1NHWC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase Year
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 15
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2002-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nhwC00
1NHWC 2NQ8C 1NNUC 1NHGC 2FOIC
chains in the Genus database with same CATH superfamily
2VIIA 4NXNM 4OX9M 1GO5A 1I4WA 5KPZA 5E6JA 3B9PA 2JNHA 2C99A 4FWDA 1N33M 1Z5BA 4IBGA 5LMUM 3W0LB 1QUTA 3DOAA 3CF0A 3HX3A 5IT9S 2LH0A 4L78A 4GHLA 1EE8A 2LVPC 1SXJE 3HY5A 1R2YA 1VEJA 2XZUA 2W82A 3SYLA 2XF3A 5EXPA 4IBKA 2FH0A 3FD9A 2F5NA 2KHHA 2L2DA 3VKHA 4LGMA 5ITTA 2K9DA 1DV0A 2XH9A 1QUSA 4LFAM 2DNAA 2XLJA 3J7AS 1SXJA 2DAMA 1NJFA 5H37D 3W68A 2CUZA 1E9SA 1XB2B 4L6V6 4DV2M 1QDTA 3UK6A 1TGUA 1IN8A 5JI3E 1L2BA 2CHGA 3PFIA 3SYKA 2KNVA 1IN7A 3HHXA 1WXQA 5EQTA 3FE3A 3MJ5A 4B08A 3TL4X 1HT2E 2QNJA 4GRIA 2D7HA 3U60A 4G3OA 4MB7A 4B7HA 4B3MM 3GLGE 2X8AA 4LF4M 5L8RF 4RF1A 5ITQA 1Z5AA 2L7HA 2YQZA 3GQ3A 1NJGA 3GLIE 4AKHA 1QANA 5DNYA 1IFYA 2DWZB 2Z4RA 1OQYA 5DYIA 3NBXX 2JZ0A 4X64M 3T1HM 1MN3A 2DXIA 1Q3BA 2EKFA 5BPVA 4PDIA 3B89A 4M9SA 1VEKA 3GLGA 1IN4A 2R4JA 3BBZA 4M9XA 5IZ7D 3ZCBB 5JI2E 3GLIA 1QQWA 3THGA 2UUAM 2MR9A 4DBGB 2QHOB 1JQJC 5FTNA 1YLAA 1PRBA 1N77A 3HHYA 1RU3A 2LVOC 2C9OA 3AOGA 1JR3D 5FTJA 1HQCA 3B7NA 2FNAA 2L4EA 3T38A 4JI4M 3ILKA 4GC5A 3M0EA 2OQ4A 3SASA 3B7QA 1DGBA 4JI2M 4L8RC 2LHGA 1K3WA 3J27B 3GLHE 2ZTDA 3EIHA 1ZMVA 4MH0E 2FFJA 3SHFA 1IY0A 3GO8A 3DFZA 4IBDA 4R7GA 1GKIA 3L27A 4R71A 3GQ5A 1XC8A 1GABA 4Y28F 4G4OA 1I94M 4NSRA 5KO3A 1QAQA 3H4JA 3KW6A 3MHVC 3A46A 3HKPA 3SBJA 2I7NA 1EFUB 1XMQM 4OVZB 1C7YA 3I4VA 3GLHA 4DV6M 1OTRA 1VQ1A 1VDDA 4FCVA 1G41A 2R4EA 1IY1A 3K1JA 3RE8A 1IBKM 1IXSB 1JB0F 4I5SA 3GPXA 4ANRA 3K9OA 4L4UA 4DUYM 1AUAA 1R5LA 4QHTA 2K6BA 2N35A 3FKEA 2CV2A 4II7A 3FRHA 2KNAA 4XK8F 2Y20A 5KQ8A 1MJGM 4AKGA 4QNMA 3A45A 5FTLA 1T43A 4IBEA 2DWLA 5GKNA 3AKZA 2V1UA 1YSYA 3SMPA 1OFIA 3UGJA 4CGYB 4LF5M 4AG6A 1XHBA 3U6OA 3QYEA 2KZSA 4LZJA 3JR4A 1KFVA 4IIWA 1IY2A 1GLNA 1D0KA 1MU5A 1HNXM 1OIZA 1WR1B 2NQ8C 2LVAA 2XZFA 3SARA 4DV1M 2R46A 1R4GA 2DZLA 4NL4H 5DFLA 1SG9A 4AG5A 2JA2A 1HR0M 4G4QA 2C9CA 1K82A 3AJIB 2JZ1A 4AW4A 2OO9A 4LRTA 2XSZD 3F92A 3KOZE 4IJFA 1MX0A 2EA0A 1N32M 4GH9A 1IM2A 1VDLA 4FWHA 1TDHA 2CEAA 2DWNA 3KXEC 3KFUG 2G5GX 4KODA 2CP8A 2ZANA 2DI0A 2JP7A 4WURA 3LW5F 1WGNA 2FS1A 3K9PA 4Z6YA 3VK8A 3R9XB 4WP2A 1PGYA 4DV3M 4AQYM 4GKJM 1HJPA 2G3QA 1FJGM 1TH2A 1ZMWA 4DR2M 4P16A 4F2LA 2EO2A 4AZFA 4LZZA 4M0DA 4MGZE 1XWIA 1IQPA 4KO8A 1G71A 1QZEA 2V1CA 1Z6TA 3TE6A 2OPFA 1J5EM 2DAEA 3J80S 5FTKA 3KOXE 3SHGB 2EKKA 2R0IA 2RGOA 3L2AA 4FW9A 4QOSA 3U6DA 1IBMM 1TH4A 4DR6M 1NHWC 4NC6A 4FCWA 4AKIA 3U6LA 3LVWA 4LF7M 1E94E 1Q3CA 4B7GA 2JY6B 1XXHB 1Z59A 2KXEA 3DZDA 1NY6A 3RGPA 3IECA 3DA1A 3VKGA 2A5YB 3HGIA 4CISA 4HLQA 3TQSA 3FTDA 4L16A 4M9ZA 4MGYE 1R7RA 3FTCA 3FUXA 3HJ8A 3L26A 4B7FA 2DHRA 1FNNA 2UUBM 2MH8A 3E46A 4EIWA 3Q8XA 5ITXE 3U5ZB 2CFOA 2DKLA 2LTUA 3GP1A 2APLA 3UMMA 1SXJC 4GC9A 4OVZA 1ZV1A 1LV7A 3QAUA 4UN2B 3C3DA 2R44A 5BR8M 5ITYA 4IBFA 1S3SA 4DUZM 3AFHA 2DZNB 2MROB 2Y0TA 3CF6E 2JY8A 3U6CA 1L2CA 4IJEA 1OIPA 3MK6A 4KLNA 1IN6A 2L6OA 2LHCA 3V76A 5ITUA 3GQ4A 4DV4M 3VLFB 1QAMA 5IREB 2GQFA 2P5TA 3WHLA 2Z8YM 2CWBA 3U61A 3AL0C 2ZAMA 1A5TA 2H5XA 4LJ6A 3SATA 1ORYB 3HU3A 2QZ4A 1HNWM 3QYBA 2Q2EB 2DAIA 3VK7A 4K0KM 4IBIA 1ZQ9A 2OOAA 2HCBA 1PM5A 3U6MA 2F5OA 2QQ8A 2ZBKB 4LF8M 2UXBM 5FSWA 3FYCA 2AHMA 3AOEA 1QVRA 2Z7JA 4PDGA 2J7NA 4NRVA 4JN6A 3B7ZA 3FYDA 4LJ7A 2HKJA 5FTMA 1IBLM 2DWMA 3L28A 1N34M 4NOOB 3K2LA 4L15A 1L1ZA 