1NI2A

Structure of the active ferm domain of ezrin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Active N-terminal Domain of Ezrin. CONFORMATIONAL AND MOBILITY CHANGES IDENTIFY KEYSTONE INTERACTIONS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Ezrin
total genus 80
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ni2A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ni2A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ni2A01
3OLMD 4HAUB 3KYDD 2FJLA 2KZRA 2V1YA 3DQVA 3QCAA 4EJNA 1LM8B 2FCMA 2AWTA 4B6WA 1J0GA 3RCZA 4HAYB 1V5MA 1YIWA 4KV2A 4F7ZA 4W9CA 3NOBA 1MKEA 3DCGA 5DPTA 1W1DA 3K9PB 4HHVA 3RZFA 1L2NA 2D4QA 3PT2B 1ZW7A 5CLLB 3EC8A 2MWNB 2GBNA 3ZTCA 2IYBA 5JHBA 1BTNA 1E5WA 2Z0OA 1WJ4A 2DZJA 2D11A 2KMCA 3QAQA 4WAAA 5KQ1A 3GYOA 3U30A 3ZDTA 3ENEA 1UBIA 4FBJB 2KQ7A 2R2QA 1NTIA 2FJ9A 2YS3A 2UVMA 3PG7A 3HK0A 2D3GA 1RRPB 2KWUB 1WFYA 3ZNGC 1ZSQA 1WZ3A 3RT3B 1WX8A 2C7NB 2Z0PA 5E6NA 3PS6A 1NU2A 1M7RA 3TVVA 3VH4B 2R2OA 3FEHA 2C7HA 2ELAA 2COAA 3P7ZA 5HE1A 4HB0B 4ANVA 2K8BA 4WQOB 3A9JB 4GOCA 4TQ0A 1EUVB 3A4RA 1MK7B 4ICVA 3PSEB 1WJ1A 3EPYA 2KOXA 5AZHA 2NCNA 4ZRIA 2P0HA 2UYZB 4KSLC 2MBHA 1WXVA 1MAIA 4HAXB 3IBEA 4HAWB 2XEWA 3L10B 3PHWB 2JRIB 4G0NB 1P6SA 4ICUA 4JIOU 4PYZA 2KC2A 5D3XA 3GOEA 2M4NA 4TQ1A 2JP2A 4FLHA 4XZ4A 2I5CA 2N1VA 3R7RA 2ZVNA 3VUXA 3O96A 5C6RA 2AL6A 1PQSA 4ANWA 4NQKE 1FAOA 2ASQA 3CIKA 4H8SA 1WGDA 3PTFC 4HPMB 2KFKB 4JGHB 2NPTA 3SHQA 3WA0A 1HB8A 2MSED 2ZPNA 3FSSA 3M62B 4DDID 1HB6A 2KWVB 1GUAB 3DBSA 1C3TA 2GS0A 4HB2B 2V3SA 1NTYA 5JHHA 1V5PA 2KD0A 3BY4B 5DH9B 1DBHA 2HTHA 1LXDA 3T8MA 3ODWA 2WX0A 4WWOA 4GDKB 5G55A 4HAZB 4W9JA 4X57B 3VDZA 2MDXA 1ACAA 3TW1A 2KQSA 4HJKA 1YX6B 1WYWB 2PPHA 2YLMA 1WX7A 4IG7B 1GJZA 3P6AA 1AWEA 2RLOA 3DBHI 1OTRB 2KTFA 3N3KB 2KKCA 2L05A 1BTKA 3RULA 4KIKB 4C0AA 2RGNB 4HCPB 2MBBB 2LJ5A 3AJ4A 3V62A 3NS8A 2LULA 3JVZX 4BKTA 1X05A 3O65B 2JXXA 3D8FA 4IM0A 5IAAC 3V61A 2EMSA 2IZVB 5TR5A 2E2XA 4W9IA 3PGEA 1UELA 1UPRA 1DDWA 1NTVA 3PPAA 3N32A 1A5RA 1X86A 3SV1A 1H4RA 3L54A 4IAPA 2JT4B 3AU5A 3SUZA 4F7UP 3AXCA 3QJZA 4NQLB 3KW5B 4BKGA 4DK5A 4FADA 1G6JA 3H7SA 1V5TA 4B95A 1TZ1A 3DVNV 2CY5A 2RGFA 1BWNA 3M1IB 3QK0A 2C9WB 3X23A 1X11A 1U5FA 3OAWA 2JRHA 4A20A 5D27A 4MEMA 2FCNA 2COPA 3M95A 3OJ3A 4EZKA 4M8NA 2LZ6A 4ZYNA 2MA9B 3L17A 4KZCA 3D8EA 2LOZA 3KRWA 5KQ4A 1P1AA 1XX0A 1TBEA 1UZXB 2D07B 1GNUA 3RD2A 3UIOB 2K6DB 4BKSD 2NPTB 2I5FA 4GDLB 1I2HA 2JUOA 3A33B 2L00B 2M0XA 5JHAA 2KN5A 3ZW3A 4KAXB 4GU2A 2NVUI 4W9LA 1WJNA 2QHOA 3CMMB 4FHKA 4K1RB 3VAWA 5IJMA 1Q5WB 2YT0A 3NZUA 2KUPA 4LDTB 4NAWB 3HM6X 2LOXA 3WANA 2DHJA 3A9KA 1AARA 2KC1A 3DOWA 4K81A 2ZNVB 2V76A 2ZCCA 3H7PA 4II2B 1PFJA 4WWNA 3PVLA 2CR5A 4TV3A 5CHWA 2P0DA 5FR6A 3WAOA 4TKNA 4GB9A 4F7HA 2COFA 3K9OB 1NDDA 4MGYE 4J6IA 1IPGA 2WDTB 2EJ8A 3PVWA 1DYNA 3DXDA 4G50A 4HATB 3IVFA 1V9JA 1WGHA 4G11A 4MGIE 5LLIA 2N9EB 3T9LA 5D3VA 1ZGUB 3GZNI 1LW3A 4KZ0A 4DHZB 3A8QA 4KIKA 2LUEA 2YF0A 3FM8C 2D2QA 4A6FA 1WGRA 2MFQA 4HPLB 1V86A 2MX2A 2LYDA 1V6EA 1WJUA 1QC6A 1MIXA 3G9WA 1YQBA 1WXAA 3DBRI 2CQUA 2CAYA 3B1LX 3QC8B 2CU1A 1U5GA 4HLEA 1P3QU 1WMHA 4N9F4 3MDBC 1J19A 2AEHA 3AU4A 2D9YA 5FI0A 3VIAA 2GBMA 4MY6A 3N30A 1WF9A 3IG3A 1ZKHA 2RNRB 4CHMA 2VSZA 4LCDE 2CHXA 4EZLA 4F7GA 1XQQA 5LOPB 3X0WA 1X1MA 1K5DB 1WE7A 4RM9A 4E3CA 3APCA 2FUHB 3UQBA 3PLVA 1GC6A 1NI2A 2GJYA 2M8SA 3APFA 2DZKA 4HWIB 1EVHA 1K5GB 2GBRA 4I6LB 3LJ3A 4II3B 2WH5A 1WG7A 2KO3A 3BINA 2M17A 1ST7A 2W2XC 2NBVB 4W9DA 3DVGX 3DPDA 1PMSA 2UZRA 3ZVVA 1WY8A 1ZC4B 3F0WA 2YRYA 3ZRCA 2J0JA 4Y94A 5HE0A 4GIVA 4IC7B 3VTUA 2ROZB 2D9ZA 4AUQC 4NAWA 1YJ1A 2NBUA 5D3WA 2N23A 2L0TA 1MK9B 4K2OA 2FCQA 1OMWA 2N7EA 4NNJB 1S1QB 3PRPB 1V88A 1OQYA 4W9FA 3T06A 3C0RB 2N4FA 4NJ6A 1UNRA 1EAZA 1UEFA 5J17A 1RRBA 4WJOA 3EECA 3KRXA 3DDCB 2H7EA 4Z2MB 4HDQA 3JYUA 2MCNB 1SIFA 1WMHB 4F8CB 4OVUA 2EMTA 4Z2NA 1TXDA 5DPWA 1IRSA 1V5UA 2LKOA 4HB3B 1IYFA 2G4SA 3R66C 1E8WA 2DYBA 1ZM0A 2LWPA 4B6HA 1FGYA 1Y19B 3RYTA 2NS5A 1TQZA 3KZ1A 3EHVA 1V2YA 1WM3A 3PRMB 2A4ZA 2DYQA 2QKMA 2LXAA 2WYQA 1OEYJ 3HQCA 4I6PA 5D2MB 5AEKB 3DVNU 1AQCA 4BKSA 4PS3A 2ROVA 1J8CA 2KDFB 3NZSA 1LFDA 1U27A 4A5KA 2KX3A 1UD7A 2BPSA 2UZSA 3ODOA 3D32A 1OEYA 2LVQA 3V6EB 3PHXB 5AZFA 4DBBA 1KOTA 1XODA 4A6KA 3W1SA 2KDBA 1Q0WB 4BFRA 1XR0B 3DVGY 1WIAA 5AZGA 1WGQA 4AOFA 1S3SG 2P8VA 3QIJA 2LI5A 2HJ8A 2MQJA 1WJ6A 2Z0EB 3ULCA 3ZUNA 1F9JA 4BBNF 1E7UA 3WYFB 2Z0DB 2OJRA 2COCA 4ASWC 5J2RA 2XK5A 3VHTC 5JLJB 2MRPA 4MJSB 4D0NB 2BKRB 2BYVE 1U4AA 1WE6A 3OANA 3U8ZA 3CF6E 2DHKA 4IM3A 2CS4A 1N3HA 1V61A 2GBJA 2PE6B 4PS8A 4WJQA 1X1FA 1XCGA 3KYCD 4K2PA 3QX1A 2L2IA 4FJZA 2JWZA 1ISNA 5J3TA 1BAKA 4GDKA 4LDTD 2RSGA 2JF5A 3L0WB 1WI0A 4I6NB 