A;  3WE0 A;  1GEU A;  2H89 A;  3EPT A;  5LV9 A;  2DW7 A;  1JPM A;  2PTX A;  1GXF A;  3P4P A;  2E5V A;  5FMH A;  3E1T A;  4H4V A;  1GSN A;  4Y4L A;  4OPD A;  2OZ3 A;  2GH5 A;  3OP2 A;  1B8S A;  1E1N A;  1BGJ A;  3H4K A;  2QGY A;  5KVH A;  2XLP A;  1JNZ A;  4WX1 A;  5BOF A;  5EOW A;  1EL7 A;  4IL0 A;  1BKW A;  3AE9 A;  2ONE A;  1VG0 A;  4LA1 A;  3DFH A;  2WP6 A;  3KVE A;  3PG6 A;  4YTM A;  5JRB A;  2GR2 A;  4ECH A;  2BK4 A;  3CK5 A;  5ENL A;  2DW6 A;  4XWZ A;  3OZY A;  2OQH A;  3N6J A;  3ICT A;  1D4E A;  2BXS A;  4HN8 A;  2BS3 A;  2OX4 A;  1RYI A;  4KEM A;  1CC4 A;  3JW7 A;  2XLU A;  3OZ2 A;  4KPR A;  2C67 A;  4AP3 A;  2XDO A;  3DIP A;  4NTC A;  2AL2 B;  2B9X A;  3QJ4 A;  3U9I A;  4DSH A;  2P3Z A;  1MRA A;  1E7P A;  3R9U A;  4YKF A;  3LAD A;  2OLA A;  4B63 A;  1NG4 A;  3SZF A;  2GV8 A;  1N61 C;  3GSI A;  4J1O A;  3P4S A;  4CY8 A;  1GRB A;  4A6N B;  3T2Z A;  1OJ9 A;  2AR8 A;  2H88 A;  1IUV A;  1NG3 A;  4CRT A;  1CL0 A;  4O5Q A;  4Z2R A;  1ELS A;  4ROP A;  1D5T A;  2X8G A;  4O5U A;  2WQY A;  1NEN A;  2OAM A;  3QTP A;  4J57 A;  5J04 A;  2Q6U A;  4YSZ A;  3UXL A;  1SEZ A;  4JN7 A;  2QAE A;  2BK3 A;  2YG3 A;  2R0P A;  1H82 A;  3NIX A;  5FS8 A;  3BSM A;  4G7F A;  1NEL A;  1FHV A;  4H2R A;  4GR1 A;  1P48 A;  4FX9 A;  5JCL A;  5CQF A;  3UKL A;  2XVF A;  2I0Z A;  4H2Q A;  3NTA A;  1Y56 B;  1P2E A;  3A7A A;  3OTR A;  2NVK X;  3CGB A;  3I6E A;  2XFQ A;  3UKF A;  1VQZ A;  1PN0 A;  3T14 A;  4II2 A;  4NEV A;  3BI5 A;  1PBB A;  3MSY A;  3K7T A;  1FCD A;  4NWZ A;  2QQ6 A;  1LQU A;  1TDE A;  1MXT A;  4U8K A;  1QJD A;  2QA2 A;  2OQY A;  3FBS A;  1OJT A;  2BAC A;  3TOY A;  3KA7 A;  4GAP A;  3ATR A;  1O95 A;  2P8B A;  3ISH A;  4FI4 A;  3UKH A;  1IUT A;  4IT1 A;  5C2T A;  3CGD A;  4EM4 A;  3P4R A;  1DNC A;  4IP4 A;  4D04 A;  4YSX A;  2X3N A;  4B65 A;  3URH A;  4JN8 A;  4OPT A;  1F8R A;  3ATQ A;  4Y4N A;  1YQZ A;  1ZOY A;  1LV0 A;  2AAQ A;  2X8H A;  3SN0 A;  4C77 A;  1VDV A;  2R45 A;  2V61 A;  4Z25 A;  5KXJ A;  4GGB A;  3R07 C;  1JRZ A;  5JCK A;  1MUC A;  4CBQ A;  2GL5 A;  3SZ0 A;  3CAW A;  4X9M A;  2OVL A;  3NLC A;  5KMR A;  1XDI A;  4DXK A;  4IA5 A;  4CNK A;  3R0K A;  2YLT A;  2WP5 A;  4CCR A;  1COY A;  2O9Z A;  3CGC A;  2VOU A;  1M64 A;  1PXB A;  4BK2 A;  3OC4 A;  1N1P A;  3RCY A;  1MOK A;  3A7R A;  1FFV C;  1OJD A;  5L46 A;  3DA1 A;  3AYJ A;  3UTG A;  3AEG A;  2RGO A;  4DYE A;  2C3D A;  1ZXI C;  1VG9 A;  3CN8 A;  3P3B A;  4I58 A;  4LII A;  1B5Q A;  1F8W A;  