1NHSA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (h2o2(a))
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 137
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhsA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA02
2GH5A 1JNZA 4J31A 1ELIA 2FJDA 4A6NA 1KNPA 2ZBWA 3AEGA 2BS2A 3NHOX 3V3NA 2GR0A 2WP9A 3LXDA 2B76A 2Q0KA 1VG9A 1BWCA 2C3DA 2YM1A 5M10A 3CNJA 2C3CA 5L46A 2OA1A 4FK1A 4HA6A 3QSMA 1N1PA 3GDNA 3ADAB 4CY8A 4JY3A 3NYFA 1PHHA 3D1CA 2C67A 4CBQA 1CC4A 4GDEA 4J33A 2FJEA 2GQFA 2GRTA 2XVHA 1QJDA 4J56A 2B9YA 3DJEA 2BCGG 1N4UA 2UZZA 3AE8A 3NTDA 3SFDA 4B63A 4D04A 1BGJA 1RP0A 4CNJA 4H4XA 3NLCA 3CNDA 1F3PA 3K7QX 1REOA 4YKGA 1EBDA 3GWDA 5M0ZA 4B68A 5LV9A 2R46A 5FS9A 1GESA 1NPXA 5BVAA 2A89A 4AP3A 4YTNA 4AT2A 4EMWA 2JB2A 3S5WA 3AWIA 4CNKA 4E0VA 2C7GA 4H2RA 2E4GA 1Y0PA 4RG4A 3AYIA 1S3BA 2YG3A 3DA1A 3NYCA 1EL8A 4H2NA 1TRBA 2B9XA 2EQ7A 1B37A 3AYJA 3G5QA 2WETA 1TDOA 2V3AA 3UP5A 2OAMA 1NAAA 3UKAA 4IA6A 3UKLA 3AXBA 1S2QA 2ARDA 3AE1A 4OPGA 4B67A 2YLWA 4M52A 1V59A 3Q6JA 1LJ1A 1O5WA 2XLTA 3O0HA 3ATRA 3VRDB 5KWFA 1GXFA 4H4PA 3UKFA 1H83A 2BACA 1OJCA 1JRZA 2EQ8A 2VZ2A 3GWFA 3AEBA 5KOXA 3DH9A 3GMBA 1EL5A 3FPZA 4XXGA 3ZDNA 4EQWA 1JRXA 3CPJG 4FDCB 1IUTA 5U25A 4EIPA 2WEUA 2RABA 2PYXA 1GT8A 3UKQA 4YWOA 3KVEA 1CBOA 2GV8A 4O5QA 3AECA 2GR3A 2CULA 4ADWA 4OPTA 2XDOA 1BZLA 3CGCA 4YTPA 3PS9A 3S61A 2CVJA 4TLXA 4NEWA 4Z25A 1FEAA 4U8LA 2WHDA 3ICRA 3LADA 2EQ9A 1VG0A 2BYBA 4OPCA 2YR6A 2R9ZA 1PBCA 1GRBA 1CC2A 5EBKA 3RHAA 2RGOA 1CL0A 3UTGA 4B69A 3LZXA 2TPRA 4K8DA 1E7PA 2X99A 1PJ6A 3NK2X 1ZY8A 3FG2P 3AEEA 4B1BA 1K4QA 3CNSA 2XVIA 1NHRA 2AQJA 1GV4A 2WPFA 1E39A 4OPIA 4U8JA 3VQRA 2YLXA 3AYLA 3BHFA 1JNRA 3L1RA 1H6VA 2H89A 2BC0A 1NENA 2E5VA 1MO9A 1K0JA 1FEBA 1D4CA 3VR9A 3KLJA 4H7UA 2B9WA 5JCKA 2YG6A 3BI4A 3P1WA 2C75A 1GPEA 2WDQA 3I6DA 4CY6A 3EF6A 3C4AA 4BJZA 3EPTA 1X31B 1GTEA 4ECHA 1D5TA 3ICTA 4H4RA 2R4EA 2C70A 4BURA 2JB3A 4I59A 1ZDLA 4AOSA 3FIMB 2Q7VA 4YKFA 1ZX9A 1KFYA 4C74A 5BRTA 2O9ZA 5FS8A 1DJNA 4K22A 2I0ZA 3GDPA 2BCPA 5J7XA 4JY2A 3NK1X 2YVJA 2JAEA 4U2TA 1FCDA 1S3EA 4U8MA 2C72A 2X8GA 4NEVA 3RNMA 5JCMA 1H81A 1PJ5A 1TDKA 3AE2A 1CHUA 2OALA 2F5ZA 1GRGA 3L8KA 4EM4A 1SEZA 2WS3A 2XFNA 2JKCA 3UOYA 4H4QA 4I58A 3VR8A 4Y4MA 4EIQA 4C5OA 2V5ZA 5EB4A 3AD8B 1OJ9A 4ZCDA 1L9DA 3DGHA 1GRTA 2BS4A 2IVEA 3GMCA 1Y56A 1RSGA 3UKKA 4YT0A 1PXBA 1IUVA 4EM3A 1HYUA 2A8XA 2WOIA 1S2YA 4Z24A 3ZYXA 4C77A 1YQZA 3OZ2A 4OCGA 4X9MA 3KU9A 3UOXA 1GOSA 2YG4A 5FS6A 1D7YA 2YG5A 3K30A 4JNQA 1M64A 4D03A 2VVLG 1GREA 3PVCA 3LJPA 5C3JA 1ZK7A 4USRA 1FL2A 3FMWA 3CTYA 4C3YA 4U8OA 1F8SA 1KNRA 5CQFA 5HHFA 3GSIA 3RP7A 2WPCA 1VQWA 1IJHA 1MOKA 1LV0A 4ZCCA 3BI5A 3GRTA 2VVMA 1O94A 2BK3A 2GMHA 1PBEA 3CGBA 4X4JA 4B64A 2YWLA 4Z2TA 4OPUA 3KD9A 2V61A 1GRFA 4A6NB 1BGNA 2XLPA 4H4SA 5DBJA 4ZN0A 5JCLA 4BJYA 3CN8A 3ABVA 2BC1A 1RYIA 4YSHA 3IHMA 2ACZA 3IC9A 3ATQA 2BABA 3NKSA 3QFAA 5U1OA 1DXLA 4U8IA 4EMIA 4TM3A 3GYJA 2WU5A 4H4TA 4U2LA 3ALLA 4XWZA 1FOHA 4Z44A 3UP4A 4BK1A 4U8KA 2R0CA 1GNDA 2GF3A 3VRAA 3UTFA 2QA2A 2R45A 2WU2A 4YSZA 4TM4A 4K7ZA 1AOGA 1GRAA 1JOAA 1GETA 1PBFA 3M13A 4H2QA 1TYTA 4APNA 3UOVA 4BK2A 2C65A 2NVKX 3UTHA 4AOXA 4OPLA 2CFYA 4CCQA 4U2SA 2BXRA 2OLOA 1XPQA 3IF9A 1UKVG 2B7SA 1K0IA 3NN6X 2FJBA 4C3XA 1ZMCA 2DKIA 3KPFA 4NTCA 3R9UA 3LZWA 2WDRA 1B8SA 5FS7A 4B66A 1OJAA 1TDEA 3BHKA 1B5QA 3AEFA 2JB1A 2XLUA 3QVPA 3CIRA 2QA1A 1ONFA 5KOWA 3NYEA 1YKJA 3UOZA 1D7LA 1KSSA 2JBVA 3NG7X 2VVLA 2Y6QA 1KDGA 2XVEA 3I3LA 4YSYA 3P4QA 4BV6A 1E1LA 2C76A 4RG3A 3PO7A 5J60A 4A65A 4A7AA 2HQMA 4JNAA 3E1TA 4GUVA 4UDPA 2WESA 2CDUA 1ZP0A 4Z43A 1LQTA 2GR2A 4EQRA 1DODA 3Q9TA 1ZMDA 3H8LA 1TDNA 1P2HA 1GEUA 5ER0A 3B3RA 1COYA 1YY5A 3T37A 2YG7A 4K2XA 2AAQA 1EL7A 1PJ7A 3DJGX 2ZZ0A 1YQ4A 3SFEA 2YVGA 1LTXR 2R4JA 3F8DA 3WE0A 3UCLA 3GRSA 4N9XA 3RP6A 4Y4NA 5GSNA 2V60A 4EQXA 3GYIA 4K5RA 3NT6A 1H7XA 2GAGB 2XFOA 4YXDA 1DJQA 4TM1A 3DMEA 5KXJA 3NNEA 3ICSA 5IQ4A 2QAEA 1JEHA 2YAUA 2BXSA 2Z5YA 1XDIA 4XWRA 4RSLA 3AD7B 1Q9IA 1ZOVA 3NH3X 5U63A 3NK0X 4J36A 4U8NA 4IA5A 2ZZCA 1GSNA 3K7MX 1W4XA 3G5SA 1E6EA 3LOVA 4UDQA 4X9NA 1D4DA 4EQSA 1PXCA 1GRHA 2BS3A 1H82A 1PS9A 3KKJA 4MJWA 4P9SA 4REKA 2NPXA 4BK3A 1DOCA 3SQPA 3II4A 4GDPA 4DSGA 2WQYA 2ZZBA 2YR4A 5CKUA 1NDAA 3HZLA 1NHQA 2C73A 3G5RA 3BNMA 2WBAA 2JK6A 1CJCA 2X8CA 1B4VA 2Q0LA 2GB0A 3C4NA 3UKHA 2YLSA 3P4SA 4NTDA 4K5SA 2V3BA 4LA1A 3LB8A 3EANA 3NTAA 2YLRA 4Y4LA 4H4VA 1QO8A 3AEAA 1YQ3A 1D4EA 3QFBA 3CNTA 3NRNA 3P9UA 4A79A 1BKWA 4AT0A 2R0PA 3F8PA 4IV9A 5JCIA 2R0GA 2YLTA 2YR5A 3CNPA 1DNCA 3IHGA 4ICYA 2X3NA 3AE9A 1F6MA 3AE5A 4EMJA 1NHPA 4GR1A 2IVDA 4YSXA 5FMHA 2YM2A 1JRYA 1IUSA 1TYPA 3P4RA 4J2WA 3CPIG 1KF6A 1OJDA 2IIDA 3DK4A 4YTMA 4USQA 1IUWA 3D8XA 5EB5A 2X8HA 4Z2UA 1GTHA 3ALMA 5KVIA 1M6IA 2WP6A 1VRQB 3CPHG 3SM8A 3DJDA 1K0LA 2FJAA 1Y56B 4UP3A 1H86A 2XYOA 2XFPA 1Q1RA 4WX1A 1PBBA 4H4ZA 1IUXA 5GRTA 2A87A 2Q6UA 3QSEA 1L0VA 4O5UA 3BNUA 2GR1A 1E1KA 2VRLA 3DJJA 3DK9A 1MXTA 3P4PA 2WDVA 3DK8A 1CJ2A 3C96A 1FECA 2OLNA 3EAOA 1TDFA 3FBSA 3V76A 1CF3A 4TM0A 1OJTA 2WOWA 1XANA 4FX9A 1LPFA 2VQBA 4KX6A 4J57A 1PDHA 2BA9A 4WCTA 5KVHA 3OC4A 1NG3A 5IQ1A 5HYMA 5HY5A 1H84A 1ZKQA 3QJ4A 2GEWA 4H50A 4GCMA 2APGA 4B65A 2VOUA 2V6OA 1CC6A 4OVIA 2FBWA 3F8RA 4PABA 2X50A 3NGCX 3UKPA 4HB9A 2RGJA 3M12A 2AR8A 2XLSA 3URHA 1DOEA 1PN0A 3IWAA 1NHSA 4CCRA 2C66A 4PAAA 3AB1A 3QVRA 3H8IA 1GALA 3AE6A 2DKHA 1F8RA 1ZOYA 4U8PA 3GD4A 3REDA 1Z6LA 3ALJA 3UTEA 3SGLA 1QLBA 2BK5A 2J3NA 2XCGA 1KSUA 4DNAA 2GAHB 1LVLA 2TMDA 4FK1C 3JSKA 5C2TA 4H4YA 1XHCA 2H88A 5JCNA 5EOWA 4A99A 5TR3A 1E1MA 4UDRA 2YQUA 4GF7A 2EQ6A 3H4KA 4H4WA 3QSSA 5KRQA 2WOVA 1NG4A 3AE4A 2YVFA 3VRBA 3CGEA 1N4VA 2GMJA 5IPYA 2VQ7A 4JN9A 2YLZA 4NTEA 3K7TA 2PHHA 2C64A 3AE7A 3COXA 2Z5XA 3V3OA 1Q1WA 1N4WA 4LU6A 3CGDA 3KA7A 5HXIA 4LIIA 5BUKA 3DGZA 1P2EA 4AP1A 1L9CA 4J34A 4CRTA 1JU2A 3RP8A 4Z2RA 4H2PA 4H4UA 1CJ3A 1F8WA 4JQ9A 4DGKA 3GD3A 1GERA 1EL9A 2VRMA 4JDRA 1BF3A 3ITJA 4IVOB 2XLRA 1PBDA 2GVCA 2XFQA 2WP5A 1VDCA 3BI2A 2W0HA 4TLZA 3AD9B 1O95A 1DOBA 2RGHA 1L9EA 4NZHA 3AEDA 4IVMB 3AE3A 3NIXA 4A9WA 4A5LA 5BULA 2XFUA 2QCUA 2B7RA 2E1MA 4DSHA 1E1NA 4Z26A 1LQUA 4GRTA 1IUUA 2WPEA 1PXAA 2BK4A 4KPRA 1NEKA 2Y6RA 3B6DA 3NN0X 2GQWA 3M0OA 1CJ4A 2XVFA 3ISHA 1H7WA 4OPDA 2XVJA
chains in the Genus database with same CATH superfamily