4B9KA 2KGXB 1M7EA 3PP2A 1WZ0A 1WJMA 2N1WA 1H10A 1RLFA 3OJ4B 2IYDB 2KFJA 2LGXA 1ZC3B 5D6JB 3TJPA 2DLWA 1MPHA 3FP5A 4GN1A 1WVHA 1FHOA 2A5UA 3SNHA 4IWQA 2LASA 2HE7A 2DKQA 5CX3A 3UQAA 4MT7A 4GXBA 2UWQA 4GZUA 1KJTA 4W9GA 4DX8A 4NPNA 2AL3A 2GCLA 1WH3A 2K1FA 1R4NI 2EKEC 5FI1A 2CB8A 2N9PC 3I3TB 5E6PA 5GMVA 1WGUA 2V4LA 3VH3B 2MW5A 3R7QA 1L7YA 4HDOA 2Y7BA 1OGWA 2ZEQA 1R4MI 1Z5SB 2MLBA 1IP9A 3ZRFA 2IO1B 4RM8A 1E8ZA 2KTRB 2BWFA 2CY4A 2L76A 3TO1A 2FIDA 2KHWB 3MJWA 4MSQB 5KHOA 2NBWB 2D9XA 2M14A 4IOYX 4DHZE 5C5BB 3DBLI 2CHWA 3JW0X 2DX1A 1SE9A 4FULA 4CHJA 3NHEB 4WJNA 2LRUA 2JZZA 3JSVA 4YONA 3SYXA 4LJPB 2KK8A 1MG8A 5KHQA 4LJOB 1UH6A 2PEAA 1E90A 4DDGD 4A3OA 3UZTA 2O2VB 4MELA 4EZJA 2J0MA 1J0WA 4DX90 3H9DA 3V5WA 2NMBA 4M8MA 5JP4A 2P0FA 3WALA 4HB4B 2HD5B 2G3QB 2KDIA 2DYNA 2JVCA 2ZZPB 4CYEA 3DXEA 4ZRKA 3P2BA 4GDLA 1EO6A 3ECIA 2OOBB 4KDLB 3TIXA 4HVBA 1P9DU 2N9XA 2Y5BB 4W9EA 5KCVA 4KHBB 4GPTB 5C23A 1YX5B 2C5LC 3VOQA 2NZ8B 2GMIC 3ZO5B 1RFAA 4WJPA 3QBVB 4OVVA 1PLSA 1U5DA 2DN6A 1C1YB 3ZNID 3KUCB 2Y8FA 2O6VB 3KUDB 3UF8A 5J18A 2MP2B 3BJIA 2FAZA 3EFUA 3W1YA 5JH5C 3DXCA 1WX9A 1Z2MA 1XD4A 1T0YA 2Y8GA 4IWPA 3SD5A 2YS1A 3V60A 2WWZA 1Q1OA 4EOYA 4ZRJA 1B55A 4CHKA 3ZKJC 2BKFA 5D3YA 3M3JA 2DYMA 1WXSA 2ZNVC 2M38A 3QHTA 5G2NA 1I35A 3W1SC 1Y5OA 2RPQA 1EF1A 2LG1A 5DPSA 3VQIA 1LQBA 2K2JA 4PNKA 1FGZA 2PE9A 5JZEB 2LD9A 3A98B 4KVGB 3MTNB 4FA6A 1NVLA 2DAJA 1Z87A 2JPHA 1HBKA 2GBKA 2L8JA 4K7SA 2DX5B 3VTWA 1DROA 1WR1A 4MM3A 5C16A 3PREA 3KVFB 5J3YA 4YL8A 1YD8U 3QQ8B 4HCNB 1FHWA 4MGZE 2YVCA 3A1QA 1RJ2A 4RMAA 2ADZA 4FHJA 2YT1A 4TUUA 4MGKE 3VVWB 1H8CA 4MSMB 1I7AA 2ZCBA 2HRJA 1P98A 2O6VD 4A6FB 5LXIB 3PVUA 1UNPA 1MIZB 3PEGA 4FN2A 3WIMA 3KSYA 4KHOA 5DHAB 3ZVRA 4BVUC 5C5BA 5DCNA 2IO3B 4XWXA 5LONB 1UBQA 3WAPA 3QWMA 4AJYB 4MK0A 4WVFB 4F1SA 4GGQA 2LGYA 2JZ3B 1WXMA 2KTRA 2J59M 2KJHB 2KXJA 2RUKB 3M63B 3ML9A 1Q67A 3HIZA 4ANUA 1WRDB 3APDA 5HE2A 5IA7A 3HW2B 2KVRA 1QQGA 3FLVA 2YSZA 2KJRA 1U29A 2XQNM 5J3QA 4PYUA 4HAVB 4IUMB 3A4SC 4NJ7A 1ZVRA 3ML8A 2NR2A 4M0WB 2CRFA 3PSCA 1P0RA 2L1CA 1HE8A 1U5EA 1X1GA 2DZIA 1VCBA 2ELBA 2LRWA 4ANXA 2I1KA 2K2UA 2DX5A 3L16A 2D10A 4PS7A 4DBGA 1WGGA 5EFXA 1SHCA 1E8XA 1OY2A 2HTHB 3KUZA 4W9KA 3TL5A 2K25A 3CSTA 4DXAB 2QKLA 2MBOA 2KJ6A 3B08A 3UGBB 3ZLZA 4BOZB 1E8YA 4P7IA 1P5TA 2K00A 3RUIB 1QZEA 1EGXA 2IY1B 5E6OA 2IO2B 3F5RA 3CSFA 2DAFA 3TBLD 2KDEB 2KANA 2KWCA 4KDIC 1TTNA 3PLUA 1V80A 5D7GA 1DDMA 2BYFA 4W9HA 1UPQA 5LXHA 4WJ7A 3SO6A 3V6CB 3ULBA 3WAMA 2YS5A 4IM2A 2MP2A 2XK5B 4IW0A 1V5OA 2CKHB 3HHMA 2LBBA 3TMPB 3ZDMC 4EEWA 3SDLC 5CLQB 3L13A 1I42A 2BCJA 2DHIA 2FIFA 2IY0B 4EMOA 4FJVB 4XC2A 1CMXB 1NBFC 2WX1A 1KI1B 1FXTB 2J7QB 3ALBA 3NY5A 3UINB 1U2BA 2MBQA 4DHJB 4EFOA 2Q13A 3A9KB 4K7UA 5CHFA 2K8HA 4HK2A 2FCSA 3UIPB 3ZNHB 4JQWC 1OQNA 3MPXA 4HXDA 4G3XB 2D9VA 3GYPA 2L7RA 2D9WA 3N7CA 3VTVA 1TGZB 3ODXA 2BGFA 1KM7A 2DENB 3H6NA 4PQ0A 2KX0A 2DA0A 5BO4B 3L08A 2IO0B 1V81A 5CTRC 4AP4C 5GOWB 2AYOB 2DKPA 5L83A 3HM3A 2ZVOA 3MHSD 3PRZA 4EKUA 2G45B 2MWSB 3AI5A 2RD0A 2RSUA 1P3RA 5DHFB 1FB8A 4A3PA 2ZJDA 3ZTDA 1W1GA 5HE3A 3A1QB 2IFSA 4MH0E 4AJWA 1VD2A 1XD3B 2KMAA 2DYOA 4NSWA 2PZ1A 2C7MB 2DHZA 2H7DA 2OQBA 2DZMA 4MJSA 4A6HA 3A8PA 1SGHA 2B3AA 2REXA 4K7WA 3RZWC 4JLCA 4GSWA 4BOSC 4WWPA 2X18A 4L6EA 1UGMA 3B0AA 4EUTA 1TJ6A 5L95C 4KSKC 4URKA 1DDVA 4KHAA 3S2AA 1W1HA 2Z0QA 3D8DA 2LGDA 2N7DA 2W9NA 4JL9A 5CHVC 3LDZE 1D3ZA 3KH0A 5C79A 2R09A 2W2WA 2KNBA 2W2XD 4TYZA 2N0YA 1M94A 2MBEA 3IFWB 4GMVA 3AULA 2L3ZA 3H7PB 3RCPA 2LVPA 2R0DA 4NY0A 2VKIA 2G35A 1WM2A 2LVOA 3A9JA 3Q3JA 1GC7A 4K17A 1EF5A 2IBIB 2VRWB 3ZIMA 2KLGA 5HKHA 2CHZA 3IHPC 3ZNZB 2CODA 4MDKE 1XKEA 2VRRB 3TFMA 1V49A 4E71A 3VXWA 1FHXA 4CO7A 3ML4A 3PZDA 2RVBB 3TCAA 2J0KA 1Y8RC 5EDSA 1V89A 4IWOA 5DIFB 1K8RB 2G4DB 2LXCA 2FNJB 4BBNC 1FOEA 3QARA 1BT0A 3SU8X 3ONSA 3CXBB 2JY6A 4FJYA 5D94A 2KLCA 2I1JA 1KZGA 3R3MA 1WGYA 1UNQA 4XX5A 3U7DA 1WI1A 1LB1A 1E7VA 1JRUA 1WR6E 2GOWA 2DTCA 1KLVA 3NSUA 2FDQA 5L81A 1KZ7A 2KCJA 3QA8A 4E74A 2XBBC 2RQ1A 3KY9A 2O2VA 3H1UA 2BF8B 5DPRA 2C60A 2EC1A 4WSFA 1GG3A 2BWES 5JHGA 3VUWA 1RAXA 2M1MA 2O6VA 4GMXB 5DI9B 4DHJD 2GCJA 2RR9A 3JSVB 2ABDA 2DFKA 2MKRA 2BYEA 1XT9B 2K8CA 4IFSA 2L0FA 3QWZB 4BBKA 2ZPYA 2K6QA 2PJHA 2K39A 3PV1A 3Q3FA 2Z59B 2OTXA 3VFKA 3VUYA 4ZDVA 5C1ZA 4AWJA 2KFKA 4DWFA 3LJUX
chains in the Genus database with same CATH superfamily