4LY6A 5EP3A 1D2NA 1PJJA 3FTEA 1V34A 2B3TA 4I4LA 2Z3XA 1TF0B 4QHSA 1G4AE 2QBYB 3VDPA 1H6UA 2LVQD 4B3SM 3FUUA 2RRUA 1R6BX 3HZJA 3LQRA 5KPRA 1YUBA 3HJQA 3OTOM 2VQEM 4MM3B 3E9SA 1CUKA 1XMOM 4DV0M 4LF9M 1NV9A 2DVWB 3I01M 4B3RM 2VF8A 3LMMA 1TDZA 4DR1M 1NHGC 3FUWA 3KVWA 4XBOA 2QP9X 3C3EA 1X37A 3RGSA 3JR5A 2HHHM 3IHPA 3J81S 2Y0QA 2R18A 1GL7A 4CHTB 1XNQM 2J7OA 3GPUA 4DR5M 1XXHE 2Z4SA 3PNYA 2ERCA 2QENA 2C96A 2KA6B 3A98B 2UXDM 1L1TA 3GRRA 1D0LA 1DGGA 1PJSA 3UJNA 1JR3E 2YNMD 4LFBM 1SXJD 2VDBB 5EP2A 2C98A 2WSEF 1EIJA 2D7GA 2VF7A 1V92A 4NXMM 1D0MA 2JY5A 3D8LA 2L7IA 4D82A 3HU2A 3GRUA 4JXJA 3T6PA 2E5LM 1JR3A 2J5YA 3KOWE 3TPZA 1ZAEA 4NRWA 3BXWA 3IG5A 3GPYA 1HNZM 2XGNA 3M7GA 4TUWA 3GRVA 4HEOA 2DZOB 2EJSA 3LQQA 2Y21A 2ZM6M 2EUCA 4DV7M 1OFHA 1OKSA 3I51A 3U6QA 4GMQA 3SC3A 3KOYE 5KPTA 3GPPA 3U5ZA 1L2DA 4X62M 3SAWA 2K47A 3QWLA 2M60A 4WW0A 3GLFB 4JI6M 4MGKE 2ZTCA 1DGHB 3BOSA 4Z8XA 5C1BA 2X49A 4DV5M 2F4VM 1W5TA 2XFTA 3PNVA 2WSFF 4FCTA 4FVMA 4MGHA 3CGWA 1Y8GA 4X66M 4LJ8A 4PD2A 2RGHA 4P17A 4BBAA 1C1KA 2UUCM 1NY5A 3FUVA 2KEBA 4LJ4A 2JUJA 1J09A 1IN5A 2LBCA 2LXEA 2XFSA 4RF0A 4YHHM 2JXNA 4LGYA 4PCZA 1G59A 2CV0A 1E32A 4LFCM 4XGIA 3U6SA 3L29A 4I8OA 4JI7M 2MJ5B 2X4AA 3VFDA 1G8PA 2R62A 3UZUA 4BLCA 5C18A 3R8FA 1PJIA 3HJSA 3K8ZA 5EXXA 3TWKA 3E21A 1K3XA 3HU1A 2CRUA 3MMPA 3EIEA 4DR3M 1XNRM 3J2PB 3KP1E 4GHAA 3ZH9B 4KHPM 2KDLA 1DO2A 5LMNM 2GNOA 1V33A 1UFZA 3IG8A 1Q02A 3SAVA 3ZC7B 3GRYA 2UXCM 1YE9A 3C9PA 1Z5CA 4PT5A 2BJWA 4X65M 1AIPC 4RNAA 4D81A 5E26A 4MGIE 4RKUF 1OAOC 4OU7A 2YR0A 3KS4A 2QBYA 5ITXA 5F3WA 1IXSA 1N36M 3SMSA 4AI6A 3HHZA 2R65A 2XSZA 4JYAM 3K92A 4B3TM 4G4NA 2FE8A 1T3TA 4I81A 3FTFA 2F5QA 2BWEA 3AV0A 3W67A 2D7EA 2M5ZA 2O5RA 3RFWA 2CHQA 3HHWA 1DO0A 2KNZA 2I7PA 3FRIA 4Q7JA 4LF6M 4DR7M 4LJAA 3LCUA 2CV1A 2ZAOA 8CATA 2LNHC 1DGFA 4ITQA 3D8BA 2R45A 3FUTA 3KSJA 5DYGA 4LJ5A 4S12A 4FWGA 5A2QS 1GJTA 4CJ6A 3M6AA 2VQFM 4GKKM 1IXZA 2HWJA 1Q39A 4REZA 3E4RA 2G8LA 5KQDA 1NNUC 1QAOA 4KT0F 1HQYE 3LCVB 2UU9M 2HL7A 2CE7A 3SAUA 4LRSA 2YFQA 1SXJB 5EJCA 5EXTA 1TTEA 3VDUA 2V6ZM 4LCBA 3W0FA 2H1RA 2O01F 2K0BX 4LJ9A 1PJTA 5EP4A 2FOIC 3GLFE 1R2ZA 4NSOB 4JI3M 4IBJA 5ITRA 3Q8GA 1IXRC 2BNKA 4QOZC 3JAMS 1HT1E 1QYRA 3ZQJA 1N78A 4FD2A 3I04M 2HAKA 3TWLA 4DR4M 1VG5A 3NBIA 1BVSA 3KP0E 1F4IA 4ZPXA 4G6ZA 3AOEC 4A3VB 4OW0A 2CHVA 3U60B 1G3IA 1OAIA 4HL4A 5IWAM 3B74A 1GL6A 4GEWA 1E9RA 3GLFA 2LVNC 2L09A 1DGHA 1WIVA 4G4RA 1NNJA 1ZMUA 2KRKA 2R6FA 1PJQA 4BB9A 2RKOA 2OOBA 1WJ7A 5EP1A 2QSFX 1QDRA 4M0WA 2DAKA 3GLGB 3NWLA 1KSFX 3SFZA 4LG2A 3GLIB 3A42A 4JI5M 3H4MA 1P3QQ 4QNRA 2WZJA 4IBBA 3T1YM 2LWXA 5EXSA 4JI8M 1NV8A 4JV5M 4D80A 1GJSA 3U61B 2QCUA 1XXHA 1NSFA 2O25A 3KS8A 3KSXA 3L25A 2KW0A 4JI1M 4YY3M 2C5RA 2BWBA 2KRUA 2L4FA 3C58A 4IBCA 3U6EA 2DENA 1WGLA 1QZMA 7CATA 1J7KA 2DAGA 1W5SA 1WHCA 3J7BA 1NVMA 3I4YA 3T15A 3PXGA 3HWSA 3WHKA 1KYIA 3CF2A 2KZUA 1L8QA 2JWSA 3U6PA 4R3DA 4JI0M 2WSCF 2XEPA 1OJLA 1NO1A 1GVNA 1UM8A 2DHYA 4W5WA 2QPAA 1N75A 1VEGA 1T6OA 1TR8A 3GLHB 3LVVA 2F5PA 2JY7A 3CTWB 4GIPA 3PVSA 1LTMA 1TH3A 4F1IA 2F5SA 3TWMA 4GITA 2BJVA 2MGWA 5FLXS 3KDSE 4CIZA
chains in the Genus database with same CATH topology