2GGEA 4A6NA 3V3NA 5KMSA 3LXDA 1VG9A 1BWCA 2C3DA 2YM1A 2GGGA 4IP4A 3IJLA 3TJ4A 1SJCA 3ZLFA 3CNJA 5L46A 4FK1A 3QSMA 3ADAB 4JY3A 3STPA 2C67A 4J33A 3MQTA 1N4UA 3SFDA 4B63A 3SZWA 4CNJA 4GAPA 4H4XA 3CNDA 1F3PA 4YKGA 1REOA 5LV9A 5BVAA 5FS9A 1GESA 4EMWA 2JB2A 4RG4A 3AYIA 1S3BA 3G5QA 2WETA 2V3AA 3OPSA 1NAAA 3UKAA 1TKKA 3VFCA 4M52A 4YWSA 3VRDB 5KWFA 3CXBA 3GWFA 3MWCA 3DH9A 3D9XA 3FPZA 4XXGA 3AM9A 1IUTA 3UKQA 4YWOA 2CULA 4ADWA 3DESA 3S61A 4TLXA 3S5SA 1FEAA 2EQ9A 4OPCA 4E4UA 5EBKA 3SN0A 2RGOA 3LZXA 2TPRA 1E7PA 1PJ6A 3AEEA 2XVIA 1NHRA 2WPFA 1JPDX 3AYLA 3R10A 2BC0A 4HCLA 2E5VA 1MO9A 4HNCA 4H7UA 2B9WA 2C75A 1GPEA 2PP3A 4BJZA 1X31B 1GTEA 3ICTA 3EUB3 2C70A 2JB3A 3FJ4A 1N5XA 3NO1A 1KFYA 3RR1A 4C74A 5BRTA 1KKRA 3RCYA 5J7XA 3SXIA 1S3EA 4NEVA 5KNLA 3RNMA 2PSNA 5JCMA 2OX4A 1GRGA 3L8KA 1ONEA 4H4QA 4EIQA 4C5OA 3AD8B 1L9DA 2GDQA 2XGZA 2OQHA 3UKKA 1SB3B 1PXBA 5G5GB 1IUVA 4ZOHB 2OQYA 3HYWA 2WOIA 4Z24A 4OCGA 4G6GA 4X9MA 2YG5A 2VVLG 3LJPA 4U8OA 5CQFA 3RP7A 3UJFA 1IJHA 1MOKA 3GRTA 1O94A 2BK3A 2POZA 4A6NB 4ZN0A 4BJYA 2W55A 3IHMA 2ACZA 3ATQA 1DXLA 4H1ZA 4EMIA 3GYJA 2C4CA 1FO4A 3R07C 4XWZA 2GF3A 1JROA 2R45A 2OZ3A 4TM4A 4H2QA 1AOGA 3M13A 1PBFA 3UOVA 4AOXA 4OPLA 3KPFA 2DKIA 5BOFA 3JVAA 4HYRA 3I4KA 4B66A 3UJ2A 3AEFA 2JB1A 5BOEA 2QA1A 1ONFA 1YKJA 2JBVA 3NG7X 3UXKA 2XVEA 4BV6A 2C76A 4RG3A 4A7AA 4DX3A 4H83A 3E1TA 3Q9TA 4J3ZA 4FP1A 5ER0A 2XSXA 1YY5A 4K2XA 2HXUA 2AAQA 1EL7A 1YQ4A 3F8DA 3GRSA 2V60A 3NT6A 2XFOA 3R0KA 1JEHA 4IZGA 4G8TA 4J36A 4U8NA 1STZA 3KKJA 3I6TA 2NPXA 1DOCA 2OLAA 4GDPA 3DFHA 2P8CA 2PPGA 3H12A 3UGVA 3RGTA 2BRAA 1B4VA 3UKHA 3P4SA 3ES8A 4Y4LA 4H4VA 1QO8A 3NRNA 4A79A 4AT0A 1EC9A 4IV9A 2P0IA 4Z17A 3TW9A 4F4RA 1IUSA 4J2WA 4Z2UA 3CPHG 3DJDA 3VCCA 1Q1RA 5GRTA 3R1ZA 5KMQA 4O5UA 2GGHA 1CJ2A 1FECA 3EAOA 3V5FA 3FBSA 1CF3A 2VQBA 4KX6A 1PDHA 5HYMA 2XH0A 1H84A 2APGA 4B65A 2VOUA 4OVIA 2FBWA 3F8RA 3UKPA 2GL5A 2PP1A 1DOEA 3IWAA 1NHSA 2GGIA 3A7AA 3R25A 2PTXA 2CHRA 3H8IA 3AE6A 1F8RA 1ZOYA 3UTEA 2BK5A 1MRAA 3IK4A 2XCGA 1LVLA 2TMDA 4FK1C 3JSKA 4ROPA 3GO2A 5IPYA 4GGBA 2PHHA 3T2KA 3COXA 2Z5XA 4HPNA 5BUKA 2GGJA 1P2EA 1L9CA 3CYJA 4CRTA 3ES7A 1GERA 3MKCA 1V97A 1BF3A 2XFQA 4HNLA 4KT2A 2W0HA 4TLZA 2E5AA 3AEDA 5BULA 4GRTA 1IUUA 3NN0X 3V3WA 1H7WA 2FJDA 1KNPA 3GD6A 3NHOX 2GR0A 5M10A 1XS2A 4HA6A 1N62C 4CY8A 3D1CA 2GSHA 2E3TA 1NU5A 2B9YA 4A3RA 3AE8A 3NTDA 3GC2A 1RP0A 3NLCA 3K7QX 3GWDA 4AP3A 3DEQA 3FCPA 4E0VA 1Y0PA 3SJNA 4H2NA 2B9XA 1TDOA 3UP5A 2OAMA 1S2QA 2YLWA 1O5WA 1KCZA 3DG3A 3O0HA 4H4PA 1N60C 3UKFA 3AMZA 3NVWB 1OJCA 3OZMA 1EL5A 3SR6B 3ZDNA 2OO6A 1JRXA 5U25A 4EIPA 2WEUA 3V5CA 3FVDA 3VC6A 2GV8A 4G6HA 4O5QA 2GR3A 3TQPA 1BZLA 3CGCA 3ZLGA 4NEWA 4Z25A 2BRYA 1VG0A 2BYBA 3SZFA 3RHAA 4GGHA 3N6JA 1ZY8A 1K4QA 1FFUC 4G7FA 3MSYA 2AQJA 1GV4A 3P0WA 1E39A 4U8JA 5G5HB 3SN4A 3BHFA 1JNRA 2MNRA 1FEBA 3KLJA 3P1WA 3EF6A 3MY9A 1X2HA 4BURA 4GYPA 5EU9A 1JCTA 1F9CA 5FS8A 3GDPA 2BCPA 2JAEA 2C72A 1PJ5A 1TDKA 3N4EA 2QJNA 4Y4MA 1OJ9A 3DGHA 1GRTA 4GIRA 3GMCA 1Y56A 1RSGA 1HYUA 1S2YA 3ZYXA 3OZ2A 1FHVA 6ENLA 2YG4A 5FS6A 1D7YA 1ZK7A 3FMWA 3CTYA 3P93A 3CAWA 3GSIA 3QPEA 3PWGA 4X4JA 1PBEA 3CGBA 4Z2TA 1P43A 4MKSA 3KD9A 4OPUA 2QJJA 3B97A 5IDZA 5DBJA 3DGBA 3CN8A 2BC1A 3GYXA 3NKSA 3QFAA 5U1OA 4U8IA 2R0CA 3R0UA 4K7ZA 1WYGA 4CCQA 4U2SA 2BXRA 1XPQA 1FIQB 1K0IA 3NN6X 1ZMCA 4NTCA 4M6UA 1B8SA 1TDEA 2W3RA 5KOWA 2OPJA 4H19A 3I3LA 3P4QA 1FHUA 3GY1A 3KPKA 4GISA 3PO7A 4A65A 3UJEA 4JNAA 4UDPA 3KUMA 4ZA0A 1LQTA 1DODA 3H8LA 1P2HA 2W3SA 3B3RA 3DJGX 3NVYB 1LTXR 3Q4DA 4Y4NA 1H7XA 2GAGB 5KXJA 3DMEA 2YAUA 2BXSA 3T8QA 1XDIA 2PTZA 5FJRA 5U63A 2ZZCA 3G5SA 3TTEA 1D4DA 4EQSA 1PXCA 4HCDA 2NQLA 1H82A 3II4A 4Z1YA 2WQYA 5ENLA 2YR4A 3HZLA 1WUFA 1SJBA 4IP5A 3A7UA 2JK6A 4E5TA 1CJCA 3FV9A 2Q0LA 4E6MA 2V3BA 3QN3A 4LA1A 1YQ3A 3CNTA 3JW7A 1BKWA 3F8PA 5JCIA 2YLTA 4ICYA 2X3NA 4EMJA 1NHPA 4YSXA 5FMHA 2YM2A 3SBFA 4X2PA 1TYPA 3P4RA 1OJDA 5KMPA 3DK4A 4YTMA 2X8HA 1GTHA 3ALMA 5KVIA 2WP6A 1VRQB 2FJAA 1Y56B 1EC8A 2XFPA 4WX1A 1PBBA 1KN0A 2Q6UA 2GR1A 3DK8A 3C96A 2HZGA 3V76A 2WOWA 1XANA 4J57A 3NS1B 1ELSA 1S7MA 2QJMA 2X50A 2PODA 2AR8A 3URHA 4CCRA 4PAAA 1KD0A 3AB1A 1RVKA 1VDVA 3REDA 3GD4A 3NVVB 1Z6LA 4IHCA 2J3NA 2P3ZA 1KSUA 2GAHB 5C2TA 4H4YA 1XHCA 3UXLA 3VC5A 3H4KA 3SZCA 3AE4A 2C64A 3V3OA 1Q1WA 4LU6A 3CGDA 3KA7A 4LIIA 3AN1A 4H2PA 3GD3A 4JDRA 3ITJA 2XLRA 1PBDA 3BI2A 2PTWA 3VDGA 3H70A 2RGHA 1TE6A 3AE3A 4A5LA 3DG7A 2B7RA 1E1NA 1LQUA 4TVYA 1PDYA 1PXAA 3B6DA 3TOYA 3DFYA 3ISHA 4OPDA 2XVJA 2GH5A 1JNZA 1ELIA 2ZBWA 3AEGA 2BS2A 2B76A 3L5OA 2PMQA 4G73A 3NYFA 2QVHA 1PHHA 4NNJA 2FJEA 2GQFA 2GRTA 2PGEA 1QJDA 1IYXA 2BCGG 2UZZA 3DIPA 5M0ZA 3UJSA 4ZCWA 4AT2A 3AWIA 3S47A 1ECQA 3R11A 2E4GA 3NYCA 5FJPA 1P48A 1B37A 3AYJA 4IA6A 3UKLA 2ARDA 4OPGA 4B67A 1V59A 4GYPC 3CMMA 1LJ1A 2XLTA 4KEMA 4II2A 3ATRA 2OVLA 4JN7A 1H83A 2BACA 1JRZA 2VZ2A 2P8BA 3V4BA 4EQWA 4NWZA 2RABA 1GT8A 3NXLA 1CBOA 2QGYA 4OPTA 2XDOA 4YTPA 3PS9A 2CVJA 3ICRA 2R9ZA 1PBCA 1GRBA 1X2GA 1CL0A 3NK2X 3FG2P 4B1BA 1VQZA 3D47A 3L1RA 3TCSA 2P88A 1D4CA 5JCKA 2YG6A 3BI4A 4CY6A 2WDQA 3EPTA 4ECHA 1D5TA 2R4EA 3BOXA 4I59A 1ZDLA 4AOSA 4HCHA 3FIMB 1OEPA 4YKFA 2O9ZA 4IT1A 2I0ZA 2PCEA 4JY2A 2YVJA 1FCDA 1H81A 3AE2A 1CHUA 2OALA 4EM4A 1SEZA 2WS3A 2XFNA 2JKCA 3UOYA 3SY4A 3TWBA 3N6HA 4E8GA 4ZCDA 3ZVHA 1TZZA 2A8XA 4C77A 2QDEA 3UOXA 2DW6A 1GOSA 3K30A 4JNQA 3RO6A 3K1GA 1F8SA 4KWSA 1KNRA 3P3BA 2WPCA 1BQGA 1LV0A 4ZCCA 3U9IA 2YWLA 2V61A 1GRFA 1N61C 2XLPA 4H4SA 4ENLA 4DYEA 3ABVA 1RYIA 4YSHA 3SQSA 2BABA 1FFVC 2FKPA 2WU5A 4GFIA 4H4TA 4U2LA 4Z44A 4BK1A 3UP4A 1GNDA 3UTFA 4YSZA 1GRAA 1GETA 1TYTA 4APNA 2C65A 2NVKX 3NVZB 3UTHA 2CFYA 3IF9A 1UKVG 4C3XA 4IL2A 3R9UA 3T31A 1B5QA 3HRDC 3CIRA 3UOZA 3H8AA 1D7LA 2VVLA 3B9JB 1E1LA 2HQMA 2WESA 2CDUA 1ZP0A 4EQRA 3SX6A 1ZMDA 1TDNA 3T37A 2YG7A 2ZZ0A 1JDFA 5FJOA 2R4JA 4A6GA 5GSNA 4EQXA 3GYIA 3SN1A 4TM1A 3NNEA 3ICSA 3HYVA 4XWRA 4RSLA 3AD7B 1Q9IA 4MMWA 3NH3X 4IA5A 1KKOA 1W4XA 4UDQA 4X9NA 3ETRB 4REKA 2BS3A 1PS9A 4P9SA 4BK3A 3SQPA 2HXTA 4DSGA 2ZZBA 5CKUA 3T0KA 3BNMA 2WBAA 2X8CA 2GB0A 1R6WA 3OP2A 3C4NA 1RM6B 3NTAA 2YLRA 3IJQA 1D4EA 3QFBA 3T2ZA 3CNPA 1DNCA 3IHGA 3AE9A 7ENLA 2XH4A 3CPIG 1KF6A 4J1OA 2IIDA 3CK5A 3SSZA 3D8XA 4G74A 1M6IA 3SM8A 3T9PA 3ZVHB 1T3QC 1K0LA 3I6EA 3NZGA 1H86A 4H4ZA 2A87A 1L0VA 2VRLA 3DJJA 3DK9A 3NRZB 3QKEA 2OLNA 4HN8A 4K8GA 2ZADA 4TM0A 2O56A 1H2IA 4FX9A 1LPFA 4DHGA 4WCTA 5KVHA 3OC4A 5HY5A 1ZKQA 3QJ4A 1SJDA 3N4FA 2GEWA 4H50A 4GCMA 2PS2A 4GMEA 1BKHA 3T2YA 2RGJA 3M12A 3QVRA 3OW1A 3ZVIA 1GALA 2DKHA 1R0MA 4DNAA 3BJSA 1E1MA 2YQUA 2EQ6A 3QSSA 2WOVA 2PA6A 4JN9A 2YLZA 4NTEA 3K7TA 1N5WC 3AE7A 3D46A 3CXOA 3DG6A 4J34A 3PG6A 1JU2A 3RP8A 4DXKA 4H4UA 1CJ3A 4JQ9A 4DGKA 2VRMA 3SYIA 2GVCA 3AD9B 4NZHA 4IVMB 3NIXA 2QCUA 4TVWA 2Y6RA 1ZXIC 3M0OA 4J31A 3UJRA 2WP9A 4K2SA 2Q0KA 3UCDA 3HPFA 2C3CA 2OA1A 1N1PA 3GDNA 4CBQA 2AL1A 1CC4A 4GDEA 2XVHA 4J56A 3DJEA 4D04A 3U4FA 1BGJA 1EBDA 4B68A 2R46A 1NPXA 2A89A 4YTNA 3S5WA 4CNKA 2C7GA 4H2RA 1MNSA 1MUCA 2YG3A 3DA1A 1EL8A 1TRBA 2EQ7A 3MUCA 3AXBA 3AE1A 3Q6JA 4EWJA 3T14A 4DN1A 2ONEA 1PDZA 1GXFA 3EEZA 2EQ8A 3AEBA 5KOXA 3GMBA 1MDLA 3OTRA 3CPJG 4FDCB 3SZ0A 2PYXA 1EC7A 3KVEA 3AECA 