4DX3 A;  4H4T A;  3CB3 A;  4YWO A;  3VRB A;  3ALJ A;  3C4N A;  2YLR A;  2Y6Q A;  1TZZ A;  4A99 A;  3NN0 X;  1RM6 B;  3ICR A;  1DTN A;  2FYM A;  4U8J A;  1X2G A;  3CTY A;  4KWS A;  4RG4 A;  2GF3 A;  3SBF A;  4II3 A;  2C70 A;  4IHC A;  1TDF A;  3CGE A;  3ZVI A;  2Z5X A;  3LOV A;  3COX A;  1PJ6 A;  3RRA A;  1V97 A;  1E6E A;  2PTW A;  3IJI A;  3ZVH A;  4GYP A;  3DJD A;  2ZZB A;  1DOB A;  2FJA A;  1YEY A;  1PBE A;  1GAL A;  3ABV A;  4BJY A;  2VVL G;  3Q6J A;  3QSS A;  4H4Z A;  3B3R A;  5J60 A;  1N63 C;  2VRL A;  4K1W A;  3CND A;  1YY5 A;  2BA9 A;  1OJA A;  3CNS A;  3H7V A;  4TM3 A;  3KPF A;  2YG4 A;  3CNT A;  3SGL A;  5EB4 A;  1IUU A;  3PK7 A;  4E0V A;  3GMB A;  3R25 A;  2QVH A;  3N4E A;  2GMH A;  3CXB A;  2R0G A;  3MQT A;  1LVL A;  4ENL A;  1WUE A;  4USR A;  4JN9 A;  3VRD B;  3B9J B;  1KCZ A;  2B7R A;  2OZ8 A;  4TVY A;  1R0M A;  1H81 A;  3G5S A;  4NZH A;  1JEH A;  1LTX R;  2V3A A;  3BJS A;  4H83 A;  5G5G B;  3TCS A;  1CF3 A;  4B68 A;  3P9U A;  5FS7 A;  1FEA A;  2OLN A;  1BGN A;  4GAV A;  2BYB A;  1GRT A;  1GT8 A;  3BI4 A;  3KUM A;  1CC2 A;  4FK1 C;  3QSM A;  1E1L A;  2TMD A;  3SYI A;  1EC8 A;  4IA6 A;  3NVV B;  3GRT A;  5FS6 A;  3VCC A;  3IHM A;  3L1R A;  3UCC A;  3ZLG A;  2XSX A;  3VCN A;  2YR4 A;  2APG A;  4A35 A;  2AL2 A;  4Z1Y A;  3AEC A;  3BNU A;  1N60 C;  2V6O A;  4U8P A;  1K0I A;  5KRQ A;  2CVJ A;  1L9E A;  4ZCC A;  4UDP A;  4GDE A;  4H4U A;  4NNJ A;  2FJD A;  2E3T A;  2XH2 A;  1L8P A;  3SZC A;  3V3N A;  3IJQ A;  2Y6R A;  4U2T A;  2IVE A;  1DXL A;  5KMP A;  3QSE A;  3CT2 A;  2WU2 A;  3UTE A;  1DOE A;  3II4 A;  1EBD A;  2C4C A;  3FV9 A;  4YT0 A;  3JSK A;  5CKU A;  5KOW A;  2GR0 A;  4YWS A;  2JB2 A;  1MDR A;  2A87 A;  3L8K A;  4G6H A;  1KNR A;  4YSY A;  3DME A;  1BZL A;  3UJF A;  3GDN A;  2C65 A;  1PBD A;  1E39 A;  2ZAD A;  1H7W A;  4J34 A;  2FKP A;  2YLS A;  1H7X A;  1H83 A;  1SJD A;  3VR8 A;  3UCL A;  3TWA A;  1L9D A;  1D4C A;  2WET A;  1HYU A;  2C73 A;  2V3B A;  2OKT A;  3SR6 B;  3VC5 A;  3TJ4 A;  2EQ8 A;  4HNC A;  1L0V A;  3Q9T A;  2AL1 A;  4H4W A;  1JRO A;  1R6W A;  1KKR A;  1JU2 A;  3K1G A;  2PMQ A;  3UKA A;  3BNM A;  2CDU A;  3UXK A;  1X31 B;  3AEB A;  1N5W C;  3CXO A;  4Z44 A;  3G5R A;  3NKS A;  3F8D A;  2GEW A;  3NT6 A;  3CPI G;  1FFU C;  2VZ2 A;  3DK4 A;  4H2P A;  3GDP A;  4GUV A;  5EB5 A;  1S7M A;  5U25 A;  3OPS A;  3NGC X;  3RP6 A;  1GRH A;  4Z26 A;  1PJ7 A;  3H8L A;  4YSH A;  1MNS A;  5FJU A;  1ZOV A;  3GWD A;  4EMI A;  1V59 