2VIIA 4NXNM 4OX9M 1I4WA 5KPZA 5E6JA 3B9PA 2C99A 4FWDA 1N33M 1Z5BA 4IBGA 5LMUM 3W0LB 3DOAA 3CF0A 5IT9S 2LH0A 4L78A 4GHLA 1EE8A 1SXJE 1R2YA 2XZUA 2W82A 3SYLA 2XF3A 5EXPA 4IBKA 3FD9A 2F5NA 3VKHA 4LGMA 5ITTA 2XH9A 4LFAM 2XLJA 3J7AS 1SXJA 1NJFA 5H37D 2CUZA 1E9SA 4DV2M 3UK6A 1TGUA 1IN8A 5JI3E 1L2BA 2CHGA 3PFIA 3SYKA 1IN7A 3HHXA 1WXQA 5EQTA 3MJ5A 4B08A 3TL4X 1HT2E 4GRIA 2D7HA 3U60A 4MB7A 4B7HA 4B3MM 2X8AA 4LF4M 4AKHA 4RF1A 5ITQA 1Z5AA 2L7HA 2YQZA 3GQ3A 1NJGA 1QANA 5DNYA 2DWZB 2Z4RA 5DYIA 4X64M 3T1HM 2DXIA 1Q3BA 5BPVA 4PDIA 4M9SA 3GLGA 1IN4A 2R4JA 4M9XA 5IZ7D 3ZCBB 3GLIA 5JI2E 2UUAM 1QQWA 3THGA 1JQJC 5FTNA 1N77A 3HHYA 2C9OA 3AOGA 1JR3D 5FTJA 1HQCA 2FNAA 3T38A 4JI4M 3ILKA 4GC5A 3M0EA 2OQ4A 3SASA 1DGBA 4JI2M 1K3WA 3J27B 3EIHA 4MH0E 2FFJA 3SHFA 1IY0A 3GO8A 3DFZA 4IBDA 4R7GA 1GKIA 3L27A 1XC8A 3GQ5A 4G4OA 1I94M 4NSRA 5KO3A 1QAQA 3KW6A 3MHVC 3A46A 3HKPA 3SBJA 2I7NA 1XMQM 4OVZB 3I4VA 3GLHA 4DV6M 1VDDA 4FCVA 1G41A 2R4EA 1IY1A 3K1JA 3RE8A 1IBKM 1IXSB 4I5SA 3GPXA 4L4UA 4DUYM 4QHTA 3FKEA 2CV2A 4II7A 2Y20A 5KQ8A 4AKGA 4QNMA 3A45A 5FTLA 4IBEA 2DWLA 5GKNA 3AKZA 2V1UA 1YSYA 3SMPA 1OFIA 3UGJA 4CGYB 4LF5M 4AG6A 1XHBA 3U6OA 2KZSA 4LZJA 3JR4A 1KFVA 4IIWA 1IY2A 1GLNA 1MU5A 1HNXM 2NQ8C 2XZFA 3SARA 4DV1M 2R46A 4NL4H 4AG5A 2JA2A 1HR0M 4G4QA 2C9CA 1K82A 3AJIB 4AW4A 4LRTA 2XSZD 3KOZE 4IJFA 1MX0A 2EA0A 1N32M 4GH9A 1IM2A 4FWHA 1TDHA 2CEAA 2DWNA 3KXEC 3KFUG 2G5GX 4KODA 2ZANA 4WURA 3VK8A 4Z6YA 3R9XB 4DV3M 4GKJM 4AQYM 1FJGM 1TH2A 4DR2M 4P16A 2EO2A 4AZFA 4LZZA 4M0DA 4MGZE 1XWIA 1IQPA 4KO8A 2V1CA 3TE6A 1Z6TA 2OPFA 1J5EM 3J80S 5FTKA 3KOXE 3SHGB 2RGOA 4QOSA 3L2AA 4FW9A 3U6DA 1IBMM 1TH4A 4DR6M 1NHWC 4FCWA 4AKIA 3U6LA 3LVWA 4LF7M 1E94E 1Q3CA 4B7GA 1XXHB 1Z59A 2KXEA 3DZDA 1NY6A 3RGPA 3VKGA 3DA1A 2A5YB 3HGIA 4CISA 4HLQA 3TQSA 3FTDA 4L16A 4M9ZA 4MGYE 1R7RA 3FTCA 3FUXA 3HJ8A 3L26A 4B7FA 2DHRA 1FNNA 2UUBM 4EIWA 5ITXE 3U5ZB 3Q8XA 2CFOA 3GP1A 3UMMA 1SXJC 4GC9A 4OVZA 1LV7A 3QAUA 5BR8M 5ITYA 4IBFA 1S3SA 4DUZM 3AFHA 2DZNB 2Y0TA 3CF6E 3U6CA 1L2CA 4IJEA 3MK6A 4KLNA 1IN6A 2L6OA 5ITUA 3GQ4A 4DV4M 3VLFB 1QAMA 5IREB 2P5TA 3WHLA 3AL0C 3U61A 2ZAMA 4LJ6A 3SATA 1ORYB 3HU3A 2QZ4A 1HNWM 4K0KM 2Q2EB 3VK7A 4IBIA 1ZQ9A 1PM5A 2HCBA 3U6MA 2F5OA 2ZBKB 4LF8M 2UXBM 5FSWA 3FYCA 2AHMA 3AOEA 1QVRA 2Z7JA 4PDGA 2J7NA 4NRVA 4JN6A 3FYDA 4LJ7A 2HKJA 5FTMA 1IBLM 2DWMA 3L28A 1N34M 4NOOB 3K2LA 4L15A 1L1ZA 4LY6A 5EP3A 1D2NA 1PJJA 3FTEA 4I4LA 2Z3XA 4QHSA 1G4AE 2QBYB 3VDPA 1H6UA 4B3SM 3FUUA 1R6BX 5KPRA 3LQRA 1YUBA 3HJQA 3OTOM 2VQEM 4MM3B 3E9SA 1XMOM 4DV0M 4LF9M 2DVWB 4B3RM 3LMMA 1TDZA 4DR1M 1NHGC 3FUWA 3KVWA 4XBOA 2QP9X 3RGSA 1X37A 3JR5A 2HHHM 3J81S 2Y0QA 2R18A 1GL7A 4CHTB 1XNQM 2J7OA 3GPUA 4DR5M 2Z4SA 3PNYA 2ERCA 2QENA 2C96A 2KA6B 3A98B 2UXDM 1L1TA 3GRRA 1DGGA 3UJNA 2YNMD 4LFBM 1SXJD 5EP2A 2C98A 2D7GA 4NXMM 3D8LA 2L7IA 4D82A 3HU2A 3GRUA 4JXJA 2E5LM 1JR3A 3TPZA 3KOWE 4NRWA 1ZAEA 3IG5A 3GPYA 1HNZM 2XGNA 3M7GA 4TUWA 3GRVA 2DZOB 3LQQA 2Y21A 2ZM6M 2EUCA 4DV7M 1OFHA 3I51A 3U6QA 4GMQA 3SC3A 3KOYE 5KPTA 3GPPA 3U5ZA 1L2DA 4X62M 3SAWA 2K47A 3QWLA 2M60A 4WW0A 3GLFB 4JI6M 4MGKE 1DGHB 3BOSA 4Z8XA 5C1BA 2X49A 4DV5M 2F4VM 1W5TA 2XFTA 3PNVA 4FCTA 4FVMA 4MGHA 4X66M 4LJ8A 4PD2A 2RGHA 4BBAA 1C1KA 2UUCM 1NY5A 3FUVA 2KEBA 4LJ4A 1J09A 1IN5A 2LXEA 4RF0A 2XFSA 4YHHM 4LGYA 4PCZA 1G59A 2CV0A 1E32A 4LFCM 4XGIA 3U6SA 3L29A 4I8OA 4JI7M 2X4AA 3VFDA 1G8PA 2R62A 3UZUA 4BLCA 5C18A 3R8FA 1PJIA 3HJSA 3K8ZA 5EXXA 3TWKA 1K3XA 3HU1A 1XNRM 3EIEA 4DR3M 3J2PB 3KP1E 4GHAA 3ZH9B 4KHPM 5LMNM 1DO2A 3SAVA 3IG8A 3ZC7B 3GRYA 2UXCM 1YE9A 1Z5CA 4PT5A 2BJWA 4X65M 4RNAA 4D81A 5E26A 4MGIE 4OU7A 2YR0A 3KS4A 2QBYA 5ITXA 5F3WA 1N36M 3SMSA 4AI6A 3HHZA 2R65A 2XSZA 4JYAM 3K92A 4B3TM 4G4NA 2FE8A 1T3TA 4I81A 3FTFA 2F5QA 3AV0A 2D7EA 2M5ZA 2O5RA 3RFWA 2CHQA 3HHWA 1DO0A 4LF6M 2I7PA 4DR7M 4LJAA 2CV1A 2ZAOA 8CATA 2LNHC 1DGFA 4ITQA 3D8BA 2R45A 3FUTA 3KSJA 5DYGA 4LJ5A 4S12A 4FWGA 5A2QS 4GKKM 3M6AA 2VQFM 1IXZA 1Q39A 4REZA 