2QQ6A 3A7RA 1DTNA 3VA8A 4U8LA 2WHDA 3LADA 3HW2A 2YR6A 1CC2A 2QDDA 4K1WA 3UTGA 4B69A 4K8DA 2X99A 3CNSA 4OPIA 3VQRA 2YLXA 3H7VA 3UCCA 1H6VA 2H89A 1NENA 2HNEA 1EBHA 2AKMA 1K0JA 4IL0A 3CT2A 3VR9A 3I6DA 3C4AA 4H4RA 2Q7VA 1ZX9A 1DJNA 4K22A 2AL2A 3T6CA 3NK1X 4U2TA 4FI4A 2XH2A 4U8MA 2X8GA 3HYXA 5FJUA 2F5ZA 4I58A 3VR8A 2V5ZA 5EB4A 1W6TA 2PU0A 2BS4A 2IVEA 4YT0A 1JRPA 4EM3A 3RITA 2OKTA 1YQZA 3KU9A 1M64A 4D03A 1GREA 3PVCA 5C3JA 3NFUA 4USRA 1FL2A 3CB3A 4C3YA 3PWIA 3RRAA 5HHFA 3QTPA 3THUA 1VQWA 2OZ8A 3BI5A 2VVMA 2GMHA 4B64A 4M0XA 1BGNA 5JCLA 3FXGA 3ENLA 3IC9A 2MUCA 4TM3A 3ALLA 1FOHA 2AKZA 4U8KA 3VRAA 2QA2A 2WU2A 1JOAA 2OZTA 4BK2A 2OLOA 2B7SA 2FJBA 3PK7A 1YEYA 3LZWA 2WDRA 5FS7A 1WUEA 1OJAA 3BHKA 2XLUA 3QVPA 3NYEA 1KSSA 2Y6QA 1KDGA 4YSYA 5J60A 4GUVA 3T4WA 4Z43A 2GR2A 5J04A 1GEUA 1COYA 2OFJA 2PGWA 2W54A 1PJ7A 3SFEA 2YVGA 3WE0A 3UCLA 4N9XA 3RP6A 3PFRA 4K5RA 4H2HA 4YXDA 1DJQA 5IQ4A 2QAEA 5JRBA 3MZNA 2Z5YA 3JZUA 4II3A 1ZOVA 3NK0X 3BSMA 1GSNA 3DDMA 3K7MX 1JPMA 1E6EA 3LOVA 2ZC8A 1GRHA 4MJWA 5FJTA 1NDAA 1NHQA 2C73A 3G5RA 3TJIA 2YLSA 4NTDA 4K5SA 2PP0A 3LB8A 3EANA 4DWDA 3AEAA 3DERA 3P9UA 4KPLA 2AL2B 2R0PA 2R0GA 2YR5A 1F6MA 3AE5A 4GR1A 2IVDA 1JRYA 4USQA 1IUWA 5EB5A 3QLDA 3TWAA 4A35A 4UP3A 4JHMA 2XYOA 1IUXA 2I5QA 3QSEA 3BNUA 1E1KA 1XPYA 1NELA 1MXTA 3P4PA 2WDVA 1MDRA 4JN8A 3OZYA 1TDFA 2PU1A 3FYYA 1OJTA 1SJAA 2BA9A 2PTYA 5IQ1A 1NG3A 3VCNA 3EKGA 5KMRA 2V6OA 1CC6A 4PABA 3NGCX 4HB9A 1E9IA 2XLSA 2XH7A 1PN0A 2C66A 4U8PA 3ALJA 3SGLA 1QLBA 2H88A 5JCNA 5EOWA 2RDXA 4E4FA 4A99A 1EBGA 5TR3A 4UDRA 2DW7A 4GF7A 4GAVA 4H4WA 5KRQA 1NG4A 2YVFA 3VRBA 3CGEA 1N4VA 3ZLHA 2GMJA 2VQ7A 4MGGA 1N4WA 5HXIA 3DGZA 4AP1A 2OG9A 3IJIA 4Z2RA 4G9KA 1F8WA 1EL9A 3Q45A 4IVOB 1L8PA 2WP5A 2FYMA 1VDCA 1O95A 1DOBA 1L9EA 4A9WA 2XFUA 2E1MA 4DSHA 4Z26A 2WPEA 2BK4A 1N63C 4KPRA 1NEKA 2GQWA 1CJ4A 2XVFA
chains in the Genus database with same CATH topology
2GH5A 1JNZA 4J31A 1ELIA 2FJDA 4A6NA 1KNPA 2ZBWA 3AEGA 2BS2A 3NHOX 3V3NA 2GR0A 2WP9A 3LXDA 2B76A 5KMSA 3L5OA 2Q0KA 1VG9A 1BWCA 2C3DA 2YM1A 5M10A 3CNJA 2C3CA 5L46A 2OA1A 4FK1A 4G73A 3QSMA 4HA6A 1N1PA 3GDNA 3ADAB 4CY8A 4JY3A 3NYFA 1PHHA 4NNJA 3D1CA 2C67A 4CBQA 1CC4A 4GDEA 4J33A 2FJEA 2GQFA 2GRTA 2XVHA 1QJDA 4J56A 2B9YA 3DJEA 2BCGG 1N4UA 2UZZA 3AE8A 3NTDA 3SFDA 4B63A 3SZWA 1BGJA 4D04A 1RP0A 4GAPA 4CNJA 4H4XA 3NLCA 3CNDA 1F3PA 3K7QX 1REOA 4YKGA 1EBDA 3GWDA 5M0ZA 4B68A 5LV9A 2R46A 5FS9A 1GESA 1NPXA 5BVAA 2A89A 4AP3A 4YTNA 4AT2A 4EMWA 2JB2A 3S5WA 3AWIA 4CNKA 4E0VA 2C7GA 4H2RA 2E4GA 1Y0PA 4RG4A 3AYIA 1S3BA 2YG3A 3DA1A 3NYCA 1EL8A 4H2NA 1TRBA 2B9XA 2EQ7A 1B37A 3AYJA 3G5QA 2WETA 1TDOA 2V3AA 3UP5A 2OAMA 1NAAA 3UKAA 4IA6A 3UKLA 3AXBA 1S2QA 2ARDA 3AE1A 4OPGA 4B67A 2YLWA 4M52A 1V59A 3Q6JA 3CMMA 1LJ1A 1O5WA 2XLTA 4II2A 3T14A 3O0HA 3ATRA 3VRDB 5KWFA 1GXFA 4H4PA 3UKFA 1H83A 2BACA 1OJCA 1JRZA 2EQ8A 2VZ2A 3GWFA 3AEBA 5KOXA 3DH9A 3GMBA 3D9XA 1EL5A 3FPZA 4XXGA 3ZDNA 4EQWA 1JRXA 3CPJG 4FDCB 3SZ0A 1IUTA 5U25A 4NWZA 4EIPA 2WEUA 2RABA 2PYXA 1GT8A 3UKQA 4YWOA 3KVEA 1CBOA 2GV8A 4G6HA 4O5QA 3AECA 2GR3A 2CULA 4ADWA 4OPTA 2XDOA 1BZLA 3CGCA 4YTPA 3PS9A 3S61A 2CVJA 4TLXA 4NEWA 4Z25A 1FEAA 4U8LA 2WHDA 3ICRA 2BRYA 3LADA 2EQ9A 1VG0A 2BYBA 4OPCA 3SZFA 2YR6A 2R9ZA 1PBCA 1GRBA 1CC2A 5EBKA 3RHAA 2RGOA 1CL0A 3UTGA 4B69A 3LZXA 2TPRA 4K8DA 1E7PA 2X99A 1PJ6A 3NK2X 1ZY8A 3FG2P 3AEEA 4B1BA 1K4QA 3CNSA 2XVIA 1NHRA 2AQJA 1GV4A 2WPFA 1E39A 4OPIA 4U8JA 3VQRA 2YLXA 3AYLA 3BHFA 1JNRA 3L1RA 1H6VA 2H89A 2BC0A 1NENA 2E5VA 1MO9A 1K0JA 1FEBA 1D4CA 3VR9A 3KLJA 4H7UA 2B9WA 5JCKA 2YG6A 3BI4A 3P1WA 2C75A 1GPEA 2WDQA 3I6DA 4CY6A 3EF6A 3C4AA 4BJZA 3EPTA 1X31B 1GTEA 4ECHA 1D5TA 3ICTA 4H4RA 2R4EA 2C70A 4BURA 2JB3A 4I59A 1ZDLA 4AOSA 3FIMB 2Q7VA 4YKFA 1ZX9A 1KFYA 4C74A 5BRTA 2O9ZA 5FS8A 1DJNA 4K22A 2I0ZA 3GDPA 2BCPA 5J7XA 3SXIA 4JY2A 3NK1X 2YVJA 2JAEA 4U2TA 1FCDA 1S3EA 4U8MA 2C72A 2X8GA 4NEVA 3HYXA 5KNLA 3RNMA 5JCMA 1H81A 1PJ5A 1TDKA 3AE2A 1CHUA 2OALA 2F5ZA 1GRGA 3L8KA 4EM4A 1SEZA 2WS3A 2XFNA 2JKCA 3UOYA 4H4QA 4I58A 3VR8A 4Y4MA 4EIQA 3SY4A 4C5OA 2V5ZA 5EB4A 3AD8B 1OJ9A 4ZCDA 1L9DA 3DGHA 1GRTA 2BS4A 2IVEA 3GMCA 1Y56A 1RSGA 3UKKA 4YT0A 1PXBA 1IUVA 4EM3A 1HYUA 2A8XA 3HYWA 2WOIA 1S2YA 4Z24A 3ZYXA 4C77A 1YQZA 3OZ2A 4G6GA 4OCGA 3KU9A 4X9MA 3UOXA 1GOSA 2YG4A 5FS6A 1D7YA 2YG5A 3K30A 4JNQA 1M64A 4D03A 2VVLG 1GREA 3PVCA 3LJPA 5C3JA 1ZK7A 4USRA 1FL2A 3FMWA 3CTYA 4C3YA 4U8OA 1F8SA 1KNRA 5CQFA 5HHFA 3GSIA 3RP7A 2WPCA 1VQWA 1IJHA 1MOKA 1LV0A 4ZCCA 3BI5A 3GRTA 2VVMA 1O94A 2BK3A 2GMHA 1PBEA 3CGBA 4X4JA 4B64A 2YWLA 4Z2TA 4OPUA 3KD9A 2V61A 1GRFA 4A6NB 1BGNA 2XLPA 4H4SA 5DBJA 4ZN0A 5JCLA 4BJYA 3CN8A 3ABVA 2BC1A 1RYIA 4YSHA 3IHMA 3GYXA 2ACZA 3IC9A 3ATQA 2BABA 3NKSA 3QFAA 5U1OA 1DXLA 4U8IA 4EMIA 4TM3A 3GYJA 2C4CA 2WU5A 4H4TA 4U2LA 3ALLA 4XWZA 1FOHA 4Z44A 3UP4A 4BK1A 4U8KA 2R0CA 1GNDA 2GF3A 3VRAA 3UTFA 2QA2A 2R45A 2WU2A 4YSZA 4TM4A 4K7ZA 1AOGA 1GRAA 1JOAA 1GETA 1PBFA 3M13A 4H2QA 1TYTA 4APNA 3UOVA 4BK2A 2C65A 2NVKX 3UTHA 4AOXA 4OPLA 2CFYA 4CCQA 4U2SA 2BXRA 2OLOA 1XPQA 3IF9A 1UKVG 2B7SA 1K0IA 3NN6X 2FJBA 4C3XA 1ZMCA 2DKIA 3KPFA 4NTCA 3R9UA 3T31A 3LZWA 2WDRA 1B8SA 5FS7A 4B66A 1OJAA 1TDEA 3BHKA 1B5QA 3AEFA 2JB1A 2XLUA 3QVPA 3CIRA 2QA1A 1ONFA 5KOWA 3NYEA 1YKJA 3UOZA 1D7LA 1KSSA 2JBVA 3NG7X 2VVLA 2Y6QA 1KDGA 2XVEA 3I3LA 4YSYA 3P4QA 3KPKA 4BV6A 1E1LA 2C76A 4RG3A 3PO7A 5J60A 4A65A 4A7AA 2HQMA 4JNAA 3E1TA 4GUVA 4UDPA 2WESA 2CDUA 1ZP0A 4Z43A 1LQTA 2GR2A 4EQRA 1DODA 3Q9TA 3SX6A 1ZMDA 3H8LA 1TDNA 1P2HA 1GEUA 5ER0A 3B3RA 1COYA 1YY5A 3T37A 2YG7A 4K2XA 2AAQA 1EL7A 1PJ7A 3DJGX 2ZZ0A 1YQ4A 3SFEA 2YVGA 1LTXR 2R4JA 3F8DA 3WE0A 3UCLA 3GRSA 4N9XA 3RP6A 4Y4NA 5GSNA 2V60A 4EQXA 3GYIA 4K5RA 3NT6A 1H7XA 2GAGB 2XFOA 4YXDA 1DJQA 4TM1A 3DMEA 5KXJA 3NNEA 3ICSA 5IQ4A 2QAEA 1JEHA 2YAUA 2BXSA 3HYVA 5JRBA 2Z5YA 1XDIA 4XWRA 4RSLA 4II3A 3AD7B 1Q9IA 1ZOVA 3NH3X 5U63A 3NK0X 4J36A 4U8NA 4IA5A 2ZZCA 1GSNA 3K7MX 1W4XA 3G5SA 1E6EA 3LOVA 4UDQA 4X9NA 1D4DA 4EQSA 1PXCA 1GRHA 2BS3A 1H82A 1PS9A 3KKJA 4MJWA 4P9SA 4REKA 2NPXA 4BK3A 1DOCA 3SQPA 3II4A 4GDPA 4DSGA 2WQYA 2ZZBA 2YR4A 5CKUA 1NDAA 3T0KA 3HZLA 1NHQA 2C73A 3G5RA 3BNMA 2WBAA 2JK6A 2BRAA 1CJCA 2X8CA 1B4VA 2Q0LA 2GB0A 3C4NA 3UKHA 2YLSA 3P4SA 4NTDA 4K5SA 2V3BA 4LA1A 3LB8A 3EANA 3NTAA 2YLRA 4Y4LA 4H4VA 1QO8A 3AEAA 1YQ3A 1D4EA 3QFBA 3CNTA 3NRNA 3P9UA 3T2ZA 1BKWA 4A79A 4AT0A 2R0PA 3F8PA 4IV9A 5JCIA 2R0GA 2YLTA 2YR5A 3CNPA 1DNCA 3IHGA 4ICYA 2X3NA 3AE9A 1F6MA 3AE5A 4EMJA 1NHPA 4GR1A 2IVDA 4YSXA 5FMHA 2YM2A 1JRYA 1IUSA 1TYPA 3P4RA 4J2WA 3CPIG 1KF6A 1OJDA 2IIDA 5KMPA 3DK4A 4YTMA 4USQA 1IUWA 3D8XA 5EB5A 2X8HA 4G74A 4Z2UA 1GTHA 3ALMA 5KVIA 1M6IA 2WP6A 1VRQB 3CPHG 3SM8A 3DJDA 1K0LA 2FJAA 1Y56B 4UP3A 1H86A 2XYOA 2XFPA 1Q1RA 