1NHSA

An l40c mutation converts the cysteine-sulfenic acid redox centre in enterococcal nadh peroxidase to a disulfide
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title An L40C mutation converts the cysteine-sulfenic acid redox center in enterococcal NADH peroxidase to a disulfide.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase (h2o2(a))
total genus 137
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1994-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1nhsA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1nhsA02
2BA9A 2CVJA 1TDNA 3NK1X 2C3CA 4DSHA 1NHQA 3M12A 1CHUA 3AE4A 3O0HA 3G5RA 3EAOA 4UDQA 4C74A 4IVOB 2BXSA 4ICYA 1GRHA 4HB9A 3VQRA 4OPLA 1OJAA 2WHDA 2VVLG 2X50A 2ZZ0A 1F8WA 2DKHA 3AD8B 4OPTA 3G5QA 5U25A 3AB1A 2BACA 3LJPA 1IUWA 4M52A 2XVJA 4FDCB 5U1OA 2YR6A 3T37A 4BJZA 1XANA 3NN6X 3NLCA 1M64A 4Z24A 1QLBA 2V60A 4AP1A 2YLXA 2TPRA 3P4SA 4Y4LA 3UP5A 4U8KA 5KOWA 4H4VA 2R0PA 4A5LA 3IWAA 3L8KA 2R0CA 2IVEA 3KD9A 2UZZA 3DH9A 1TYPA 3P4PA 3BI4A 2BC1A 2VVLA 2WDQA 2C75A 3I6DA 3K7QX 3NTDA 3QVPA 2YG7A 2WESA 2WU5A 3FMWA 2ARDA 4RSLA 2JB1A 1N4WA 4RG4A 3NYCA 1HYUA 3CPHG 4TLXA 3UKAA 3IC9A 4YSYA 3GD4A 1L0VA 3NH3X 4WX1A 3DJDA 4OPDA 4Z2TA 4FK1C 1CL0A 1E7PA 2C7GA 5C2TA 2W0HA 2CDUA 1EL8A 1ZMCA 5C3JA 4H2PA 2F5ZA 1JOAA 2GVCA 1VG9A 1Y56A 3AEEA 3BHFA 1LVLA 1IUXA 3IHGA 4GCMA 1JNZA 3AYLA 1E1LA 4U8NA 2GV8A 1CF3A 3D1CA 4OCGA 3NK0X 1FECA 1CC2A 5FS8A 3SGLA 2XDOA 3NNEA 2C72A 2OALA 3DK4A 3SM8A 1IUTA 3AE1A 2C67A 4Z2UA 2C64A 1REOA 1K4QA 3BNMA 2V6OA 4U2SA 4N9XA 1H86A 3LXDA 1ZOVA 3NHOX 4U8LA 4D04A 1FEBA 2OLOA 1PXCA 4H4WA 3C4AA 1O95A 1D7LA 1B4VA 1YY5A 2A89A 4JDRA 4EQXA 2JKCA 1XPQA 1CJ3A 3L1RA 3CNJA 3M13A 3DGHA 1YKJA 1DXLA 3UKFA 2XFOA 3BI5A 3V76A 5BULA 4MJWA 2EQ9A 1TDEA 2TMDA 3ICTA 4TM4A 2GR2A 2Q0KA 2XLRA 4XXGA 3RP8A 1D4DA 4GDEA 1LQUA 2RGJA 3AD7B 1Q1RA 2EQ6A 3UOVA 4J56A 5J60A 3BI2A 1GRTA 1SEZA 3CTYA 4A65A 3EANA 2GH5A 1YQZA 4JQ9A 3CNPA 2C65A 1TDFA 4C77A 1E1NA 3VRBA 1RYIA 2WU2A 4NTCA 3QFBA 5FMHA 4IA6A 3UTEA 4B66A 3NK2X 3ALMA 5ER0A 2QA2A 1BZLA 3LZWA 2APGA 4J57A 4Z2RA 2B7RA 3AWIA 3SFDA 2R46A 4H2QA 1FCDA 4E0VA 3P1WA 4H4ZA 2XFUA 2WQYA 2YVGA 2X8HA 3EF6A 5FS6A 1D5TA 1MXTA 1GRAA 5J7XA 1BGNA 5KVIA 5TR3A 2R0GA 1DOEA 5EB5A 4NEWA 2CULA 1E1KA 1CJ2A 4EQWA 4A7AA 1ZX9A 5GRTA 1E39A 1PXAA 1TDOA 1VDCA 2BCGG 3C96A 3AEFA 1ZMDA 2WDVA 1GALA 3ADAB 3F8PA 4O5UA 3AE2A 3NN0X 1XDIA 2AAQA 4H4QA 4PAAA 1PBDA 3ICSA 2YR4A 4H4RA 2WPCA 2YLWA 3BNUA 3CNTA 1GV4A 1D7YA 1K0LA 3KLJA 3CNSA 5GSNA 4AT2A 5DBJA 4YKGA 1X31B 4TM3A 4Y4MA 1P2HA 4AOXA 4IA5A 3EPTA 1IUSA 4J34A 2EQ8A 1ZOYA 2XYOA 1KF6A 5JCLA 1FL2A 3DGZA 3NT6A 4UDRA 3URHA 3KA7A 4H7UA 1GEUA 2EQ7A 5KOXA 2A87A 1RP0A 4A6NA 4UP3A 4RG3A 1DJNA 3Q6JA 3B3RA 2O9ZA 2WBAA 1EL7A 2YG3A 4U8OA 4X9NA 4AT0A 1GNDA 2WDRA 1EL9A 2C66A 3ICRA 5HHFA 3FPZA 4J31A 3P4QA 1W4XA 2JBVA 4NTDA 3PVCA 1XHCA 2X99A 1F6MA 2J3NA 4JN9A 1DODA 5M10A 2Z5YA 1VQWA 3BHKA 1D4CA 4ADWA 1FOHA 5KVHA 1P2EA 1PS9A 3HZLA 4JNQA 1PBBA 2GQWA 2OAMA 1ELIA 2YM2A 4KPRA 3C4NA 3CGBA 3FIMB 3IF9A 1N4UA 3I3LA 2GR0A 2YM1A 3QJ4A 3AXBA 2BXRA 2XLUA 2QA1A 4HA6A 1NENA 2B9XA 1ZDLA 2JAEA 4BK3A 1GETA 2YLZA 4EIQA 4K22A 2JB2A 5HY5A 1PJ5A 2XVEA 3D8XA 4K5RA 1S3BA 2WOVA 4K2XA 2A8XA 4NZHA 1B37A 3QVRA 4U8MA 3AE7A 3ITJA 3UOZA 4USQA 1PN0A 4K8DA 3KPFA 4H4XA 1BGJA 5JCNA 1PJ7A 3F8RA 3DA1A 3PO7A 3GYIA 3RP6A 4O5QA 2YG6A 3JSKA 1M6IA 4GF7A 1PJ6A 3RNMA 5HXIA 2YVJA 2Q0LA 1MO9A 4U2TA 1E1MA 4XWRA 2RGOA 1TDKA 3CGCA 2ZBWA 2XVIA 3NYEA 1B8SA 1NG3A 1ONFA 3ZDNA 5IPYA 1H81A 1S2QA 2GRTA 3Q9TA 2Y6QA 2VQ7A 2BYBA 4GR1A 2Q7VA 2R4EA 3REDA 3ABVA 4IV9A 5JCMA 4A9WA 3VRDB 1GRGA 4C3YA 4EM4A 4YXDA 1D4EA 2GF3A 1NG4A 5L46A 1UKVG 2E1MA 2XLPA 3F8DA 1F3PA 2ZZCA 3VR9A 4AP3A 1IJHA 3NYFA 2YG5A 1IUVA 3NKSA 1Q9IA 1JEHA 1AOGA 1S3EA 2X8CA 1NPXA 1ZP0A 4OPCA 3KU9A 1H7XA 1CJ4A 2V61A 4CNKA 1IUUA 1L9CA 4OPUA 2Y6RA 3QSMA 3LOVA 4CCQA 3LB8A 1Y0PA 4NTEA 1PHHA 4EMIA 4APNA 1N1PA 1O5WA 3AE6A 4GUVA 3P9UA 3H8LA 3R9UA 1VG0A 3AE5A 2VQBA 2GR3A 4A79A 3AYIA 4H4TA 4OPGA 3AE3A 1ZKQA 3CGDA 1K0JA 4YTMA 3WE0A 3GDNA 3LADA 2BS3A 3KKJA 1JRXA 1DJQA 1Y56B 2PHHA 3GMCA 4B63A 4TM1A 1H82A 2JB3A 2Q6UA 5BUKA 4UDPA 3S61A 4LU6A 2WOWA 2E4GA 4H2NA 1Z6LA 2XFPA 2XFQA 1DOCA 3GSIA 5KXJA 2ZZBA 3V3OA 4PABA 3AYJA 3NG7X 3GYJA 4ECHA 4ZCCA 4YT0A 1ZY8A 1YQ4A 2GB0A 4B68A 3UTFA 3NRNA 2PYXA 3KVEA 2XFNA 1GPEA 1KSSA 3NIXA 3UTGA 3GWDA 1NHSA 4H4PA 1F8RA 1PBFA 4JNAA 1BF3A 4I58A 4H4UA 2H89A 4Z26A 1BKWA 1JRYA 4YTNA 1OJCA 2RABA 2C76A 1H7WA 4U8IA 4X9MA 3ATRA 1GREA 4YSXA 4LIIA 2C73A 2WP5A 4CBQA 3CIRA 1QO8A 3DJGX 4REKA 3AECA 2DKIA 1NHPA 3ALJA 3GMBA 1V59A 4EIPA 4Y4NA 1GRBA 1CBOA 5EBKA 2R9ZA 1GESA 2OLNA 1H83A 4H2RA 4J36A 5CKUA 5BRTA 3IHMA 4KX6A 4YTPA 1PXBA 2WP9A 1TYTA 4YWOA 1GOSA 4P9SA 5IQ1A 4CRTA 4EQSA 3DMEA 4TLZA 1F8SA 2ACZA 1JRZA 4FX9A 2HQMA 1OJDA 2WP6A 3ALLA 3G5SA 4A99A 2XCGA 3H8IA 4I59A 2JK6A 2XVHA 1JU2A 5FS9A 1CC4A 5LV9A 1GT8A 1S2YA 2GEWA 5BVAA 3DJEA 3UOXA 3AEDA 4Z25A 3DK8A 4H4SA 4U8JA 2Z5XA 3UKPA 4C3XA 2YR5A 1GSNA 2YAUA 4DNAA 1EBDA 2QCUA 3AD9B 3QSSA 4AOSA 1EL5A 3OZ2A 3K7MX 1JNRA 3CPIG 3UCLA 3PS9A 3ISHA 4B1BA 2I0ZA 3H4KA 2AR8A 2BS2A 1NHRA 4J2WA 3CGEA 2V5ZA 2WOIA 2WETA 1DNCA 3SFEA 3VRAA 4B64A 4B67A 2R4JA 1GERA 2VRLA 2YLSA 2YLRA 1GTHA 4U8PA 2FBWA 3ZYXA 4YSZA 2VOUA 2QAEA 1COYA 1OJTA 5KWFA 2BK4A 1Q1WA 3UKHA 2YWLA 5EB4A 4C5OA 4DSGA 4YKFA 2E5VA 3CPJG 3GDPA 2WEUA 3AE9A 1PBEA 4Z43A 2AQJA 1FEAA 3VR8A 4A6NB 1CC6A 3ATQA 2FJBA 4D03A 2BABA 3QSEA 5JCIA 3OC4A 2XLTA 4WCTA 2X8GA 3NGCX 4CNJA 4B69A 2XLSA 2X3NA 2H88A 2YQUA 4EM3A 2R45A 2FJDA 2WS3A 3UKKA 1VRQB 3AE8A 2VZ2A 1L9EA 4Z44A 3SQPA 2BS4A 3UP4A 5HYMA 1K0IA 2WPFA 2GAGB 3NTAA 3RHAA 5FS7A 2YLTA 2B9WA 5IQ4A 3S5WA 1LQTA 1TRBA 1ZK7A 1OJ9A 3GD3A 3UKLA 4ZN0A 1LPFA 1GTEA 2C3DA 2GQFA 3GRTA 4EMJA 1KNPA 3AEBA 4FK1A 4CY8A 3K7TA 2YG4A 4JY3A 1KDGA 1NDAA 1GRFA 4NEVA 1LV0A 4ZCDA 3CNDA 4BJYA 1KFYA 3V3NA 4CY6A 3RP7A 2GMJA 1DOBA 2VRMA 4USRA 1L9DA 5EOWA 4OVIA 4H4YA 2C70A 3K30A 5U63A 1LJ1A 2IIDA 2BK3A 2OA1A 1KNRA 4DGKA 1CJCA 3AEGA 1MOKA 1E6EA 2BCPA 4X4JA 3FG2P 4K7ZA 4TM0A 1H6VA 4BV6A 1RSGA 2B7SA 5M0ZA 1BWCA 3QFAA 4J33A 2FJEA 4GDPA 5KRQA 4EMWA 4JY2A 3UOYA 1YQ3A 3DK9A 3LZXA 4XWZA 2BC0A 1N4VA 1KSUA 2IVDA 4U2LA 2NVKX 3DJJA 4IVMB 2NPXA 3GWFA 4EQRA 2B9YA 3B6DA 3E1TA 4CCRA 2CFYA 1O94A 1PBCA 2WPEA 1QJDA 2V3AA 4BK1A 2FJAA 1NAAA 3UTHA 1GXFA 4LA1A 2YVFA 2V3BA 3M0OA 3AEAA 2B76A 4YSHA 4BURA 3II4A 3P4RA 4B65A 2BK5A 2RGHA 3UKQA 4H50A 2VVMA 4OPIA 4BK2A 2GAHB 5CQFA 3COXA 3FBSA 5JCKA 3GRSA 4GRTA 1B5QA 1LTXR 3CN8A 2GR1A 2XVFA 1NEKA 2GMHA 4K5SA 1H84A 1PDHA
chains in the Genus database with same CATH superfamily