3KYDD 1NVID 4YSZB 2JWUA 1VBHA 4EJNA 2KT7A 4HAYB 1YIWA 4KV2A 4F7ZA 4W9CA 2KYWA 3NOBA 2WXFA 1MKEA 3DCGA 5DPTA 3K9PB 2IJ0A 3PT2B 2HTME 3EC8A 2GBNA 1YN5A 5JHBA 2BTEA 3QAQA 2D11A 4WAAA 2MJ3A 3I5JC 3KWVA 2N9LA 2YS3A 3PG7A 1RRPB 1NEKB 3RT3B 1QOFA 2C7NB 2KVZA 3W5UB 2ELAA 1V8CA 4TQ0A 1EUVB 1MK7B 3Q8AA 3AEFB 3PSEB 2NCNA 4ZRIA 2UYZB 4KSLC 2N9KA 4HAXB 3NS1A 1P6SA 2KC2A 4M0WA 4XGAB 4XZ4A 2JP2A 2N1VA 3O96A 5LG4B 3MP9A 4H8SA 4HPMB 2KFKB 2NPTA 3SEBA 3SHQA 3WA0A 3AE4B 3N20C 3M62B 4DDID 1DIKA 2KWVB 2GS0A 2V3SA 1NTYA 1DBHA 1LXDA 3T8MA 3ODWA 3N1YC 4WWOA 4HAZB 4W9JA 2QILA 1PGBA 2PPHA 4ARCA 1GJZA 1AWEA 3C19A 1OTRB 2KKCA 3NRZA 4JKEA 2MBBB 4L1BA 4JK7A 3JVZX 1R4MB 3O65B 3D8FA 4KGSA 5IAAC 2IZVB 2M0AA 3PPAA 3SV1A 2ZKMX 2UU7A 4FADA 4BKGA 4DK5A 1G6JA 1UNSA 3A58A 1TZ1A 3AE5B 4JKAA 4IDIA 3M1IB 1C4AA 1MHHE 1U5FA 3OAWA 2JRHA 3R2TA 2K5PA 2FCNA 3OJ3A 3PZ7A 3L17A 2D07B 3OLMD 1P1AA 3UIOB 2BS3B 1XF5L 2AQ3B 1I2HA 2V9HA 5JHAA 1KTKA 4KAXB 2XN9C 5IJMA 2KUPA 1YQ3B 3FILB 3IAS1 1AARA 1E10A 2ZNVB 2V76A 4II2B 2CR5A 3NVZA 5CHWA 4GB9A 2COFA 1IPGA 2EJ8A 2FJUB 1V9JA 2WDQB 2JX5A 4G11A 5BMIA 5D3VA 1ZGUB 2LUEA 2YF0A 1PGAA 2D2QA 1WGRA 4HPLB 2MX2A 2LYDA 1WJUA 2FE8A 1MIXA 2CAYA 3B1LX 3QC8B 1P3QU 1J19A 3VIAA 3RNAC 1XLNA 3IG3A 3Q3NC 4LCDE 4P1CC 4F7GA 3AEBB 2OEDA 3PLVA 2M8SA 1EVHA 1YQ4B 3LJ3A 1WG7A 2M17A 3BINA 2H89B 3HRDD 1ZC4B 2YRYA 1AN8A 1C4PA 2J0JA 2FUG1 3AB5A 3B2GA 4GIVA 3L4PA 1FIQA 1TYGB 5D3WA 2L0TA 1S1QB 3PRPB 1VLBA 1A70A 2N4FA 3E9SA 4REZA 4QJ3B 4JWSC 4OVUA 1NENB 5TSSA 1JDEA 4HB3B 2G4SA 3U7ZA 2DYBA 1I4QA 3KZ1A 1WM3A 2QKMA 5AEKB 1OEYJ 5BMHA 5D2MB 3DVNU 1AQCA 4ZHPA 2ROVA 3DWMA 3NZSA 4A5KA 1UD7A 2BPSA 3D32A 4JPSA 3PHXB 5AZFA 4LNFA 4GNKB 2KQ4X 3W1SA 4C4VB 3NWFA 5AZGA 4AOFA 2RDHA 2HJ8A 4JKCA 1V1PA 1D4BA 3ULCA 1OQQA 3WYFB 2XK5A 3VHTC 2BKRB 1WE6A 1FMAD 1L6UA 3CF6E 4IM3A 2GBJA 4YSXB 2PE6B 4JX1C 3KYCD 2JWZA 1ISNA 2KN4A 4LDTD 4JKGA 3P63A 4EEWA 1M7EA 1WJMA 1H10A 2IYDB 2R82A 5HHDG 1MPHA 3FP5A 3Q8EA 4DIXA 3SNHA 3UQAA 4GXBA 4GZUA 2L32A 2AL3A 1BUIC 5GMVA 2YT2A 1L7YA 1OGWA 1R4MI 1Z5SB 4MSQB 3TO1A 2FIDA 2KIEA 2M14A 2V4IB 5C5BB 2K9XA 1SE9A 3NHEB 3SYXA 1MG8A 1E90A 4EZJA 2O2VB 2J0MA 2BBCA 1P7EA 2K3UA 1VDVA 1EWYC 2HD5B 4ZRKA 3TIXA 1EO6A 1XEEA 1B1ZA 2AQ2B 4HKQA 3ZO5B 4WJPA 3QBVB 2WNMA 4XE0A 2Y8FA 2O6VB 4A6QA 2FBWB 1Z2MA 1XD4A 2Y8GA 1V97A 3MJ5A 2BKFA 1J7AA 4XDDA 2DYMA 1WXSA 4JE3B 3AE6B 2WXPA 2RPQA 2NMQA 2PE9A 3IAM1 2PW9A 4M01A 1OQRA 3MTNB 4FA6A 2DAJA 1Z87A 4K7SA 2L8JA 2DX5B 3PREA 3A1QA 4TUUA 3TEYA 2LEKA 2YT1A 4MGKE 1H8CA 4MSMB 2ZCBA 1P98A 4P6VF 3WIMA 4KHOA 2IPKD 2QCZA 2IO3B 5LONB 4AQ7A 3AEAB 3QWMA 4AJYB 1OFFA 4F1SA 1FNUA 1WXMA 1JWAD 2J59M 3ML9A 1WRDB 1M4VA 3APDA 3HW2B 4PYUA 2YSZA 4IUMB 4NJ7A 1I4PA 3R8BA 5FR3A 3PSCA 2L1CA 2K8EA 1HE8A 5BYRA 4OZCA 2I1KA 2K2UA 4DBGA 1SHCA 3CSTA 1VZ6A 3B08A 2WXKA 1P5TA 3RUIB 3MC8A 2IY1B 2J4XA 3ZGZA 4QXAB 1LO5D 4KDIC 1QT9A 1UPQA 5LXHA 4IM2A 2MP2A 2Z8LA 3KWLA 5I2MA 2Y5PA 2BCJA 3Q14C 1KI1B 1FCCC 2J7QB 1ESFA 3V3XA 1U2BA 4EFOA 1UUPA 4ITKA 3UIPB 4HXDA 4G3XB 4NZLB 2D9WA 3N7CA 2GUMA 3VTVA 1T3QA 2BGFA 5BO4B 3L08A 1V81A 4AP4C 1KLUD 2QC8A 3MHSD 3LYYA 1P3RA 3ZTDA 3KLSX 1I7HA 1XD3B 2KMAA 4NSWA 3V60A 2B3AA 4K7WA 3RZWC 2OHFA 4JLCA 4BOSC 1N5XA 4URKA 2BS4B 3S2AA 2Z0QA 1D3ZA 2PTLA 1DOYA 1FO4A 2N0YA 1M94A 2VZKD 3RNFC 4GMVA 4PK1A 3H7PB 2IBIB 2VRWB 3GE3C 3ZIMA 2KLGA 3IHPC 5H8YE 2CODA 4YWGG 1XKEA 2NBVA 2VRRB 1FHXA 3ML4A 1WYGA 2GRIA 2GB1A 2G4DB 1PFDA 2INDC 3FVCA 2FNJB 3RNEC 1FOEA 3MFGA 3SU8X 4FJYA 4KKJA 5D94A 2KLCA 1KZGA 1WGYA 3BVZA 1WI1A 1FFVA 3P42A 2WGSA 3H1UA 2O2VA 2C60A 4WSFA 1GG3A 3VUWA 2O6VA 1E0ZA 2ABDA 2BYEA 1XT9B 3QWZB 2KACA 2K6QA 2PJHA 2WDRB 3LXFA 3PV1A 3URYA 2Z59B 1SB3C 2KFKA 2KZRA 4B6WA 2V1YA 2AWTA 2KUQA 1EWCA 1V5MA 3OHMB 4HHVA 3RZFA 2D4QA 1ZW7A 2MWNB 1JWBD 1BTNA 2Z0OA 1TT5B 4FBJB 3J9CA 1SIJA 3QHTA 2D3GA 2KWUB 1RFKA 1WFYA 1ZSQA 1WZ3A 4RGNA 3V05A 2JYTA 3E9PA 2Z0PA 5E6NA 2X8XX 3FEHA 2WXHA 5HE1A 4ANVA 4WQOB 3EPYA 5AZHA 3AECB 2N0SB 1YJIA 3W2DA 1KLGD 3IBEA 1Q10A 2XEWA 3PHWB 4TQ1A 1QILA 5D3XA 2SEBD 2I5CA 3VUXA 2ZVNA 4MACA 5C6RA 2AL6A 4ANWA 2ASQA 2WDVB 4BZAA 3PTFC 2ZPNA 3FSSA 3U2SC 4HB2B 3MC0B 3BY4B 5DH9B 1GB1A 1XLOA 1GB4A 1ZE3D 4X57B 1ACAA 4HJKA 1YX6B 1SEBD 2YLMA 2AX5A 2RLOA 1BTKA 4TSSA 4KIKB 2RGNB 4HCPB 4IOIE 1FRDA 2LULA 3HVDA 4USAA 4RGOS 2JXXA 4IM0A 3BYTB 2EMSA 2E2XA 3PGEA 1FNWA 1X86A 3U52E 1H4RA 3BK2A 4NQLB 3ZJVA 1V5TA 3DHHC 3P4RB 2RGFA 1RWSA 1HTQA 3QK0A 1X11A 1SBBB 4MEMA 3M95A 5E6JA 2MA9B 3D8EA 5FKAC 1GNUA 3RD2A 1R4NB 2W55A 4BKSD 2NPTB 4GDLB 2L00B 2KN5A 3ZW3A 4GU2A 2QHOA 3CMMB 4FHKA 4K1RB 4JKDA 2YT0A 3NZUA 4LDTB 1KH0A 4NAWB 2LOXA 5D3IB 5HFYA 2VH1A 1CJEA 3H7PA 1PFJA 3PVLA 4GOUA 4TV3A 3WAOA 2PIAA 1NDDA 4J6IA 2WDTB 1DYQA 3T3OA 3DXDA 3DCXA 4G50A 1WGHA 3T9LA 1VRAB 1QOAA 5FK9C 2MFQA 1TKYA 5JXVA 1QC6A 1K53A 4FHJA 2CU1A 3PZ8A 1WMHA 5G5HA 3MDBC 5FI0A 3AU4A 2GBMA 1NI3A 4BAXA 1WF9A 1YNTE 1ZKHA 1F2RI 2RNRB 4CHMA 4N59A 4EZLA 1XQQA 5LOPB 1X1MA 3APCA 3AE1B 1YN4A 2EKIA 1UGJA 3BZDB 4I6LB 2QEJC 2NBVB 