4WX1A 1PBBA 4H4ZA 1IUXA 5GRTA 2A87A 1KN0A 2Q6UA 3QSEA 5KMQA 1L0VA 4O5UA 3BNUA 2GR1A 1E1KA 2VRLA 3DJJA 3DK9A 1MXTA 3P4PA 2WDVA 3DK8A 1CJ2A 3C96A 1FECA 2OLNA 3EAOA 1TDFA 3FBSA 3V76A 1CF3A 4TM0A 1OJTA 2WOWA 1XANA 1H2IA 4FX9A 1LPFA 2VQBA 4KX6A 4J57A 1PDHA 2BA9A 4WCTA 5KVHA 3OC4A 1NG3A 5IQ1A 5HYMA 5HY5A 1H84A 1ZKQA 3QJ4A 5KMRA 2GEWA 4H50A 4GCMA 2APGA 4B65A 1S7MA 2V6OA 1CC6A 2VOUA 2FBWA 3F8RA 4OVIA 4PABA 3T2YA 2X50A 3NGCX 3UKPA 4HB9A 2RGJA 3M12A 2AR8A 2XLSA 3URHA 1DOEA 1PN0A 3IWAA 1NHSA 4CCRA 2C66A 4PAAA 3AB1A 3QVRA 3H8IA 1GALA 3AE6A 2DKHA 1F8RA 1ZOYA 4U8PA 3GD4A 3REDA 1Z6LA 3ALJA 3UTEA 3SGLA 1QLBA 2BK5A 2J3NA 2XCGA 1KSUA 4DNAA 2GAHB 1LVLA 2TMDA 4FK1C 3JSKA 5C2TA 4H4YA 1XHCA 2H88A 5JCNA 5EOWA 4A99A 5TR3A 1E1MA 4UDRA 2YQUA 4GF7A 2EQ6A 3H4KA 4H4WA 4GAVA 3QSSA 5KRQA 3SZCA 2WOVA 1NG4A 3AE4A 2YVFA 3VRBA 3CGEA 1N4VA 2GMJA 5IPYA 2VQ7A 4JN9A 2YLZA 4NTEA 3K7TA 2PHHA 2C64A 3T2KA 3AE7A 3COXA 2Z5XA 3V3OA 1Q1WA 1N4WA 4LU6A 3CGDA 3KA7A 5HXIA 4LIIA 5BUKA 3DGZA 1P2EA 4AP1A 1L9CA 3PG6A 4J34A 4CRTA 1JU2A 3RP8A 4Z2RA 4H2PA 4H4UA 4G9KA 1CJ3A 1F8WA 4JQ9A 4DGKA 3GD3A 1GERA 1EL9A 2VRMA 3SYIA 4JDRA 1BF3A 3ITJA 4IVOB 2XLRA 1PBDA 2GVCA 2XFQA 2WP5A 1VDCA 3BI2A 2W0HA 4TLZA 3AD9B 1O95A 1DOBA 2RGHA 1L9EA 4NZHA 3AEDA 4IVMB 3AE3A 3NIXA 4A9WA 4A5LA 5BULA 2XFUA 2QCUA 2B7RA 2E1MA 4DSHA 1E1NA 4Z26A 1LQUA 4GRTA 1IUUA 2WPEA 1PXAA 2BK4A 4KPRA 1NEKA 2Y6RA 3B6DA 3NN0X 2GQWA 3M0OA 1CJ4A 2XVFA 3ISHA 1H7WA 4OPDA 2XVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH5 A;  1JNZ A;  4J31 A;  1ELI A;  2FJD A;  4A6N A;  1KNP A;  2ZBW A;  3AEG A;  2BS2 A;  3NHO X;  3V3N A;  2GR0 A;  2WP9 A;  3LXD A;  2B76 A;  2Q0K A;  1VG9 A;  1BWC A;  2C3D A;  2YM1 A;  5M10 A;  3CNJ A;  2C3C A;  5L46 A;  2OA1 A;  4FK1 A;  4HA6 A;  3QSM A;  1N1P A;  3GDN A;  3ADA B;  4CY8 A;  4JY3 A;  3NYF A;  1PHH A;  3D1C A;  2C67 A;  4CBQ A;  1CC4 A;  4GDE A;  4J33 A;  2FJE A;  2GQF A;  2GRT A;  2XVH A;  1QJD A;  4J56 A;  2B9Y A;  3DJE A;  2BCG G;  1N4U A;  2UZZ A;  3AE8 A;  3NTD A;  3SFD A;  4B63 A;  4D04 A;  1BGJ A;  1RP0 A;  4CNJ A;  4H4X A;  3NLC A;  3CND A;  1F3P A;  3K7Q X;  1REO A;  4YKG A;  1EBD A;  3GWD A;  5M0Z A;  4B68 A;  5LV9 A;  2R46 A;  5FS9 A;  1GES A;  1NPX A;  5BVA A;  2A89 A;  4AP3 A;  4YTN A;  4AT2 A;  4EMW A;  2JB2 A;  3S5W A;  3AWI A;  4CNK A;  4E0V A;  2C7G A;  4H2R A;  2E4G A;  1Y0P A;  4RG4 A;  3AYI A;  1S3B A;  2YG3 A;  3DA1 A;  3NYC A;  1EL8 A;  4H2N A;  1TRB A;  2B9X A;  2EQ7 A;  1B37 A;  3AYJ A;  3G5Q A;  2WET A;  1TDO A;  2V3A A;  3UP5 A;  2OAM A;  1NAA A;  3UKA A;  4IA6 A;  3UKL A;  3AXB A;  1S2Q A;  2ARD A;  3AE1 A;  4OPG A;  4B67 A;  2YLW A;  4M52 A;  1V59 A;  3Q6J A;  1LJ1 A;  1O5W A;  2XLT A;  3O0H A;  3ATR A;  3VRD B;  5KWF A;  1GXF A;  4H4P A;  3UKF A;  1H83 A;  2BAC A;  1OJC A;  1JRZ A;  2EQ8 A;  2VZ2 A;  3GWF A;  3AEB A;  5KOX A;  3DH9 A;  3GMB A;  1EL5 A;  3FPZ A;  4XXG A;  3ZDN A;  4EQW A;  1JRX A;  3CPJ G;  4FDC B;  1IUT A;  5U25 A;  4EIP A;  2WEU A;  2RAB A;  2PYX A;  1GT8 A;  3UKQ A;  4YWO A;  3KVE A;  1CBO A;  2GV8 A;  4O5Q A;  3AEC A;  2GR3 A;  2CUL A;  4ADW A;  4OPT A;  2XDO A;  1BZL A;  3CGC A;  4YTP A;  3PS9 A;  3S61 A;  2CVJ A;  4TLX A;  4NEW A;  4Z25 A;  1FEA A;  4U8L A;  2WHD A;  3ICR A;  3LAD A;  2EQ9 A;  1VG0 A;  2BYB A;  4OPC A;  2YR6 A;  2R9Z A;  1PBC A;  1GRB A;  1CC2 A;  5EBK A;  3RHA A;  2RGO A;  1CL0 A;  3UTG A;  4B69 A;  3LZX A;  2TPR A;  4K8D A;  1E7P A;  2X99 A;  1PJ6 A;  3NK2 X;  1ZY8 A;  3FG2 P;  3AEE A;  4B1B A;  1K4Q A;  3CNS A;  2XVI A;  1NHR A;  2AQJ A;  1GV4 A;  2WPF A;  1E39 A;  4OPI A;  4U8J A;  3VQR A;  2YLX A;  3AYL A;  3BHF A;  1JNR A;  3L1R A;  1H6V A;  2H89 A;  2BC0 A;  1NEN A;  2E5V A;  1MO9 A;  1K0J A;  1FEB A;  1D4C A;  3VR9 A;  3KLJ A;  4H7U A;  2B9W A;  5JCK A;  2YG6 A;  3BI4 A;  3P1W A;  2C75 A;  1GPE A;  2WDQ A;  3I6D A;  4CY6 A;  3EF6 A;  3C4A A;  4BJZ A;  3EPT A;  1X31 B;  1GTE A;  4ECH A;  1D5T A;  3ICT A;  4H4R A;  2R4E A;  2C70 A;  4BUR A;  2JB3 A;  4I59 A;  1ZDL A;  4AOS A;  3FIM B;  2Q7V A;  4YKF A;  1ZX9 A;  1KFY A;  4C74 A;  5BRT A;  2O9Z A;  5FS8 A;  1DJN A;  4K22 A;  2I0Z A;  3GDP A;  2BCP A;  5J7X A;  4JY2 A;  3NK1 X;  2YVJ A;  2JAE A;  4U2T A;  1FCD A;  1S3E A;  4U8M A;  2C72 A;  2X8G A;  4NEV A;  3RNM A;  5JCM A;  1H81 A;  1PJ5 A;  1TDK A;  3AE2 A;  1CHU A;  2OAL A;  2F5Z A;  1GRG A;  3L8K A;  4EM4 A;  1SEZ A;  2WS3 A;  2XFN A;  2JKC A;  3UOY A;  4H4Q A;  4I58 A;  3VR8 A;  4Y4M A;  4EIQ A;  4C5O A;  2V5Z A;  5EB4 A;  3AD8 B;  1OJ9 A;  4ZCD A;  1L9D A;  3DGH A;  1GRT A;  2BS4 A;  2IVE A;  3GMC A;  1Y56 A;  1RSG A;  3UKK A;  4YT0 A;  1PXB A;  1IUV A;  4EM3 A;  1HYU A;  2A8X A;  2WOI A;  1S2Y A;  4Z24 A;  3ZYX A;  4C77 A;  1YQZ A;  3OZ2 A;  4OCG A;  4X9M A;  3KU9 A;  3UOX A;  1GOS A;  2YG4 A;  5FS6 A;  1D7Y A;  2YG5 A;  3K30 A;  4JNQ A;  1M64 A;  4D03 A;  2VVL G;  1GRE A;  3PVC A;  3LJP A;  5C3J A;  1ZK7 A;  4USR A;  1FL2 A;  3FMW A;  3CTY A;  4C3Y A;  4U8O A;  1F8S A;  1KNR A;  5CQF A;  5HHF A;  3GSI A;  3RP7 A;  2WPC A;  1VQW A;  1IJH A;  1MOK A;  1LV0 A;  4ZCC A;  3BI5 A;  3GRT A;  2VVM A;  1O94 A;  2BK3 A;  2GMH A;  1PBE A;  3CGB A;  4X4J A;  4B64 A;  2YWL A;  4Z2T A;  4OPU A;  3KD9 A;  2V61 A;  1GRF A;  4A6N B;  1BGN A;  2XLP A;  4H4S A;  5DBJ A;  4ZN0 A;  5JCL A;  4BJY A;  3CN8 A;  3ABV A;  2BC1 A;  1RYI A;  4YSH A;  3IHM A;  2ACZ A;  3IC9 A;  3ATQ A;  2BAB A;  3NKS A;  3QFA A;  5U1O A;  1DXL A;  4U8I A;  4EMI A;  4TM3 A;  3GYJ A;  2WU5 A;  4H4T A;  4U2L A;  3ALL A;  4XWZ A;  1FOH A;  4Z44 A;  3UP4 A;  4BK1 A;  4U8K A;  2R0C A;  1GND A;  2GF3 A;  3VRA A;  3UTF A;  2QA2 A;  2R45 A;  2WU2 A;  4YSZ A;  4TM4 A;  4K7Z A;  1AOG A;  1GRA A;  1JOA A;  1GET A;  1PBF A;  3M13 A;  4H2Q A;  1TYT A;  4APN A;  3UOV A;  4BK2 A;  2C65 A;  2NVK X;  3UTH A;  4AOX A;  4OPL A;  2CFY A;  4CCQ A;  4U2S A;  2BXR A;  2OLO A;  1XPQ A;  3IF9 A;  1UKV G;  2B7S A;  1K0I A;  3NN6 X;  2FJB A;  4C3X A;  1ZMC A;  2DKI A;  3KPF A;  4NTC A;  3R9U A;  3LZW A;  2WDR A;  1B8S A;  5FS7 A;  4B66 A;  1OJA A;  1TDE A;  3BHK A;  1B5Q A;  3AEF A;  2JB1 A;  2XLU A;  3QVP A;  3CIR A;  2QA1 A;  1ONF A;  5KOW A;  3NYE A;  1YKJ A;  3UOZ A;  1D7L A;  1KSS A;  2JBV A;  3NG7 X;  2VVL A;  2Y6Q A;  1KDG A;  2XVE A;  3I3L A;  4YSY A;  3P4Q A;  4BV6 A;  1E1L A;  2C76 A;  4RG3 A;  3PO7 A;  5J60 A;  4A65 A;  4A7A A;  2HQM A;  4JNA A;  3E1T A;  4GUV A;  4UDP A;  2WES A;  2CDU A;  1ZP0 A;  4Z43 A;  1LQT A;  2GR2 A;  4EQR A;  1DOD A;  3Q9T A;  1ZMD A;  3H8L A;  1TDN A;  1P2H A;  1GEU A;  5ER0 A;  3B3R A;  1COY A;  1YY5 A;  3T37 A;  2YG7 A;  4K2X A;  