2BA9A 1V97A 1WUFA 3M12A 3EAOA 4IVOB 2BRYA 4HB9A 2X50A 1EC9A 4CCQA 4BJZA 1XANA 1M64A 4Z24A 2V60A 1IYXA 4U8KA 3NVWB 3DH9A 1YEYA 2QJNA 5G5HB 2WDQA 2C75A 2YG7A 3FMWA 1R0MA 3VDGA 1N4WA 4GGBA 4YSYA 3GD4A 3NH3X 3DJDA 4TVWA 4Z2TA 1CL0A 3ETRB 1EL8A 1ZMCA 4IHCA 3BHFA 1VG9A 3VC5A 1CF3A 1ECQA 3NK0X 3SGLA 3NNEA 2OALA 1PDZA 1IUTA 3R11A 4U2SA 1H86A 2OLOA 3RITA 1D7LA 4GAPA 3M13A 3DGHA 3R0KA 2AL2B 4GYPC 4XXGA 3NVZB 3AD7B 4J56A 3CTYA 1YQZA 2C65A 1TDFA 1RYIA 3QKEA 3ALMA 1KD0A 1BZLA 4F4RA 2APGA 2B7RA 3SFDA 2R46A 2QQ6A 2YVGA 3EF6A 5FS6A 1MXTA 4FI4A 1BGNA 5G5GB 5GRTA 3R10A 1PXAA 3RRAA 1VDCA 3AEFA 3A7UA 5KMQA 1ZMDA 3A7AA 3ICSA 3CNTA 1GV4A 1D7YA 4HYRA 4Y4MA 2HXUA 4AOXA 4DYEA 3HYXA 2EQ8A 1GEUA 5KOXA 1RP0A 4RG3A 2QJMA 1DJNA 1RVKA 3Q6JA 2O9ZA 1L8PA 4AT0A 2C66A 3FPZA 2X99A 4M0XA 2GDQA 5M10A 1FOHA 3HZLA 3I6EA 2QGYA 4KEMA 1ELIA 4KPRA 3SZCA 3FIMB 3OZYA 3AXBA 3AM9A 1GETA 2YLZA 4EIQA 2JB2A 3OZMA 2XVEA 1B37A 3UOZA 4K8DA 3F8RA 3DEQA 3DA1A 3JSKA 4U2TA 1E1MA 3V4BA 3Q9TA 2Y6QA 5JCMA 4NNJA 4C3YA 4IP5A 4EM4A 2ONEA 2E1MA 3GO2A 2XLPA 3F8DA 4AP3A 1IJHA 3NKSA 1FHUA 1S3EA 4KT2A 1ZP0A 1CJ4A 4G9KA 1L9CA 4OPUA 2Y6RA 2AKMA 1MUCA 1O5WA 3P9UA 3H8LA 3R9UA 1VG0A 3AE5A 3DGBA 4OPGA 1ZKQA 2PU0A 5IDZA 3WE0A 2GSHA 3JVAA 2PHHA 4TM1A 4GISA 2E4GA 4H2NA 5KXJA 3AYJA 4YT0A 3H12A 1ZY8A 2GB0A 3UTFA 4MMWA 3KVEA 2XFNA 3UTGA 1NHSA 1F8RA 1PBFA 1NU5A 4H4UA 1GREA 4LIIA 2FYMA 3DJGX 2PSNA 1V59A 4IL2A 1ZXIC 3HPFA 4Y4NA 2R9ZA 1GESA 2OLNA 1H83A 1H2IA 2OZ8A 1PXBA 5FJTA 4NWZA 4P9SA 4TLZA 1JRZA 4KWSA 1OJDA 2HQMA 2WP6A 3ALLA 2XVHA 1P48A 1CC4A 1GT8A 1X2HA 3ES8A 3DK8A 4H4SA 4GAVA 3UKPA 1VDVA 2QCUA 3AD9B 1EL5A 3K7MX 4HPNA 3CPIG 3UCLA 3Q4DA 4B1BA 2W3RA 4IZGA 3T2KA 3CGEA 1ELSA 3SSZA 2V5ZA 4B64A 2R4JA 2YLRA 4U8PA 2QAEA 1COYA 2GGGA 3CPJG 3VCCA 1FEAA 4GIRA 2FJBA 3IJLA 2W54A 5JCIA 3ZVHA 4IT1A 4CNJA 3UKKA 4Z44A 3NTAA 5FS7A 2YLTA 4HCHA 3S5WA 3OPSA 1ZK7A 1OJ9A 3GD3A 4ZN0A 4FK1A 1LV0A 4BJYA 2HXTA 3DG7A 1DOBA 4USRA 4OVIA 3K30A 2C70A 5FJRA 1LJ1A 2BK3A 4DGKA 2XH2A 3NS1B 3AEGA 1MNSA 1R6WA 4TM0A 4BV6A 4G6GA 4EMWA 4DWDA 3DK9A 3LZXA 2BC0A 1N4VA 4U2LA 1XS2A 2XGZA 4EQRA 4CCRA 2CFYA 1F9CA 2FJAA 1ONEA 4LA1A 3VC6A 4II2A 3N4FA 3RR1A 3UKQA 4TVYA 5JCKA 2GR1A 4EWJA 2CVJA 1TDNA 3THUA 2C3CA 2OZTA 3MWCA 3MZNA 4UDQA 4C74A 2XH4A 4ICYA 3VQRA 5FJUA 1N62C 2VVLG 2ZZ0A 2BACA 2XVJA 4M52A 4FDCB 3H70A 3NLCA 1QLBA 4AP1A 2YLXA 2TPRA 2IVEA 3KD9A 2UZZA 1TYPA 3ZLGA 5JRBA 2BC1A 2PPGA 4H1ZA 3DDMA 4RG4A 1HYUA 4TLXA 3UKAA 1L0VA 3TJIA 3P93A 3S47A 3CT2A 5C3JA 1JOAA 2GVCA 3AYLA 1E1LA 4U8NA 1FECA 3STPA 4DHGA 2C67A 4Z2UA 3LXDA 2A89A 2JKCA 1XPQA 1CJ3A 3L1RA 3Q45A 1DXLA 3UKFA 4H19A 2XFOA 3BI5A 3V76A 5BULA 3P3BA 1TDEA 3ICTA 2GR2A 2Q0KA 2XLRA 3RP8A 5J60A 2EQ6A 3BI2A 1GRTA 4A65A 2GH5A 3CNPA 4JQ9A 4C77A 3VRBA 4NTCA 2WU2A 3QFBA 5FMHA 4B66A 3SJNA 4J57A 4ZOHB 3AWIA 4H4ZA 1JRPA 2XFUA 3MY9A 1BQGA 5KVIA 5TR3A 1DOEA 4NEWA 2CULA 1CJ2A 2BCGG 3C96A 1GALA 3T2ZA 4H4QA 3BNUA 2YLWA 3BJSA 2OQYA 3KLJA 3QTPA 4YKGA 4TM3A 4IA5A 1IUSA 1ZOYA 1FL2A 3DGZA 4UDRA 4HN8A 3KA7A 4H7UA 4A6NA 4X9NA 3P4QA 3RGTA 4K8GA 5ENLA 1VQWA 3BHKA 3KPKA 1D4CA 5KVHA 1PS9A 2OVLA 2OAMA 2YM2A 1N4UA 4II3A 3CXOA 3QJ4A 2BXRA 2XLUA 2B9XA 1ZDLA 1E9IA 3GYXA 1PJ5A 3AE7A 3ITJA 4USQA 1PN0A 4H4XA 1BGJA 1BKHA 5JCNA 1PJ7A 3GYIA 3RP6A 4O5QA 2YG6A 2PGEA 1PJ6A 2YVJA 2RGOA 2PP1A 2XVIA 2ZBWA 1B8SA 1NG3A 1ONFA 3HW2A 2GRTA 2PU1A 2Q7VA 2R4EA 4A9WA 3SN0A 3VRDB 1GRGA 5KMRA 5L46A 3VR9A 1AOGA 3OW1A 3FYYA 4OPCA 3KU9A 3RO6A 4CNKA 1EC8A 3QSMA 1PHHA 4APNA 2VQBA 4DN1A 3D9XA 2GR3A 3I6TA 4YTMA 3N4EA 3A7RA 3LADA 3KKJA 4B63A 1H82A 2JB3A 2Q6UA 4UDPA 3V3OA 3RCYA 4PABA 1OEPA 4ECHA 1YQ4A 4B68A 4G8TA 4JNAA 4Z26A 1JRYA 4YWSA 4YTNA 2RABA 1H7WA 4U8IA 4G73A 4YSXA 3QPEA 4CBQA 3CIRA 1W6TA 3AECA 3ALJA 3GMBA 3T6CA 1CBOA 5EBKA 4J36A 5BRTA 4KX6A 4HNLA 2WP9A 4YWOA 1N63C 2I5QA 4CRTA 3SX6A 2ACZA 4FX9A 4A99A 1SJBA 2XCGA 4I59A 1EC7A 4Z17A 1S2YA 3DJEA 2Z5XA 4C3XA 4DNAA 3QSSA 3PWGA 2AKZA 3GD6A 3OZ2A 3ISHA 2I0ZA 3H4KA 2AR8A 2BS2A 2MNRA 2YLSA 4YSZA 1OJTA 5KWFA 4YKFA 3ENLA 2E5VA 3AE9A 2W55A 1FO4A 2AQJA 3BOXA 4IP4A 3UXLA 4A6NB 3ATQA 2BABA 3OC4A 2XLTA 4WCTA 4B69A 3NXLA 2FJDA 1KKRA 3NFUA 3TOYA 3AE8A 1L9EA 2GAGB 2B9WA 3TQPA 1LQTA 1TRBA 2ZADA 1LPFA 4EMJA 3AEBA 2XSXA 4JY3A 2PTZA 3CNDA 4E4UA 3RP7A 2GMJA 4GGHA 3GY1A 5U63A 3FVDA 1CJCA 4ZA0A 3FG2P 4A6GA 1PDYA 1BWCA 4J33A 2W3SA 1YQ3A 1KN0A 3TCSA 3DJJA 2V3AA 2WPEA 1QJDA 3UTHA 2YVFA 3AEAA 4B65A 3II4A 3P4RA 4H50A 2VVMA 4OPIA 3COXA 3FBSA 1LTXR 1B5QA 2OX4A 3PK7A 1NEKA 2GMHA 4K5SA 1PDHA 4DSGA 2P0IA 3AE4A 3G5RA 2PTWA 2OQHA 2BXSA 1GRHA 4OPLA 2WHDA 5KMPA 3AD8B 3G5QA 5U25A 1DTNA 3LJPA 1IUWA 3T37A 2YR6A 3UXKA 3L5OA 3V5FA 4Y4LA 2C4CA 2R0PA 3IWAA 3L8KA 2MUCA 1N61C 3BI4A 3I6DA 3QVPA 2WESA 2JB1A 3PFRA 3DESA 4H2HA 3QN3A 3TJ4A 4WX1A 2OZ3A 3SQSA 2F5ZA 3AEEA 4MJWA 6ENLA 4GCMA 3IJQA 2GV8A 4HCDA 3SXIA 4OCGA 1SB3B 1CC2A 1FHVA 2DW7A 3TTEA 3HRDC 2C64A 1REOA 3BNMA 1P43A 2V6OA 3FJ4A 4N9XA 1MDLA 1ZOVA 1PXCA 3MSYA 5BOEA 1YKJA 2P8BA 1N5WC 4K2SA 2EQ9A 4J1OA 2TMDA 4DX3A 2RGJA 1Q1RA 1SEZA 3EANA 3U4FA 1E1NA 4DXKA 4IA6A 3UTEA 3DG6A 3NVYB 1FCDA 2WQYA 1D5TA 4G7FA 1EBGA 5EB5A 2OLAA 4GMEA 3R25A 4EQWA 4A7AA 1E39A 3AN1A 3DFHA 2QVHA 3AE2A 3NN0X 2ZC8A 3DFYA 4PAAA 2OG9A 1PBDA 2YR4A 4H4RA 2WPCA 3CAWA 1K0LA 3CNSA 5KNLA 3EPTA 2XYOA 3NT6A 3URHA 3NVVB 1EL7A 4U8OA 3ICRA 5HHFA 4NTDA 3HYWA 1XHCA 1F6MA 2J3NA 4JN9A 1MDRA 3SZ0A 3DIPA 1MRAA 3GC2A 4ADWA 1P2EA 3MQTA 2GQWA 3SN4A 3CGBA 1RM6B 3I3LA 2GR0A 2QA1A 3SR6B 2JAEA 5HY5A 2GGIA 3D8XA 4K5RA 4K2XA 4NZHA 4U8MA 3BSMA 1M6IA 5HXIA 3RNMA 1MO9A 2DW6A 5FJPA 2QDDA 1H81A 4GR1A 4E4FA 3REDA 3ABVA 1STZA 4YXDA 2BRAA 2GF3A 4A35A 1F3PA 2P3ZA 2ZZCA 1IUVA 1Q9IA 1JEHA 1NPXA 2V61A 1IUUA 3PWIA 3LOVA 3AMZA 3LB8A 1Y0PA 4EMIA 4GUVA 4A79A 3AE3A 3GDNA 2O56A 1JRXA 1DJQA 3OP2A 3GMCA 3KUMA 4LU6A 1Z6LA 1DOCA 2ZZBA 3GYJA 1JCTA 2PTYA 2GGEA 3NRNA 2PYXA 2QDEA 1GPEA 1N5XA 3NIXA 3GWDA 1X2GA 4I58A 3TW9A 1OJCA 4X9MA 2C73A 2WP5A 1QO8A 1NHPA 4EIPA 5EU9A 4Z1YA 2PS2A 2PCEA 4K1WA 3TWAA 5FJOA 4KPLA 5IQ1A 3JW7A 4EQSA 1JDFA 4JN7A 1F8SA 2RDXA 4HCLA 3H8IA 2JK6A 1JU2A 3P0WA 2GEWA 3AEDA 3SY4A 1JROA 2YR5A 4J3ZA 3S5SA 1GSNA 2PP3A 2YAUA 2GGHA 4AOSA 1JNRA 3PS9A 3CB3A 3NO1A 4J2WA 3FXGA 2WETA 1DNCA 3SFEA 4B67A 1GERA 3IJIA 3ZYXA 2FBWA 2VOUA 2BK4A 2YWLA 5EB4A 2XH0A 3GDPA 1PBEA 4Z43A 3VR8A 2GL5A 1FFVC 4D03A 3B97A 3QSEA 3T14A 3NGCX 2XLSA 2X3NA 2GGJA 2YQUA 3UJSA 4EM3A 3ES7A 4FP1A 2VZ2A 2BS4A 2WPFA 3PG6A 3RHAA 5IQ4A 3UKLA 2GQFA 4CY8A 1NDAA 4ZCDA 4CY6A 3V3NA 2HNEA 2VRMA 4H4YA 2IIDA 3CK5A 2OA1A 1KNRA 1MOKA 3DG3A 4K7ZA 2PODA 2B7SA 3QFAA 4GDPA 3V3WA 2PGWA 2OO6A 3R07C 2POZA 4XWZA 1KSUA 2NVKX 1JPMA 4IVMB 2B9YA 3SN1A 3M0OA 2B76A 2PA6A 2BK5A 4G74A 4BK2A 2GAHB 5CQFA 3GRSA 1FFUC 4A3RA 1H84A 3NK1X 4DSHA 1NHQA 4ENLA 1CHUA 3ZVIA 3O0HA 2PP0A 3T2YA 1TE6A 1OJAA 3I4KA 1F8WA 2DKHA 4OPTA 3AB1A 3MUCA 5U1OA 3NN6X 3P4SA 3UP5A 3N6HA 5KOWA 4H4VA 4A5LA 2R0CA 4IL0A 