A;  3T9P A;  3UGV A;  1JPD X;  3LB8 A;  1STZ A;  2EQ9 A;  3T8Q A;  4GCM A;  1YKJ A;  2OO6 A;  3AD9 B;  3G5Q A;  3HYX A;  2CHR A;  1GRE A;  1FL2 A;  3CYJ A;  4TM0 A;  2YQU A;  2GSH A;  3QFB A;  3GYI A;  3VR9 A;  2PCE A;  5HHF A;  4BK3 A;  1W6T A;  2C64 A;  2ZZC A;  3BOX A;  2PP1 A;  2YG6 A;  4YTP A;  1OEP A;  2YR6 A;  3QPE A;  4REK A;  4B1B A;  2GVC A;  1CJ4 A;  1PDH A;  3FCP A;  2IID A;  4JQ9 A;  2WS3 A;  1TRB A;  2QJN A;  3ICS A;  5IPY A;  4KPL A;  3AE2 A;  4U2L A;  5JCN A;  1NDA A;  3GWF A;  3MWC A;  4JY2 A;  1E1M A;  1H86 A;  3A7U A;  3DG7 A;  2BK5 A;  2CUL A;  1TYP A;  4E6M A;  1PDY A;  2I5Q A;  1TDN A;  1IYX A;  3F8P A;  3P0W A;  2B9W A;  2W54 A;  2GQW A;  2NPX A;  3K7M X;  1SJA A;  4GIS A;  1IUS A;  3RED A;  1FEB A;  1EBG A;  3GYX A;  1PHH A;  3NVW B;  4H1Z A;  3IC9 A;  3GMC A;  3NK1 X;  1KFY A;  2P88 A;  3DEQ A;  2WEU A;  4MGG A;  3NH3 X;  4M0X A;  4OVI A;  4U8N A;  3GO2 A;  2WPC A;  4Z2T A;  3DJG X;  4BUR A;  2PGW A;  3L5O A;  4A79 A;  4EQW A;  2AQJ A;  2AKM A;  4A65 A;  1O94 A;  4JY3 A;  1NEK A;  1S2Y A;  4AT2 A;  2XCG A;  1JNR A;  4H4P A;  2AKZ A;  3I6T A;  3UP4 A;  1FEC A;  3FPZ A;  3N4F A;  1Q1W A;  3NRN A;  2B9Y A;  3CMM A;  4U8I A;  1PJ5 A;  3K30 A;  4E5T A;  3R10 A;  3NNE A;  3EKG A;  2FBW A;  2XGZ A;  2X50 A;  1GRA A;  1EL9 A;  4HNL A;  3BHF A;  3RP7 A;  2BS4 A;  3NYC A;  2JB1 A;  4OPL A;  4A3R A;  3ZDN A;  2OAL A;  2PU1 A;  3GD3 A;  1TDK A;  3NYF A;  4ICY A;  4EIQ A;  3UOY A;  1Q1R A;  3R0U A;  4GF7 A;  4BJZ A;  2WOW A;  1OJC A;  3EF6 A;  2W0H A;  1SJB A;  1ONF A;  3D8X A;  2ARD A;  2GRT A;  4B66 A;  4J33 A;  4LU6 A;  3T0K A;  3DH9 A;  2YVG A;  2JAE A;  3S5W A;  1F9C A;  4X4J A;  3NZG A;  1SB3 B;  2YM2 A;  4J3Z A;  1KNP A;  4G9K A;  5BRT A;  4A7A A;  2GR3 A;  1CC6 A;  4X2P A;  5JCM A;  1NHP A;  1JDF A;  3SM8 A;  4DSG A;  2PPG A;  2VVM A;  5KOX A;  1NPX A;  4JHM A;  1IUW A;  4K2S A;  3C4A A;  4NTE A;  3UJR A;  5EBK A;  1GPE A;  2WU5 A;  1BQG A;  5FJP A;  2V60 A;  1D7Y A;  2E4G A;  5HYM A;  4AP1 A;  2TPR A;  3FMW A;  2XFN A;  1PBF A;  3P1W A;  4EQS A;  3NS1 B;  1KF6 A;  3UKK A;  1LPF A;  1B4V A;  2VQ7 A;  2W3S A;  4C74 A;  3NN6 X;  2O56 A;  2XLT A;  5ER0 A;  2XFU A;  2PP0 A;  4TLX A;  2WP9 A;  3DK9 A;  3DDM A;  3NTD A;  5KMS A;  3CNJ A;  1GOS A;  4YTN A;  1ZK7 A;  2WES A;  2BC0 A;  3SQP A;  4CCQ A;  1JRP A;  1H84 A;  3RNM A;  2PHH A;  5HXI A;  1XAN A;  2GDQ A;  3ES8 A;  2C66 A;  1ELI A;  4PAB A;  4MJW A;  3VA8 A;  1FIQ B;  