3E4RA 2G8LA 5KQDA 1NNUC 1QAOA 1HQYE 2UU9M 2HL7A 2CE7A 3SAUA 4LRSA 2YFQA 1SXJB 5EJCA 5EXTA 3VDUA 2V6ZM 4LCBA 3W0FA 2H1RA 4LJ9A 5EP4A 2FOIC 1R2ZA 4NSOB 4JI3M 4IBJA 5ITRA 1IXRC 2BNKA 4QOZC 3JAMS 1HT1E 1QYRA 1N78A 4FD2A 3TWLA 4DR4M 3NBIA 3KP0E 4ZPXA 4G6ZA 3AOEC 4A3VB 4OW0A 2CHVA 3U60B 1G3IA 5IWAM 4HL4A 1GL6A 1E9RA 3GLFA 2L09A 4G4RA 1DGHA 1NNJA 2KRKA 4BB9A 2RKOA 5EP1A 4M0WA 3GLGB 3NWLA 1KSFX 3SFZA 4LG2A 3GLIB 3A42A 4JI5M 3H4MA 4QNRA 4IBBA 3T1YM 2LWXA 5EXSA 4JI8M 4JV5M 4D80A 3U61B 2QCUA 1XXHA 1NSFA 3KS8A 3KSXA 3L25A 2KW0A 4JI1M 4YY3M 2C5RA 2KRUA 3C58A 3U6EA 4IBCA 7CATA 1QZMA 1J7KA 1W5SA 3J7BA 1NVMA 3I4YA 3T15A 3PXGA 3HWSA 3WHKA 1KYIA 3CF2A 2KZUA 1L8QA 3U6PA 4R3DA 4JI0M 2XEPA 1OJLA 1GVNA 1UM8A 4W5WA 2QPAA 1N75A 3GLHB 3LVVA 2F5PA 4GIPA 3CTWB 3PVSA 1TH3A 2F5SA 3TWMA 4GITA 2BJVA 4L8RC 5FLXS 3KDSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHW C;  2NQ8 C;  1NNU C;  1NHG C;  2FOI C; 
#chains in the Genus database with same CATH topology
 2VII A;  4NXN M;  4OX9 M;  1GO5 A;  1I4W A;  5KPZ A;  5E6J A;  3B9P A;  2JNH A;  2C99 A;  4FWD A;  1N33 M;  1Z5B A;  4IBG A;  5LMU M;  3W0L B;  1QUT A;  3DOA A;  3CF0 A;  3HX3 A;  5IT9 S;  2LH0 A;  4L78 A;  4GHL A;  1EE8 A;  2LVP C;  1SXJ E;  3HY5 A;  1R2Y A;  1VEJ A;  2XZU A;  2W82 A;  3SYL A;  2XF3 A;  5EXP A;  4IBK A;  2FH0 A;  3FD9 A;  2F5N A;  2KHH A;  2L2D A;  3VKH A;  4LGM A;  5ITT A;  2K9D A;  1DV0 A;  2XH9 A;  1QUS A;  4LFA M;  2DNA A;  2XLJ A;  3J7A S;  1SXJ A;  2DAM A;  1NJF A;  5H37 D;  3W68 A;  2CUZ A;  1E9S A;  1XB2 B;  4L6V 6;  4DV2 M;  1QDT A;  3UK6 A;  1TGU A;  1IN8 A;  5JI3 E;  1L2B A;  2CHG A;  3PFI A;  3SYK A;  2KNV A;  1IN7 A;  3HHX A;  1WXQ A;  5EQT A;  3FE3 A;  3MJ5 A;  4B08 A;  3TL4 X;  1HT2 E;  2QNJ A;  4GRI A;  2D7H A;  3U60 A;  4G3O A;  4MB7 A;  4B7H A;  4B3M M;  3GLG E;  2X8A A;  4LF4 M;  5L8R F;  4RF1 A;  5ITQ A;  1Z5A A;  2L7H A;  2YQZ A;  3GQ3 A;  1NJG A;  3GLI E;  4AKH A;  1QAN A;  5DNY A;  1IFY A;  2DWZ B;  2Z4R A;  1OQY A;  5DYI A;  3NBX X;  2JZ0 A;  4X64 M;  3T1H M;  1MN3 A;  2DXI A;  1Q3B A;  2EKF A;  5BPV A;  4PDI A;  3B89 A;  4M9S A;  1VEK A;  3GLG A;  1IN4 A;  2R4J A;  3BBZ A;  4M9X A;  5IZ7 D;  3ZCB B;  5JI2 E;  3GLI A;  1QQW A;  3THG A;  2UUA M;  2MR9 A;  4DBG B;  2QHO B;  1JQJ C;  5FTN A;  1YLA A;  1PRB A;  1N77 A;  3HHY A;  1RU3 A;  2LVO C;  2C9O A;  3AOG A;  1JR3 D;  5FTJ A;  1HQC A;  3B7N A;  2FNA A;  2L4E A;  3T38 A;  4JI4 M;  3ILK A;  4GC5 A;  3M0E A;  2OQ4 A;  3SAS A;  3B7Q A;  1DGB A;  4JI2 M;  4L8R C;  2LHG A;  1K3W A;  3J27 B;  3GLH E;  2ZTD A;  3EIH A;  1ZMV A;  4MH0 E;  2FFJ A;  3SHF A;  1IY0 A;  3GO8 A;  3DFZ A;  4IBD A;  4R7G A;  1GKI A;  3L27 A;  4R71 A;  3GQ5 A;  1XC8 A;  1GAB A;  4Y28 F;  4G4O A;  1I94 M;  4NSR A;  5KO3 A;  1QAQ A;  3H4J A;  3KW6 A;  3MHV C;  3A46 A;  3HKP A;  3SBJ A;  2I7N A;  1EFU B;  1XMQ M;  4OVZ B;  1C7Y A;  3I4V A;  3GLH A;  4DV6 M;  1OTR A;  1VQ1 A;  1VDD A;  4FCV A;  1G41 A;  2R4E A;  1IY1 A;  3K1J A;  3RE8 A;  1IBK M;  1IXS B;  1JB0 F;  4I5S A;  3GPX A;  4ANR A;  3K9O A;  4L4U A;  4DUY M;  1AUA A;  1R5L A;  4QHT A;  2K6B A;  2N35 A;  3FKE A;  2CV2 A;  4II7 A;  3FRH A;  2KNA A;  4XK8 F;  2Y20 A;  5KQ8 A;  1MJG M;  4AKG A;  4QNM A;  3A45 A;  5FTL A;  1T43 A;  4IBE A;  2DWL A;  5GKN A;  3AKZ A;  2V1U A;  1YSY A;  3SMP A;  1OFI A;  3UGJ A;  4CGY B;  4LF5 M;  4AG6 A;  1XHB A;  3U6O A;  3QYE A;  2KZS A;  4LZJ A;  3JR4 A;  1KFV A;  4IIW A;  1IY2 A;  1GLN A;  1D0K A;  1MU5 A;  1HNX M;  1OIZ A;  