7ENLA 3P4PA 4M6UA 2VVLA 3MKCA 3K7QX 3NTDA 2WU5A 2ARDA 3SYIA 4RSLA 4E5TA 3NYCA 3CPHG 3IC9A 2QJJA 4OPDA 2E5AA 3UCDA 4FK1C 1E7PA 2C7GA 5C2TA 2W0HA 2CDUA 1N60C 4H2PA 1Y56A 3IHGA 1LVLA 1IUXA 1JNZA 3D1CA 5FS8A 2XDOA 3SM8A 2C72A 3DK4A 3AE1A 3VFCA 1K4QA 1JPDX 4JN8A 2E3TA 3ZLFA 3ZLHA 3NHOX 4MGGA 4U8LA 4D04A 1FEBA 4H4WA 3C4AA 3OTRA 1O95A 1B4VA 1YY5A 4JDRA 4EQXA 3CNJA 1VQZA 5KMSA 1KCZA 3H7VA 4TM4A 1D4DA 3UJEA 4GDEA 1LQUA 3UOVA 2OFJA 3UJRA 3NK2X 5ER0A 2QA2A 3LZWA 4Z2RA 1S7MA 4H2QA 4E0VA 3P1WA 2X8HA 1GRAA 5J7XA 3R0UA 2R0GA 1E1KA 1ZX9A 1TDOA 4GYPA 3EUB3 2WDVA 3ADAB 3F8PA 4O5UA 3FCPA 1SJAA 1XDIA 2AAQA 1EBHA 3CXBA 5GSNA 4AT2A 5DBJA 1X31B 1P2HA 4J34A 3UGVA 1KF6A 5JCLA 2EQ7A 2A87A 4UP3A 3T31A 3B3RA 2WBAA 2YG3A 1GNDA 2WDRA 1EL9A 4J31A 3T0KA 4MKSA 1W4XA 2JBVA 3PVCA 1DODA 3U9IA 2Z5YA 3SBFA 4JNQA 1PBBA 4ZCWA 3C4NA 3IF9A 2YM1A 1TKKA 1SJDA 4HA6A 1NENA 4BK3A 4K22A 1S3BA 2WOVA 2A8XA 3QVRA 3KPFA 3PO7A 4GF7A 2Q0LA 4XWRA 1TDKA 3CGCA 3NYEA 3ZDNA 3NRZB 5IPYA 1S2QA 2VQ7A 2BYBA 3NZGA 4IV9A 1KKOA 3VCNA 3D47A 1D4EA 4E6MA 1NG4A 2OPJA 1UKVG 2PMQA 3NYFA 2YG5A 2X8CA 1H7XA 4NTEA 1SJCA 1N1PA 3AE6A 2PTXA 3AYIA 4H4TA 3EKGA 3CGDA 1K0JA 2BS3A 3R1ZA 1Y56B 5BUKA 3S61A 2WOWA 2XFPA 2XFQA 3GSIA 2CHRA 3NG7X 4ZCCA 3IK4A 1KSSA 3T4WA 4H4PA 4ROPA 3CMMA 2P8CA 1BF3A 2H89A 1BKWA 2C76A 3ATRA 4REKA 1TZZA 2DKIA 3T8QA 1GRBA 4H2RA 2NQLA 5CKUA 3IHMA 4YTPA 3SZWA 4JHMA 2OKTA 4GFIA 1TYTA 1GOSA 3H8AA 3DMEA 4X2PA 3CYJA 3K1GA 3G5SA 2P88A 5FS9A 5LV9A 5BVAA 3UOXA 2HZGA 4Z25A 4U8JA 2AL2A 1WUEA 1EBDA 3V5CA 1NHRA 2WOIA 3VRAA 3B9JB 2VRLA 4G6HA 1GTHA 1Q1WA 3UKHA 4C5OA 2WEUA 1CC6A 4HNCA 3JZUA 2X8GA 3TWBA 2H88A 3VA8A 3SZFA 2R45A 2WS3A 3D46A 1VRQB 3SQPA 3UP4A 3FV9A 5HYMA 1K0IA 1T3QC 3HYVA 4H83A 1NELA 3EEZA 5J04A 3UJ2A 3N6JA 1GTEA 2C3DA 3GRTA 1KNPA 3K7TA 2YG4A 1KDGA 4NEVA 1GRFA 1WYGA 1KFYA 1L9DA 5EOWA 2FKPA 5BOFA 2XH7A 3QLDA 4E8GA 3UCCA 3UJFA 1E6EA 2BCPA 4X4JA 1H6VA 3DERA 1RSGA 5M0ZA 2FJEA 5KRQA 1FIQB 4JY2A 3UOYA 2AL1A 2IVDA 2NPXA 3GWFA 3B6DA 3T9PA 3E1TA 1O94A 1PBCA 4BK1A 1NAAA 1GXFA 2V3BA 4YSHA 4BURA 2RGHA 3ZVHB 1XPYA 4GRTA 3CN8A 2XVFA
chains in the Genus database with same CATH topology
2BA9A 2CVJA 1TDNA 3NK1X 2C3CA 4DSHA 1NHQA 3M12A 1CHUA 3AE4A 3O0HA 3G5RA 3EAOA 4UDQA 4C74A 3T2YA 4IVOB 2BXSA 2BRYA 1GRHA 4HB9A 4ICYA 3VQRA 4OPLA 1OJAA 2WHDA 2VVLG 2X50A 5KMPA 2ZZ0A 1F8WA 2DKHA 3AD8B 4OPTA 3G5QA 5U25A 3AB1A 2BACA 3LJPA 1IUWA 4M52A 2XVJA 4FDCB 5U1OA 2YR6A 3T37A 4BJZA 1XANA 3NN6X 3NLCA 1M64A 4Z24A 1QLBA 3L5OA 2V60A 4AP1A 2YLXA 2TPRA 3P4SA 4Y4LA 2C4CA 3UP5A 4U8KA 5KOWA 4H4VA 2R0PA 4A5LA 3IWAA 3L8KA 2R0CA 2IVEA 3KD9A 2UZZA 3DH9A 1TYPA 3P4PA 5JRBA 3BI4A 2BC1A 2VVLA 2WDQA 2C75A 3I6DA 3K7QX 3NTDA 3QVPA 2YG7A 2WESA 2WU5A 3FMWA 2ARDA 3SYIA 4RSLA 2JB1A 1N4WA 4RG4A 3NYCA 1HYUA 3CPHG 4TLXA 3UKAA 3IC9A 4YSYA 3GD4A 1L0VA 3NH3X 4WX1A 3DJDA 4OPDA 4Z2TA 4FK1C 1CL0A 1E7PA 2C7GA 5C2TA 2W0HA 2CDUA 1EL8A 1ZMCA 5C3JA 4H2PA 2F5ZA 1JOAA 2GVCA 1VG9A 1Y56A 3AEEA 3BHFA 1LVLA 1IUXA 3IHGA 4GCMA 1JNZA 3AYLA 1E1LA 4U8NA 2GV8A 1CF3A 3SXIA 3D1CA 4OCGA 3NK0X 1FECA 1CC2A 5FS8A 3SGLA 2XDOA 3NNEA 2C72A 2OALA 3DK4A 3SM8A 1IUTA 3AE1A 2C67A 4Z2UA 2C64A 1REOA 1K4QA 3BNMA 2V6OA 4U2SA 4N9XA 1H86A 3LXDA 1ZOVA 3NHOX 4U8LA 4D04A 1FEBA 2OLOA 1PXCA 4H4WA 3C4AA 1O95A 1D7LA 1B4VA 1YY5A 2A89A 4JDRA 4EQXA 2JKCA 1XPQA 1CJ3A 3L1RA 3CNJA 3M13A 4GAPA 3DGHA 1YKJA 1DXLA 3UKFA 2XFOA 3BI5A 5KMSA 3V76A 5BULA 4MJWA 2EQ9A 1TDEA 2TMDA 3ICTA 4TM4A 2GR2A 2Q0KA 2XLRA 4XXGA 3RP8A 1D4DA 4GDEA 1LQUA 2RGJA 3AD7B 1Q1RA 2EQ6A 3UOVA 4J56A 5J60A 3BI2A 1GRTA 1SEZA 3CTYA 4A65A 3EANA 2GH5A 1YQZA 4JQ9A 3CNPA 2C65A 1TDFA 4C77A 1E1NA 3VRBA 1RYIA 2WU2A 4NTCA 3QFBA 5FMHA 4IA6A 3UTEA 4B66A 3NK2X 3ALMA 5ER0A 2QA2A 1BZLA 3LZWA 2APGA 4J57A 4Z2RA 2B7RA 3AWIA 3SFDA 2R46A 1S7MA 4H2QA 1FCDA 4E0VA 3P1WA 4H4ZA 2XFUA 2WQYA 2YVGA 2X8HA 3EF6A 5FS6A 1D5TA 1MXTA 1GRAA 5J7XA 1BGNA 5KVIA 5TR3A 2R0GA 4YSZA 1DOEA 5EB5A 4NEWA 2CULA 1E1KA 1CJ2A 4EQWA 4A7AA 1ZX9A 5GRTA 1E39A 1PXAA 1TDOA 1VDCA 2BCGG 3C96A 3AEFA 5KMQA 1ZMDA 2WDVA 1GALA 3ADAB 3F8PA 4O5UA 3AE2A 3NN0X 3T2ZA 1XDIA 2AAQA 4H4QA 4PAAA 1PBDA 3ICSA 2YR4A 4H4RA 2WPCA 2YLWA 3BNUA 3CNTA 1GV4A 1D7YA 1K0LA 3KLJA 3CNSA 5GSNA 4AT2A 5DBJA 5KNLA 4YKGA 1X31B 4TM3A 4Y4MA 1P2HA 3HYXA 4AOXA 4IA5A 3EPTA 1IUSA 4J34A 2EQ8A 1ZOYA 2XYOA 1KF6A 5JCLA 1FL2A 3DGZA 3NT6A 4UDRA 3URHA 3KA7A 4H7UA 1GEUA 2EQ7A 5KOXA 2A87A 1RP0A 4A6NA 4UP3A 4RG3A 3T31A 1DJNA 3Q6JA 3B3RA 2O9ZA 2WBAA 1EL7A 2YG3A 4U8OA 4X9NA 4AT0A 1GNDA 2WDRA 1EL9A 2C66A 3ICRA 5HHFA 3FPZA 4J31A 3P4QA 3T0KA 1W4XA 2JBVA 4NTDA 3HYWA 3PVCA 1XHCA 2X99A 1F6MA 2J3NA 4JN9A 1DODA 3SZ0A 5M10A 2Z5YA 1VQWA 3BHKA 3KPKA 1D4CA 4ADWA 1FOHA 5KVHA 1P2EA 1PS9A 3HZLA 4JNQA 1PBBA 2GQWA 2OAMA 1ELIA 2YM2A 4KPRA 3SZCA 3C4NA 3CGBA 3FIMB 3IF9A 1N4UA 3I3LA 2GR0A 2YM1A 4II3A 3QJ4A 3AXBA 2BXRA 2XLUA 2QA1A 4HA6A 1NENA 2B9XA 1ZDLA 2JAEA 4BK3A 1GETA 2YLZA 4EIQA 4K22A 2JB2A 5HY5A 3GYXA 1PJ5A 2XVEA 3D8XA 4K5RA 1S3BA 2WOVA 4K2XA 2A8XA 4NZHA 1B37A 3QVRA 4U8MA 3AE7A 3ITJA 3UOZA 4USQA 1PN0A 4K8DA 3KPFA 4H4XA 1BGJA 5JCNA 1PJ7A 3F8RA 3DA1A 3PO7A 3GYIA 3RP6A 4O5QA 2YG6A 3JSKA 1M6IA 4GF7A 1PJ6A 3RNMA 5HXIA 2YVJA 2Q0LA 1MO9A 4U2TA 1E1MA 4XWRA 2RGOA 1TDKA 3CGCA 2ZBWA 2XVIA 3NYEA 1B8SA 1NG3A 1ONFA 3ZDNA 5IPYA 1H81A 1S2QA 2GRTA 3Q9TA 2Y6QA 2VQ7A 2BYBA 4GR1A 2Q7VA 2R4EA 3REDA 3ABVA 4IV9A 5JCMA 4NNJA 4A9WA 3VRDB 1GRGA 4C3YA 4EM4A 4YXDA 1D4EA 2BRAA 2GF3A 5KMRA 1NG4A 5L46A 1UKVG 2E1MA 2XLPA 3F8DA 1F3PA 2ZZCA 3VR9A 4AP3A 1IJHA 3NYFA 2YG5A 1IUVA 3NKSA 1Q9IA 1JEHA 1AOGA 1S3EA 2X8CA 1NPXA 1ZP0A 4OPCA 3KU9A 1H7XA 1CJ4A 2V61A 4CNKA 1IUUA 1L9CA 4G9KA 2Y6RA 3QSMA 3LOVA 4OPUA 4CCQA 3LB8A 1Y0PA 4NTEA 1PHHA 4EMIA 4APNA 1N1PA 1O5WA 3AE6A 4GUVA 3P9UA 3H8LA 3R9UA 1VG0A 3AE5A 2VQBA 3D9XA 2GR3A 4A79A 3AYIA 4H4TA 4OPGA 3AE3A 1ZKQA 3CGDA 1K0JA 4YTMA 3WE0A 3GDNA 3LADA 2BS3A 3KKJA 1JRXA 1DJQA 1Y56B 2PHHA 3GMCA 4B63A 4TM1A 1H82A 2JB3A 2Q6UA 5BUKA 4UDPA 3S61A 4LU6A 2WOWA 2E4GA 4H2NA 1Z6LA 2XFPA 2XFQA 1DOCA 3GSIA 5KXJA 2ZZBA 3V3OA 4PABA 3AYJA 3NG7X 3GYJA 4ECHA 4ZCCA 4YT0A 1ZY8A 1YQ4A 2GB0A 4B68A 3UTFA 3NRNA 2PYXA 3KVEA 2XFNA 1GPEA 1KSSA 3NIXA 3UTGA 3GWDA 1NHSA 4H4PA 1F8RA 1PBFA 3CMMA 4JNAA 1BF3A 4I58A 4H4UA 2H89A 4Z26A 1BKWA 1JRYA 4YTNA 1OJCA 2RABA 2C76A 1H7WA 4U8IA 4X9MA 4G73A 3ATRA 1GREA 4YSXA 4LIIA 2C73A 2WP5A 4CBQA 3CIRA 1QO8A 3DJGX 4REKA 3AECA 2DKIA 1NHPA 3ALJA 3GMBA 1V59A 4EIPA 4Y4NA 1GRBA 1CBOA 5EBKA 2R9ZA 1GESA 2OLNA 1H83A 1H2IA 4H2RA 4J36A 5CKUA 5BRTA 3IHMA 4KX6A 4YTPA 1PXBA 3SZWA 2WP9A 4NWZA 1TYTA 4YWOA 1GOSA 4P9SA 5IQ1A 4CRTA 4EQSA 3DMEA 3SX6A 4TLZA 1F8SA 2ACZA 1JRZA 4FX9A 2HQMA 1OJDA 2WP6A 3ALLA 3G5SA 4A99A 2XCGA 3H8IA 4I59A 2JK6A 2XVHA 1JU2A 5FS9A 1CC4A 5LV9A 1GT8A 1S2YA 2GEWA 5BVAA 3DJEA 3UOXA 