4YXD A;  4C3Y A;  1XPQ A;  3QVP A;  3GD4 A;  3P4Q A;  2C75 A;  1DJN A;  1T3Q C;  2YWL A;  4IZG A;  3BI2 A;  3ENL A;  1GET A;  3UJS A;  4B69 A;  2QCU A;  3T4W A;  1ZDL A;  4NEW A;  2WDV A;  2HNE A;  3DFY A;  3OW1 A;  1FO4 A;  4G8T A;  3HRD C;  1WUF A;  4AOS A;  2YLZ A;  1Q9I A;  1IUX A;  3V5F A;  2JK6 A;  2OG9 A;  3CIR A;  2PA6 A;  1RVK A;  2BXR A;  4GYP C;  4DHG A;  3DJE A;  4E8G A;  5HY5 A;  4TVW A;  2ZBW A;  3ALL A;  3IK4 A;  5U63 A;  4DGK A;  3T37 A;  4H19 A;  3UKP A;  2F5Z A;  2C7G A;  3RR1 A;  3VC6 A;  3AB1 A;  2A8X A;  1M6I A;  3GD6 A;  1QLB A;  5BUL A;  2WOI A;  4K5S A;  5TR3 A;  1UKV G;  2W3R A;  3GC2 A;  4EQX A;  2GGE A;  3NVY B;  4A9W A;  2BAB A;  1SJC A;  2QJM A;  4HCD A;  3ADA B;  3QVR A;  3SFD A;  2WHD A;  2YAU A;  1H6V A;  2YLX A;  3RO6 A;  1DJQ A;  4H4R A;  4GFI A;  2C76 A;  4USQ A;  3SQS A;  4H4Y A;  4H4S A;  1EBH A;  1P43 A;  2GAG B;  3UTH A;  2QJJ A;  4Z2U A;  3T2K A;  3MKC A;  5DBJ A;  5C3J A;  1KD0 A;  3ZVH B;  1N4U A;  4OCG A;  3MZN A;  3UP5 A;  4YKG A;  4H2H A;  1BKH A;  2XYO A;  2WOV A;  2WDQ A;  4OPI A;  5GRT A;  1K0J A;  3HYV A;  1MDL A;  2JBV A;  1F8S A;  4X9N A;  1GRG A;  2YLW A;  4ADW A;  2R9Z A;  2XFO A;  3AD8 B;  5J7X A;  2X99 A;  1S3B A;  3HYW A;  1E9I A;  3ES7 A;  4EM3 A;  3M0O A;  2R46 A;  2BRY A;  1GTE A;  1N5X A;  4JDR A;  1BF3 A;  3HPF A;  3AYI A;  1CJC A;  4HCL A;  3R1Z A;  1XS2 A;  1D4D A;  2PYX A;  4IV9 A;  3ZYX A;  3UCD A;  2XH4 A;  1ZMD A;  3Q45 A;  1CBO A;  3RGT A;  5BOE A;  4Z17 A;  5IQ4 A;  3QFA A;  3AE4 A;  4HA6 A;  2YVF A;  3NFU A;  2DKH A;  1TKK A;  1L9C A;  4J36 A;  4CY6 A;  3QN3 A;  4K22 A;  2PTY A;  2B7S A;  3DGZ A;  4KX6 A;  4MMW A;  3NVZ B;  2C72 A;  1PXC A;  3PO7 A;  1ZKQ A;  2GAH B;  1KKO A;  5KNL A;  1ZP0 A;  2BCG G;  6ENL A;  3LZW A;  3H8A A;  2XVH A;  3I6D A;  3SSZ A;  3PWG A;  2ZC8 A;  4M52 A;  1PXA A;  4U2S A;  2HXU A;  4K7Z A;  1VDC A;  1VRQ B;  1ONE A;  1EL5 A;  3DES A;  4CNJ A;  2RAB A;  3THU A;  1TDO A;  3S47 A;  4JNA A;  3DJJ A;  3D9X A;  3SX6 A;  5U1O A;  4GRT A;  2IVD A;  4DNA A;  3AEA A;  3LJP A;  1XHC A;  3AWI A;  2PP3 A;  3SN1 A;  4TLZ A;  2PSN A;  1ZMC A;  2OZT A;  2NQL A;  1NHR A;  2GB0 A;  3QKE A;  2ACZ A;  3AED A;  2PTZ A;  4H7U A;  2RDX A;  4FP1 A;  4J2W A;  3K7Q X;  4RG3 A;  4FDC B;  3AE8 A;  3S61 A;  1TYT A;  1PBC A;  1DOD A;  2XFP A;  1N4W A;  4DN1 A;  2OPJ A;  1CHU A;  3PWI A;  3NYE A;  3DGB A;  3KLJ A;  2MNR A;  1ZY8 A;  2QDE A;  2MUC A;  2OFJ A;  3UJ2 A;  1FOH