2WH5A 1GGOA 5EE0A 3DVGX 3DPDA 2WXNA 1WY8A 3F0WA 3ZRCA 1JALA 2AQ1B 2D9ZA 2BYTA 4P1BC 1YJ1A 2MHJA 2N23A 4K2OA 4YTPB 4NNJB 1FXAA 4W9FA 1UNRA 1EAZA 1QF6A 1QOBA 1AYFA 1AWDA 1ACCA 1K50A 3KRXA 2H7EA 3Q8CA 4HDQA 1SIFA 1WMHB 1TXDA 2KDMA 2LKOA 4A8XC 2MH7A 1N63A 2LWPA 4B6HA 1N61A 2NS5A 5EE9A 2DYQA 2DNFA 1E9MA 4BKSA 1U27A 4LNIA 1FFUA 3AMZA 2UZSA 2IGDA 1OEYA 2LVQA 1SXTA 4YT0B 4A6KA 1FD6A 2KDBA 2QSDA 1WIAA 1WJ6A 3UI3A 1MG4A 2Z0DB 4XYCA 4JKBA 5JLJB 3OANA 1UWMA 4P16A 2DHKA 2INNE 2CS4A 1V61A 3GB1A 4WJQA 1X1FA 1ZXIA 1ZDVA 2JF5A 5H92C 1WZ0A 2KFJA 2LGXA 2BVCA 5D6JB 2JQRB 4EE2A 2HE7A 1ZPSA 1WH3A 2K1FA 2EKEC 5E6PA 1UF0A 2V4LA 2MW5A 3R7QA 4H2AA 1NYRA 1CZPA 2IO1B 3SBTA 2CY4A 1L5PA 2NBWB 3AH7A 2W3RA 2CHWA 2D5GA 4WJNA 3RNCC 1ZP0B 5KHQA 2PEAA 4GLSC 4DDGD 3UZTA 3AE2B 1SJHD 1MHXA 4C56C 2WXGA 4DX90 3V5WA 2NMBA 4M8MA 4HB4B 1GOZA 2KDIA 2JVCA 2ZZPB 3DXEA 2YEPF 4GDLA 4C00A 4HVBA 1P9DU 2LGSA 4W9EA 5KCVA 2WS3B 4KHBB 1F52A 4GPTB 2W54A 1MI1A 2RPVA 2NZ8B 1R7SA 4OVVA 1PLSA 3ZNID 3UF8A 2BQQA 2FAZA 1YN3A 2MP2B 3OG5A 5EE1A 5AUKA 3DXCA 4R3DA 1T0YA 2YS1A 1YMHE 4CHKA 5D3YA 3M3JA 2ZNVC 3W1SC 1Y5OA 1I4XA 2K2JA 5JZEB 1MVKA 2WXQA 3VRBB 1K51A 4KVGB 2QJLA 1KF6B 2JPHA 1HBKA 2CJNA 2GBKA 3VTWA 4MM3A 3KVFB 5J3YA 4HCNB 1RJ2A 3TEZA 1I7AA 2HRJA 2O6VD 4A6FB 2JYEA 1UNPA 1MIZB 3KSYA 3ZVRA 5I4DA 2PMVA 5C5BA 5DCNA 4XWXA 3E9LA 1VR9A 2LGYA 2JZ3B 3DBHB 2KJHB 2RMMA 5IA7A 1QQGA 2XQNM 5J3QA 4HAVB 5HI1A 3ML8A 2NR2A 1P0RA 2G9HD 1V1OA 1F2RC 3NWAA 1L4DB 2ELBA 4IKGA 4ANXA 3BWUD 2DIKA 1E8XA 3KUZA 4KGTA 1T0SC 4AS1A 2KJ6A 2BS2B 1E8YA 4P7IA 3Q69A 3RN9C 2K00A 4US8A 4J3OD 1QZEA 4OZBA 3CSFA 2KIGA 4HJGE 4YXDB 2KWCA 3PLUA 4RCOA 1NYQA 1DDMA 2BYFA 4W9HA 1XCTL 4WJ7A 2V0GA 3WAMA 4UDUC 2XK5B 4IW0A 3FAHA 2CJOA 3HHMA 3Q2AC 3TMPB 3ETRA 3ZDMC 5BMGA 3L13A 2KAJA 2IY0B 4FJVB 3I9V1 1ET6A 2Z59A 4L2YA 1FXTB 3DWGC 3NY5A 1VZ8A 4C80A 1J7BA 2Q13A 5CHFA 2K8HA 1YJJA 3ENBA 1TGZB 3ODXA 4PQ0A 4KX6B 3Q3MC 5GOWB 1IBXA 1I4RA 2MWSB 3FC4A 4A3PA 1W1GA 5HE3A 1FNVA 3A1QB 4WH4A 2J53A 1VD2A 4AJWA 4D6WA 4YTNB 2PZ1A 1WGKA 1J7CA 3TSSA 3NWDA 2REXA 3U4EG 4WWPA 5L95C 3BVMA 3NW8A 3RNGC 4KSKC 4KKIA 1DDVA 3AN1A 3D8DA 4A90A 3LDZE 3KH0A 2KNBA 2W2XD 2WXIA 3IFWB 3P4SB 2LVPA 2G35A 2L1AA 1EF5A 3LB8C 2QIEB 2CHZA 1I4GA 1L0VB 3ZNZB 4C7YA 3TFMA 1V49A 1VJKA 4E71A 3AEGB 4CO7A 3FKYA 4WWMA 1V89A 2LXCA 2DBYA 3ONSA 4PT5A 4XX5A 1UNQA 2IGHA 1LB1A 1SSNA 1JRUA 1WR6E 1KLVA 1KZ7A 2KCJA 4WAFA 2RQ1A 3EGRA 5JHGA 1D5XC 1RAXA 5DI9B 2GCJA 3JSVB 2QDFA 4HEA1 2K8CA 4IFSA 4BBKA 2ZPYA 5C1ZA 3VUYA 3I57A 4HAUB 5JVLA 3QCAA 1EM7A 1J0GA 2FCMA 5BYQA 1W1DA 1L2NA 5CLLB 1PYWD 2YEPB 1WJ4A 1E5WA 3GYOA 3U30A 3ZDTA 3ENEA 3SFDB 2KQ7A 2R2QA 4YSYB 2UVMA 3ZNGC 3TEWA 1BMLC 1SJED 4D2KA 2K8BA 4LNOA 3A9JB 4ICVA 1WJ1A 2KOXA 1V1PB 2JSVX 2P0HA 2MBHA 2V3NA 1MAIA 4RFBA 4G0NB 3L10B 4BKTA 4JIOU 4C4VA 2M4NA 4BVUC 4FLHA 3R7RA 4NJCA 3ZJUA 4JGHB 3CIKA 1WGDA 3IT6B 4CQNA 1QLBB 2MSED 1JW9D 5I2SA 2Y3AA 1GUAB 3DBSA 3W5VB 5JHHA 2KD0A 1V5PA 4OT1A 5IRSA 2HTHA 4GDKB 2INCC 4K3CA 2MDXA 3TW1A 2KQSA 4IG7B 2WQYB 1HQRD 2L05A 3VR9B 4C0AA 2LJ5A 3V62A 1X05A 3V61A 1XO3A 1UELA 1A5RA 4IAPA 3AU5A 3AXCA 3KW5B 3AEEB 2LUMA 3BYYB 3N1ZC 3DVNV 1TS3A 1BWNA 2INPE 2C9WB 3X23A 3RI7C 1MI0A 2COPA 4M8NA 4ZYNA 2M56B 5TR5A 2LOZA 3KRWA 1XX0A 1T77A 2K6DB 1ZOYB 2ZW1A 2RDBC 3VAWA 1Q5WB 2IDYA 3HM6X 1C77A 3SR6A 3WANA 2DHJA 4M00A 2KC1A 3DOWA 1IBXB 2ZCCA 4WWNA 3P1MA 2ZW0A 4F7HA 4MGYE 4M02A 3PVWA 5LLIA 4OHJA 4MGIE 2GI9A 2R61A 3GZNI 4DHZB 3A8QA 4KIKA 3FM8C 1KC7A 3GE8C 5IP4D 4HK2A 3MHZA 3WAPA 1YQBA 3B2FA 2MJEA 2CQUA 1U5GA 1F77A 3N30A 2D9YA 4MY6A 1DOXA 3X0WA 1RM6C 2Q5WD 4RM9A 3UQBA 1QQRA 1GC6A 1NI2A 2GBRA 3BVGA 2KO3A 1ST7A 2W2XC 1PMSA 1Y56A 4IC7B 4AUQC 1T5XD 3O13A 1MK9B 2N7EA 2FCQA 3NUHB 1YOVB 1V88A 1OQYA 1B9RA 3T06A 3C0RB 1TJEA 4NJ6A 1TS4A 3DDCB 4Z2MB 1TS5A 2DLBA 4K3BA 4F8CB 2EMTA 1STEA 4Z2NA 5DPWA 1IRSA 1V5UA 1VBGA 4OW0A 3NG0A 1Y19B 4FXCA 2NTSA 3EHVA 1V2YA 1WRIA 2A4ZA 1TS2A 1JMLA 2WYQA 4I6PA 2LHDA 1JROA 1AW7A 3ODOA 4DBBA 2BB5A 3DBLB 1ZDXA 1Q0WB 1XR0B 3DVGY 1WGQA 2MQJA 3ZUNA 1F9JA 4BBNF 5J2RA 4KHBA 2OJRA 2COCA 3C8YA 4ASWC 4WIPA 4MJSB 3T3NA 2BYVE 1U4AA 1QOGA 3WCQA 4PS8A 1XCGA 4K2PA 3QX1A 2L2IA 1TZOA 4FJZA 4GDKA 2RSGA 3L0WB 2XNAC 1WI0A 4B9KA 3PP2A 3VFKA 4ILHA 3AE8B 2SAKA 2DLWA 4N6EB 1FHOA 2A5UA 4IWQA 2DKQA 4MT7A 1HXYD 1N60A 4W9GA 4DX8A 2Z13A 1FCLA 2GCLA 5M4YB 3I3TB 4ZRQA 2N9PC 5FI1A 2CB8A 1E6EB 3VH3B 4HDOA 2ZEQA 1IP9A 2RDGA 4JK8A 3ZRFA 2L76A 4RF1A 4IOYX 2CU3A 3DBLI 2DX1A 4FULA 3IXSA 2LRUA 2JZZA 4YONA 4LJPB 2KK8A 2X38A 4LJOB 1PGXA 1UH6A 4QJ4B 4MELA 3RMKC 1J0WA 3H9DA 5BYSA 2K49A 2P0FA 3WALA 2TSSA 2G3QB 2DYNA 4CYEA 4KDLB 1DOIA 2JXTA 2Y5BB 2N9XA 2PLPA 5C23A 1FEHA 