1WR1 B;  2NQ8 C;  2LVA A;  2XZF A;  3SAR A;  4DV1 M;  2R46 A;  1R4G A;  2DZL A;  4NL4 H;  5DFL A;  1SG9 A;  4AG5 A;  2JA2 A;  1HR0 M;  4G4Q A;  2C9C A;  1K82 A;  3AJI B;  2JZ1 A;  4AW4 A;  2OO9 A;  4LRT A;  2XSZ D;  3F92 A;  3KOZ E;  4IJF A;  1MX0 A;  2EA0 A;  1N32 M;  4GH9 A;  1IM2 A;  1VDL A;  4FWH A;  1TDH A;  2CEA A;  2DWN A;  3KXE C;  3KFU G;  2G5G X;  4KOD A;  2CP8 A;  2ZAN A;  2DI0 A;  2JP7 A;  4WUR A;  3LW5 F;  1WGN A;  2FS1 A;  3K9P A;  4Z6Y A;  3VK8 A;  3R9X B;  4WP2 A;  1PGY A;  4DV3 M;  4AQY M;  4GKJ M;  1HJP A;  2G3Q A;  1FJG M;  1TH2 A;  1ZMW A;  4DR2 M;  4P16 A;  4F2L A;  2EO2 A;  4AZF A;  4LZZ A;  4M0D A;  4MGZ E;  1XWI A;  1IQP A;  4KO8 A;  1G71 A;  1QZE A;  2V1C A;  1Z6T A;  3TE6 A;  2OPF A;  1J5E M;  2DAE A;  3J80 S;  5FTK A;  3KOX E;  3SHG B;  2EKK A;  2R0I A;  2RGO A;  3L2A A;  4FW9 A;  4QOS A;  3U6D A;  1IBM M;  1TH4 A;  4DR6 M;  1NHW C;  4NC6 A;  4FCW A;  4AKI A;  3U6L A;  3LVW A;  4LF7 M;  1E94 E;  1Q3C A;  4B7G A;  2JY6 B;  1XXH B;  1Z59 A;  2KXE A;  3DZD A;  1NY6 A;  3RGP A;  3IEC A;  3DA1 A;  3VKG A;  2A5Y B;  3HGI A;  4CIS A;  4HLQ A;  3TQS A;  3FTD A;  4L16 A;  4M9Z A;  4MGY E;  1R7R A;  3FTC A;  3FUX A;  3HJ8 A;  3L26 A;  4B7F A;  2DHR A;  1FNN A;  2UUB M;  2MH8 A;  3E46 A;  4EIW A;  3Q8X A;  5ITX E;  3U5Z B;  2CFO A;  2DKL A;  2LTU A;  3GP1 A;  2APL A;  3UMM A;  1SXJ C;  4GC9 A;  4OVZ A;  1ZV1 A;  1LV7 A;  3QAU A;  4UN2 B;  3C3D A;  2R44 A;  5BR8 M;  5ITY A;  4IBF A;  1S3S A;  4DUZ M;  3AFH A;  2DZN B;  2MRO B;  2Y0T A;  3CF6 E;  2JY8 A;  3U6C A;  1L2C A;  4IJE A;  1OIP A;  3MK6 A;  4KLN A;  1IN6 A;  2L6O A;  2LHC A;  3V76 A;  5ITU A;  3GQ4 A;  4DV4 M;  3VLF B;  1QAM A;  5IRE B;  2GQF A;  2P5T A;  3WHL A;  2Z8Y M;  2CWB A;  3U61 A;  3AL0 C;  2ZAM A;  1A5T A;  2H5X A;  4LJ6 A;  3SAT A;  1ORY B;  3HU3 A;  2QZ4 A;  1HNW M;  3QYB A;  2Q2E B;  2DAI A;  3VK7 A;  4K0K M;  4IBI A;  1ZQ9 A;  2OOA A;  2HCB A;  1PM5 A;  3U6M A;  2F5O A;  2QQ8 A;  2ZBK B;  4LF8 M;  2UXB M;  5FSW A;  3FYC A;  2AHM A;  3AOE A;  1QVR A;  2Z7J A;  4PDG A;  2J7N A;  4NRV A;  4JN6 A;  3B7Z A;  3FYD A;  4LJ7 A;  2HKJ A;  5FTM A;  1IBL M;  2DWM A;  3L28 A;  1N34 M;  4NOO B;  3K2L A;  4L15 A;  1L1Z A;  4LY6 A;  5EP3 A;  1D2N A;  1PJJ A;  3FTE A;  1V34 A;  2B3T A;  4I4L A;  2Z3X A;  1TF0 B;  4QHS A;  1G4A E;  2QBY B;  3VDP A;  1H6U A;  2LVQ D;  4B3S M;  3FUU A;  2RRU A;  1R6B X;  3HZJ A;  3LQR A;  5KPR A;  1YUB A;  3HJQ A;  3OTO M;  2VQE M;  4MM3 B;  3E9S A;  1CUK A;  1XMO M;  4DV0 M;  4LF9 M;  1NV9 A;  2DVW B;  3I01 M;  4B3R M;  2VF8 A;  3LMM A;  1TDZ A;  4DR1 M;  1NHG C;  3FUW A;  3KVW A;  4XBO A;  2QP9 X;  3C3E A;  1X37 A;  3RGS A;  3JR5 A;  2HHH M;  3IHP A;  3J81 S;  2Y0Q A;  2R18 A;  1GL7 A;  4CHT B;  1XNQ M;  2J7O A;  3GPU A;  4DR5 M;  1XXH E;  2Z4S A;  3PNY A;  2ERC A;  2QEN A;  2C96 A;  2KA6 B;  3A98 B;  2UXD M;  1L1T A;  3GRR A;  1D0L A;  1DGG A;  1PJS A;  3UJN A;  1JR3 E;  2YNM D;  4LFB M;  1SXJ D;  2VDB B;  5EP2 A;  2C98 A;  2WSE F;  1EIJ A;  2D7G A;  2VF7 A;  1V92 A;  4NXM M;  1D0M A;  2JY5 A;  3D8L A;  2L7I A;  4D82 A;  3HU2 A;  3GRU A;  4JXJ A;  3T6P A;  2E5L M;  1JR3 A;  2J5Y A;  3KOW E;  3TPZ A;  1ZAE A;  4NRW A;  3BXW A;  3IG5 A;  3GPY A;  1HNZ M;  2XGN A;  3M7G A;  4TUW A;  3GRV A;  4HEO A;  2DZO B;  2EJS A;  3LQQ A;  2Y21 A;  2ZM6 M;  2EUC A;  4DV7 M;  1OFH A;  1OKS A;  3I51 A;  3U6Q A;  4GMQ A;  3SC3 A;  3KOY E;  5KPT A;  3GPP A;  3U5Z A;  1L2D A;  4X62 M;  3SAW A;  2K47 A;  3QWL A;  