A;  2R4E A;  3C96 A;  3VFC A;  3AE7 A;  2E1M A;  3TTE A;  4AOX A;  4P9S A;  4H50 A;  2XH0 A;  2VQB A;  4HB9 A;  3HZL A;  4GGH A;  1O5W A;  2P8C A;  4G6G A;  4ZCW A;  1W4X A;  1K4Q A;  1CJ2 A;  1VQW A;  3AM9 A;  1GES A;  1KDG A;  3NG7 X;  2B76 A;  2POZ A;  4C5O A;  4E4F A;  2J3N A;  4B67 A;  2WPF A;  3EEZ A;  2P0I A;  3H12 A;  1KSU A;  3P93 A;  3AE3 A;  4PAA A;  2X8C A;  2EQ7 A;  2Q7V A;  1CJ3 A;  1E1K A;  2FJB A;  4XXG A;  1GER A;  3AE1 A;  3I3L A;  4H4Q A;  4OPG A;  4A6N A;  3VQR A;  3DK8 A;  1AOG A;  1FHU A;  1BWC A;  3MY9 A;  2UZZ A;  4OPC A; 
#chains in the Genus database with same CATH homology
 2GR1 A;  2YR4 A;  3CPH G;  2WP6 A;  2APG A;  4C74 A;  4K8D A;  3KVE A;  3PG6 A;  3M12 A;  3AEC A;  3BNU A;  2XLS A;  3DGH A;  3NN6 X;  4YTM A;  1LQT A;  2V6O A;  4U8P A;  3V76 A;  1K0I A;  5KRQ A;  4FK1 A;  5JRB A;  2CVJ A;  2XLT A;  5ER0 A;  2XFU A;  2GR2 A;  4K2X A;  1L9E A;  4TLX A;  4ZCC A;  4ECH A;  4UDP A;  2BK4 A;  4GDE A;  2WP9 A;  3DK9 A;  3RHA A;  4H4U A;  3NTD A;  4NNJ A;  2FJD A;  4XWZ A;  4NTD A;  5KMS A;  2CFY A;  1P2H A;  3H8I A;  3CNJ A;  1GOS A;  3ICT A;  3SZC A;  4YTN A;  1ZK7 A;  2WES A;  3V3N A;  1D4E A;  2BC0 A;  2Y6R A;  3AD7 B;  5BVA A;  3LXD A;  3SQP A;  4CCQ A;  2BXS A;  1H84 A;  4U2T A;  2IVE A;  1DXL A;  3AYL A;  2OLO A;  5KMP A;  3QSE A;  2WU2 A;  2BS3 A;  3UTE A;  3RNM A;  1RYI A;  2PHH A;  1DOE A;  2WBA A;  5HXI A;  1XAN A;  4U8L A;  2C66 A;  3NK2 X;  3II4 A;  1CC4 A;  1ELI A;  4PAB A;  1EBD A;  2XLU A;  2C4C A;  3OZ2 A;  4MJW A;  4KPR A;  2C67 A;  4YXD A;  2OA1 A;  4AP3 A;  4N9X A;  4YT0 A;  2XDO A;  4C3Y A;  3T31 A;  3UTF A;  5BUK A;  1XPQ A;  4EQR A;  3JSK A;  3QVP A;  4NTC A;  5CKU A;  5M0Z A;  4ZCD A;  5KOW A;  2GR0 A;  2Q0K A;  2B9X A;  3GD4 A;  2JB2 A;  3QJ4 A;  4EMW A;  1GND A;  2A87 A;  2C75 A;  3P4Q A;  4DSH A;  3L8K A;  4G6H A;  1DJN A;  2YG7 A;  1KNR A;  1E7P A;  4YSY A;  3R9U A;  3DME A;  1BZL A;  4YKF A;  3LAD A;  2YWL A;  3KD9 A;  3BI2 A;  4B63 A;  1NG4 A;  3IWA A;  3SZF A;  2GV8 A;  1GET A;  4B69 A;  3IF9 A;  2QCU A;  3GDN A;  3GSI A;  1ZDL A;  2C65 A;  3KKJ A;  1PBD A;  4NEW A;  3UOZ A;  2FJE A;  2WDV A;  1E39 A;  3P4S A;  4CY8 A;  1H7W A;  1GRB A;  4J34 A;  4A6N B;  4AT0 A;  2YLS A;  1H7X A;  3T2Z A;  1H83 A;  2YLZ A;  1Q9I A;  4AOS A;  1OJ9 A;  2AR8 A;  1IUX A;  2H88 A;  3VR8 A;  3UCL A;  1YQ3 A;  1L9D A;  2JK6 A;  1D4C A;  2WET A;  1IUV A;  1NG3 A;  3CIR A;  4CRT A;  1CL0 A;  1HYU A;  4O5Q A;  