2AAQ A;  1EL7 A;  1PJ7 A;  3DJG X;  2ZZ0 A;  1YQ4 A;  3SFE A;  2YVG A;  1LTX R;  2R4J A;  3F8D A;  3WE0 A;  3UCL A;  3GRS A;  4N9X A;  3RP6 A;  4Y4N A;  5GSN A;  2V60 A;  4EQX A;  3GYI A;  4K5R A;  3NT6 A;  1H7X A;  2GAG B;  2XFO A;  4YXD A;  1DJQ A;  4TM1 A;  3DME A;  5KXJ A;  3NNE A;  3ICS A;  5IQ4 A;  2QAE A;  1JEH A;  2YAU A;  2BXS A;  2Z5Y A;  1XDI A;  4XWR A;  4RSL A;  3AD7 B;  1Q9I A;  1ZOV A;  3NH3 X;  5U63 A;  3NK0 X;  4J36 A;  4U8N A;  4IA5 A;  2ZZC A;  1GSN A;  3K7M X;  1W4X A;  3G5S A;  1E6E A;  3LOV A;  4UDQ A;  4X9N A;  1D4D A;  4EQS A;  1PXC A;  1GRH A;  2BS3 A;  1H82 A;  1PS9 A;  3KKJ A;  4MJW A;  4P9S A;  4REK A;  2NPX A;  4BK3 A;  1DOC A;  3SQP A;  3II4 A;  4GDP A;  4DSG A;  2WQY A;  2ZZB A;  2YR4 A;  5CKU A;  1NDA A;  3HZL A;  1NHQ A;  2C73 A;  3G5R A;  3BNM A;  2WBA A;  2JK6 A;  1CJC A;  2X8C A;  1B4V A;  2Q0L A;  2GB0 A;  3C4N A;  3UKH A;  2YLS A;  3P4S A;  4NTD A;  4K5S A;  2V3B A;  4LA1 A;  3LB8 A;  3EAN A;  3NTA A;  2YLR A;  4Y4L A;  4H4V A;  1QO8 A;  3AEA A;  1YQ3 A;  1D4E A;  3QFB A;  3CNT A;  3NRN A;  3P9U A;  4A79 A;  1BKW A;  4AT0 A;  2R0P A;  3F8P A;  4IV9 A;  5JCI A;  2R0G A;  2YLT A;  2YR5 A;  3CNP A;  1DNC A;  3IHG A;  4ICY A;  2X3N A;  3AE9 A;  1F6M A;  3AE5 A;  4EMJ A;  1NHP A;  4GR1 A;  2IVD A;  4YSX A;  5FMH A;  2YM2 A;  1JRY A;  1IUS A;  1TYP A;  3P4R A;  4J2W A;  3CPI G;  1KF6 A;  1OJD A;  2IID A;  3DK4 A;  4YTM A;  4USQ A;  1IUW A;  3D8X A;  5EB5 A;  2X8H A;  4Z2U A;  1GTH A;  3ALM A;  5KVI A;  1M6I A;  2WP6 A;  1VRQ B;  3CPH G;  3SM8 A;  3DJD A;  1K0L A;  2FJA A;  1Y56 B;  4UP3 A;  1H86 A;  2XYO A;  2XFP A;  1Q1R A;  4WX1 A;  1PBB A;  4H4Z A;  1IUX A;  5GRT A;  2A87 A;  2Q6U A;  3QSE A;  1L0V A;  4O5U A;  3BNU A;  2GR1 A;  1E1K A;  2VRL A;  3DJJ A;  3DK9 A;  1MXT A;  3P4P A;  2WDV A;  3DK8 A;  1CJ2 A;  3C96 A;  1FEC A;  2OLN A;  3EAO A;  1TDF A;  3FBS A;  3V76 A;  1CF3 A;  4TM0 A;  1OJT A;  2WOW A;  1XAN A;  4FX9 A;  1LPF A;  2VQB A;  4KX6 A;  4J57 A;  1PDH A;  2BA9 A;  4WCT A;  5KVH A;  3OC4 A;  1NG3 A;  5IQ1 A;  5HYM A;  5HY5 A;  1H84 A;  1ZKQ A;  3QJ4 A;  2GEW A;  4H50 A;  4GCM A;  2APG A;  4B65 A;  2VOU A;  2V6O A;  1CC6 A;  4OVI A;  2FBW A;  3F8R A;  4PAB A;  2X50 A;  3NGC X;  3UKP A;  4HB9 A;  2RGJ A;  3M12 A;  2AR8 A;  2XLS A;  3URH A;  1DOE A;  1PN0 A;  3IWA A;  1NHS A;  4CCR A;  2C66 A;  4PAA A;  3AB1 A;  3QVR A;  3H8I A;  1GAL A;  3AE6 A;  2DKH A;  1F8R A;  1ZOY A;  4U8P A;  3GD4 A;  3RED A;  1Z6L A;  3ALJ A;  3UTE A;  3SGL A;  1QLB A;  2BK5 A;  2J3N A;  2XCG A;  1KSU A;  4DNA A;  2GAH B;  1LVL A;  2TMD A;  4FK1 C;  3JSK A;  5C2T A;  4H4Y A;  1XHC A;  2H88 A;  5JCN A;  5EOW A;  4A99 A;  5TR3 A;  1E1M A;  4UDR A;  2YQU A;  4GF7 A;  2EQ6 A;  3H4K A;  4H4W A;  3QSS A;  5KRQ A;  2WOV A;  1NG4 A;  3AE4 A;  2YVF A;  3VRB A;  3CGE A;  1N4V A;  2GMJ A;  5IPY A;  2VQ7 A;  4JN9 A;  2YLZ A;  4NTE A;  3K7T A;  2PHH A;  2C64 A;  3AE7 A;  3COX A;  2Z5X A;  3V3O A;  1Q1W A;  1N4W A;  4LU6 A;  3CGD A;  3KA7 A;  5HXI A;  4LII A;  5BUK A;  3DGZ A;  1P2E A;  4AP1 A;  1L9C A;  4J34 A;  4CRT A;  1JU2 A;  3RP8 A;  4Z2R A;  4H2P A;  4H4U A;  1CJ3 A;  1F8W A;  4JQ9 A;  4DGK A;  3GD3 A;  1GER A;  1EL9 A;  2VRM A;  4JDR A;  1BF3 A;  3ITJ A;  4IVO B;  2XLR A;  1PBD A;  2GVC A;  2XFQ A;  2WP5 A;  1VDC A;  3BI2 A;  2W0H A;  4TLZ A;  3AD9 B;  1O95 A;  1DOB A;  2RGH A;  1L9E A;  4NZH A;  3AED A;  4IVM B;  3AE3 A;  3NIX A;  4A9W A;  4A5L A;  5BUL A;  2XFU A;  2QCU A;  2B7R A;  2E1M A;  4DSH A;  1E1N A;  4Z26 A;  1LQU A;  4GRT A;  1IUU A;  2WPE A;  1PXA A;  2BK4 A;  4KPR A;  1NEK A;  2Y6R A;  3B6D A;  3NN0 X;  2GQW A;  3M0O A;  1CJ4 A;  2XVF A;  3ISH A;  1H7W A;  4OPD A;  2XVJ A; 
#chains in the Genus database with same CATH topology
 2GGE A;  4A6N A;  3V3N A;  5KMS A;  3LXD A;  1VG9 A;  1BWC A;  2C3D A;  2YM1 A;  2GGG A;  4IP4 A;  3IJL A;  3TJ4 A;  1SJC A;  3ZLF A;  3CNJ A;  5L46 A;  4FK1 A;  3QSM A;  3ADA B;  4JY3 A;  3STP A;  2C67 A;  4J33 A;  3MQT A;  1N4U A;  3SFD A;  4B63 A;  3SZW A;  4CNJ A;  4GAP A;  4H4X A;  3CND A;  1F3P A;  4YKG A;  1REO A;  5LV9 A;  5BVA A;  5FS9 A;  1GES A;  4EMW A;  2JB2 A;  4RG4 A;  3AYI A;  1S3B A;  3G5Q A;  2WET A;  2V3A A;  3OPS A;  1NAA A;  3UKA A;  1TKK A;  3VFC A;  4M52 A;  4YWS A;  3VRD B;  5KWF A;  3CXB A;  3GWF A;  3MWC A;  3DH9 A;  3D9X A;  3FPZ A;  4XXG A;  3AM9 A;  1IUT A;  3UKQ A;  4YWO A;  2CUL A;  4ADW A;  3DES A;  3S61 A;  4TLX A;  3S5S A;  1FEA A;  2EQ9 A;  4OPC A;  4E4U A;  5EBK A;  3SN0 A;  2RGO A;  3LZX A;  2TPR A;  1E7P A;  1PJ6 A;  3AEE A;  2XVI A;  1NHR A;  2WPF A;  1JPD X;  3AYL A;  3R10 A;  2BC0 A;  4HCL A;  2E5V A;  1MO9 A;  4HNC A;  4H7U A;  2B9W A;  2C75 A;  1GPE A;  2PP3 A;  4BJZ A;  1X31 B;  1GTE A;  3ICT A;  3EUB 3;  2C70 A;  2JB3 A;  3FJ4 A;  1N5X A;  3NO1 A;  1KFY A;  3RR1 A;  4C74 A;  5BRT A;  1KKR A;  3RCY A;  5J7X A;  3SXI A;  1S3E A;  4NEV A;  5KNL A;  3RNM A;  2PSN A;  5JCM A;  2OX4 A;  1GRG A;  3L8K A;  1ONE A;  4H4Q A;  4EIQ A;  4C5O A;  3AD8 B;  1L9D A;  2GDQ A;  2XGZ A;  2OQH A;  3UKK A;  1SB3 B;  1PXB A;  5G5G B;  1IUV A;  4ZOH B;  2OQY A;  3HYW A;  2WOI A;  4Z24 A;  4OCG A;  4G6G A;  4X9M A;  2YG5 A;  2VVL G;  3LJP A;  4U8O A;  5CQF A;  3RP7 A;  3UJF A;  1IJH A;  1MOK A;  3GRT A;  1O94 A;  2BK3 A;  2POZ A;  4A6N B;  4ZN0 A;  4BJY A;  2W55 A;  3IHM A;  2ACZ A;  3ATQ A;  1DXL A;  4H1Z A;  4EMI A;  3GYJ A;  2C4C A;  1FO4 A;  3R07 C;  4XWZ A;  2GF3 A;  1JRO A;  2R45 A;  2OZ3 A;  4TM4 A;  4H2Q A;  1AOG A;  3M13 A;  1PBF A;  3UOV A;  4AOX A;  4OPL A;  3KPF A;  2DKI A;  5BOF A;  3JVA A;  4HYR A;  3I4K A;  4B66 A;  3UJ2 A;  3AEF A;  2JB1 A;  5BOE A;  2QA1 A;  1ONF A;  1YKJ A;  2JBV A;  3NG7 X;  3UXK A;  2XVE A;  4BV6 A;  2C76 A;  4RG3 A;  4A7A A;  4DX3 A;  4H83 A;  3E1T A;  3Q9T A;  4J3Z A;  4FP1 A;  5ER0 A;  2XSX A;  1YY5 A;  4K2X A;  2HXU A;  2AAQ A;  1EL7 A;  1YQ4 A;  3F8D A;  3GRS A;  2V60 A;  3NT6 A;  2XFO A;  3R0K A;  1JEH A;  4IZG A;  4G8T A;  4J36 A;  4U8N A;  1STZ A;  3KKJ A;  3I6T A;  2NPX A;  1DOC A;  2OLA A;  4GDP A;  3DFH A;  2P8C A;  2PPG A;  3H12 A;  3UGV A;  3RGT A;  2BRA A;  1B4V A;  3UKH A;  3P4S A;  3ES8 A;  4Y4L A;  4H4V A;  1QO8 A;  3NRN A;  4A79 A;  4AT0 A;  1EC9 A;  4IV9 A;  2P0I A;  4Z17 A;  3TW9 A;  4F4R A;  1IUS A;  4J2W A;  4Z2U A;  3CPH G;  3DJD A;  3VCC A;  1Q1R A;  5GRT A;  3R1Z A;  5KMQ A;  4O5U A;  2GGH A;  1CJ2 A;  1FEC A;  3EAO A;  3V5F A;  3FBS A;  1CF3 A;  2VQB A;  4KX6 A;  1PDH A;  5HYM A;  2XH0 A;  1H84 A;  2APG A;  4B65 A;  2VOU A;  4OVI A;  2FBW A;  3F8R A;  3UKP A;  2GL5 A;  2PP1 A;  