2M60 A;  4WW0 A;  3GLF B;  4JI6 M;  4MGK E;  2ZTC A;  1DGH B;  3BOS A;  4Z8X A;  5C1B A;  2X49 A;  4DV5 M;  2F4V M;  1W5T A;  2XFT A;  3PNV A;  2WSF F;  4FCT A;  4FVM A;  4MGH A;  3CGW A;  1Y8G A;  4X66 M;  4LJ8 A;  4PD2 A;  2RGH A;  4P17 A;  4BBA A;  1C1K A;  2UUC M;  1NY5 A;  3FUV A;  2KEB A;  4LJ4 A;  2JUJ A;  1J09 A;  1IN5 A;  2LBC A;  2LXE A;  2XFS A;  4RF0 A;  4YHH M;  2JXN A;  4LGY A;  4PCZ A;  1G59 A;  2CV0 A;  1E32 A;  4LFC M;  4XGI A;  3U6S A;  3L29 A;  4I8O A;  4JI7 M;  2MJ5 B;  2X4A A;  3VFD A;  1G8P A;  2R62 A;  3UZU A;  4BLC A;  5C18 A;  3R8F A;  1PJI A;  3HJS A;  3K8Z A;  5EXX A;  3TWK A;  3E21 A;  1K3X A;  3HU1 A;  2CRU A;  3MMP A;  3EIE A;  4DR3 M;  1XNR M;  3J2P B;  3KP1 E;  4GHA A;  3ZH9 B;  4KHP M;  2KDL A;  1DO2 A;  5LMN M;  2GNO A;  1V33 A;  1UFZ A;  3IG8 A;  1Q02 A;  3SAV A;  3ZC7 B;  3GRY A;  2UXC M;  1YE9 A;  3C9P A;  1Z5C A;  4PT5 A;  2BJW A;  4X65 M;  1AIP C;  4RNA A;  4D81 A;  5E26 A;  4MGI E;  4RKU F;  1OAO C;  4OU7 A;  2YR0 A;  3KS4 A;  2QBY A;  5ITX A;  5F3W A;  1IXS A;  1N36 M;  3SMS A;  4AI6 A;  3HHZ A;  2R65 A;  2XSZ A;  4JYA M;  3K92 A;  4B3T M;  4G4N A;  2FE8 A;  1T3T A;  4I81 A;  3FTF A;  2F5Q A;  2BWE A;  3AV0 A;  3W67 A;  2D7E A;  2M5Z A;  2O5R A;  3RFW A;  2CHQ A;  3HHW A;  1DO0 A;  2KNZ A;  2I7P A;  3FRI A;  4Q7J A;  4LF6 M;  4DR7 M;  4LJA A;  3LCU A;  2CV1 A;  2ZAO A;  8CAT A;  2LNH C;  1DGF A;  4ITQ A;  3D8B A;  2R45 A;  3FUT A;  3KSJ A;  5DYG A;  4LJ5 A;  4S12 A;  4FWG A;  5A2Q S;  1GJT A;  4CJ6 A;  3M6A A;  2VQF M;  4GKK M;  1IXZ A;  2HWJ A;  1Q39 A;  4REZ A;  3E4R A;  2G8L A;  5KQD A;  1NNU C;  1QAO A;  4KT0 F;  1HQY E;  3LCV B;  2UU9 M;  2HL7 A;  2CE7 A;  3SAU A;  4LRS A;  2YFQ A;  1SXJ B;  5EJC A;  5EXT A;  1TTE A;  3VDU A;  2V6Z M;  4LCB A;  3W0F A;  2H1R A;  2O01 F;  2K0B X;  4LJ9 A;  1PJT A;  5EP4 A;  2FOI C;  3GLF E;  1R2Z A;  4NSO B;  4JI3 M;  4IBJ A;  5ITR A;  3Q8G A;  1IXR C;  2BNK A;  4QOZ C;  3JAM S;  1HT1 E;  1QYR A;  3ZQJ A;  1N78 A;  4FD2 A;  3I04 M;  2HAK A;  3TWL A;  4DR4 M;  1VG5 A;  3NBI A;  1BVS A;  3KP0 E;  1F4I A;  4ZPX A;  4G6Z A;  3AOE C;  4A3V B;  4OW0 A;  2CHV A;  3U60 B;  1G3I A;  1OAI A;  4HL4 A;  5IWA M;  3B74 A;  1GL6 A;  4GEW A;  1E9R A;  3GLF A;  2LVN C;  2L09 A;  1DGH A;  1WIV A;  4G4R A;  1NNJ A;  1ZMU A;  2KRK A;  2R6F A;  1PJQ A;  4BB9 A;  2RKO A;  2OOB A;  1WJ7 A;  5EP1 A;  2QSF X;  1QDR A;  4M0W A;  2DAK A;  3GLG B;  3NWL A;  1KSF X;  3SFZ A;  4LG2 A;  3GLI B;  3A42 A;  4JI5 M;  3H4M A;  1P3Q Q;  4QNR A;  2WZJ A;  4IBB A;  3T1Y M;  2LWX A;  5EXS A;  4JI8 M;  1NV8 A;  4JV5 M;  4D80 A;  1GJS A;  3U61 B;  2QCU A;  1XXH A;  1NSF A;  2O25 A;  3KS8 A;  3KSX A;  3L25 A;  2KW0 A;  4JI1 M;  4YY3 M;  2C5R A;  2BWB A;  2KRU A;  2L4F A;  3C58 A;  4IBC A;  3U6E A;  2DEN A;  1WGL A;  1QZM A;  7CAT A;  1J7K A;  2DAG A;  1W5S A;  1WHC A;  3J7B A;  1NVM A;  3I4Y A;  3T15 A;  3PXG A;  3HWS A;  3WHK A;  1KYI A;  3CF2 A;  2KZU A;  1L8Q A;  2JWS A;  3U6P A;  4R3D A;  4JI0 M;  2WSC F;  2XEP A;  1OJL A;  1NO1 A;  1GVN A;  1UM8 A;  2DHY A;  4W5W A;  2QPA A;  1N75 A;  1VEG A;  1T6O A;  1TR8 A;  3GLH B;  3LVV A;  2F5P A;  2JY7 A;  3CTW B;  4GIP A;  3PVS A;  1LTM A;  1TH3 A;  4F1I A;  2F5S A;  3TWM A;  4GIT A;  2BJV A;  2MGW A;  5FLX S;  3KDS E;  4CIZ A; 
#chains in the Genus database with same CATH homology