3AEDA 3SY4A 4Z25A 3DK8A 4H4SA 4GAVA 4U8JA 2Z5XA 3UKPA 4C3XA 2YR5A 1GSNA 2YAUA 4DNAA 1EBDA 2QCUA 3AD9B 3QSSA 4AOSA 1EL5A 3OZ2A 3K7MX 1JNRA 3CPIG 3UCLA 3PS9A 3ISHA 4B1BA 2I0ZA 3H4KA 2AR8A 2BS2A 1NHRA 3T2KA 4J2WA 3CGEA 2V5ZA 2WOIA 2WETA 1DNCA 3SFEA 3VRAA 4B64A 4B67A 2R4JA 1GERA 2VRLA 2YLSA 2YLRA 1GTHA 4G6HA 2FBWA 4U8PA 3ZYXA 2VOUA 2QAEA 1COYA 1OJTA 5KWFA 2BK4A 1Q1WA 3UKHA 2YWLA 5EB4A 4C5OA 4DSGA 4YKFA 2E5VA 3CPJG 3GDPA 2WEUA 3AE9A 1PBEA 4Z43A 2AQJA 1FEAA 3VR8A 4A6NB 1CC6A 3ATQA 2FJBA 4D03A 2BABA 3QSEA 5JCIA 3OC4A 2XLTA 4WCTA 3T14A 2X8GA 3NGCX 4CNJA 4B69A 2XLSA 2X3NA 2H88A 2YQUA 4EM3A 2R45A 2FJDA 2WS3A 3SZFA 3UKKA 1VRQB 3AE8A 2VZ2A 1L9EA 4Z44A 3SQPA 2BS4A 3UP4A 5HYMA 1K0IA 2WPFA 2GAGB 3PG6A 3NTAA 3RHAA 5FS7A 2YLTA 3HYVA 2B9WA 5IQ4A 3S5WA 1LQTA 1TRBA 1ZK7A 1OJ9A 3GD3A 3UKLA 4ZN0A 1LPFA 1GTEA 2C3DA 2GQFA 3GRTA 4EMJA 1KNPA 3AEBA 4FK1A 4CY8A 3K7TA 2YG4A 4JY3A 1KDGA 1NDAA 1GRFA 4NEVA 1LV0A 4ZCDA 3CNDA 4BJYA 1KFYA 3V3NA 4CY6A 3RP7A 2GMJA 1DOBA 2VRMA 4USRA 1L9DA 5EOWA 4OVIA 4H4YA 2C70A 3K30A 5U63A 1LJ1A 2IIDA 2BK3A 2OA1A 1KNRA 4DGKA 1CJCA 3AEGA 1MOKA 1E6EA 2BCPA 4X4JA 3FG2P 4K7ZA 4TM0A 1H6VA 4BV6A 1RSGA 2B7SA 5M0ZA 1BWCA 3QFAA 4J33A 2FJEA 4G6GA 4GDPA 5KRQA 4EMWA 4JY2A 3UOYA 1YQ3A 3DK9A 3LZXA 4XWZA 2BC0A 1KN0A 1N4VA 1KSUA 2IVDA 4U2LA 2NVKX 3DJJA 4IVMB 2NPXA 3GWFA 4EQRA 2B9YA 3B6DA 3E1TA 4CCRA 2CFYA 1O94A 1PBCA 2V3AA 2WPEA 1QJDA 4BK1A 2FJAA 1NAAA 3UTHA 1GXFA 4LA1A 2YVFA 2V3BA 3M0OA 3AEAA 2B76A 4YSHA 4BURA 3II4A 3P4RA 4B65A 4II2A 2BK5A 2RGHA 3UKQA 4H50A 2VVMA 4OPIA 4G74A 4BK2A 2GAHB 5CQFA 3COXA 3FBSA 5JCKA 3GRSA 4GRTA 1B5QA 1LTXR 3CN8A 2GR1A 2XVFA 1NEKA 2GMHA 4K5SA 1H84A 1PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA9 A;  2CVJ A;  1TDN A;  3NK1 X;  2C3C A;  4DSH A;  1NHQ A;  3M12 A;  1CHU A;  3AE4 A;  3O0H A;  3G5R A;  3EAO A;  4UDQ A;  4C74 A;  4IVO B;  2BXS A;  4ICY A;  1GRH A;  4HB9 A;  3VQR A;  4OPL A;  1OJA A;  2WHD A;  2VVL G;  2X50 A;  2ZZ0 A;  1F8W A;  2DKH A;  3AD8 B;  4OPT A;  3G5Q A;  5U25 A;  3AB1 A;  2BAC A;  3LJP A;  1IUW A;  4M52 A;  2XVJ A;  4FDC B;  5U1O A;  2YR6 A;  3T37 A;  4BJZ A;  1XAN A;  3NN6 X;  3NLC A;  1M64 A;  4Z24 A;  1QLB A;  2V60 A;  4AP1 A;  2YLX A;  2TPR A;  3P4S A;  4Y4L A;  3UP5 A;  4U8K A;  5KOW A;  4H4V A;  2R0P A;  4A5L A;  3IWA A;  3L8K A;  2R0C A;  2IVE A;  3KD9 A;  2UZZ A;  3DH9 A;  1TYP A;  3P4P A;  3BI4 A;  2BC1 A;  2VVL A;  2WDQ A;  2C75 A;  3I6D A;  3K7Q X;  3NTD A;  3QVP A;  2YG7 A;  2WES A;  2WU5 A;  3FMW A;  2ARD A;  4RSL A;  2JB1 A;  1N4W A;  4RG4 A;  3NYC A;  1HYU A;  3CPH G;  4TLX A;  3UKA A;  3IC9 A;  4YSY A;  3GD4 A;  1L0V A;  3NH3 X;  4WX1 A;  3DJD A;  4OPD A;  4Z2T A;  4FK1 C;  1CL0 A;  1E7P A;  2C7G A;  5C2T A;  2W0H A;  2CDU A;  1EL8 A;  1ZMC A;  5C3J A;  4H2P A;  2F5Z A;  1JOA A;  2GVC A;  1VG9 A;  1Y56 A;  3AEE A;  3BHF A;  1LVL A;  1IUX A;  3IHG A;  4GCM A;  1JNZ A;  3AYL A;  1E1L A;  4U8N A;  2GV8 A;  1CF3 A;  3D1C A;  4OCG A;  3NK0 X;  1FEC A;  1CC2 A;  5FS8 A;  3SGL A;  2XDO A;  3NNE A;  2C72 A;  2OAL A;  3DK4 A;  3SM8 A;  1IUT A;  3AE1 A;  2C67 A;  4Z2U A;  2C64 A;  1REO A;  1K4Q A;  3BNM A;  2V6O A;  4U2S A;  4N9X A;  1H86 A;  3LXD A;  1ZOV A;  3NHO X;  4U8L A;  4D04 A;  1FEB A;  2OLO A;  1PXC A;  4H4W A;  3C4A A;  1O95 A;  1D7L A;  1B4V A;  1YY5 A;  2A89 A;  4JDR A;  4EQX A;  2JKC A;  1XPQ A;  1CJ3 A;  3L1R A;  3CNJ A;  3M13 A;  3DGH A;  1YKJ A;  1DXL A;  3UKF A;  2XFO A;  3BI5 A;  3V76 A;  5BUL A;  4MJW A;  2EQ9 A;  1TDE A;  2TMD A;  3ICT A;  4TM4 A;  2GR2 A;  2Q0K A;  2XLR A;  4XXG A;  3RP8 A;  1D4D A;  4GDE A;  1LQU A;  2RGJ A;  3AD7 B;  1Q1R A;  2EQ6 A;  3UOV A;  4J56 A;  5J60 A;  3BI2 A;  1GRT A;  1SEZ A;  3CTY A;  4A65 A;  3EAN A;  2GH5 A;  1YQZ A;  4JQ9 A;  3CNP A;  2C65 A;  1TDF A;  4C77 A;  1E1N A;  3VRB A;  1RYI A;  2WU2 A;  4NTC A;  3QFB A;  5FMH A;  4IA6 A;  3UTE A;  4B66 A;  3NK2 X;  3ALM A;  5ER0 A;  2QA2 A;  1BZL A;  3LZW A;  2APG A;  4J57 A;  4Z2R A;  2B7R A;  3AWI A;  3SFD A;  2R46 A;  4H2Q A;  1FCD A;  4E0V A;  3P1W A;  4H4Z A;  2XFU A;  2WQY A;  2YVG A;  2X8H A;  3EF6 A;  5FS6 A;  1D5T A;  1MXT A;  1GRA A;  5J7X A;  1BGN A;  5KVI A;  5TR3 A;  2R0G A;  1DOE A;  5EB5 A;  4NEW A;  2CUL A;  1E1K A;  1CJ2 A;  4EQW A;  4A7A A;  1ZX9 A;  5GRT A;  1E39 A;  1PXA A;  1TDO A;  1VDC A;  2BCG G;  3C96 A;  3AEF A;  1ZMD A;  2WDV A;  1GAL A;  3ADA B;  3F8P A;  4O5U A;  3AE2 A;  3NN0 X;  1XDI A;  2AAQ A;  4H4Q A;  4PAA A;  1PBD A;  3ICS A;  2YR4 A;  4H4R A;  2WPC A;  2YLW A;  3BNU A;  3CNT A;  1GV4 A;  1D7Y A;  1K0L A;  3KLJ A;  3CNS A;  5GSN A;  4AT2 A;  5DBJ A;  4YKG A;  1X31 B;  4TM3 A;  4Y4M A;  1P2H A;  4AOX A;  4IA5 A;  3EPT A;  1IUS A;  4J34 A;  2EQ8 A;  1ZOY A;  2XYO A;  1KF6 A;  5JCL A;  1FL2 A;  3DGZ A;  3NT6 A;  4UDR A;  3URH A;  3KA7 A;  4H7U A;  1GEU A;  2EQ7 A;  5KOX A;  2A87 A;  1RP0 A;  4A6N A;  4UP3 A;  4RG3 A;  1DJN A;  3Q6J A;  3B3R A;  2O9Z A;  2WBA A;  1EL7 A;  2YG3 A;  4U8O A;  4X9N A;  4AT0 A;  1GND A;  2WDR A;  1EL9 A;  2C66 A;  3ICR A;  5HHF A;  3FPZ A;  4J31 A;  3P4Q A;  1W4X A;  2JBV A;  4NTD A;  3PVC A;  1XHC A;  2X99 A;  1F6M A;  2J3N A;  4JN9 A;  1DOD A;  5M10 A;  2Z5Y A;  1VQW A;  3BHK A;  1D4C A;  4ADW A;  1FOH A;  5KVH A;  1P2E A;  1PS9 A;  3HZL A;  4JNQ A;  1PBB A;  2GQW A;  2OAM A;  1ELI A;  2YM2 A;  4KPR A;  3C4N A;  3CGB A;  3FIM B;  3IF9 A;  1N4U A;  3I3L A;  2GR0 A;  2YM1 A;  3QJ4 A;  3AXB A;  2BXR A;  2XLU A;  2QA1 A;  4HA6 A;  1NEN A;  2B9X A;  1ZDL A;  2JAE A;  4BK3 A;  1GET A;  2YLZ A;  4EIQ A;  4K22 A;  2JB2 A;  5HY5 A;  1PJ5 A;  2XVE A;  3D8X A;  4K5R A;  1S3B A;  2WOV A;  4K2X A;  2A8X A;  4NZH A;  1B37 A;  3QVR A;  4U8M A;  3AE7 A;  3ITJ A;  3UOZ A;  4USQ A;  1PN0 A;  4K8D A;  3KPF A;  4H4X A;  1BGJ A;  5JCN A;  1PJ7 A;  3F8R A;  3DA1 A;  3PO7 A;  3GYI A;  3RP6 A;  4O5Q A;  2YG6 A;  3JSK A;  1M6I A;  4GF7 A;  1PJ6 A;  3RNM A;  5HXI A;  2YVJ A;  2Q0L A;  1MO9 A;  4U2T A;  1E1M A;  4XWR A;  2RGO A;  1TDK A;  3CGC A;  2ZBW A;  2XVI A;  3NYE A;  1B8S A;  1NG3 A;  1ONF A;  3ZDN A;  5IPY A;  1H81 A;  1S2Q A;  2GRT A;  3Q9T A;  2Y6Q A;  2VQ7 A;  2BYB A;  4GR1 A;  2Q7V A;  2R4E A;  3RED A;  3ABV A;  4IV9 A;  5JCM A;  4A9W A;  3VRD B;  1GRG A;  4C3Y A;  4EM4 A;  4YXD A;  1D4E A;  2GF3 A;  1NG4 A;  5L46 A;  1UKV G;  2E1M A;  2XLP A;  3F8D A;  1F3P A;  2ZZC A;  3VR9 A;  4AP3 A;  1IJH A;  3NYF A;  2YG5 A;  1IUV A;  3NKS A;  1Q9I A;  1JEH A;  1AOG A;  1S3E A;  2X8C A;  1NPX A;  1ZP0 A;  4OPC A;  3KU9 A;  1H7X A;  1CJ4 A;  2V61 A;  4CNK A;  1IUU A;  1L9C A;  4OPU A;  2Y6R A;  3QSM A;  3LOV A;  4CCQ A;  3LB8 A;  1Y0P A;  4NTE A;  1PHH A;  4EMI A;  4APN A;  