1DOE A;  3IWA A;  1NHS A;  2GGI A;  3A7A A;  3R25 A;  2PTX A;  2CHR A;  3H8I A;  3AE6 A;  1F8R A;  1ZOY A;  3UTE A;  2BK5 A;  1MRA A;  3IK4 A;  2XCG A;  1LVL A;  2TMD A;  4FK1 C;  3JSK A;  4ROP A;  3GO2 A;  5IPY A;  4GGB A;  2PHH A;  3T2K A;  3COX A;  2Z5X A;  4HPN A;  5BUK A;  2GGJ A;  1P2E A;  1L9C A;  3CYJ A;  4CRT A;  3ES7 A;  1GER A;  3MKC A;  1V97 A;  1BF3 A;  2XFQ A;  4HNL A;  4KT2 A;  2W0H A;  4TLZ A;  2E5A A;  3AED A;  5BUL A;  4GRT A;  1IUU A;  3NN0 X;  3V3W A;  1H7W A;  2FJD A;  1KNP A;  3GD6 A;  3NHO X;  2GR0 A;  5M10 A;  1XS2 A;  4HA6 A;  1N62 C;  4CY8 A;  3D1C A;  2GSH A;  2E3T A;  1NU5 A;  2B9Y A;  4A3R A;  3AE8 A;  3NTD A;  3GC2 A;  1RP0 A;  3NLC A;  3K7Q X;  3GWD A;  4AP3 A;  3DEQ A;  3FCP A;  4E0V A;  1Y0P A;  3SJN A;  4H2N A;  2B9X A;  1TDO A;  3UP5 A;  2OAM A;  1S2Q A;  2YLW A;  1O5W A;  1KCZ A;  3DG3 A;  3O0H A;  4H4P A;  1N60 C;  3UKF A;  3AMZ A;  3NVW B;  1OJC A;  3OZM A;  1EL5 A;  3SR6 B;  3ZDN A;  2OO6 A;  1JRX A;  5U25 A;  4EIP A;  2WEU A;  3V5C A;  3FVD A;  3VC6 A;  2GV8 A;  4G6H A;  4O5Q A;  2GR3 A;  3TQP A;  1BZL A;  3CGC A;  3ZLG A;  4NEW A;  4Z25 A;  2BRY A;  1VG0 A;  2BYB A;  3SZF A;  3RHA A;  4GGH A;  3N6J A;  1ZY8 A;  1K4Q A;  1FFU C;  4G7F A;  3MSY A;  2AQJ A;  1GV4 A;  3P0W A;  1E39 A;  4U8J A;  5G5H B;  3SN4 A;  3BHF A;  1JNR A;  2MNR A;  1FEB A;  3KLJ A;  3P1W A;  3EF6 A;  3MY9 A;  1X2H A;  4BUR A;  4GYP A;  5EU9 A;  1JCT A;  1F9C A;  5FS8 A;  3GDP A;  2BCP A;  2JAE A;  2C72 A;  1PJ5 A;  1TDK A;  3N4E A;  2QJN A;  4Y4M A;  1OJ9 A;  3DGH A;  1GRT A;  4GIR A;  3GMC A;  1Y56 A;  1RSG A;  1HYU A;  1S2Y A;  3ZYX A;  3OZ2 A;  1FHV A;  6ENL A;  2YG4 A;  5FS6 A;  1D7Y A;  1ZK7 A;  3FMW A;  3CTY A;  3P93 A;  3CAW A;  3GSI A;  3QPE A;  3PWG A;  4X4J A;  1PBE A;  3CGB A;  4Z2T A;  1P43 A;  4MKS A;  3KD9 A;  4OPU A;  2QJJ A;  3B97 A;  5IDZ A;  5DBJ A;  3DGB A;  3CN8 A;  2BC1 A;  3GYX A;  3NKS A;  3QFA A;  5U1O A;  4U8I A;  2R0C A;  3R0U A;  4K7Z A;  1WYG A;  4CCQ A;  4U2S A;  2BXR A;  1XPQ A;  1FIQ B;  1K0I A;  3NN6 X;  1ZMC A;  4NTC A;  4M6U A;  1B8S A;  1TDE A;  2W3R A;  5KOW A;  2OPJ A;  4H19 A;  3I3L A;  3P4Q A;  1FHU A;  3GY1 A;  3KPK A;  4GIS A;  3PO7 A;  4A65 A;  3UJE A;  4JNA A;  4UDP A;  3KUM A;  4ZA0 A;  1LQT A;  1DOD A;  3H8L A;  1P2H A;  2W3S A;  3B3R A;  3DJG X;  3NVY B;  1LTX R;  3Q4D A;  4Y4N A;  1H7X A;  2GAG B;  5KXJ A;  3DME A;  2YAU A;  2BXS A;  3T8Q A;  1XDI A;  2PTZ A;  5FJR A;  5U63 A;  2ZZC A;  3G5S A;  3TTE A;  1D4D A;  4EQS A;  1PXC A;  4HCD A;  2NQL A;  1H82 A;  3II4 A;  4Z1Y A;  2WQY A;  5ENL A;  2YR4 A;  3HZL A;  1WUF A;  1SJB A;  4IP5 A;  3A7U A;  2JK6 A;  4E5T A;  1CJC A;  3FV9 A;  2Q0L A;  4E6M A;  2V3B A;  3QN3 A;  4LA1 A;  1YQ3 A;  3CNT A;  3JW7 A;  1BKW A;  3F8P A;  5JCI A;  2YLT A;  4ICY A;  2X3N A;  4EMJ A;  1NHP A;  4YSX A;  5FMH A;  2YM2 A;  3SBF A;  4X2P A;  1TYP A;  3P4R A;  1OJD A;  5KMP A;  3DK4 A;  4YTM A;  2X8H A;  1GTH A;  3ALM A;  5KVI A;  2WP6 A;  1VRQ B;  2FJA A;  1Y56 B;  1EC8 A;  2XFP A;  4WX1 A;  1PBB A;  1KN0 A;  2Q6U A;  2GR1 A;  3DK8 A;  3C96 A;  2HZG A;  3V76 A;  2WOW A;  1XAN A;  4J57 A;  3NS1 B;  1ELS A;  1S7M A;  2QJM A;  2X50 A;  2POD A;  2AR8 A;  3URH A;  4CCR A;  4PAA A;  1KD0 A;  3AB1 A;  1RVK A;  1VDV A;  3RED A;  3GD4 A;  3NVV B;  1Z6L A;  4IHC A;  2J3N A;  2P3Z A;  1KSU A;  2GAH B;  5C2T A;  4H4Y A;  1XHC A;  3UXL A;  3VC5 A;  3H4K A;  3SZC A;  3AE4 A;  2C64 A;  3V3O A;  1Q1W A;  4LU6 A;  3CGD A;  3KA7 A;  4LII A;  3AN1 A;  4H2P A;  3GD3 A;  4JDR A;  3ITJ A;  2XLR A;  1PBD A;  3BI2 A;  2PTW A;  3VDG A;  3H70 A;  2RGH A;  1TE6 A;  3AE3 A;  4A5L A;  3DG7 A;  2B7R A;  1E1N A;  1LQU A;  4TVY A;  1PDY A;  1PXA A;  3B6D A;  3TOY A;  3DFY A;  3ISH A;  4OPD A;  2XVJ A;  2GH5 A;  1JNZ A;  1ELI A;  2ZBW A;  3AEG A;  2BS2 A;  2B76 A;  3L5O A;  2PMQ A;  4G73 A;  3NYF A;  2QVH A;  1PHH A;  4NNJ A;  2FJE A;  2GQF A;  2GRT A;  2PGE A;  1QJD A;  1IYX A;  2BCG G;  2UZZ A;  3DIP A;  5M0Z A;  3UJS A;  4ZCW A;  4AT2 A;  3AWI A;  3S47 A;  1ECQ A;  3R11 A;  2E4G A;  3NYC A;  5FJP A;  1P48 A;  1B37 A;  3AYJ A;  4IA6 A;  3UKL A;  2ARD A;  4OPG A;  4B67 A;  1V59 A;  4GYP C;  3CMM A;  1LJ1 A;  2XLT A;  4KEM A;  4II2 A;  3ATR A;  2OVL A;  4JN7 A;  1H83 A;  2BAC A;  1JRZ A;  2VZ2 A;  2P8B A;  3V4B A;  4EQW A;  4NWZ A;  2RAB A;  1GT8 A;  3NXL A;  1CBO A;  2QGY A;  4OPT A;  2XDO A;  4YTP A;  3PS9 A;  2CVJ A;  3ICR A;  2R9Z A;  1PBC A;  1GRB A;  1X2G A;  1CL0 A;  3NK2 X;  3FG2 P;  4B1B A;  1VQZ A;  3D47 A;  3L1R A;  3TCS A;  2P88 A;  1D4C A;  5JCK A;  2YG6 A;  3BI4 A;  4CY6 A;  2WDQ A;  3EPT A;  4ECH A;  1D5T A;  2R4E A;  3BOX A;  4I59 A;  1ZDL A;  4AOS A;  4HCH A;  3FIM B;  1OEP A;  4YKF A;  2O9Z A;  4IT1 A;  2I0Z A;  2PCE A;  4JY2 A;  2YVJ A;  1FCD A;  1H81 A;  3AE2 A;  1CHU A;  2OAL A;  4EM4 A;  1SEZ A;  2WS3 A;  2XFN A;  2JKC A;  3UOY A;  3SY4 A;  3TWB A;  3N6H A;  4E8G A;  4ZCD A;  3ZVH A;  1TZZ A;  2A8X A;  4C77 A;  2QDE A;  3UOX A;  2DW6 A;  1GOS A;  3K30 A;  4JNQ A;  3RO6 A;  3K1G A;  1F8S A;  4KWS A;  1KNR A;  3P3B A;  2WPC A;  1BQG A;  1LV0 A;  4ZCC A;  3U9I A;  2YWL A;  2V61 A;  1GRF A;  1N61 C;  2XLP A;  4H4S A;  4ENL A;  4DYE A;  3ABV A;  1RYI A;  4YSH A;  3SQS A;  2BAB A;  1FFV C;  2FKP A;  2WU5 A;  4GFI A;  4H4T A;  4U2L A;  4Z44 A;  4BK1 A;  3UP4 A;  1GND A;  3UTF A;  4YSZ A;  1GRA A;  1GET A;  1TYT A;  4APN A;  2C65 A;  2NVK X;  3NVZ B;  3UTH A;  2CFY A;  3IF9 A;  1UKV G;  4C3X A;  4IL2 A;  3R9U A;  3T31 A;  1B5Q A;  3HRD C;  3CIR A;  3UOZ A;  3H8A A;  1D7L A;  2VVL A;  3B9J B;  1E1L A;  2HQM A;  2WES A;  2CDU A;  1ZP0 A;  4EQR A;  3SX6 A;  1ZMD A;  1TDN A;  3T37 A;  2YG7 A;  2ZZ0 A;  1JDF A;  5FJO A;  2R4J A;  4A6G A;  5GSN A;  4EQX A;  3GYI A;  3SN1 A;  4TM1 A;  3NNE A;  3ICS A;  3HYV A;  4XWR A;  4RSL A;  3AD7 B;  1Q9I A;  4MMW A;  3NH3 X;  4IA5 A;  1KKO A;  1W4X A;  4UDQ A;  4X9N A;  3ETR B;  4REK A;  2BS3 A;  1PS9 A;  4P9S A;  4BK3 A;  3SQP A;  2HXT A;  4DSG A;  2ZZB A;  5CKU A;  3T0K A;  3BNM A;  2WBA A;  2X8C A;  2GB0 A;  1R6W A;  3OP2 A;  3C4N A;  1RM6 B;  3NTA A;  2YLR A;  3IJQ A;  1D4E A;  3QFB A;  3T2Z A;  3CNP A;  1DNC A;  3IHG A;  3AE9 A;  7ENL A;  2XH4 A;  3CPI G;  1KF6 A;  4J1O A;  2IID A;  3CK5 A;  3SSZ A;  3D8X A;  4G74 A;  1M6I A;  3SM8 A;  3T9P A;  3ZVH B;  1T3Q C;  1K0L A;  3I6E A;  3NZG A;  1H86 A;  4H4Z A;  2A87 A;  1L0V A;  2VRL A;  3DJJ A;  3DK9 A;  3NRZ B;  3QKE A;  2OLN A;  4HN8 A;  4K8G A;  2ZAD A;  4TM0 A;  2O56 A;  1H2I A;  4FX9 A;  1LPF A;  4DHG A;  4WCT A;  5KVH A;  3OC4 A;  5HY5 A;  1ZKQ A;  3QJ4 A;  1SJD