 2VII A;  4NXN M;  4OX9 M;  1I4W A;  5KPZ A;  5E6J A;  3B9P A;  2C99 A;  4FWD A;  1N33 M;  1Z5B A;  4IBG A;  5LMU M;  3W0L B;  3DOA A;  3CF0 A;  5IT9 S;  2LH0 A;  4L78 A;  4GHL A;  1EE8 A;  1SXJ E;  1R2Y A;  2XZU A;  2W82 A;  3SYL A;  2XF3 A;  5EXP A;  4IBK A;  3FD9 A;  2F5N A;  3VKH A;  4LGM A;  5ITT A;  2XH9 A;  4LFA M;  2XLJ A;  3J7A S;  1SXJ A;  1NJF A;  5H37 D;  2CUZ A;  1E9S A;  4DV2 M;  3UK6 A;  1TGU A;  1IN8 A;  5JI3 E;  1L2B A;  2CHG A;  3PFI A;  3SYK A;  1IN7 A;  3HHX A;  1WXQ A;  5EQT A;  3MJ5 A;  4B08 A;  3TL4 X;  1HT2 E;  4GRI A;  2D7H A;  3U60 A;  4MB7 A;  4B7H A;  4B3M M;  2X8A A;  4LF4 M;  4AKH A;  4RF1 A;  5ITQ A;  1Z5A A;  2L7H A;  2YQZ A;  3GQ3 A;  1NJG A;  1QAN A;  5DNY A;  2DWZ B;  2Z4R A;  5DYI A;  4X64 M;  3T1H M;  2DXI A;  1Q3B A;  5BPV A;  4PDI A;  4M9S A;  3GLG A;  1IN4 A;  2R4J A;  4M9X A;  5IZ7 D;  3ZCB B;  3GLI A;  5JI2 E;  2UUA M;  1QQW A;  3THG A;  1JQJ C;  5FTN A;  1N77 A;  3HHY A;  2C9O A;  3AOG A;  1JR3 D;  5FTJ A;  1HQC A;  2FNA A;  3T38 A;  4JI4 M;  3ILK A;  4GC5 A;  3M0E A;  2OQ4 A;  3SAS A;  1DGB A;  4JI2 M;  1K3W A;  3J27 B;  3EIH A;  4MH0 E;  2FFJ A;  3SHF A;  1IY0 A;  3GO8 A;  3DFZ A;  4IBD A;  4R7G A;  1GKI A;  3L27 A;  1XC8 A;  3GQ5 A;  4G4O A;  1I94 M;  4NSR A;  5KO3 A;  1QAQ A;  3KW6 A;  3MHV C;  3A46 A;  3HKP A;  3SBJ A;  2I7N A;  1XMQ M;  4OVZ B;  3I4V A;  3GLH A;  4DV6 M;  1VDD A;  4FCV A;  1G41 A;  2R4E A;  1IY1 A;  3K1J A;  3RE8 A;  1IBK M;  1IXS B;  4I5S A;  3GPX A;  4L4U A;  4DUY M;  4QHT A;  3FKE A;  2CV2 A;  4II7 A;  2Y20 A;  5KQ8 A;  4AKG A;  4QNM A;  3A45 A;  5FTL A;  4IBE A;  2DWL A;  5GKN A;  3AKZ A;  2V1U A;  1YSY A;  3SMP A;  1OFI A;  3UGJ A;  4CGY B;  4LF5 M;  4AG6 A;  1XHB A;  3U6O A;  2KZS A;  4LZJ A;  3JR4 A;  1KFV A;  4IIW A;  1IY2 A;  1GLN A;  1MU5 A;  1HNX M;  2NQ8 C;  2XZF A;  3SAR A;  4DV1 M;  2R46 A;  4NL4 H;  4AG5 A;  2JA2 A;  1HR0 M;  4G4Q A;  2C9C A;  1K82 A;  3AJI B;  4AW4 A;  4LRT A;  2XSZ D;  3KOZ E;  4IJF A;  1MX0 A;  2EA0 A;  1N32 M;  4GH9 A;  1IM2 A;  4FWH A;  1TDH A;  2CEA A;  2DWN A;  3KXE C;  3KFU G;  2G5G X;  4KOD A;  2ZAN A;  4WUR A;  3VK8 A;  4Z6Y A;  3R9X B;  4DV3 M;  4GKJ M;  4AQY M;  1FJG M;  1TH2 A;  4DR2 M;  4P16 A;  2EO2 A;  4AZF A;  4LZZ A;  4M0D A;  4MGZ E;  1XWI A;  1IQP A;  4KO8 A;  2V1C A;  3TE6 A;  1Z6T A;  2OPF A;  1J5E M;  3J80 S;  5FTK A;  3KOX E;  3SHG B;  2RGO A;  4QOS A;  3L2A A;  4FW9 A;  3U6D A;  1IBM M;  1TH4 A;  4DR6 M;  1NHW C;  4FCW A;  4AKI A;  3U6L A;  3LVW A;  4LF7 M;  1E94 E;  1Q3C A;  4B7G A;  1XXH B;  1Z59 A;  2KXE A;  3DZD A;  1NY6 A;  3RGP A;  3VKG A;  3DA1 A;  2A5Y B;  3HGI A;  4CIS A;  4HLQ A;  3TQS A;  3FTD A;  4L16 A;  4M9Z A;  4MGY E;  1R7R A;  3FTC A;  3FUX A;  3HJ8 A;  3L26 A;  4B7F A;  2DHR A;  1FNN A;  2UUB M;  4EIW A;  5ITX E;  3U5Z B;  3Q8X A;  2CFO A;  3GP1 A;  3UMM A;  1SXJ C;  4GC9 A;  4OVZ A;  1LV7 A;  3QAU A;  5BR8 M;  5ITY A;  4IBF A;  1S3S A;  4DUZ M;  3AFH A;  2DZN B;  2Y0T A;  3CF6 E;  3U6C A;  1L2C A;  4IJE A;  3MK6 A;  4KLN A;  1IN6 A;  2L6O A;  5ITU A;  3GQ4 A;  4DV4 M;  3VLF B;  1QAM A;  5IRE B;  2P5T A;  3WHL A;  3AL0 C;  3U61 A;  2ZAM A;  4LJ6 A;  3SAT A;  1ORY B;  3HU3 A;  2QZ4 A;  1HNW M;  4K0K M;  2Q2E B;  3VK7 A;  4IBI A;  1ZQ9 A;  1PM5 A;  2HCB A;  3U6M A;  2F5O A;  2ZBK B;  4LF8 M;  2UXB M;  5FSW A;  3FYC A;  2AHM A;  3AOE A;  1QVR A;  2Z7J A;  4PDG A;  2J7N A;  4NRV A;  4JN6 A;  3FYD A;  4LJ7 A;  2HKJ A;  5FTM A;  1IBL M;  2DWM A;  3L28 A;  1N34 M;  4NOO B;  3K2L A;  4L15 A;  1L1Z A;  4LY6 A;  5EP3 A;  1D2N A;  1PJJ A;  3FTE A;  4I4L A;  2Z3X A;  4QHS A;  1G4A E;  2QBY B;  3VDP A;  1H6U