1N1P A;  1O5W A;  3AE6 A;  4GUV A;  3P9U A;  3H8L A;  3R9U A;  1VG0 A;  3AE5 A;  2VQB A;  2GR3 A;  4A79 A;  3AYI A;  4H4T A;  4OPG A;  3AE3 A;  1ZKQ A;  3CGD A;  1K0J A;  4YTM A;  3WE0 A;  3GDN A;  3LAD A;  2BS3 A;  3KKJ A;  1JRX A;  1DJQ A;  1Y56 B;  2PHH A;  3GMC A;  4B63 A;  4TM1 A;  1H82 A;  2JB3 A;  2Q6U A;  5BUK A;  4UDP A;  3S61 A;  4LU6 A;  2WOW A;  2E4G A;  4H2N A;  1Z6L A;  2XFP A;  2XFQ A;  1DOC A;  3GSI A;  5KXJ A;  2ZZB A;  3V3O A;  4PAB A;  3AYJ A;  3NG7 X;  3GYJ A;  4ECH A;  4ZCC A;  4YT0 A;  1ZY8 A;  1YQ4 A;  2GB0 A;  4B68 A;  3UTF A;  3NRN A;  2PYX A;  3KVE A;  2XFN A;  1GPE A;  1KSS A;  3NIX A;  3UTG A;  3GWD A;  1NHS A;  4H4P A;  1F8R A;  1PBF A;  4JNA A;  1BF3 A;  4I58 A;  4H4U A;  2H89 A;  4Z26 A;  1BKW A;  1JRY A;  4YTN A;  1OJC A;  2RAB A;  2C76 A;  1H7W A;  4U8I A;  4X9M A;  3ATR A;  1GRE A;  4YSX A;  4LII A;  2C73 A;  2WP5 A;  4CBQ A;  3CIR A;  1QO8 A;  3DJG X;  4REK A;  3AEC A;  2DKI A;  1NHP A;  3ALJ A;  3GMB A;  1V59 A;  4EIP A;  4Y4N A;  1GRB A;  1CBO A;  5EBK A;  2R9Z A;  1GES A;  2OLN A;  1H83 A;  4H2R A;  4J36 A;  5CKU A;  5BRT A;  3IHM A;  4KX6 A;  4YTP A;  1PXB A;  2WP9 A;  1TYT A;  4YWO A;  1GOS A;  4P9S A;  5IQ1 A;  4CRT A;  4EQS A;  3DME A;  4TLZ A;  1F8S A;  2ACZ A;  1JRZ A;  4FX9 A;  2HQM A;  1OJD A;  2WP6 A;  3ALL A;  3G5S A;  4A99 A;  2XCG A;  3H8I A;  4I59 A;  2JK6 A;  2XVH A;  1JU2 A;  5FS9 A;  1CC4 A;  5LV9 A;  1GT8 A;  1S2Y A;  2GEW A;  5BVA A;  3DJE A;  3UOX A;  3AED A;  4Z25 A;  3DK8 A;  4H4S A;  4U8J A;  2Z5X A;  3UKP A;  4C3X A;  2YR5 A;  1GSN A;  2YAU A;  4DNA A;  1EBD A;  2QCU A;  3AD9 B;  3QSS A;  4AOS A;  1EL5 A;  3OZ2 A;  3K7M X;  1JNR A;  3CPI G;  3UCL A;  3PS9 A;  3ISH A;  4B1B A;  2I0Z A;  3H4K A;  2AR8 A;  2BS2 A;  1NHR A;  4J2W A;  3CGE A;  2V5Z A;  2WOI A;  2WET A;  1DNC A;  3SFE A;  3VRA A;  4B64 A;  4B67 A;  2R4J A;  1GER A;  2VRL A;  2YLS A;  2YLR A;  1GTH A;  4U8P A;  2FBW A;  3ZYX A;  4YSZ A;  2VOU A;  2QAE A;  1COY A;  1OJT A;  5KWF A;  2BK4 A;  1Q1W A;  3UKH A;  2YWL A;  5EB4 A;  4C5O A;  4DSG A;  4YKF A;  2E5V A;  3CPJ G;  3GDP A;  2WEU A;  3AE9 A;  1PBE A;  4Z43 A;  2AQJ A;  1FEA A;  3VR8 A;  4A6N B;  1CC6 A;  3ATQ A;  2FJB A;  4D03 A;  2BAB A;  3QSE A;  5JCI A;  3OC4 A;  2XLT A;  4WCT A;  2X8G A;  3NGC X;  4CNJ A;  4B69 A;  2XLS A;  2X3N A;  2H88 A;  2YQU A;  4EM3 A;  2R45 A;  2FJD A;  2WS3 A;  3UKK A;  1VRQ B;  3AE8 A;  2VZ2 A;  1L9E A;  4Z44 A;  3SQP A;  2BS4 A;  3UP4 A;  5HYM A;  1K0I A;  2WPF A;  2GAG B;  3NTA A;  3RHA A;  5FS7 A;  2YLT A;  2B9W A;  5IQ4 A;  3S5W A;  1LQT A;  1TRB A;  1ZK7 A;  1OJ9 A;  3GD3 A;  3UKL A;  4ZN0 A;  1LPF A;  1GTE A;  2C3D A;  2GQF A;  3GRT A;  4EMJ A;  1KNP A;  3AEB A;  4FK1 A;  4CY8 A;  3K7T A;  2YG4 A;  4JY3 A;  1KDG A;  1NDA A;  1GRF A;  4NEV A;  1LV0 A;  4ZCD A;  3CND A;  4BJY A;  1KFY A;  3V3N A;  4CY6 A;  3RP7 A;  2GMJ A;  1DOB A;  2VRM A;  4USR A;  1L9D A;  5EOW A;  4OVI A;  4H4Y A;  2C70 A;  3K30 A;  5U63 A;  1LJ1 A;  2IID A;  2BK3 A;  2OA1 A;  1KNR A;  4DGK A;  1CJC A;  3AEG A;  1MOK A;  1E6E A;  2BCP A;  4X4J A;  3FG2 P;  4K7Z A;  4TM0 A;  1H6V A;  4BV6 A;  1RSG A;  2B7S A;  5M0Z A;  1BWC A;  3QFA A;  4J33 A;  2FJE A;  4GDP A;  5KRQ A;  4EMW A;  4JY2 A;  3UOY A;  1YQ3 A;  3DK9 A;  3LZX A;  4XWZ A;  2BC0 A;  1N4V A;  1KSU A;  2IVD A;  4U2L A;  2NVK X;  3DJJ A;  4IVM B;  2NPX A;  3GWF A;  4EQR A;  2B9Y A;  3B6D A;  3E1T A;  4CCR A;  2CFY A;  1O94 A;  1PBC A;  2WPE A;  1QJD A;  2V3A A;  4BK1 A;  2FJA A;  1NAA A;  3UTH A;  1GXF A;  4LA1 A;  2YVF A;  2V3B A;  3M0O A;  3AEA A;  2B76 A;  4YSH A;  4BUR A;  3II4 A;  3P4R A;  4B65 A;  2BK5 A;  2RGH A;  3UKQ A;  4H50 A;  2VVM A;  4OPI A;  4BK2 A;  2GAH B;  5CQF A;  3COX A;  3FBS A;  5JCK A;  3GRS A;  4GRT A;  1B5Q A;  1LTX R;  3CN8 A;  2GR1 A;  2XVF A;  1NEK A;  2GMH A;  4K5S A;  1H84 A;  1PDH A; 
#chains in the Genus database with same CATH topology
 2BA9 A;  1V97 A;  1WUF A;  3M12 A;  3EAO A;  4IVO B;  2BRY A;  4HB9 A;  2X50 A;  1EC9 A;  4CCQ A;  4BJZ A;  1XAN A;  1M64 A;  4Z24 A;  2V60 A;  1IYX A;  4U8K A;  3NVW B;  3DH9 A;  1YEY A;  2QJN A;  5G5H B;  2WDQ A;  2C75 A;  2YG7 A;  3FMW A;  1R0M A;  3VDG A;  1N4W A;  4GGB A;  4YSY A;  3GD4 A;  3NH3 X;  3DJD A;  4TVW A;  4Z2T A;  1CL0 A;  3ETR B;  1EL8 A;  1ZMC A;  4IHC A;  3BHF A;  1VG9 A;  3VC5 A;  1CF3 A;  1ECQ A;  3NK0 X;  3SGL A;  3NNE A;  2OAL A;  1PDZ A;  1IUT A;  3R11 A;  4U2S A;  1H86 A;  2OLO A;  3RIT A;  1D7L A;  4GAP A;  3M13 A;  3DGH A;  3R0K A;  2AL2 B;  4GYP C;  4XXG A;  3NVZ B;  3AD7 B;  4J56 A;  3CTY A;  1YQZ A;  2C65 A;  1TDF A;  1RYI A;  3QKE A;  3ALM A;  1KD0 A;  1BZL A;  4F4R A;  2APG A;  2B7R A;  3SFD A;  2R46 A;  2QQ6 A;  2YVG A;  3EF6 A;  5FS6 A;  1MXT A;  4FI4 A;  1BGN A;  5G5G B;  5GRT A;  3R10 A;  1PXA A;  3RRA A;  1VDC A;  3AEF A;  3A7U A;  5KMQ A;  1ZMD A;  3A7A A;  3ICS A;  3CNT A;  1GV4 A;  1D7Y A;  4HYR A;  4Y4M A;  2HXU A;  4AOX A;  4DYE A;  3HYX A;  2EQ8 A;  1GEU A;  5KOX A;  1RP0 A;  4RG3 A;  2QJM A;  1DJN A;  1RVK A;  3Q6J A;  2O9Z A;  1L8P A;  4AT0 A;  2C66 A;  3FPZ A;  2X99 A;  4M0X A;  2GDQ A;  5M10 A;  1FOH A;  3HZL A;  3I6E A;  2QGY A;  4KEM A;  1ELI A;  4KPR A;  3SZC A;  3FIM B;  3OZY A;  3AXB A;  3AM9 A;  1GET A;  2YLZ A;  4EIQ A;  2JB2 A;  3OZM A;  2XVE A;  1B37 A;  3UOZ A;  4K8D A;  3F8R A;  3DEQ A;  3DA1 A;  3JSK A;  4U2T A;  1E1M A;  3V4B A;  3Q9T A;  2Y6Q A;  5JCM A;  4NNJ A;  4C3Y A;  4IP5 A;  4EM4 A;  2ONE A;  2E1M A;  3GO2 A;  2XLP A;  3F8D A;  4AP3 A;  1IJH A;  3NKS A;  1FHU A;  1S3E A;  4KT2 A;  1ZP0 A;  1CJ4 A;  4G9K A;  1L9C A;  4OPU A;  2Y6R A;  2AKM A;  1MUC A;  1O5W A;  3P9U A;  3H8L A;  3R9U A;  1VG0 A;  3AE5 A;  3DGB A;  4OPG A;  1ZKQ A;  2PU0 A;  5IDZ A;  3WE0 A;  2GSH A;  3JVA A;  2PHH A;  4TM1 A;  4GIS A;  2E4G A;  4H2N A;  5KXJ A;  3AYJ A;  4YT0 A;  3H12 A;  1ZY8 A;  2GB0 A;  3UTF A;  4MMW A;  3KVE A;  2XFN A;  3UTG A;  1NHS A;  1F8R A;  1PBF A;  1NU5 A;  4H4U A;  1GRE A;  4LII A;  2FYM A;  3DJG X;  2PSN A;  1V59 A;  4IL2 A;  1ZXI C;  3HPF A;  4Y4N A;  2R9Z A;  1GES A;  2OLN A;  1H83 A;  1H2I A;  2OZ8 A;  1PXB A;  5FJT A;  4NWZ A;  4P9S A;  4TLZ A;  1JRZ A;  4KWS A;  1OJD A;  2HQM A;  2WP6 A;  3ALL A;  2XVH A;  1P48 A;  1CC4 A;  1GT8 A;  1X2H A;  3ES8 A;  3DK8 A;  4H4S A;  4GAV A;  3UKP A;  1VDV A;  2QCU A;  3AD9 B;  1EL5 A;  3K7M X;  4HPN A;  3CPI G;  3UCL A;  3Q4D A;  4B1B A;  2W3R A;  4IZG A;  3T2K A;  3CGE A;  1ELS A;  3SSZ A;  2V5Z A;  4B64 A;  2R4J A;  2YLR A;  4U8P A;  2QAE A;  1COY A;  2GGG A;  3CPJ G;  3VCC A;  1FEA A;  4GIR A;  2FJB A;  3IJL A;  2W54 A;  5JCI A;  3ZVH A;  