2C73 A;  2V3B A;  2BXR A;  4Z2R A;  3PS9 A;  1EL8 A;  3NHO X;  4UP3 A;  1D5T A;  2X8G A;  4O5U A;  2EQ8 A;  2WQY A;  2XLR A;  1NEN A;  2OAM A;  4J57 A;  4APN A;  1L0V A;  3DJE A;  3Q9T A;  2Q6U A;  5HY5 A;  4H4W A;  2ZBW A;  1GV4 A;  2YG5 A;  2WDR A;  3ALL A;  5U63 A;  4DGK A;  3T37 A;  1JU2 A;  3UKP A;  4YSZ A;  1SEZ A;  2F5Z A;  2BRA A;  2QAE A;  2C7G A;  3ITJ A;  3EAN A;  2BK3 A;  2YG3 A;  2R0P A;  2BC1 A;  3UKA A;  3AB1 A;  2A8X A;  4Z43 A;  1M6I A;  1QLB A;  3BNM A;  5BUL A;  2WOI A;  1H82 A;  2CDU A;  5TR3 A;  4K5S A;  3NIX A;  1X31 B;  3AEB A;  1UKV G;  5FS8 A;  3CNP A;  3EAO A;  4Z44 A;  4EQX A;  3G5R A;  3NKS A;  2Z5Y A;  4A9W A;  3F8D A;  2BAB A;  2GEW A;  4H2R A;  3ADA B;  3QVR A;  3NT6 A;  2JKC A;  3SFD A;  3SXI A;  4GR1 A;  2WHD A;  2YAU A;  3CPI G;  4Z24 A;  4FX9 A;  5JCL A;  3FG2 P;  2VZ2 A;  4GDP A;  5CQF A;  3UKL A;  1H6V A;  1ZX9 A;  2BCP A;  2YLX A;  3DK4 A;  3VRA A;  2XVF A;  3GDP A;  4GUV A;  4H2P A;  4I59 A;  5EB5 A;  1S7M A;  5U25 A;  2I0Z A;  1NAA A;  4H2Q A;  3NGC X;  3RP6 A;  1IJH A;  1GRH A;  3SFE A;  4Z26 A;  1PJ7 A;  1DJQ A;  4H4R A;  3NTA A;  3CPJ G;  3H8L A;  1Y56 B;  4YSH A;  1P2E A;  2C76 A;  1ZOV A;  4G73 A;  4USQ A;  3GWD A;  4EMI A;  3KPK A;  1V59 A;  2NVK X;  3CGB A;  4H4Y A;  2WPE A;  2XFQ A;  3UKF A;  4H4S A;  1PN0 A;  2GAG B;  3UTH A;  3UOV A;  3T14 A;  3LB8 A;  4NEV A;  4II2 A;  4Z2U A;  3BI5 A;  2EQ9 A;  1PBB A;  3K7T A;  3T2K A;  2V5Z A;  1FCD A;  4GCM A;  4NWZ A;  1GTH A;  1LQU A;  1YKJ A;  1TDE A;  5DBJ A;  1MXT A;  4U8K A;  5C3J A;  1QJD A;  2QA2 A;  3RP8 A;  3D1C A;  3AD9 B;  1N4U A;  3FBS A;  1OJT A;  3G5Q A;  4OCG A;  2VVL A;  3HYX A;  3UP5 A;  4YKG A;  1GRE A;  2BAC A;  1FL2 A;  3KA7 A;  2RGH A;  2XYO A;  3ATR A;  1O95 A;  4GAP A;  4TM0 A;  2WOV A;  1JRY A;  2YQU A;  1NHQ A;  2WDQ A;  3QFB A;  3GYI A;  4OPI A;  5GRT A;  3VR9 A;  1K0J A;  3HYV A;  5HHF A;  3ISH A;  4Y4M A;  2JBV A;  4BK3 A;  1F8S A;  4X9N A;  3UKH A;  1REO A;  1IUT A;  5C2T A;  1S2Q A;  2C64 A;  1GRG A;  2ZZC A;  3CGD A;  4EM4 A;  2YLW A;  3P4R A;  4WCT A;  4J56 A;  4ADW A;  1DNC A;  2GQF A;  2YG6 A;  2R9Z A;  4YTP A;  2XFO A;  5KMQ A;  3AD8 B;  5J7X A;  3M13 A;  4D04 A;  4YSX A;  2YR6 A;  2X99 A;  1S3B A;  2X3N A;  4REK A;  1GRF A;  3URH A;  2GVC A;  4B1B A;  4B65 A;  1CJ4 A;  4BK1 A;  1PDH A;  3HYW A;  4OPT A;  2IID A;  1F8R A;  4JQ9 A;  2WS3 A;  1TRB A;  3ATQ A;  3ICS A;  4EM3 A;  5IPY A;  2YVJ A;  3M0O A;  4XWR A;  4Y4N