A;  3N4F A;  2GEW A;  4H50 A;  4GCM A;  2PS2 A;  4GME A;  1BKH A;  3T2Y A;  2RGJ A;  3M12 A;  3QVR A;  3OW1 A;  3ZVI A;  1GAL A;  2DKH A;  1R0M A;  4DNA A;  3BJS A;  1E1M A;  2YQU A;  2EQ6 A;  3QSS A;  2WOV A;  2PA6 A;  4JN9 A;  2YLZ A;  4NTE A;  3K7T A;  1N5W C;  3AE7 A;  3D46 A;  3CXO A;  3DG6 A;  4J34 A;  3PG6 A;  1JU2 A;  3RP8 A;  4DXK A;  4H4U A;  1CJ3 A;  4JQ9 A;  4DGK A;  2VRM A;  3SYI A;  2GVC A;  3AD9 B;  4NZH A;  4IVM B;  3NIX A;  2QCU A;  4TVW A;  2Y6R A;  1ZXI C;  3M0O A;  4J31 A;  3UJR A;  2WP9 A;  4K2S A;  2Q0K A;  3UCD A;  3HPF A;  2C3C A;  2OA1 A;  1N1P A;  3GDN A;  4CBQ A;  2AL1 A;  1CC4 A;  4GDE A;  2XVH A;  4J56 A;  3DJE A;  4D04 A;  3U4F A;  1BGJ A;  1EBD A;  4B68 A;  2R46 A;  1NPX A;  2A89 A;  4YTN A;  3S5W A;  4CNK A;  2C7G A;  4H2R A;  1MNS A;  1MUC A;  2YG3 A;  3DA1 A;  1EL8 A;  1TRB A;  2EQ7 A;  3MUC A;  3AXB A;  3AE1 A;  3Q6J A;  4EWJ A;  3T14 A;  4DN1 A;  2ONE A;  1PDZ A;  1GXF A;  3EEZ A;  2EQ8 A;  3AEB A;  5KOX A;  3GMB A;  1MDL A;  3OTR A;  3CPJ G;  4FDC B;  3SZ0 A;  2PYX A;  1EC7 A;  3KVE A;  3AEC A;  2QQ6 A;  3A7R A;  1DTN A;  3VA8 A;  4U8L A;  2WHD A;  3LAD A;  3HW2 A;  2YR6 A;  1CC2 A;  2QDD A;  4K1W A;  3UTG A;  4B69 A;  4K8D A;  2X99 A;  3CNS A;  4OPI A;  3VQR A;  2YLX A;  3H7V A;  3UCC A;  1H6V A;  2H89 A;  1NEN A;  2HNE A;  1EBH A;  2AKM A;  1K0J A;  4IL0 A;  3CT2 A;  3VR9 A;  3I6D A;  3C4A A;  4H4R A;  2Q7V A;  1ZX9 A;  1DJN A;  4K22 A;  2AL2 A;  3T6C A;  3NK1 X;  4U2T A;  4FI4 A;  2XH2 A;  4U8M A;  2X8G A;  3HYX A;  5FJU A;  2F5Z A;  4I58 A;  3VR8 A;  2V5Z A;  5EB4 A;  1W6T A;  2PU0 A;  2BS4 A;  2IVE A;  4YT0 A;  1JRP A;  4EM3 A;  3RIT A;  2OKT A;  1YQZ A;  3KU9 A;  1M64 A;  4D03 A;  1GRE A;  3PVC A;  5C3J A;  3NFU A;  4USR A;  1FL2 A;  3CB3 A;  4C3Y A;  3PWI A;  3RRA A;  5HHF A;  3QTP A;  3THU A;  1VQW A;  2OZ8 A;  3BI5 A;  2VVM A;  2GMH A;  4B64 A;  4M0X A;  1BGN A;  5JCL A;  3FXG A;  3ENL A;  3IC9 A;  2MUC A;  4TM3 A;  3ALL A;  1FOH A;  2AKZ A;  4U8K A;  3VRA A;  2QA2 A;  2WU2 A;  1JOA A;  2OZT A;  4BK2 A;  2OLO A;  2B7S A;  2FJB A;  3PK7 A;  1YEY A;  3LZW A;  2WDR A;  5FS7 A;  1WUE A;  1OJA A;  3BHK A;  2XLU A;  3QVP A;  3NYE A;  1KSS A;  2Y6Q A;  1KDG A;  4YSY A;  5J60 A;  4GUV A;  3T4W A;  4Z43 A;  2GR2 A;  5J04 A;  1GEU A;  1COY A;  2OFJ A;  2PGW A;  2W54 A;  1PJ7 A;  3SFE A;  2YVG A;  3WE0 A;  3UCL A;  4N9X A;  3RP6 A;  3PFR A;  4K5R A;  4H2H A;  4YXD A;  1DJQ A;  5IQ4 A;  2QAE A;  5JRB A;  3MZN A;  2Z5Y A;  3JZU A;  4II3 A;  1ZOV A;  3NK0 X;  3BSM A;  1GSN A;  3DDM A;  3K7M X;  1JPM A;  1E6E A;  3LOV A;  2ZC8 A;  1GRH A;  4MJW A;  5FJT A;  1NDA A;  1NHQ A;  2C73 A;  3G5R A;  3TJI A;  2YLS A;  4NTD A;  4K5S A;  2PP0 A;  3LB8 A;  3EAN A;  4DWD A;  3AEA A;  3DER A;  3P9U A;  4KPL A;  2AL2 B;  2R0P A;  2R0G A;  2YR5 A;  1F6M A;  3AE5 A;  4GR1 A;  2IVD A;  1JRY A;  4USQ A;  1IUW A;  5EB5 A;  3QLD A;  3TWA A;  4A35 A;  4UP3 A;  4JHM A;  2XYO A;  1IUX A;  2I5Q A;  3QSE A;  3BNU A;  1E1K A;  1XPY A;  1NEL A;  1MXT A;  3P4P A;  2WDV A;  1MDR A;  4JN8 A;  3OZY A;  1TDF A;  2PU1 A;  3FYY A;  1OJT A;  1SJA A;  2BA9 A;  2PTY A;  5IQ1 A;  1NG3 A;  3VCN A;  3EKG A;  5KMR A;  2V6O A;  1CC6 A;  4PAB A;  3NGC X;  4HB9 A;  1E9I A;  2XLS A;  2XH7 A;  1PN0 A;  2C66 A;  4U8P A;  3ALJ A;  3SGL A;  1QLB A;  2H88 A;  5JCN A;  5EOW A;  2RDX A;  4E4F A;  4A99 A;  1EBG A;  5TR3 A;  4UDR A;  2DW7 A;  4GF7 A;  4GAV A;  4H4W A;  5KRQ A;  1NG4 A;  2YVF A;  3VRB A;  3CGE A;  1N4V A;  3ZLH A;  2GMJ A;  2VQ7 A;  4MGG A;  1N4W A;  5HXI A;  3DGZ A;  4AP1 A;  2OG9 A;  3IJI A;  4Z2R A;  4G9K A;  1F8W A;  1EL9 A;  3Q45 A;  4IVO B;  1L8P A;  2WP5 A;  2FYM A;  1VDC A;  1O95 A;  1DOB A;  1L9E A;  4A9W A;  2XFU A;  2E1M A;  4DSH A;  4Z26 A;  2WPE A;  2BK4 A;  1N63 C;  4KPR A;  1NEK A;  2GQW A;  1CJ4 A;  2XVF A; 
#chains in the Genus database with same CATH homology
 2GH5 A;  1JNZ A;  4J31 A;  1ELI A;  2FJD A;  4A6N A;  1KNP A;  2ZBW A;  3AEG A;  2BS2 A;  3NHO X;  3V3N A;  2GR0 A;  2WP9 A;  3LXD A;  2B76 A;  5KMS A;  3L5O A;  2Q0K A;  1VG9 A;  1BWC A;  2C3D A;  2YM1 A;  5M10 A;  3CNJ A;  2C3C A;  5L46 A;  2OA1 A;  4FK1 A;  4G73 A;  3QSM A;  4HA6 A;  1N1P A;  3GDN A;  3ADA B;  4CY8 A;  4JY3 A;  3NYF A;  1PHH A;  4NNJ A;  3D1C A;  2C67 A;  4CBQ A;  1CC4 A;  4GDE A;  4J33 A;  2FJE A;  2GQF A;  2GRT A;  2XVH A;  1QJD A;  4J56 A;  2B9Y A;  3DJE A;  2BCG G;  1N4U A;  2UZZ A;  3AE8 A;  3NTD A;  3SFD A;  4B63 A;  3SZW A;  1BGJ A;  4D04 A;  1RP0 A;  4GAP A;  4CNJ A;  4H4X A;  3NLC A;  3CND A;  1F3P A;  3K7Q X;  1REO A;  4YKG A;  1EBD A;  3GWD A;  5M0Z A;  4B68 A;  5LV9 A;  2R46 A;  5FS9 A;  1GES A;  1NPX A;  5BVA A;  2A89 A;  4AP3 A;  4YTN A;  4AT2 A;  4EMW A;  2JB2 A;  3S5W A;  3AWI A;  4CNK A;  4E0V A;  2C7G A;  4H2R A;  2E4G A;  1Y0P A;  4RG4 A;  3AYI A;  1S3B A;  2YG3 A;  3DA1 A;  3NYC A;  1EL8 A;  4H2N A;  1TRB A;  2B9X A;  2EQ7 A;  1B37 A;  3AYJ A;  3G5Q A;  2WET A;  1TDO A;  2V3A A;  3UP5 A;  2OAM A;  1NAA A;  3UKA A;  4IA6 A;  3UKL A;  3AXB A;  1S2Q A;  2ARD A;  3AE1 A;  4OPG A;  4B67 A;  2YLW A;  4M52 A;  1V59 A;  3Q6J A;  3CMM A;  1LJ1 A;  1O5W A;  2XLT A;  4II2 A;  3T14 A;  3O0H A;  3ATR A;  3VRD B;  5KWF A;  1GXF A;  4H4P A;  3UKF A;  1H83 A;  2BAC A;  1OJC A;  1JRZ A;  2EQ8 A;  2VZ2 A;  3GWF A;  3AEB A;  5KOX A;  3DH9 A;  3GMB A;  3D9X A;  1EL5 A;  3FPZ A;  4XXG A;  3ZDN A;  4EQW A;  1JRX A;  3CPJ G;  4FDC B;  3SZ0 A;  1IUT A;  5U25 A;  4NWZ A;  4EIP A;  2WEU A;  2RAB A;  2PYX A;  1GT8 A;  3UKQ A;  4YWO A;  3KVE A;  1CBO A;  2GV8 A;  4G6H A;  4O5Q A;  3AEC A;  2GR3 A;  2CUL A;  4ADW A;  4OPT A;  2XDO A;  1BZL A;  3CGC A;  4YTP A;  3PS9 A;  3S61 A;  2CVJ A;  4TLX A;  4NEW A;  4Z25 A;  1FEA A;  4U8L A;  2WHD A;  3ICR A;  2BRY A;  3LAD A;  2EQ9 A;  1VG0 A;  2BYB A;  4OPC A;  3SZF A;  2YR6 A;  2R9Z A;  1PBC A;  1GRB A;  1CC2 A;  5EBK A;  3RHA A;  2RGO A;  1CL0 A;  3UTG A;  4B69 A;  3LZX A;  2TPR A;  4K8D A;  1E7P A;  2X99 A;  1PJ6 A;  3NK2 X;  1ZY8 A;  3FG2 P;  3AEE A;  4B1B A;  1K4Q A;  3CNS A;  2XVI A;  1NHR A;  2AQJ A;  1GV4 A;  2WPF A;  1E39 A;  4OPI A;  4U8J A;  3VQR A;  2YLX A;  3AYL A;  3BHF A;  1JNR A;  3L1R A;  1H6V A;  2H89 A;  2BC0 A;  1NEN A;  2E5V A;  1MO9 A;  1K0J A;  1FEB A;  1D4C A;  3VR9 A;  3KLJ A;  4H7U A;  2B9W A;  5JCK A;  2YG6 A;  3BI4 A;  3P1W A;  2C75 A;  1GPE A;  2WDQ A;  3I6D A;  4CY6 A;  3EF6 A;  3C4A A;  4BJZ A;  3EPT A;  1X31 B;  1GTE A;  4ECH A;  1D5T A;  3ICT A;  4H4R A;  2R4E A;  2C70 A;  4BUR A;  2JB3 A;  4I59 A;  1ZDL A;  4AOS A;  3FIM B;  2Q7V A;  4YKF A;  1ZX9 A;  1KFY