2MEKA 1RFAA 1U5DA 2DN6A 1C1YB 3KUCB 5J18A 3BJIA 5JH5C 4IWPA 2WWZA 1Q1OA 4EOYA 1D5ZC 3HIEA 3H8HA 5DPSA 1N62A 3VQIA 1LQBA 3IT4B 4WURA 1FGZA 5HG2A 3A98B 1NVLA 2EELA 4B0MA 1MJDA 1WR1A 3Q8FA 1ET9A 4YL8A 1YD8U 4MGZE 1FHWA 2YVCA 2ADZA 1P7FA 4QJ5B 3GS2A 3EUB2 4YTMB 3DHGC 1EU3A 4B0EA 4MK0A 4WVFB 2KXJA 2KTRA 2RUKB 1Q67A 2N7JA 3HIZA 5HE2A 2KVRA 2KJRA 3FLVA 3DBRB 1U29A 3ABVB 2K22A 2LHEA 3A4SC 1ZVRA 2CRFA 4OZAA 1U5EA 2D3BA 4DXGA 2HDEA 1KFYB 2DX5A 2D10A 3B77A 4W9KA 3TL5A 4DXAB 2MBOA 3UGBB 2PVOD 3ZLZA 4BOZB 5E6OA 2ON8A 3F5RA 2DAFA 3TBLD 4CSQA 1V80A 3I63C 1FM0D 2RRFA 3SO6A 3V6CB 3ULBA 2YS5A 3OWEB 1V5OA 2LBBA 3HVZA 3SDLC 4XC2A 4EMOA 2L52A 1CMXB 1NBFC 2WX1A 3B9JA 4DHJB 1JWUD 2MBQA 5IKCM 2FCSA 3CIRB 3MPXA 2D9VA 2L7RA 1C78A 3H6NA 4HRSA 2KX0A 1JQ4A 2G1EA 5L83A 2DKPA 3HM3A 2ZVOA 3PRZA 4EKUA 2G45B 2BB6A 5DHFB 1FB8A 1TKGA 2ZJDA 5AUIA 1D6EC 2DYOA 2DHZA 2H7DA 2OQBA 1FXIA 4MJSA 1F0ZA 1SGHA 2J42A 3AM9A 4GSWA 4EUTA 2X18A 4L6EA 1UGMA 2WXLA 2E6XA 1CQVA 4KHAA 4JL9A 2HJ1A 1L0XB 5CHVC 5C79A 2R09A 2W2WA 1C9FA 2L3ZA 5D3DA 2VKIA 2R0DA 4NY0A 1WM2A 2LVOA 3A9JA 1GC7A 1GAQB 4JKHA 3VXWA 2R2YA 3TCAA 3N9YC 5EDSA 1XLPA 4IWOA 5DIFB 1VZ7A 1HZ5A 2BT6A 1BT0A 1D5MC 3CXBB 2JY6A 2FDQA 4E74A 1C76A 3KY9A 2B76B 2BF8B 2EC1A 5LNK1 2BWES 1IGDA 1MPEA 3AE7B 4MM3B 4DHJD 2M1MA 1KBLA 4A55A 2RR9A 3P4QB 4ZDVA 2OTXA 4AWJA 1JWMD 4W9DA 2FJLA 3DQVA 1LM8B 3RCZA 2Z14A 4C7ZA 1LGRA 4LTUA 3ZTCA 4WQMA 2IYBA 3AEDB 2DZJA 2KMCA 2WXOA 3DHIC 5KQ1A 3SFEB 1UBIA 2WP9B 1NTIA 2FJ9A 3HK0A 1ENFA 5EE3A 4HPPA 1WX8A 2NTTA 3PS6A 1NU2A 1M7RA 3TVVA 3VH4B 2R2OA 3ZQ4A 3FILA 2C7HA 4LK0M 3P7ZA 2COAA 3EFCA 2J52A 4LNKA 4HB0B 1FRRA 3VR8B 4GOCA 3A4RA 4A9AA 3VRAB 1WXVA 4HAWB 4PYZA 3RNBC 2JRIB 4ICUA 3GOEA 1I4HA 1PQSA 1WSPA 4NQKE 1FAOA 1HB8A 1HB6A 1C3TA 3ZXRA 2I2YA 2WX0A 5G55A 3VDZA 2PVGC 3E9OA 2WXRA 1WYWB 1WX7A 1F1HA 3P6AA 3DBHI 3RULA 2KTFA 4JWUC 3RFZB 1L0YB 3AJ4A 1ROEA 3NS8A 4DQOC 4JKFA 1GPXA 4W9IA 1SE2A 1UPRA 1DDWA 1NTVA 3AE3B 3N32A 2H88B 3L54A 2JT4B 4F7UP 3SUZA 1JCKB 3QJZA 3HSAA 3H7SA 4B95A 2CY5A 5GXGB 1MFWA 1HZ6A 1ZUD2 1T6BX 5D27A 4EZKA 2LZ6A 4KZCA 5KQ4A 1TBEA 1UZXB 3MC9A 3BIID 3NVVA 2I5FA 2JUOA 3A33B 3ZXVA 3E66A 2M0XA 2NVUI 4W9LA 1WJNA 2E3TA 3U12A 5C3JB 3A9KA 2DWQA 4K81A 1JWSD 2P0DA 5FR6A 4TKNA 2WXJA 3K9OB 4ACFA 1DYNA 4KGRA 4HATB 3IVFA 4S17A 4HKZE 2N9EB 1LW3A 4KZ0A 1CK1A 4A6FA 1V86A 1V6EA 3G9WA 2V3PA 3DBRI 1WXAA 2JZPA 4HLEA 4N9F4 2AEHA 3Q8BA 4HROA 2KMMA 2VSZA 2CHXA 4OVZA 4L1RA 1K5DB 1WE7A 4E3CA 4DXFA 1XCQL 2FUHB 3W9CB 3APFA 2GJYA 4HWIB 2DZKA 3TEXA 1K5GB 4II3B 3AV8A 1ZXHA 2BW2A 2W3SA 2UZRA 3ZVVA 4QAYA 4Y94A 5HE0A 4ZYSA 3VTUA 2ROZB 1N6ZA 4NAWA 2NBUA 1KRHA 1OMWA 1HTOA 3Q3OC 1UEFA 4XDCA 5J17A 1RRBA 4WJOA 3EECA 2MCNB 4O1NA 3JYUA 2ACZB 1IYFA 3R66C 1E8WA 1L6VA 4RGMA 4XWTA 1ZM0A 1FGYA 3RYTA 1TQZA 1PDXA 3PRMB 2LGIA 2LXAA 1L4ZB 3HQCA 4PS3A 1J8CA 2KDFB 1T0RC 1LFDA 2KX3A 1TIFA 2D3CA 3V6EB 1KOTA 1XODA 3Q6BA 4RNAA 1SE3A 3BK1A 4XWWA 4BFRA 1S3SG 2P8VA 3QIJA 2LI5A 3NVWA 2Z0EB 1E7UA 4US9A 4MH8A 2KR0A 2Y5CA 2MRPA 4D0NB 2M19A 3U8ZA 3KQ4A 3NJTA 4TMAB 1N3HA 2GLSA 3EA6A 3PO0A 5J3TA 1BAKA 4I6NB 2KGXB 4ARIA 3OJ4B 2N1WA 1RLFA 3TJPA 1IGCA 1ZC3B 2LJIA 2Z4DA 1WVHA 4GN1A 2LASA 4ILJA 2L83A 5CX3A 2UWQA 1KJTA 4NPNA 1R4NI 5T8IA 1TKEA 1WGUA 1C79A 2Y7BA 2MLBA 4RM8A 1E8ZA 2KTRB 2BWFA 3MJWA 4MT5A 2KHWB 2WXMA 5KHOA 4A20A 3NZ3A 2D9XA 4DHZE 3P4PB 3JW0X 1RYJA 4CHJA 1BXTA 3JSVA 1PUTA 4A3OA 5JP4A 3GP7A 3P2BA 2D3AA 3ECIA 1N5WA 2OOBB 2QMTA 1IUEA 3ZYYX 1YX5B 2C5LC 3VOQA 2GMIC 5G5GA 3CWIA 3KUDB 3EFUA 1WX9A 3W1YA 3SD5A 2I38A 4ZRJA 1B55A 3ZKJC 5G2NA 2M38A 1I35A 1EF1A 2LG1A 4N58A 4PNKA 1T0QC 3SBGA 2LD9A 1TY0A 1DROA 5C16A 4OSNA 2LFIA 3QQ8B 5IO9A 4RMAA 1SF0A 1XXGA 2W82A 3VVWB 1K52A 1HA5A 5LXIB 1WWTA 3PVUA 4S0RA 3PEGA 1ZYIA 1WXQA 4FN2A 1HEZE 5DHAB 1UBQA 4GGQA 3R2IA 2WLBA 4ILGB 2VH2A 3M63B 4ANUA 1XLQA 3AE9B 4M0WB 3GZNB 1X1GA 2DZIA 2WHIA 1VCBA 2ICIA 2LRWA 4L23A 3L16A 4PS7A 1WGGA 5EFXA 3N1XC 1OY2A 2HTHB 4ZHOA 2K25A 2QKLA 5C2TB 4ZOHC 2K0PA 1EGXA 4LNNA 4ZRPA 2IO2B 2IGGA 2KDEB 2KANA 5D7GA 1TTNA 3RPFC 2CKHB 5CLQB 1I42A 2DHIA 2FIFA 2PKOA 4RGTA 2JU6X 3ALBA 4JKGB 3UINB 5IOIA 2LMCA 3A9KB 4K7UA 3NVYA 3ZNHB 4JQWC 4JK9A 2WU5B 1OQNA 3GYPA 1E7PB 2VZKB 2DENB 1KM7A 5MPOA 2DA0A 2IO0B 1JRPA 5CTRC 2AYOB 3AI5A 2RD0A 2RSUA 2WU2B 3ZJTA 4MH0E 2IFSA 2DZMA 2C7MB 4A6HA 3A8PA 4LLGM 4RF0A 3E56A 4RH6A 1C4CA 3B0AA 1TJ6A 1QKZA 4HSIA 2MJDA 2ONQA 1W1HA 2LGDA 2W9NA 2N7DA 3TUOA 4TYZA 2MBEA 3AULA 3N3KB 3RCPA 3Q3JA 4K17A 5IN7A 5HKHA 4NAMA 4MDKE 2OJWA 3PZDA 2RVBB 2J0KA 1Y8RC 1K8RB 4BBNC 3QARA 3HUIA 1UWXA 1DGJA 2I1JA 3R3MA 1SE4A 3U7DA 2GOWA 1E7VA 2DTCA 3NSUA 5L81A 2KWDA 3QA8A 1TY2A 2XBBC 2X0SA 5DPRA 1EU4A 4GMXB 2DFKA 2MKRA 2L0FA 1FPYA 2K39A 3Q3FA 4Q2JA 4DWFA 3LJUX