4IT1 A;  4CNJ A;  3UKK A;  4Z44 A;  3NTA A;  5FS7 A;  2YLT A;  4HCH A;  3S5W A;  3OPS A;  1ZK7 A;  1OJ9 A;  3GD3 A;  4ZN0 A;  4FK1 A;  1LV0 A;  4BJY A;  2HXT A;  3DG7 A;  1DOB A;  4USR A;  4OVI A;  3K30 A;  2C70 A;  5FJR A;  1LJ1 A;  2BK3 A;  4DGK A;  2XH2 A;  3NS1 B;  3AEG A;  1MNS A;  1R6W A;  4TM0 A;  4BV6 A;  4G6G A;  4EMW A;  4DWD A;  3DK9 A;  3LZX A;  2BC0 A;  1N4V A;  4U2L A;  1XS2 A;  2XGZ A;  4EQR A;  4CCR A;  2CFY A;  1F9C A;  2FJA A;  1ONE A;  4LA1 A;  3VC6 A;  4II2 A;  3N4F A;  3RR1 A;  3UKQ A;  4TVY A;  5JCK A;  2GR1 A;  4EWJ A;  2CVJ A;  1TDN A;  3THU A;  2C3C A;  2OZT A;  3MWC A;  3MZN A;  4UDQ A;  4C74 A;  2XH4 A;  4ICY A;  3VQR A;  5FJU A;  1N62 C;  2VVL G;  2ZZ0 A;  2BAC A;  2XVJ A;  4M52 A;  4FDC B;  3H70 A;  3NLC A;  1QLB A;  4AP1 A;  2YLX A;  2TPR A;  2IVE A;  3KD9 A;  2UZZ A;  1TYP A;  3ZLG A;  5JRB A;  2BC1 A;  2PPG A;  4H1Z A;  3DDM A;  4RG4 A;  1HYU A;  4TLX A;  3UKA A;  1L0V A;  3TJI A;  3P93 A;  3S47 A;  3CT2 A;  5C3J A;  1JOA A;  2GVC A;  3AYL A;  1E1L A;  4U8N A;  1FEC A;  3STP A;  4DHG A;  2C67 A;  4Z2U A;  3LXD A;  2A89 A;  2JKC A;  1XPQ A;  1CJ3 A;  3L1R A;  3Q45 A;  1DXL A;  3UKF A;  4H19 A;  2XFO A;  3BI5 A;  3V76 A;  5BUL A;  3P3B A;  1TDE A;  3ICT A;  2GR2 A;  2Q0K A;  2XLR A;  3RP8 A;  5J60 A;  2EQ6 A;  3BI2 A;  1GRT A;  4A65 A;  2GH5 A;  3CNP A;  4JQ9 A;  4C77 A;  3VRB A;  4NTC A;  2WU2 A;  3QFB A;  5FMH A;  4B66 A;  3SJN A;  4J57 A;  4ZOH B;  3AWI A;  4H4Z A;  1JRP A;  2XFU A;  3MY9 A;  1BQG A;  5KVI A;  5TR3 A;  1DOE A;  4NEW A;  2CUL A;  1CJ2 A;  2BCG G;  3C96 A;  1GAL A;  3T2Z A;  4H4Q A;  3BNU A;  2YLW A;  3BJS A;  2OQY A;  3KLJ A;  3QTP A;  4YKG A;  4TM3 A;  4IA5 A;  1IUS A;  1ZOY A;  1FL2 A;  3DGZ A;  4UDR A;  4HN8 A;  3KA7 A;  4H7U A;  4A6N A;  4X9N A;  3P4Q A;  3RGT A;  4K8G A;  5ENL A;  1VQW A;  3BHK A;  3KPK A;  1D4C A;  5KVH A;  1PS9 A;  2OVL A;  2OAM A;  2YM2 A;  1N4U A;  4II3 A;  3CXO A;  3QJ4 A;  2BXR A;  2XLU A;  2B9X A;  1ZDL A;  1E9I A;  3GYX A;  1PJ5 A;  3AE7 A;  3ITJ A;  4USQ A;  1PN0 A;  4H4X A;  1BGJ A;  1BKH A;  5JCN A;  1PJ7 A;  3GYI A;  3RP6 A;  4O5Q A;  2YG6 A;  2PGE A;  1PJ6 A;  2YVJ A;  2RGO A;  2PP1 A;  2XVI A;  2ZBW A;  1B8S A;  1NG3 A;  1ONF A;  3HW2 A;  2GRT A;  2PU1 A;  2Q7V A;  2R4E A;  4A9W A;  3SN0 A;  3VRD B;  1GRG A;  5KMR A;  5L46 A;  3VR9 A;  1AOG A;  3OW1 A;  3FYY A;  4OPC A;  3KU9 A;  3RO6 A;  4CNK A;  1EC8 A;  3QSM A;  1PHH A;  4APN A;  2VQB A;  4DN1 A;  3D9X A;  2GR3 A;  3I6T A;  4YTM A;  3N4E A;  3A7R A;  3LAD A;  3KKJ A;  4B63 A;  1H82 A;  2JB3 A;  2Q6U A;  4UDP A;  3V3O A;  3RCY A;  4PAB A;  1OEP A;  4ECH A;  1YQ4 A;  4B68 A;  4G8T A;  4JNA A;  4Z26 A;  1JRY A;  4YWS A;  4YTN A;  2RAB A;  1H7W A;  4U8I A;  4G73 A;  4YSX A;  3QPE A;  4CBQ A;  3CIR A;  1W6T A;  3AEC A;  3ALJ A;  3GMB A;  3T6C A;  1CBO A;  5EBK A;  4J36 A;  5BRT A;  4KX6 A;  4HNL A;  2WP9 A;  4YWO A;  1N63 C;  2I5Q A;  4CRT A;  3SX6 A;  2ACZ A;  4FX9 A;  4A99 A;  1SJB A;  2XCG A;  4I59 A;  1EC7 A;  4Z17 A;  1S2Y A;  3DJE A;  2Z5X A;  4C3X A;  4DNA A;  3QSS A;  3PWG A;  2AKZ A;  3GD6 A;  3OZ2 A;  3ISH A;  2I0Z A;  3H4K A;  2AR8 A;  2BS2 A;  2MNR A;  2YLS A;  4YSZ A;  1OJT A;  5KWF A;  4YKF A;  3ENL A;  2E5V A;  3AE9 A;  2W55 A;  1FO4 A;  2AQJ A;  3BOX A;  4IP4 A;  3UXL A;  4A6N B;  3ATQ A;  2BAB A;  3OC4 A;  2XLT A;  4WCT A;  4B69 A;  3NXL A;  2FJD A;  1KKR A;  3NFU A;  3TOY A;  3AE8 A;  1L9E A;  2GAG B;  2B9W A;  3TQP A;  1LQT A;  1TRB A;  2ZAD A;  1LPF A;  4EMJ A;  3AEB A;  2XSX A;  4JY3 A;  2PTZ A;  3CND A;  4E4U A;  3RP7 A;  2GMJ A;  4GGH A;  3GY1 A;  5U63 A;  3FVD A;  1CJC A;  4ZA0 A;  3FG2 P;  4A6G A;  1PDY A;  1BWC A;  4J33 A;  2W3S A;  1YQ3 A;  1KN0 A;  3TCS A;  3DJJ A;  2V3A A;  2WPE A;  1QJD A;  3UTH A;  2YVF A;  3AEA A;  4B65 A;  3II4 A;  3P4R A;  4H50 A;  2VVM A;  4OPI A;  3COX A;  3FBS A;  1LTX R;  1B5Q A;  2OX4 A;  3PK7 A;  1NEK A;  2GMH A;  4K5S A;  1PDH A;  4DSG A;  2P0I A;  3AE4 A;  3G5R A;  2PTW A;  2OQH A;  2BXS A;  1GRH A;  4OPL A;  2WHD A;  5KMP A;  3AD8 B;  3G5Q A;  5U25 A;  1DTN A;  3LJP A;  1IUW A;  3T37 A;  2YR6 A;  3UXK A;  3L5O A;  3V5F A;  4Y4L A;  2C4C A;  2R0P A;  3IWA A;  3L8K A;  2MUC A;  1N61 C;  3BI4 A;  3I6D A;  3QVP A;  2WES A;  2JB1 A;  3PFR A;  3DES A;  4H2H A;  3QN3 A;  3TJ4 A;  4WX1 A;  2OZ3 A;  3SQS A;  2F5Z A;  3AEE A;  4MJW A;  6ENL A;  4GCM A;  3IJQ A;  2GV8 A;  4HCD A;  3SXI A;  4OCG A;  1SB3 B;  1CC2 A;  1FHV A;  2DW7 A;  3TTE A;  3HRD C;  2C64 A;  1REO A;  3BNM A;  1P43 A;  2V6O A;  3FJ4 A;  4N9X A;  1MDL A;  1ZOV A;  1PXC A;  3MSY A;  5BOE A;  1YKJ A;  2P8B A;  1N5W C;  4K2S A;  2EQ9 A;  4J1O A;  2TMD A;  4DX3 A;  2RGJ A;  1Q1R A;  1SEZ A;  3EAN A;  3U4F A;  1E1N A;  4DXK A;  4IA6 A;  3UTE A;  3DG6 A;  3NVY B;  1FCD A;  2WQY A;  1D5T A;  4G7F A;  1EBG A;  5EB5 A;  2OLA A;  4GME A;  3R25 A;  4EQW A;  4A7A A;  1E39 A;  3AN1 A;  3DFH A;  2QVH A;  3AE2 A;  3NN0 X;  2ZC8 A;  3DFY A;  4PAA A;  2OG9 A;  1PBD A;  2YR4 A;  4H4R A;  2WPC A;  3CAW A;  1K0L A;  3CNS A;  5KNL A;  3EPT A;  2XYO A;  3NT6 A;  3URH A;  3NVV B;  1EL7 A;  4U8O A;  3ICR A;  5HHF A;  4NTD A;  3HYW A;  1XHC A;  1F6M A;  2J3N A;  4JN9 A;  1MDR A;  3SZ0 A;  3DIP A;  1MRA A;  3GC2 A;  4ADW A;  1P2E A;  3MQT A;  2GQW A;  3SN4 A;  3CGB A;  1RM6 B;  3I3L A;  2GR0 A;  2QA1 A;  3SR6 B;  2JAE A;  5HY5 A;  2GGI A;  3D8X A;  4K5R A;  4K2X A;  4NZH A;  4U8M A;  3BSM A;  1M6I A;  5HXI A;  3RNM A;  1MO9 A;  2DW6 A;  5FJP A;  2QDD A;  1H81 A;  4GR1 A;  4E4F A;  3RED A;  3ABV A;  1STZ A;  4YXD A;  2BRA A;  2GF3 A;  4A35 A;  1F3P A;  2P3Z A;  2ZZC A;  1IUV A;  1Q9I A;  1JEH A;  1NPX A;  2V61 A;  1IUU A;  3PWI A;  3LOV A;  3AMZ A;  3LB8 A;  1Y0P A;  4EMI A;  4GUV A;  4A79 A;  3AE3 A;  3GDN A;  2O56 A;  1JRX A;  1DJQ A;  3OP2 A;  3GMC A;  3KUM A;  4LU6 A;  1Z6L A;  1DOC A;  2ZZB A;  3GYJ A;  1JCT A;  2PTY A;  2GGE A;  3NRN A;  2PYX A;  2QDE A;  1GPE A;  1N5X A;  3NIX A;  3GWD A;  1X2G A;  4I58 A;  3TW9 A;  1OJC A;  4X9M A;  2C73 A;  2WP5 A;  1QO8 A;  1NHP A;  4EIP A;  5EU9 A;  4Z1Y A;  2PS2 A;  2PCE A;  4K1W A;  3TWA A;  5FJO A;  4KPL A;  5IQ1 A;  3JW7 A;  4EQS A;  1JDF A;  4JN7 A;  1F8S A;  2RDX A;  4HCL A;  3H8I A;  2JK6 A;  1JU2 A;  3P0W A;  2GEW A;  3AED A;  3SY4 A;  1JRO A;  2YR5 A;  4J3Z A;  3S5S A;  1GSN A;  2PP3 A;  2YAU A;  2GGH A;  4AOS A;  1JNR A;  3PS9 A;  3CB3 A;  3NO1 A;  4J2W A;  3FXG A;  2WET A;  1DNC A;  3SFE A;  4B67 A;  1GER A;  3IJI A;  3ZYX A;  2FBW A;  2VOU A;  2BK4 A;  2YWL A;  5EB4 A;  2XH0 A;  3GDP A;  1PBE A;  4Z43 A;  3VR8 A;  2GL5 A;  1FFV C;  4D03 A;  3B97 A;  3QSE A;  3T14 A;  3NGC