A;  4C74 A;  5BRT A;  2O9Z A;  5FS8 A;  1DJN A;  4K22 A;  2I0Z A;  3GDP A;  2BCP A;  5J7X A;  3SXI A;  4JY2 A;  3NK1 X;  2YVJ A;  2JAE A;  4U2T A;  1FCD A;  1S3E A;  4U8M A;  2C72 A;  2X8G A;  4NEV A;  3HYX A;  5KNL A;  3RNM A;  5JCM A;  1H81 A;  1PJ5 A;  1TDK A;  3AE2 A;  1CHU A;  2OAL A;  2F5Z A;  1GRG A;  3L8K A;  4EM4 A;  1SEZ A;  2WS3 A;  2XFN A;  2JKC A;  3UOY A;  4H4Q A;  4I58 A;  3VR8 A;  4Y4M A;  4EIQ A;  3SY4 A;  4C5O A;  2V5Z A;  5EB4 A;  3AD8 B;  1OJ9 A;  4ZCD A;  1L9D A;  3DGH A;  1GRT A;  2BS4 A;  2IVE A;  3GMC A;  1Y56 A;  1RSG A;  3UKK A;  4YT0 A;  1PXB A;  1IUV A;  4EM3 A;  1HYU A;  2A8X A;  3HYW A;  2WOI A;  1S2Y A;  4Z24 A;  3ZYX A;  4C77 A;  1YQZ A;  3OZ2 A;  4G6G A;  4OCG A;  3KU9 A;  4X9M A;  3UOX A;  1GOS A;  2YG4 A;  5FS6 A;  1D7Y A;  2YG5 A;  3K30 A;  4JNQ A;  1M64 A;  4D03 A;  2VVL G;  1GRE A;  3PVC A;  3LJP A;  5C3J A;  1ZK7 A;  4USR A;  1FL2 A;  3FMW A;  3CTY A;  4C3Y A;  4U8O A;  1F8S A;  1KNR A;  5CQF A;  5HHF A;  3GSI A;  3RP7 A;  2WPC A;  1VQW A;  1IJH A;  1MOK A;  1LV0 A;  4ZCC A;  3BI5 A;  3GRT A;  2VVM A;  1O94 A;  2BK3 A;  2GMH A;  1PBE A;  3CGB A;  4X4J A;  4B64 A;  2YWL A;  4Z2T A;  4OPU A;  3KD9 A;  2V61 A;  1GRF A;  4A6N B;  1BGN A;  2XLP A;  4H4S A;  5DBJ A;  4ZN0 A;  5JCL A;  4BJY A;  3CN8 A;  3ABV A;  2BC1 A;  1RYI A;  4YSH A;  3IHM A;  3GYX A;  2ACZ A;  3IC9 A;  3ATQ A;  2BAB A;  3NKS A;  3QFA A;  5U1O A;  1DXL A;  4U8I A;  4EMI A;  4TM3 A;  3GYJ A;  2C4C A;  2WU5 A;  4H4T A;  4U2L A;  3ALL A;  4XWZ A;  1FOH A;  4Z44 A;  3UP4 A;  4BK1 A;  4U8K A;  2R0C A;  1GND A;  2GF3 A;  3VRA A;  3UTF A;  2QA2 A;  2R45 A;  2WU2 A;  4YSZ A;  4TM4 A;  4K7Z A;  1AOG A;  1GRA A;  1JOA A;  1GET A;  1PBF A;  3M13 A;  4H2Q A;  1TYT A;  4APN A;  3UOV A;  4BK2 A;  2C65 A;  2NVK X;  3UTH A;  4AOX A;  4OPL A;  2CFY A;  4CCQ A;  4U2S A;  2BXR A;  2OLO A;  1XPQ A;  3IF9 A;  1UKV G;  2B7S A;  1K0I A;  3NN6 X;  2FJB A;  4C3X A;  1ZMC A;  2DKI A;  3KPF A;  4NTC A;  3R9U A;  3T31 A;  3LZW A;  2WDR A;  1B8S A;  5FS7 A;  4B66 A;  1OJA A;  1TDE A;  3BHK A;  1B5Q A;  3AEF A;  2JB1 A;  2XLU A;  3QVP A;  3CIR A;  2QA1 A;  1ONF A;  5KOW A;  3NYE A;  1YKJ A;  3UOZ A;  1D7L A;  1KSS A;  2JBV A;  3NG7 X;  2VVL A;  2Y6Q A;  1KDG A;  2XVE A;  3I3L A;  4YSY A;  3P4Q A;  3KPK A;  4BV6 A;  1E1L A;  2C76 A;  4RG3 A;  3PO7 A;  5J60 A;  4A65 A;  4A7A A;  2HQM A;  4JNA A;  3E1T A;  4GUV A;  4UDP A;  2WES A;  2CDU A;  1ZP0 A;  4Z43 A;  1LQT A;  2GR2 A;  4EQR A;  1DOD A;  3Q9T A;  3SX6 A;  1ZMD A;  3H8L A;  1TDN A;  1P2H A;  1GEU A;  5ER0 A;  3B3R A;  1COY A;  1YY5 A;  3T37 A;  2YG7 A;  4K2X A;  2AAQ A;  1EL7 A;  1PJ7 A;  3DJG X;  2ZZ0 A;  1YQ4 A;  3SFE A;  2YVG A;  1LTX R;  2R4J A;  3F8D A;  3WE0 A;  3UCL A;  3GRS A;  4N9X A;  3RP6 A;  4Y4N A;  5GSN A;  2V60 A;  4EQX A;  3GYI A;  4K5R A;  3NT6 A;  1H7X A;  2GAG B;  2XFO A;  4YXD A;  1DJQ A;  4TM1 A;  3DME A;  5KXJ A;  3NNE A;  3ICS A;  5IQ4 A;  2QAE A;  1JEH A;  2YAU A;  2BXS A;  3HYV A;  5JRB A;  2Z5Y A;  1XDI A;  4XWR A;  4RSL A;  4II3 A;  3AD7 B;  1Q9I A;  1ZOV A;  3NH3 X;  5U63 A;  3NK0 X;  4J36 A;  4U8N A;  4IA5 A;  2ZZC A;  1GSN A;  3K7M X;  1W4X A;  3G5S A;  1E6E A;  3LOV A;  4UDQ A;  4X9N A;  1D4D A;  4EQS A;  1PXC A;  1GRH A;  2BS3 A;  1H82 A;  1PS9 A;  3KKJ A;  4MJW A;  4P9S A;  4REK A;  2NPX A;  4BK3 A;  1DOC A;  3SQP A;  3II4 A;  4GDP A;  4DSG A;  2WQY A;  2ZZB A;  2YR4 A;  5CKU A;  1NDA A;  3T0K A;  3HZL A;  1NHQ A;  2C73 A;  3G5R A;  3BNM A;  2WBA A;  2JK6 A;  2BRA A;  1CJC A;  2X8C A;  1B4V A;  2Q0L A;  2GB0 A;  3C4N A;  3UKH A;  2YLS A;  3P4S A;  4NTD A;  4K5S A;  2V3B A;  4LA1 A;  3LB8 A;  3EAN A;  3NTA A;  2YLR A;  4Y4L A;  4H4V A;  1QO8 A;  3AEA A;  1YQ3 A;  1D4E A;  3QFB A;  3CNT A;  3NRN A;  3P9U A;  3T2Z A;  1BKW A;  4A79 A;  4AT0 A;  2R0P A;  3F8P A;  4IV9 A;  5JCI A;  2R0G A;  2YLT A;  2YR5 A;  3CNP A;  1DNC A;  3IHG A;  4ICY A;  2X3N A;  3AE9 A;  1F6M A;  3AE5 A;  4EMJ A;  1NHP A;  4GR1 A;  2IVD A;  4YSX A;  5FMH A;  2YM2 A;  1JRY A;  1IUS A;  1TYP A;  3P4R A;  4J2W A;  3CPI G;  1KF6 A;  1OJD A;  2IID A;  5KMP A;  3DK4 A;  4YTM A;  4USQ A;  1IUW A;  3D8X A;  5EB5 A;  2X8H A;  4G74 A;  4Z2U A;  1GTH A;  3ALM A;  5KVI A;  1M6I A;  2WP6 A;  1VRQ B;  3CPH G;  3SM8 A;  3DJD A;  1K0L A;  2FJA A;  1Y56 B;  4UP3 A;  1H86 A;  2XYO A;  2XFP A;  1Q1R A;  4WX1 A;  1PBB A;  4H4Z A;  1IUX A;  5GRT A;  2A87 A;  1KN0 A;  2Q6U A;  3QSE A;  5KMQ A;  1L0V A;  4O5U A;  3BNU A;  2GR1 A;  1E1K A;  2VRL A;  3DJJ A;  3DK9 A;  1MXT A;  3P4P A;  2WDV A;  3DK8 A;  1CJ2 A;  3C96 A;  1FEC A;  2OLN A;  3EAO A;  1TDF A;  3FBS A;  3V76 A;  1CF3 A;  4TM0 A;  1OJT A;  2WOW A;  1XAN A;  1H2I A;  4FX9 A;  1LPF A;  2VQB A;  4KX6 A;  4J57 A;  1PDH A;  2BA9 A;  4WCT A;  5KVH A;  3OC4 A;  1NG3 A;  5IQ1 A;  5HYM A;  5HY5 A;  1H84 A;  1ZKQ A;  3QJ4 A;  5KMR A;  2GEW A;  4H50 A;  4GCM A;  2APG A;  4B65 A;  1S7M A;  2V6O A;  1CC6 A;  2VOU A;  2FBW A;  3F8R A;  4OVI A;  4PAB A;  3T2Y A;  2X50 A;  3NGC X;  3UKP A;  4HB9 A;  2RGJ A;  3M12 A;  2AR8 A;  2XLS A;  3URH A;  1DOE A;  1PN0 A;  3IWA A;  1NHS A;  4CCR A;  2C66 A;  4PAA A;  3AB1 A;  3QVR A;  3H8I A;  1GAL A;  3AE6 A;  2DKH A;  1F8R A;  1ZOY A;  4U8P A;  3GD4 A;  3RED A;  1Z6L A;  3ALJ A;  3UTE A;  3SGL A;  1QLB A;  2BK5 A;  2J3N A;  2XCG A;  1KSU A;  4DNA A;  2GAH B;  1LVL A;  2TMD A;  4FK1 C;  3JSK A;  5C2T A;  4H4Y A;  1XHC A;  2H88 A;  5JCN A;  5EOW A;  4A99 A;  5TR3 A;  1E1M A;  4UDR A;  2YQU A;  4GF7 A;  2EQ6 A;  3H4K A;  4H4W A;  4GAV A;  3QSS A;  5KRQ A;  3SZC A;  2WOV A;  1NG4 A;  3AE4 A;  2YVF A;  3VRB A;  3CGE A;  1N4V A;  2GMJ A;  5IPY A;  2VQ7 A;  4JN9 A;  2YLZ A;  4NTE A;  3K7T A;  2PHH A;  2C64 A;  3T2K A;  3AE7 A;  3COX A;  2Z5X A;  3V3O A;  1Q1W A;  1N4W A;  4LU6 A;  3CGD A;  3KA7 A;  5HXI A;  4LII A;  5BUK A;  3DGZ A;  1P2E A;  4AP1 A;  1L9C A;  3PG6 A;  4J34 A;  4CRT A;  1JU2 A;  3RP8 A;  4Z2R A;  4H2P A;  4H4U A;  4G9K A;  1CJ3 A;  1F8W A;  4JQ9 A;  4DGK A;  3GD3 A;  1GER A;  1EL9 A;  2VRM A;  3SYI A;  4JDR A;  1BF3 A;  3ITJ A;  4IVO B;  2XLR A;  1PBD A;  2GVC A;  2XFQ A;  2WP5 A;  1VDC A;  3BI2 A;  2W0H A;  4TLZ A;  3AD9 B;  1O95 A;  1DOB A;  2RGH A;  1L9E A;  4NZH A;  3AED A;  4IVM B;  3AE3 A;  3NIX A;  4A9W A;  4A5L A;  5BUL A;  2XFU A;  2QCU A;  2B7R A;  2E1M A;  4DSH A;  1E1N A;  4Z26 A;  1LQU A;  4GRT A;  1IUU A;  2WPE A;  1PXA A;  2BK4 A;  4KPR A;  1NEK A;  2Y6R A;  3B6D A;  3NN0 X;  2GQW A;  3M0O A;  1CJ4 A;  2XVF A;  3ISH A;  1H7W A;  4OPD A;  2XVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...