chains in the Genus database with same CATH topology
3KYDD 1VBHA 4EJNA 4HAYB 1YIWA 4KV2A 4F7ZA 4W9CA 3NOBA 1MKEA 3DCGA 5DPTA 3K9PB 3PT2B 3EC8A 2GBNA 5JHBA 3QAQA 2D11A 4WAAA 2YS3A 3PG7A 1RRPB 3RT3B 2C7NB 2ELAA 4TQ0A 1EUVB 1MK7B 3PSEB 2NCNA 4ZRIA 2UYZB 4KSLC 4HAXB 1P6SA 2KC2A 4XZ4A 2JP2A 2N1VA 3O96A 4H8SA 4HPMB 2KFKB 2NPTA 3SHQA 3WA0A 3M62B 4DDID 1DIKA 2KWVB 2GS0A 2V3SA 1NTYA 1DBHA 1LXDA 3T8MA 3ODWA 4WWOA 4HAZB 4W9JA 2PPHA 1GJZA 1AWEA 1OTRB 2KKCA 4JKEA 2MBBB 4JK7A 3JVZX 3O65B 3D8FA 5IAAC 2IZVB 3PPAA 3SV1A 4FADA 4BKGA 4DK5A 1G6JA 1TZ1A 4JKAA 3M1IB 1U5FA 3OAWA 2JRHA 2FCNA 3OJ3A 3L17A 3OLMD 2D07B 1P1AA 3UIOB 5JHAA 1I2HA 4KAXB 5IJMA 2KUPA 1AARA 2ZNVB 2V76A 4II2B 2CR5A 5CHWA 4GB9A 2COFA 1IPGA 2EJ8A 1V9JA 4G11A 5D3VA 1ZGUB 2LUEA 2YF0A 4HPLB 2D2QA 1WGRA 2MX2A 2LYDA 1WJUA 1MIXA 2CAYA 3B1LX 3QC8B 1P3QU 1J19A 3VIAA 3IG3A 4LCDE 4F7GA 3PLVA 2M8SA 1EVHA 3LJ3A 1WG7A 2M17A 3BINA 1ZC4B 2YRYA 2J0JA 4GIVA 5D3WA 2L0TA 1S1QB 3PRPB 2N4FA 4OVUA 1JDEA 4HB3B 2G4SA 2DYBA 3KZ1A 1WM3A 2QKMA 5AEKB 1OEYJ 5D2MB 3DVNU 1AQCA 2ROVA 3NZSA 4A5KA 1UD7A 2BPSA 3D32A 3PHXB 5AZFA 3W1SA 5AZGA 4AOFA 2HJ8A 4JKCA 3ULCA 3WYFB 2XK5A 3VHTC 2BKRB 1WE6A 3CF6E 4IM3A 2GBJA 2PE6B 3KYCD 2JWZA 1ISNA 4LDTD 4JKGA 4EEWA 1M7EA 1WJMA 1H10A 2IYDB 2R82A 1MPHA 3FP5A 3UQAA 3SNHA 4GXBA 4GZUA 2AL3A 5GMVA 1L7YA 1OGWA 1R4MI 1Z5SB 4MSQB 3TO1A 2FIDA 2M14A 5C5BB 1SE9A 3NHEB 3SYXA 1MG8A 1E90A 4EZJA 2O2VB 2J0MA 2HD5B 4ZRKA 3TIXA 1EO6A 3ZO5B 4WJPA 3QBVB 2Y8FA 2O6VB 1Z2MA 1XD4A 2Y8GA 2BKFA 2DYMA 1WXSA 2RPQA 2PE9A 3MTNB 4FA6A 2DAJA 1Z87A 4K7SA 2L8JA 2DX5B 3PREA 3A1QA 4TUUA 2YT1A 4MGKE 1H8CA 4MSMB 2ZCBA 1P98A 3WIMA 4KHOA 2IO3B 5LONB 3QWMA 4AJYB 4F1SA 1WXMA 2J59M 3ML9A 1WRDB 3APDA 3HW2B 4PYUA 2YSZA 4IUMB 4NJ7A 3PSCA 2L1CA 1HE8A 2I1KA 2K2UA 4DBGA 1SHCA 3CSTA 3B08A 1P5TA 3RUIB 2IY1B 4KDIC 1UPQA 5LXHA 4IM2A 2MP2A 2BCJA 1KI1B 2J7QB 1U2BA 4EFOA 3UIPB 4HXDA 4G3XB 2D9WA 3N7CA 3VTVA 2BGFA 5BO4B 3L08A 1V81A 4AP4C 3MHSD 1P3RA 3ZTDA 1XD3B 2KMAA 4NSWA 3V60A 2B3AA 4K7WA 3RZWC 4JLCA 4BOSC 4URKA 3S2AA 2Z0QA 1D3ZA 2N0YA 1M94A 4GMVA 3H7PB 2IBIB 2VRWB 3ZIMA 2KLGA 3IHPC 2CODA 1XKEA 2VRRB 1FHXA 3ML4A 2G4DB 2FNJB 1FOEA 3SU8X 4FJYA 5D94A 2KLCA 1KZGA 1WGYA 1WI1A 3H1UA 2O2VA 2C60A 4WSFA 1GG3A 3VUWA 2O6VA 2ABDA 2BYEA 1XT9B 3QWZB 2K6QA 2PJHA 3PV1A 2Z59B 2KFKA 2KZRA 4B6WA 2V1YA 2AWTA 1V5MA 4HHVA 3RZFA 2D4QA 1ZW7A 2MWNB 1BTNA 2Z0OA 4FBJB 3QHTA 2D3GA 2KWUB 1WFYA 1ZSQA 1WZ3A 3E9PA 2Z0PA 5E6NA 3FEHA 5HE1A 4ANVA 4WQOB 3EPYA 5AZHA 3IBEA 2XEWA 3PHWB 4TQ1A 5D3XA 2I5CA 3VUXA 2ZVNA 5C6RA 2AL6A 4ANWA 2ASQA 3PTFC 2ZPNA 3FSSA 4HB2B 3BY4B 5DH9B 4X57B 1ACAA 4HJKA 1YX6B 2YLMA 2RLOA 1BTKA 4KIKB 2RGNB 4HCPB 2LULA 2JXXA 4IM0A 2EMSA 2E2XA 3PGEA 1X86A 1H4RA 4NQLB 1V5TA 2RGFA 3QK0A 1X11A 4MEMA 3M95A 2MA9B 3D8EA 1GNUA 3RD2A 4BKSD 2NPTB 4GDLB 2L00B 2KN5A 3ZW3A 4GU2A 2QHOA 3CMMB 4FHKA 4K1RB 4JKDA 2YT0A 3NZUA 4LDTB 4NAWB 2LOXA 3H7PA 1PFJA 3PVLA 4TV3A 3WAOA 1NDDA 4J6IA 2WDTB 3DXDA 4G50A 1WGHA 3T9LA 2MFQA 1QC6A 4FHJA 2CU1A 1WMHA 3MDBC 5FI0A 3AU4A 2GBMA 1WF9A 1ZKHA 2RNRB 4CHMA 4EZLA 1XQQA 5LOPB 1X1MA 3APCA 4I6LB 2WH5A 2NBVB 1GGOA 3DVGX 3DPDA 1WY8A 3F0WA 3ZRCA 2D9ZA 1YJ1A 2N23A 4K2OA 4NNJB 4W9FA 1UNRA 1EAZA 3KRXA 2H7EA 4HDQA 1SIFA 1WMHB 1TXDA 2LKOA 2LWPA 4B6HA 2NS5A 2DYQA 4BKSA 1U27A 2UZSA 1OEYA 2LVQA 4A6KA 2KDBA 1WIAA 1WJ6A 2Z0DB 4JKBA 5JLJB 3OANA 2DHKA 2CS4A 1V61A 4WJQA 1X1FA 2JF5A 1WZ0A 2KFJA 2LGXA 5D6JB 2HE7A 1WH3A 2K1FA 2EKEC 5E6PA 2V4LA 2MW5A 3R7QA 2IO1B 3SBTA 2CY4A 2NBWB 2CHWA 4WJNA 5KHQA 2PEAA 4DDGD 3UZTA 4DX90 3V5WA 2NMBA 4M8MA 4HB4B 2KDIA 2JVCA 2ZZPB 3DXEA 4GDLA 4HVBA 1P9DU 4W9EA 5KCVA 4KHBB 4GPTB 2NZ8B 4OVVA 1PLSA 3ZNID 3UF8A 2MP2B 2FAZA 3DXCA 1T0YA 2YS1A 4CHKA 5D3YA 3M3JA 2ZNVC 3W1SC 1Y5OA 2K2JA 5JZEB 4KVGB 2JPHA 1HBKA 2GBKA 3VTWA 4MM3A 3KVFB 5J3YA 4HCNB 1RJ2A 1I7AA 2HRJA 2O6VD 4A6FB 1UNPA 1MIZB 3KSYA 3ZVRA 5C5BA 5DCNA 4XWXA 3E9LA 2LGYA 2JZ3B 2KJHB 5IA7A 1QQGA 2XQNM 5J3QA 4HAVB 3ML8A 2NR2A 1P0RA 2ELBA 4ANXA 2DIKA 1E8XA 3KUZA 2KJ6A 1E8YA 4P7IA 2K00A 1QZEA 3CSFA 2KWCA 3PLUA 1DDMA 2BYFA 4W9HA 4WJ7A 3WAMA 2XK5B 4IW0A 3HHMA 3TMPB 3ZDMC 3L13A 2IY0B 4FJVB 1FXTB 3NY5A 2Q13A 5CHFA 2K8HA 3ENBA 1TGZB 3ODXA 4PQ0A 5GOWB 2MWSB 4A3PA 1W1GA 5HE3A 3A1QB 4AJWA 1VD2A 2PZ1A 2REXA 4WWPA 5L95C 4KSKC 1DDVA 3D8DA 3LDZE 3KH0A 2KNBA 2W2XD 3IFWB 2LVPA 2G35A 1EF5A 2CHZA 3ZNZB 3TFMA 1V49A 4E71A 4CO7A 1V89A 2LXCA 3ONSA 4XX5A 1UNQA 1LB1A 1WR6E 1JRUA 1KLVA 1KZ7A 2KCJA 2RQ1A 5JHGA 1RAXA 5DI9B 2GCJA 3JSVB 2K8CA 4IFSA 4BBKA 2ZPYA 5C1ZA 3VUYA 4HAUB 5JVLA 3QCAA 1J0GA 2FCMA 1W1DA 1L2NA 5CLLB 1WJ4A 1E5WA 3GYOA 3U30A 3ZDTA 3ENEA 2KQ7A 