X;  2XLS A;  2X3N A;  2GGJ A;  2YQU A;  3UJS A;  4EM3 A;  3ES7 A;  4FP1 A;  2VZ2 A;  2BS4 A;  2WPF A;  3PG6 A;  3RHA A;  5IQ4 A;  3UKL A;  2GQF A;  4CY8 A;  1NDA A;  4ZCD A;  4CY6 A;  3V3N A;  2HNE A;  2VRM A;  4H4Y A;  2IID A;  3CK5 A;  2OA1 A;  1KNR A;  1MOK A;  3DG3 A;  4K7Z A;  2POD A;  2B7S A;  3QFA A;  4GDP A;  3V3W A;  2PGW A;  2OO6 A;  3R07 C;  2POZ A;  4XWZ A;  1KSU A;  2NVK X;  1JPM A;  4IVM B;  2B9Y A;  3SN1 A;  3M0O A;  2B76 A;  2PA6 A;  2BK5 A;  4G74 A;  4BK2 A;  2GAH B;  5CQF A;  3GRS A;  1FFU C;  4A3R A;  1H84 A;  3NK1 X;  4DSH A;  1NHQ A;  4ENL A;  1CHU A;  3ZVI A;  3O0H A;  2PP0 A;  3T2Y A;  1TE6 A;  1OJA A;  3I4K A;  1F8W A;  2DKH A;  4OPT A;  3AB1 A;  3MUC A;  5U1O A;  3NN6 X;  3P4S A;  3UP5 A;  3N6H A;  5KOW A;  4H4V A;  4A5L A;  2R0C A;  4IL0 A;  7ENL A;  3P4P A;  4M6U A;  2VVL A;  3MKC A;  3K7Q X;  3NTD A;  2WU5 A;  2ARD A;  3SYI A;  4RSL A;  4E5T A;  3NYC A;  3CPH G;  3IC9 A;  2QJJ A;  4OPD A;  2E5A A;  3UCD A;  4FK1 C;  1E7P A;  2C7G A;  5C2T A;  2W0H A;  2CDU A;  1N60 C;  4H2P A;  1Y56 A;  3IHG A;  1LVL A;  1IUX A;  1JNZ A;  3D1C A;  5FS8 A;  2XDO A;  3SM8 A;  2C72 A;  3DK4 A;  3AE1 A;  3VFC A;  1K4Q A;  1JPD X;  4JN8 A;  2E3T A;  3ZLF A;  3ZLH A;  3NHO X;  4MGG A;  4U8L A;  4D04 A;  1FEB A;  4H4W A;  3C4A A;  3OTR A;  1O95 A;  1B4V A;  1YY5 A;  4JDR A;  4EQX A;  3CNJ A;  1VQZ A;  5KMS A;  1KCZ A;  3H7V A;  4TM4 A;  1D4D A;  3UJE A;  4GDE A;  1LQU A;  3UOV A;  2OFJ A;  3UJR A;  3NK2 X;  5ER0 A;  2QA2 A;  3LZW A;  4Z2R A;  1S7M A;  4H2Q A;  4E0V A;  3P1W A;  2X8H A;  1GRA A;  5J7X A;  3R0U A;  2R0G A;  1E1K A;  1ZX9 A;  1TDO A;  4GYP A;  3EUB 3;  2WDV A;  3ADA B;  3F8P A;  4O5U A;  3FCP A;  1SJA A;  1XDI A;  2AAQ A;  1EBH A;  3CXB A;  5GSN A;  4AT2 A;  5DBJ A;  1X31 B;  1P2H A;  4J34 A;  3UGV A;  1KF6 A;  5JCL A;  2EQ7 A;  2A87 A;  4UP3 A;  3T31 A;  3B3R A;  2WBA A;  2YG3 A;  1GND A;  2WDR A;  1EL9 A;  4J31 A;  3T0K A;  4MKS A;  1W4X A;  2JBV A;  3PVC A;  1DOD A;  3U9I A;  2Z5Y A;  3SBF A;  4JNQ A;  1PBB A;  4ZCW A;  3C4N A;  3IF9 A;  2YM1 A;  1TKK A;  1SJD A;  4HA6 A;  1NEN A;  4BK3 A;  4K22 A;  1S3B A;  2WOV A;  2A8X A;  3QVR A;  3KPF A;  3PO7 A;  4GF7 A;  2Q0L A;  4XWR A;  1TDK A;  3CGC A;  3NYE A;  3ZDN A;  3NRZ B;  5IPY A;  1S2Q A;  2VQ7 A;  2BYB A;  3NZG A;  4IV9 A;  1KKO A;  3VCN A;  3D47 A;  1D4E A;  4E6M A;  1NG4 A;  2OPJ A;  1UKV G;  2PMQ A;  3NYF A;  2YG5 A;  2X8C A;  1H7X A;  4NTE A;  1SJC A;  1N1P A;  3AE6 A;  2PTX A;  3AYI A;  4H4T A;  3EKG A;  3CGD A;  1K0J A;  2BS3 A;  3R1Z A;  1Y56 B;  5BUK A;  3S61 A;  2WOW A;  2XFP A;  2XFQ A;  3GSI A;  2CHR A;  3NG7 X;  4ZCC A;  3IK4 A;  1KSS A;  3T4W A;  4H4P A;  4ROP A;  3CMM A;  2P8C A;  1BF3 A;  2H89 A;  1BKW A;  2C76 A;  3ATR A;  4REK A;  1TZZ A;  2DKI A;  3T8Q A;  1GRB A;  4H2R A;  2NQL A;  5CKU A;  3IHM A;  4YTP A;  3SZW A;  4JHM A;  2OKT A;  4GFI A;  1TYT A;  1GOS A;  3H8A A;  3DME A;  4X2P A;  3CYJ A;  3K1G A;  3G5S A;  2P88 A;  5FS9 A;  5LV9 A;  5BVA A;  3UOX A;  2HZG A;  4Z25 A;  4U8J A;  2AL2 A;  1WUE A;  1EBD A;  3V5C A;  1NHR A;  2WOI A;  3VRA A;  3B9J B;  2VRL A;  4G6H A;  1GTH A;  1Q1W A;  3UKH A;  4C5O A;  2WEU A;  1CC6 A;  4HNC A;  3JZU A;  2X8G A;  3TWB A;  2H88 A;  3VA8 A;  3SZF A;  2R45 A;  2WS3 A;  3D46 A;  1VRQ B;  3SQP A;  3UP4 A;  3FV9 A;  5HYM A;  1K0I A;  1T3Q C;  3HYV A;  4H83 A;  1NEL A;  3EEZ A;  5J04 A;  3UJ2 A;  3N6J A;  1GTE A;  2C3D A;  3GRT A;  1KNP A;  3K7T A;  2YG4 A;  1KDG A;  4NEV A;  1GRF A;  1WYG A;  1KFY A;  1L9D A;  5EOW A;  2FKP A;  5BOF A;  2XH7 A;  3QLD A;  4E8G A;  3UCC A;  3UJF A;  1E6E A;  2BCP A;  4X4J A;  1H6V A;  3DER A;  1RSG A;  5M0Z A;  2FJE A;  5KRQ A;  1FIQ B;  4JY2 A;  3UOY A;  2AL1 A;  2IVD A;  2NPX A;  3GWF A;  3B6D A;  3T9P A;  3E1T A;  1O94 A;  1PBC A;  4BK1 A;  1NAA A;  1GXF A;  2V3B A;  4YSH A;  4BUR A;  2RGH A;  3ZVH B;  1XPY A;  4GRT A;  3CN8 A;  2XVF A; 
#chains in the Genus database with same CATH homology
 2BA9 A;  2CVJ A;  1TDN A;  3NK1 X;  2C3C A;  4DSH A;  1NHQ A;  3M12 A;  1CHU A;  3AE4 A;  3O0H A;  3G5R A;  3EAO A;  4UDQ A;  4C74 A;  3T2Y A;  4IVO B;  2BXS A;  2BRY A;  1GRH A;  4HB9 A;  4ICY A;  3VQR A;  4OPL A;  1OJA A;  2WHD A;  2VVL G;  2X50 A;  5KMP A;  2ZZ0 A;  1F8W A;  2DKH A;  3AD8 B;  4OPT A;  3G5Q A;  5U25 A;  3AB1 A;  2BAC A;  3LJP A;  1IUW A;  4M52 A;  2XVJ A;  4FDC B;  5U1O A;  2YR6 A;  3T37 A;  4BJZ A;  1XAN A;  3NN6 X;  3NLC A;  1M64 A;  4Z24 A;  1QLB A;  3L5O A;  2V60 A;  4AP1 A;  2YLX A;  2TPR A;  3P4S A;  4Y4L A;  2C4C A;  3UP5 A;  4U8K A;  5KOW A;  4H4V A;  2R0P A;  4A5L A;  3IWA A;  3L8K A;  2R0C A;  2IVE A;  3KD9 A;  2UZZ A;  3DH9 A;  1TYP A;  3P4P A;  5JRB A;  3BI4 A;  2BC1 A;  2VVL A;  2WDQ A;  2C75 A;  3I6D A;  3K7Q X;  3NTD A;  3QVP A;  2YG7 A;  2WES A;  2WU5 A;  3FMW A;  2ARD A;  3SYI A;  4RSL A;  2JB1 A;  1N4W A;  4RG4 A;  3NYC A;  1HYU A;  3CPH G;  4TLX A;  3UKA A;  3IC9 A;  4YSY A;  3GD4 A;  1L0V A;  3NH3 X;  4WX1 A;  3DJD A;  4OPD A;  4Z2T A;  4FK1 C;  1CL0 A;  1E7P A;  2C7G A;  5C2T A;  2W0H A;  2CDU A;  1EL8 A;  1ZMC A;  5C3J A;  4H2P A;  2F5Z A;  1JOA A;  2GVC A;  1VG9 A;  1Y56 A;  3AEE A;  3BHF A;  1LVL A;  1IUX A;  3IHG A;  4GCM A;  1JNZ A;  3AYL A;  1E1L A;  4U8N A;  2GV8 A;  1CF3 A;  3SXI A;  3D1C A;  4OCG A;  3NK0 X;  1FEC A;  1CC2 A;  5FS8 A;  3SGL A;  2XDO A;  3NNE A;  2C72 A;  2OAL A;  3DK4 A;  3SM8 A;  1IUT A;  3AE1 A;  2C67 A;  4Z2U A;  2C64 A;  1REO A;  1K4Q A;  3BNM A;  2V6O A;  4U2S A;  4N9X A;  1H86 A;  3LXD A;  1ZOV A;  3NHO X;  4U8L A;  4D04 A;  1FEB A;  2OLO A;  1PXC A;  4H4W A;  3C4A A;  1O95 A;  1D7L A;  1B4V A;  1YY5 A;  2A89 A;  4JDR A;  4EQX A;  2JKC A;  1XPQ A;  1CJ3 A;  3L1R A;  3CNJ A;  3M13 A;  4GAP A;  3DGH A;  1YKJ A;  1DXL A;  3UKF A;  2XFO A;  3BI5 A;  5KMS A;  3V76 A;  5BUL A;  4MJW A;  2EQ9 A;  1TDE A;  2TMD A;  3ICT A;  4TM4 A;  2GR2 A;  2Q0K A;  2XLR A;  4XXG A;  3RP8 A;  1D4D A;  4GDE A;  1LQU A;  2RGJ A;  3AD7 B;  1Q1R A;  2EQ6 A;  3UOV A;  4J56 A;  5J60 A;  3BI2 A;  1GRT A;  1SEZ A;  3CTY A;  4A65 A;  3EAN A;  2GH5 A;  1YQZ A;  4JQ9 A;  3CNP A;  2C65 A;  1TDF A;  4C77 A;  1E1N A;  3VRB A;  1RYI A;  2WU2 A;  4NTC A;  3QFB A;  5FMH A;  4IA6 A;  3UTE A;  4B66 A;  3NK2 X;  3ALM A;  5ER0 A;  2QA2 A;  1BZL A;  3LZW A;  2APG A;  4J57 A;  4Z2R A;  2B7R A;  3AWI A;  3SFD A;  2R46 A;  1S7M A;  4H2Q A;  1FCD A;  4E0V A;  3P1W A;  4H4Z A;  2XFU A;  2WQY A;  2YVG A;  2X8H A;  3EF6 A;  5FS6 A;  1D5T A;  1MXT A;  1GRA A;  5J7X A;  1BGN A;  5KVI A;  5TR3 A;  2R0G A;  4YSZ A;  1DOE A;  5EB5 A;  4NEW A;  2CUL A;  1E1K A;  1CJ2 A;  4EQW A;  4A7A A;  