A;  2R46 A;  1YQZ A;  3AE2 A;  4U2L A;  2BRY A;  3T2Y A;  5JCN A;  1NDA A;  3B6D A;  1GTE A;  3GWF A;  1ZOY A;  4JDR A;  4UDQ A;  1LV0 A;  2HQM A;  1E1M A;  2AAQ A;  1H86 A;  1BF3 A;  2X8H A;  1CJC A;  2R0C A;  3AYI A;  4JY2 A;  1D4D A;  2PYX A;  4IVO B;  2DKI A;  4C77 A;  1KSS A;  2R45 A;  2A89 A;  2BK5 A;  2V61 A;  1D7L A;  4Z25 A;  5KXJ A;  2CUL A;  3ALM A;  4IV9 A;  1JRZ A;  2Q0L A;  3ZYX A;  5JCK A;  3AE5 A;  1TYP A;  4U8M A;  4CBQ A;  1B37 A;  2XVJ A;  1Y56 A;  3SZ0 A;  4X9M A;  1ZMD A;  1TDN A;  3NLC A;  5KMR A;  1CBO A;  1XDI A;  2RGJ A;  1YQ4 A;  3F8P A;  5IQ4 A;  2B9W A;  3QFA A;  3AE4 A;  2XVI A;  4IA5 A;  4HA6 A;  4CNK A;  2YLT A;  4D03 A;  2YVF A;  2WP5 A;  4CCR A;  1COY A;  2DKH A;  3CGC A;  2O9Z A;  3BHK A;  4K5R A;  4H2N A;  2GQW A;  2NPX A;  4A5L A;  2VOU A;  1M64 A;  3F8R A;  3K7M X;  1PXB A;  1L9C A;  3PVC A;  5IQ1 A;  3OC4 A;  1IUS A;  1N1P A;  4J36 A;  4BK2 A;  3RED A;  1MOK A;  1FEB A;  4CY6 A;  4K22 A;  1OJD A;  3GYX A;  1PHH A;  5L46 A;  3SY4 A;  1JOA A;  1RSG A;  2B7S A;  4TM4 A;  3IC9 A;  3DA1 A;  3GMC A;  3AYJ A;  3NK1 X;  3UTG A;  1KFY A;  4EMJ A;  3DGZ A;  2GMJ A;  3AEG A;  2C3C A;  5JCI A;  4KX6 A;  2RGO A;  2C3D A;  1VG9 A;  3CN8 A;  5FS9 A;  2WEU A;  4I58 A;  4LII A;  2C72 A;  3NH3 X;  1PXC A;  4OVI A;  1B5Q A;  1F8W A;  4H4T A;  4U8N A;  1Z6L A;  3PO7 A;  2WPC A;  1ZKQ A;  2GAH B;  4Z2T A;  3DJG X;  4BUR A;  3L5O A;  1Y0P A;  4A79 A;  5KNL A;  4YWO A;  1ZP0 A;  4EQW A;  2BCG G;  3VRB A;  1KN0 A;  3ALJ A;  3C4N A;  2AQJ A;  3LZW A;  2ZZ0 A;  4ZN0 A;  2XVH A;  1O94 A;  2Y6Q A;  2R4J A;  2YLR A;  3NN0 X;  3I6D A;  4JY3 A;  4A65 A;  3UKQ A;  4A99 A;  1NEK A;  4M52 A;  1RP0 A;  1PXA A;  3ICR A;  4U2S A;  4U8J A;  4K7Z A;  1VDC A;  1VRQ B;  3CTY A;  1EL5 A;  4EIP A;  3AE6 A;  4CNJ A;  1S2Y A;  2RAB A;  1TDO A;  4RG4 A;  5KVI A;  2QA1 A;  4JNQ A;  4JNA A;  2GF3 A;  1NHS A;  3DJJ A;  2XCG A;  4TM1 A;  3D9X A;  4AT2 A;  1JNR A;  3SX6 A;  4H4P A;  5U1O A;  4GRT A;  3SZW A;  4II3 A;  3UP4 A;  1JRX A;  2C70 A;  1FEC A;  3FPZ A;  2IVD A;  1LJ1 A;  4DNA A;  3LZX A;  3AEA A;  1TDF A;  3LJP A;  1MO9 A;  3AEF A;  3CGE A;  1Q1W A;  1XHC A;  3AWI A;  3NRN A;  4C3X A;  2Z5X A;  2B9Y A;  3LOV A;  4TLZ A;  3COX A;  1ZMC A;  1DOC A;  1PJ6 A;  3CMM A;  3KU9 A;  3FIM B;  3AEE A;  4U8I A;  1QO8 A;  3GYJ A;  3NK0 X;  1NHR A;  2GB0 A;  1E6E A;  1PJ5 A;  2ACZ A;  3AED A;  5GSN A;  4H7U A;  3K30 A;  3AXB A;  3DJD A;  2ZZB A;  4J2W A;  