2R2QA 2UVMA 3ZNGC 2K8BA 3A9JB 4ICVA 1WJ1A 2KOXA 2P0HA 2MBHA 1MAIA 4G0NB 3L10B 4BKTA 4JIOU 2M4NA 4BVUC 4FLHA 3R7RA 4JGHB 3CIKA 1WGDA 2MSED 1GUAB 3DBSA 5JHHA 2KD0A 1V5PA 2HTHA 4GDKB 2MDXA 3TW1A 2KQSA 4IG7B 2L05A 4C0AA 2LJ5A 3V62A 1X05A 3V61A 1UELA 1A5RA 4IAPA 3AU5A 3AXCA 3KW5B 3DVNV 1BWNA 2C9WB 3X23A 2COPA 4M8NA 4ZYNA 5TR5A 2LOZA 3KRWA 1XX0A 2K6DB 3VAWA 1Q5WB 3HM6X 3WANA 2DHJA 2KC1A 3DOWA 2ZCCA 4WWNA 4F7HA 4MGYE 3PVWA 5LLIA 4MGIE 3GZNI 4DHZB 3A8QA 4KIKA 3FM8C 1KC7A 4HK2A 3WAPA 1YQBA 2CQUA 1U5GA 3N30A 2D9YA 4MY6A 3X0WA 4RM9A 3UQBA 1GC6A 1NI2A 2GBRA 2KO3A 1ST7A 2W2XC 1PMSA 4IC7B 4AUQC 1MK9B 2N7EA 2FCQA 1V88A 1OQYA 3T06A 3C0RB 4NJ6A 3DDCB 4Z2MB 4F8CB 2EMTA 4Z2NA 5DPWA 1IRSA 1V5UA 1VBGA 1Y19B 3EHVA 1V2YA 2A4ZA 2WYQA 4I6PA 3ODOA 4DBBA 1Q0WB 1XR0B 3DVGY 1WGQA 2MQJA 3ZUNA 1F9JA 4BBNF 5J2RA 2OJRA 2COCA 4ASWC 4MJSB 2BYVE 1U4AA 4PS8A 1XCGA 4K2PA 3QX1A 2L2IA 4FJZA 4GDKA 2RSGA 3L0WB 1WI0A 4B9KA 3PP2A 3VFKA 4ILHA 2DLWA 1FHOA 2A5UA 4IWQA 2DKQA 4MT7A 4W9GA 4DX8A 2GCLA 3I3TB 2N9PC 5FI1A 2CB8A 3VH3B 4HDOA 2ZEQA 1IP9A 4JK8A 3ZRFA 2L76A 4IOYX 3DBLI 2DX1A 4FULA 2LRUA 2JZZA 4YONA 4LJPB 2KK8A 4LJOB 1UH6A 4MELA 1J0WA 3H9DA 2P0FA 3WALA 2G3QB 2DYNA 4CYEA 4KDLB 2Y5BB 2N9XA 5C23A 1RFAA 1U5DA 2DN6A 1C1YB 3KUCB 5J18A 3BJIA 5JH5C 4IWPA 2WWZA 1Q1OA 4EOYA 5DPSA 3VQIA 1LQBA 1FGZA 3A98B 1NVLA 1WR1A 4YL8A 1YD8U 4MGZE 1FHWA 2YVCA 2ADZA 4MK0A 4WVFB 2KXJA 2KTRA 2RUKB 1Q67A 3HIZA 5HE2A 2KVRA 2KJRA 3FLVA 1U29A 3A4SC 1ZVRA 2CRFA 1U5EA 2DX5A 2D10A 4W9KA 3TL5A 4DXAB 2MBOA 3UGBB 3ZLZA 4BOZB 5E6OA 3F5RA 2DAFA 3TBLD 1V80A 3SO6A 3V6CB 3ULBA 2YS5A 1V5OA 2LBBA 3SDLC 4XC2A 4EMOA 1CMXB 1NBFC 2WX1A 4DHJB 2MBQA 2FCSA 3MPXA 2D9VA 2L7RA 3H6NA 2KX0A 5L83A 2DKPA 3HM3A 2ZVOA 3PRZA 4EKUA 2G45B 5DHFB 1FB8A 2ZJDA 2DYOA 2DHZA 2H7DA 2OQBA 4MJSA 1SGHA 4GSWA 4EUTA 2X18A 4L6EA 1UGMA 4KHAA 4JL9A 5CHVC 5C79A 2R09A 2W2WA 2L3ZA 2VKIA 2R0DA 4NY0A 1WM2A 2LVOA 3A9JA 1GC7A 4JKHA 3VXWA 3TCAA 5EDSA 4IWOA 5DIFB 1BT0A 3CXBB 2JY6A 2FDQA 4E74A 3KY9A 2BF8B 2EC1A 2BWES 4DHJD 2M1MA 1KBLA 2RR9A 4ZDVA 2OTXA 4AWJA 4W9DA 2FJLA 3DQVA 1LM8B 3RCZA 3ZTCA 2IYBA 2DZJA 2KMCA 5KQ1A 1UBIA 1NTIA 2FJ9A 3HK0A 1WX8A 3PS6A 1NU2A 1M7RA 3TVVA 3VH4B 2R2OA 2C7HA 3P7ZA 2COAA 4HB0B 4GOCA 3A4RA 1WXVA 4HAWB 4PYZA 2JRIB 4ICUA 3GOEA 1PQSA 4NQKE 1FAOA 1HB8A 1HB6A 1C3TA 2WX0A 5G55A 3VDZA 3E9OA 1WYWB 1WX7A 3P6AA 3DBHI 3RULA 2KTFA 3AJ4A 3NS8A 4JKFA 4W9IA 1UPRA 1DDWA 1NTVA 3N32A 3L54A 2JT4B 4F7UP 3SUZA 3QJZA 3H7SA 4B95A 2CY5A 5D27A 4EZKA 2LZ6A 4KZCA 5KQ4A 1TBEA 1UZXB 2I5FA 2JUOA 3A33B 3E66A 2M0XA 2NVUI 4W9LA 1WJNA 3A9KA 4K81A 2P0DA 5FR6A 4TKNA 3K9OB 1DYNA 4HATB 3IVFA 2N9EB 1LW3A 4KZ0A 4A6FA 1V86A 1V6EA 3G9WA 3DBRI 1WXAA 4HLEA 4N9F4 2AEHA 2VSZA 2CHXA 1K5DB 1WE7A 4E3CA 2FUHB 3APFA 2GJYA 4HWIB 2DZKA 1K5GB 4II3B 2UZRA 3ZVVA 4Y94A 5HE0A 3VTUA 2ROZB 4NAWA 2NBUA 1OMWA 1UEFA 5J17A 1RRBA 4WJOA 3EECA 2MCNB 3JYUA 1IYFA 3R66C 1E8WA 1ZM0A 1FGYA 3RYTA 1TQZA 3PRMB 2LXAA 3HQCA 4PS3A 1J8CA 2KDFB 1LFDA 2KX3A 3V6EB 1KOTA 1XODA 4BFRA 1S3SG 2P8VA 3QIJA 2LI5A 2Z0EB 1E7UA 2MRPA 4D0NB 3U8ZA 1N3HA 5J3TA 1BAKA 4I6NB 2KGXB 3OJ4B 2N1WA 1RLFA 3TJPA 1ZC3B 4GN1A 1WVHA 2LASA 4ILJA 5CX3A 2UWQA 1KJTA 4NPNA 1R4NI 1WGUA 2Y7BA 2MLBA 4A20A 4RM8A 1E8ZA 2KTRB 2BWFA 3MJWA 2KHWB 5KHOA 2D9XA 4DHZE 3JW0X 4CHJA 3JSVA 4A3OA 5JP4A 3P2BA 3ECIA 2OOBB 1YX5B 2C5LC 3VOQA 2GMIC 3KUDB 3EFUA 1WX9A 3W1YA 3SD5A 4ZRJA 1B55A 3ZKJC 5G2NA 2M38A 1I35A 1EF1A 2LG1A 4PNKA 3SBGA 2LD9A 1DROA 5C16A 3QQ8B 4RMAA 3VVWB 5LXIB 3PVUA 3PEGA 4FN2A 5DHAB 1UBQA 4GGQA 4ILGB 3M63B 4ANUA 4M0WB 1X1GA 2DZIA 1VCBA 2LRWA 3L16A 4PS7A 1WGGA 5EFXA 1OY2A 2HTHB 2K25A 2QKLA 1EGXA 2IO2B 2KDEB 2KANA 5D7GA 1TTNA 2CKHB 5CLQB 1I42A 2DHIA 2FIFA 3ALBA 4JKGB 3UINB 3A9KB 4K7UA 3ZNHB 4JQWC 4JK9A 1OQNA 3GYPA 2DENB 1KM7A 2DA0A 2IO0B 5CTRC 2AYOB 3AI5A 2RD0A 2RSUA 4MH0E 2IFSA 2DZMA 2C7MB 4A6HA 3A8PA 3B0AA 1TJ6A 1W1HA 2LGDA 2W9NA 2N7DA 4TYZA 2MBEA 3AULA 3N3KB 3RCPA 3Q3JA 4K17A 5HKHA 4MDKE 3PZDA 2RVBB 2J0KA 1Y8RC 1K8RB 4BBNC 3QARA 2I1JA 3R3MA 3U7DA 2GOWA 1E7VA 2DTCA 3NSUA 5L81A 3QA8A 2XBBC 2X0SA 5DPRA 4GMXB 2DFKA 2MKRA 2L0FA 2K39A 3Q3FA 4DWFA 3LJUX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLM D;  4HAU B;  3KYD D;  2FJL A;  2KZR A;  2V1Y A;  3DQV A;  3QCA A;  4EJN A;  1LM8 B;  2FCM A;  2AWT A;  4B6W A;  1J0G A;  3RCZ A;  4HAY B;  1V5M A;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  3NOB A;  1MKE A;  3DCG A;  5DPT A;  1W1D A;  3K9P B;  4HHV A;  3RZF A;  1L2N A;  2D4Q A;  3PT2 B;  1ZW7 A;  5CLL B;  3EC8 A;  2MWN B;  2GBN A;  3ZTC A;  2IYB A;  5JHB A;  1BTN A;  1E5W A;  2Z0O A;  1WJ4 A;  2DZJ A;  2D11 A;  2KMC A;  3QAQ A;  4WAA A;  