1ZX9 A;  5GRT A;  1E39 A;  1PXA A;  1TDO A;  1VDC A;  2BCG G;  3C96 A;  3AEF A;  5KMQ A;  1ZMD A;  2WDV A;  1GAL A;  3ADA B;  3F8P A;  4O5U A;  3AE2 A;  3NN0 X;  3T2Z A;  1XDI A;  2AAQ A;  4H4Q A;  4PAA A;  1PBD A;  3ICS A;  2YR4 A;  4H4R A;  2WPC A;  2YLW A;  3BNU A;  3CNT A;  1GV4 A;  1D7Y A;  1K0L A;  3KLJ A;  3CNS A;  5GSN A;  4AT2 A;  5DBJ A;  5KNL A;  4YKG A;  1X31 B;  4TM3 A;  4Y4M A;  1P2H A;  3HYX A;  4AOX A;  4IA5 A;  3EPT A;  1IUS A;  4J34 A;  2EQ8 A;  1ZOY A;  2XYO A;  1KF6 A;  5JCL A;  1FL2 A;  3DGZ A;  3NT6 A;  4UDR A;  3URH A;  3KA7 A;  4H7U A;  1GEU A;  2EQ7 A;  5KOX A;  2A87 A;  1RP0 A;  4A6N A;  4UP3 A;  4RG3 A;  3T31 A;  1DJN A;  3Q6J A;  3B3R A;  2O9Z A;  2WBA A;  1EL7 A;  2YG3 A;  4U8O A;  4X9N A;  4AT0 A;  1GND A;  2WDR A;  1EL9 A;  2C66 A;  3ICR A;  5HHF A;  3FPZ A;  4J31 A;  3P4Q A;  3T0K A;  1W4X A;  2JBV A;  4NTD A;  3HYW A;  3PVC A;  1XHC A;  2X99 A;  1F6M A;  2J3N A;  4JN9 A;  1DOD A;  3SZ0 A;  5M10 A;  2Z5Y A;  1VQW A;  3BHK A;  3KPK A;  1D4C A;  4ADW A;  1FOH A;  5KVH A;  1P2E A;  1PS9 A;  3HZL A;  4JNQ A;  1PBB A;  2GQW A;  2OAM A;  1ELI A;  2YM2 A;  4KPR A;  3SZC A;  3C4N A;  3CGB A;  3FIM B;  3IF9 A;  1N4U A;  3I3L A;  2GR0 A;  2YM1 A;  4II3 A;  3QJ4 A;  3AXB A;  2BXR A;  2XLU A;  2QA1 A;  4HA6 A;  1NEN A;  2B9X A;  1ZDL A;  2JAE A;  4BK3 A;  1GET A;  2YLZ A;  4EIQ A;  4K22 A;  2JB2 A;  5HY5 A;  3GYX A;  1PJ5 A;  2XVE A;  3D8X A;  4K5R A;  1S3B A;  2WOV A;  4K2X A;  2A8X A;  4NZH A;  1B37 A;  3QVR A;  4U8M A;  3AE7 A;  3ITJ A;  3UOZ A;  4USQ A;  1PN0 A;  4K8D A;  3KPF A;  4H4X A;  1BGJ A;  5JCN A;  1PJ7 A;  3F8R A;  3DA1 A;  3PO7 A;  3GYI A;  3RP6 A;  4O5Q A;  2YG6 A;  3JSK A;  1M6I A;  4GF7 A;  1PJ6 A;  3RNM A;  5HXI A;  2YVJ A;  2Q0L A;  1MO9 A;  4U2T A;  1E1M A;  4XWR A;  2RGO A;  1TDK A;  3CGC A;  2ZBW A;  2XVI A;  3NYE A;  1B8S A;  1NG3 A;  1ONF A;  3ZDN A;  5IPY A;  1H81 A;  1S2Q A;  2GRT A;  3Q9T A;  2Y6Q A;  2VQ7 A;  2BYB A;  4GR1 A;  2Q7V A;  2R4E A;  3RED A;  3ABV A;  4IV9 A;  5JCM A;  4NNJ A;  4A9W A;  3VRD B;  1GRG A;  4C3Y A;  4EM4 A;  4YXD A;  1D4E A;  2BRA A;  2GF3 A;  5KMR A;  1NG4 A;  5L46 A;  1UKV G;  2E1M A;  2XLP A;  3F8D A;  1F3P A;  2ZZC A;  3VR9 A;  4AP3 A;  1IJH A;  3NYF A;  2YG5 A;  1IUV A;  3NKS A;  1Q9I A;  1JEH A;  1AOG A;  1S3E A;  2X8C A;  1NPX A;  1ZP0 A;  4OPC A;  3KU9 A;  1H7X A;  1CJ4 A;  2V61 A;  4CNK A;  1IUU A;  1L9C A;  4G9K A;  2Y6R A;  3QSM A;  3LOV A;  4OPU A;  4CCQ A;  3LB8 A;  1Y0P A;  4NTE A;  1PHH A;  4EMI A;  4APN A;  1N1P A;  1O5W A;  3AE6 A;  4GUV A;  3P9U A;  3H8L A;  3R9U A;  1VG0 A;  3AE5 A;  2VQB A;  3D9X A;  2GR3 A;  4A79 A;  3AYI A;  4H4T A;  4OPG A;  3AE3 A;  1ZKQ A;  3CGD A;  1K0J A;  4YTM A;  3WE0 A;  3GDN A;  3LAD A;  2BS3 A;  3KKJ A;  1JRX A;  1DJQ A;  1Y56 B;  2PHH A;  3GMC A;  4B63 A;  4TM1 A;  1H82 A;  2JB3 A;  2Q6U A;  5BUK A;  4UDP A;  3S61 A;  4LU6 A;  2WOW A;  2E4G A;  4H2N A;  1Z6L A;  2XFP A;  2XFQ A;  1DOC A;  3GSI A;  5KXJ A;  2ZZB A;  3V3O A;  4PAB A;  3AYJ A;  3NG7 X;  3GYJ A;  4ECH A;  4ZCC A;  4YT0 A;  1ZY8 A;  1YQ4 A;  2GB0 A;  4B68 A;  3UTF A;  3NRN A;  2PYX A;  3KVE A;  2XFN A;  1GPE A;  1KSS A;  3NIX A;  3UTG A;  3GWD A;  1NHS A;  4H4P A;  1F8R A;  1PBF A;  3CMM A;  4JNA A;  1BF3 A;  4I58 A;  4H4U A;  2H89 A;  4Z26 A;  1BKW A;  1JRY A;  4YTN A;  1OJC A;  2RAB A;  2C76 A;  1H7W A;  4U8I A;  4X9M A;  4G73 A;  3ATR A;  1GRE A;  4YSX A;  4LII A;  2C73 A;  2WP5 A;  4CBQ A;  3CIR A;  1QO8 A;  3DJG X;  4REK A;  3AEC A;  2DKI A;  1NHP A;  3ALJ A;  3GMB A;  1V59 A;  4EIP A;  4Y4N A;  1GRB A;  1CBO A;  5EBK A;  2R9Z A;  1GES A;  2OLN A;  1H83 A;  1H2I A;  4H2R A;  4J36 A;  5CKU A;  5BRT A;  3IHM A;  4KX6 A;  4YTP A;  1PXB A;  3SZW A;  2WP9 A;  4NWZ A;  1TYT A;  4YWO A;  1GOS A;  4P9S A;  5IQ1 A;  4CRT A;  4EQS A;  3DME A;  3SX6 A;  4TLZ A;  1F8S A;  2ACZ A;  1JRZ A;  4FX9 A;  2HQM A;  1OJD A;  2WP6 A;  3ALL A;  3G5S A;  4A99 A;  2XCG A;  3H8I A;  4I59 A;  2JK6 A;  2XVH A;  1JU2 A;  5FS9 A;  1CC4 A;  5LV9 A;  1GT8 A;  1S2Y A;  2GEW A;  5BVA A;  3DJE A;  3UOX A;  3AED A;  3SY4 A;  4Z25 A;  3DK8 A;  4H4S A;  4GAV A;  4U8J A;  2Z5X A;  3UKP A;  4C3X A;  2YR5 A;  1GSN A;  2YAU A;  4DNA A;  1EBD A;  2QCU A;  3AD9 B;  3QSS A;  4AOS A;  1EL5 A;  3OZ2 A;  3K7M X;  1JNR A;  3CPI G;  3UCL A;  3PS9 A;  3ISH A;  4B1B A;  2I0Z A;  3H4K A;  2AR8 A;  2BS2 A;  1NHR A;  3T2K A;  4J2W A;  3CGE A;  2V5Z A;  2WOI A;  2WET A;  1DNC A;  3SFE A;  3VRA A;  4B64 A;  4B67 A;  2R4J A;  1GER A;  2VRL A;  2YLS A;  2YLR A;  1GTH A;  4G6H A;  2FBW A;  4U8P A;  3ZYX A;  2VOU A;  2QAE A;  1COY A;  1OJT A;  5KWF A;  2BK4 A;  1Q1W A;  3UKH A;  2YWL A;  5EB4 A;  4C5O A;  4DSG A;  4YKF A;  2E5V A;  3CPJ G;  3GDP A;  2WEU A;  3AE9 A;  1PBE A;  4Z43 A;  2AQJ A;  1FEA A;  3VR8 A;  4A6N B;  1CC6 A;  3ATQ A;  2FJB A;  4D03 A;  2BAB A;  3QSE A;  5JCI A;  3OC4 A;  2XLT A;  4WCT A;  3T14 A;  2X8G A;  3NGC X;  4CNJ A;  4B69 A;  2XLS A;  2X3N A;  2H88 A;  2YQU A;  4EM3 A;  2R45 A;  2FJD A;  2WS3 A;  3SZF A;  3UKK A;  1VRQ B;  3AE8 A;  2VZ2 A;  1L9E A;  4Z44 A;  3SQP A;  2BS4 A;  3UP4 A;  5HYM A;  1K0I A;  2WPF A;  2GAG B;  3PG6 A;  3NTA A;  3RHA A;  5FS7 A;  2YLT A;  3HYV A;  2B9W A;  5IQ4 A;  3S5W A;  1LQT A;  1TRB A;  1ZK7 A;  1OJ9 A;  3GD3 A;  3UKL A;  4ZN0 A;  1LPF A;  1GTE A;  2C3D A;  2GQF A;  3GRT A;  4EMJ A;  1KNP A;  3AEB A;  4FK1 A;  4CY8 A;  3K7T A;  2YG4 A;  4JY3 A;  1KDG A;  1NDA A;  1GRF A;  4NEV A;  1LV0 A;  4ZCD A;  3CND A;  4BJY A;  1KFY A;  3V3N A;  4CY6 A;  3RP7 A;  2GMJ A;  1DOB A;  2VRM A;  4USR A;  1L9D A;  5EOW A;  4OVI A;  4H4Y A;  2C70 A;  3K30 A;  5U63 A;  1LJ1 A;  2IID A;  2BK3 A;  2OA1 A;  1KNR A;  4DGK A;  1CJC A;  3AEG A;  1MOK A;  1E6E A;  2BCP A;  4X4J A;  3FG2 P;  4K7Z A;  4TM0 A;  1H6V A;  4BV6 A;  1RSG A;  2B7S A;  5M0Z A;  1BWC A;  3QFA A;  4J33 A;  2FJE A;  4G6G A;  4GDP A;  5KRQ A;  4EMW A;  4JY2 A;  3UOY A;  1YQ3 A;  3DK9 A;  3LZX A;  4XWZ A;  2BC0 A;  1KN0 A;  1N4V A;  1KSU A;  2IVD A;  4U2L A;  2NVK X;  3DJJ A;  4IVM B;  2NPX A;  3GWF A;  4EQR A;  2B9Y A;  3B6D A;  3E1T A;  4CCR A;  2CFY A;  1O94 A;  1PBC A;  2V3A A;  2WPE A;  1QJD A;  4BK1 A;  2FJA A;  1NAA A;  3UTH A;  1GXF A;  4LA1 A;  2YVF A;  2V3B A;  3M0O A;  3AEA A;  2B76 A;  4YSH A;  4BUR A;  3II4 A;  3P4R A;  4B65 A;  4II2 A;  2BK5 A;  2RGH A;  3UKQ A;  4H50 A;  2VVM A;  4OPI A;  4G74 A;  4BK2 A;  2GAH B;  5CQF A;  3COX A;  3FBS A;  5JCK A;  3GRS A;  4GRT A;  1B5Q A;  1LTX R;  3CN8 A;  2GR1 A;  2XVF A;  1NEK A;  2GMH A;  4K5S A;  1H84 A;  1PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...