A;  4B3S M;  3FUU A;  1R6B X;  5KPR A;  3LQR A;  1YUB A;  3HJQ A;  3OTO M;  2VQE M;  4MM3 B;  3E9S A;  1XMO M;  4DV0 M;  4LF9 M;  2DVW B;  4B3R M;  3LMM A;  1TDZ A;  4DR1 M;  1NHG C;  3FUW A;  3KVW A;  4XBO A;  2QP9 X;  3RGS A;  1X37 A;  3JR5 A;  2HHH M;  3J81 S;  2Y0Q A;  2R18 A;  1GL7 A;  4CHT B;  1XNQ M;  2J7O A;  3GPU A;  4DR5 M;  2Z4S A;  3PNY A;  2ERC A;  2QEN A;  2C96 A;  2KA6 B;  3A98 B;  2UXD M;  1L1T A;  3GRR A;  1DGG A;  3UJN A;  2YNM D;  4LFB M;  1SXJ D;  5EP2 A;  2C98 A;  2D7G A;  4NXM M;  3D8L A;  2L7I A;  4D82 A;  3HU2 A;  3GRU A;  4JXJ A;  2E5L M;  1JR3 A;  3TPZ A;  3KOW E;  4NRW A;  1ZAE A;  3IG5 A;  3GPY A;  1HNZ M;  2XGN A;  3M7G A;  4TUW A;  3GRV A;  2DZO B;  3LQQ A;  2Y21 A;  2ZM6 M;  2EUC A;  4DV7 M;  1OFH A;  3I51 A;  3U6Q A;  4GMQ A;  3SC3 A;  3KOY E;  5KPT A;  3GPP A;  3U5Z A;  1L2D A;  4X62 M;  3SAW A;  2K47 A;  3QWL A;  2M60 A;  4WW0 A;  3GLF B;  4JI6 M;  4MGK E;  1DGH B;  3BOS A;  4Z8X A;  5C1B A;  2X49 A;  4DV5 M;  2F4V M;  1W5T A;  2XFT A;  3PNV A;  4FCT A;  4FVM A;  4MGH A;  4X66 M;  4LJ8 A;  4PD2 A;  2RGH A;  4BBA A;  1C1K A;  2UUC M;  1NY5 A;  3FUV A;  2KEB A;  4LJ4 A;  1J09 A;  1IN5 A;  2LXE A;  4RF0 A;  2XFS A;  4YHH M;  4LGY A;  4PCZ A;  1G59 A;  2CV0 A;  1E32 A;  4LFC M;  4XGI A;  3U6S A;  3L29 A;  4I8O A;  4JI7 M;  2X4A A;  3VFD A;  1G8P A;  2R62 A;  3UZU A;  4BLC A;  5C18 A;  3R8F A;  1PJI A;  3HJS A;  3K8Z A;  5EXX A;  3TWK A;  1K3X A;  3HU1 A;  1XNR M;  3EIE A;  4DR3 M;  3J2P B;  3KP1 E;  4GHA A;  3ZH9 B;  4KHP M;  5LMN M;  1DO2 A;  3SAV A;  3IG8 A;  3ZC7 B;  3GRY A;  2UXC M;  1YE9 A;  1Z5C A;  4PT5 A;  2BJW A;  4X65 M;  4RNA A;  4D81 A;  5E26 A;  4MGI E;  4OU7 A;  2YR0 A;  3KS4 A;  2QBY A;  5ITX A;  5F3W A;  1N36 M;  3SMS A;  4AI6 A;  3HHZ A;  2R65 A;  2XSZ A;  4JYA M;  3K92 A;  4B3T M;  4G4N A;  2FE8 A;  1T3T A;  4I81 A;  3FTF A;  2F5Q A;  3AV0 A;  2D7E A;  2M5Z A;  2O5R A;  3RFW A;  2CHQ A;  3HHW A;  1DO0 A;  4LF6 M;  2I7P A;  4DR7 M;  4LJA A;  2CV1 A;  2ZAO A;  8CAT A;  2LNH C;  1DGF A;  4ITQ A;  3D8B A;  2R45 A;  3FUT A;  3KSJ A;  5DYG A;  4LJ5 A;  4S12 A;  4FWG A;  5A2Q S;  4GKK M;  3M6A A;  2VQF M;  1IXZ A;  1Q39 A;  4REZ A;  3E4R A;  2G8L A;  5KQD A;  1NNU C;  1QAO A;  1HQY E;  2UU9 M;  2HL7 A;  2CE7 A;  3SAU A;  4LRS A;  2YFQ A;  1SXJ B;  5EJC A;  5EXT A;  3VDU A;  2V6Z M;  4LCB A;  3W0F A;  2H1R A;  4LJ9 A;  5EP4 A;  2FOI C;  1R2Z A;  4NSO B;  4JI3 M;  4IBJ A;  5ITR A;  1IXR C;  2BNK A;  4QOZ C;  3JAM S;  1HT1 E;  1QYR A;  1N78 A;  4FD2 A;  3TWL A;  4DR4 M;  3NBI A;  3KP0 E;  4ZPX A;  4G6Z A;  3AOE C;  4A3V B;  4OW0 A;  2CHV A;  3U60 B;  1G3I A;  5IWA M;  4HL4 A;  1GL6 A;  1E9R A;  3GLF A;  2L09 A;  4G4R A;  1DGH A;  1NNJ A;  2KRK A;  4BB9 A;  2RKO A;  5EP1 A;  4M0W A;  3GLG B;  3NWL A;  1KSF X;  3SFZ A;  4LG2 A;  3GLI B;  3A42 A;  4JI5 M;  3H4M A;  4QNR A;  4IBB A;  3T1Y M;  2LWX A;  5EXS A;  4JI8 M;  4JV5 M;  4D80 A;  3U61 B;  2QCU A;  1XXH A;  1NSF A;  3KS8 A;  3KSX A;  3L25 A;  2KW0 A;  4JI1 M;  4YY3 M;  2C5R A;  2KRU A;  3C58 A;  3U6E A;  4IBC A;  7CAT A;  1QZM A;  1J7K A;  1W5S A;  3J7B A;  1NVM A;  3I4Y A;  3T15 A;  3PXG A;  3HWS A;  3WHK A;  1KYI A;  3CF2 A;  2KZU A;  1L8Q A;  3U6P A;  4R3D A;  4JI0 M;  2XEP A;  1OJL A;  1GVN A;  1UM8 A;  4W5W A;  2QPA A;  1N75 A;  3GLH B;  3LVV A;  2F5P A;  4GIP A;  3CTW B;  3PVS A;  1TH3 A;  2F5S A;  3TWM A;  4GIT A;  2BJV A;  4L8R C;  5FLX S;  3KDS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...