1DOB A;  2FJA A;  3ABV A;  1PBE A;  1GAL A;  2XVE A;  3K7Q X;  1F3P A;  1S3E A;  4G74 A;  4RG3 A;  3NNE A;  4BJY A;  2VVL G;  4OPU A;  5KWF A;  4FDC B;  3AE8 A;  3Q6J A;  2FBW A;  3S61 A;  1TYT A;  1PBC A;  4UDR A;  5M10 A;  1DOD A;  2XFP A;  3QSS A;  2X50 A;  1GRA A;  4H4Z A;  1N4W A;  2YR5 A;  3UOX A;  2BS2 A;  1K0L A;  2EQ6 A;  1EL9 A;  4H4X A;  1CHU A;  3B3R A;  3IHG A;  3BHF A;  5J60 A;  2VRL A;  4U8O A;  3NYE A;  2JB3 A;  3KLJ A;  4J31 A;  3RP7 A;  2BS4 A;  3CND A;  3NYC A;  1F6M A;  1YY5 A;  2BA9 A;  2JB1 A;  4OPL A;  3ZDN A;  1OJA A;  1ZY8 A;  2OAL A;  3GD3 A;  1TDK A;  3CNS A;  3NYF A;  4ICY A;  2YM1 A;  4EIQ A;  4TM3 A;  3UOY A;  1Q1R A;  2YG4 A;  3KPF A;  1FOH A;  2VRM A;  3CNT A;  1N4V A;  2R4E A;  3SGL A;  3C96 A;  4B64 A;  5EB4 A;  1PS9 A;  4BV6 A;  3AE7 A;  2E1M A;  1IUU A;  3GRS A;  4GF7 A;  1H2I A;  4RSL A;  3V3O A;  4AOX A;  2WOW A;  4BJZ A;  4E0V A;  1OJC A;  3EF6 A;  3GMB A;  4H50 A;  4P9S A;  2VQB A;  4HB9 A;  2W0H A;  3O0H A;  1ONF A;  3HZL A;  4IVM B;  1O5W A;  4G6G A;  3D8X A;  1W4X A;  2ARD A;  2GMH A;  2GRT A;  2R0G A;  4J33 A;  4LU6 A;  3T0K A;  4B66 A;  1LVL A;  3WE0 A;  1GEU A;  3DH9 A;  2H89 A;  2YVG A;  3EPT A;  2JAE A;  4JN9 A;  4USR A;  3S5W A;  1K4Q A;  3VRD B;  5LV9 A;  4X4J A;  1GXF A;  2B7R A;  1CJ2 A;  1VQW A;  3P4P A;  2YM2 A;  1KNP A;  2E5V A;  5FMH A;  1H81 A;  1GES A;  1KDG A;  3G5S A;  4G9K A;  4NZH A;  1JEH A;  5BRT A;  1LTX R;  3E1T A;  2V3A A;  4H4V A;  3NG7 X;  2B76 A;  4A7A A;  1GSN A;  2GR3 A;  1CC6 A;  4Y4L A;  4C5O A;  2J3N A;  1NHP A;  5JCM A;  3SM8 A;  4DSG A;  4B67 A;  2VVM A;  2WPF A;  4OPD A;  5KOX A;  2GH5 A;  1NPX A;  1B8S A;  1IUW A;  1E1N A;  1KSU A;  1BGJ A;  3AE3 A;  3H4K A;  1CF3 A;  3C4A A;  4NTE A;  4B68 A;  3P9U A;  4PAA A;  5EBK A;  1GPE A;  5KVH A;  2WU5 A;  2X8C A;  2EQ7 A;  5FS7 A;  1FEA A;  2XLP A;  2OLN A;  1BGN A;  1JNZ A;  2Q7V A;  1CJ3 A;  4GAV A;  2BYB A;  1GRT A;  1GT8 A;  3BI4 A;  2V60 A;  4WX1 A;  1D7Y A;  2E4G A;  1E1K A;  2FJB A;  4XXG A;  1GER A;  5HYM A;  5EOW A;  1CC2 A;  4FK1 C;  3QSM A;  1E1L A;  1EL7 A;  2TPR A;  2TMD A;  3AE1 A;  3FMW A;  2XFN A;  4IA6 A;  3SYI A;  4AP1 A;  3I3L A;  3GRT A;  4H4Q A;  1PBF A;  4OPG A;  4A6N A;  3VQR A;  5FS6 A;  3DK8 A;  1AOG A;  1BKW A;  3IHM A;  3P1W A;  1BWC A;  3L1R A;  3AE9 A;  4EQS A;  1KF6 A;  3UKK A;  1LPF A;  1VG0 A;  1B4V A;  2VQ7 A;  4LA1 A;  2UZZ A;  4OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...