5KQ1 A;  3GYO A;  3U30 A;  3ZDT A;  3ENE A;  1UBI A;  4FBJ B;  2KQ7 A;  2R2Q A;  1NTI A;  2FJ9 A;  2YS3 A;  2UVM A;  3PG7 A;  3HK0 A;  2D3G A;  1RRP B;  2KWU B;  1WFY A;  3ZNG C;  1ZSQ A;  1WZ3 A;  3RT3 B;  1WX8 A;  2C7N B;  2Z0P A;  5E6N A;  3PS6 A;  1NU2 A;  1M7R A;  3TVV A;  3VH4 B;  2R2O A;  3FEH A;  2C7H A;  2ELA A;  2COA A;  3P7Z A;  5HE1 A;  4HB0 B;  4ANV A;  2K8B A;  4WQO B;  3A9J B;  4GOC A;  4TQ0 A;  1EUV B;  3A4R A;  1MK7 B;  4ICV A;  3PSE B;  1WJ1 A;  3EPY A;  2KOX A;  5AZH A;  2NCN A;  4ZRI A;  2P0H A;  2UYZ B;  4KSL C;  2MBH A;  1WXV A;  1MAI A;  4HAX B;  3IBE A;  4HAW B;  2XEW A;  3L10 B;  3PHW B;  2JRI B;  4G0N B;  1P6S A;  4ICU A;  4JIO U;  4PYZ A;  2KC2 A;  5D3X A;  3GOE A;  2M4N A;  4TQ1 A;  2JP2 A;  4FLH A;  4XZ4 A;  2I5C A;  2N1V A;  3R7R A;  2ZVN A;  3VUX A;  3O96 A;  5C6R A;  2AL6 A;  1PQS A;  4ANW A;  4NQK E;  1FAO A;  2ASQ A;  3CIK A;  4H8S A;  1WGD A;  3PTF C;  4HPM B;  2KFK B;  4JGH B;  2NPT A;  3SHQ A;  3WA0 A;  1HB8 A;  2MSE D;  2ZPN A;  3FSS A;  3M62 B;  4DDI D;  1HB6 A;  2KWV B;  1GUA B;  3DBS A;  1C3T A;  2GS0 A;  4HB2 B;  2V3S A;  1NTY A;  5JHH A;  1V5P A;  2KD0 A;  3BY4 B;  5DH9 B;  1DBH A;  2HTH A;  1LXD A;  3T8M A;  3ODW A;  2WX0 A;  4WWO A;  4GDK B;  5G55 A;  4HAZ B;  4W9J A;  4X57 B;  3VDZ A;  2MDX A;  1ACA A;  3TW1 A;  2KQS A;  4HJK A;  1YX6 B;  1WYW B;  2PPH A;  2YLM A;  1WX7 A;  4IG7 B;  1GJZ A;  3P6A A;  1AWE A;  2RLO A;  3DBH I;  1OTR B;  2KTF A;  3N3K B;  2KKC A;  2L05 A;  1BTK A;  3RUL A;  4KIK B;  4C0A A;  2RGN B;  4HCP B;  2MBB B;  2LJ5 A;  3AJ4 A;  3V62 A;  3NS8 A;  2LUL A;  3JVZ X;  4BKT A;  1X05 A;  3O65 B;  2JXX A;  3D8F A;  4IM0 A;  5IAA C;  3V61 A;  2EMS A;  2IZV B;  5TR5 A;  2E2X A;  4W9I A;  3PGE A;  1UEL A;  1UPR A;  1DDW A;  1NTV A;  3PPA A;  3N32 A;  1A5R A;  1X86 A;  3SV1 A;  1H4R A;  3L54 A;  4IAP A;  2JT4 B;  3AU5 A;  3SUZ A;  4F7U P;  3AXC A;  3QJZ A;  4NQL B;  3KW5 B;  4BKG A;  4DK5 A;  4FAD A;  1G6J A;  3H7S A;  1V5T A;  4B95 A;  1TZ1 A;  3DVN V;  2CY5 A;  2RGF A;  1BWN A;  3M1I B;  3QK0 A;  2C9W B;  3X23 A;  1X11 A;  1U5F A;  3OAW A;  2JRH A;  4A20 A;  5D27 A;  4MEM A;  2FCN A;  2COP A;  3M95 A;  3OJ3 A;  4EZK A;  4M8N A;  2LZ6 A;  4ZYN A;  2MA9 B;  3L17 A;  4KZC A;  3D8E A;  2LOZ A;  3KRW A;  5KQ4 A;  1P1A A;  1XX0 A;  1TBE A;  1UZX B;  2D07 B;  1GNU A;  3RD2 A;  3UIO B;  2K6D B;  4BKS D;  2NPT B;  2I5F A;  4GDL B;  1I2H A;  2JUO A;  3A33 B;  2L00 B;  2M0X A;  5JHA A;  2KN5 A;  3ZW3 A;  4KAX B;  4GU2 A;  2NVU I;  4W9L A;  1WJN A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  3VAW A;  5IJM A;  1Q5W B;  2YT0 A;  3NZU A;  2KUP A;  4LDT B;  4NAW B;  3HM6 X;  2LOX A;  3WAN A;  2DHJ A;  3A9K A;  1AAR A;  2KC1 A;  3DOW A;  4K81 A;  2ZNV B;  2V76 A;  2ZCC A;  3H7P A;  4II2 B;  1PFJ A;  4WWN A;  3PVL A;  2CR5 A;  4TV3 A;  5CHW A;  2P0D A;  5FR6 A;  3WAO A;  4TKN A;  4GB9 A;  4F7H A;  2COF A;  3K9O B;  1NDD A;  4MGY E;  4J6I A;  1IPG A;  2WDT B;  2EJ8 A;  3PVW A;  1DYN A;  3DXD A;  4G50 A;  4HAT B;  3IVF A;  1V9J A;  1WGH A;  4G11 A;  4MGI E;  5LLI A;  2N9E B;  3T9L A;  5D3V A;  1ZGU B;  3GZN I;  1LW3 A;  4KZ0 A;  4DHZ B;  3A8Q A;  4KIK A;  2LUE A;  2YF0 A;  3FM8 C;  2D2Q A;  4A6F A;  1WGR A;  2MFQ A;  4HPL B;  1V86 A;  2MX2 A;  2LYD A;  1V6E A;  1WJU A;  1QC6 A;  1MIX A;  3G9W A;  1YQB A;  1WXA A;  3DBR I;  2CQU A;  2CAY A;  3B1L X;  3QC8 B;  2CU1 A;  1U5G A;  4HLE A;  1P3Q U;  1WMH A;  4N9F 4;  3MDB C;  1J19 A;  2AEH A;  3AU4 A;  2D9Y A;  5FI0 A;  3VIA A;  2GBM A;  4MY6 A;  3N30 A;  1WF9 A;  3IG3 A;  1ZKH A;  2RNR B;  4CHM A;  2VSZ A;  4LCD E;  2CHX A;  4EZL A;  4F7G A;  1XQQ A;  5LOP B;  3X0W A;  1X1M A;  1K5D B;  1WE7 A;  4RM9 A;  4E3C A;  3APC A;  2FUH B;  3UQB A;  3PLV A;  1GC6 A;  1NI2 A;  2GJY A;  2M8S A;  3APF A;  2DZK A;  4HWI B;  1EVH A;  1K5G B;  2GBR A;  4I6L B;  3LJ3 A;  4II3 B;  2WH5 A;  1WG7 A;  2KO3 A;  3BIN A;  2M17 A;  1ST7 A;  2W2X C;  2NBV B;  4W9D A;  3DVG X;  3DPD A;  1PMS A;  2UZR A;  3ZVV A;  1WY8 A;  1ZC4 B;  3F0W A;  2YRY A;  3ZRC A;  2J0J A;  4Y94 A;  5HE0 A;  4GIV A;  4IC7 B;  3VTU A;  2ROZ B;  2D9Z A;  4AUQ C;  4NAW A;  1YJ1 A;  2NBU A;  5D3W A;  2N23 A;  2L0T A;  1MK9 B;  4K2O A;  2FCQ A;  1OMW A;  2N7E A;  4NNJ B;  1S1Q B;  3PRP B;  1V88 A;  1OQY A;  4W9F A;  3T06 A;  3C0R B;  2N4F A;  4NJ6 A;  1UNR A;  1EAZ A;  1UEF A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  3KRX A;  3DDC B;  2H7E A;  4Z2M B;  4HDQ A;  3JYU A;  2MCN B;  1SIF A;  1WMH B;  4F8C B;  4OVU A;  2EMT A;  4Z2N A;  1TXD A;  5DPW A;  1IRS A;  1V5U A;  2LKO A;  4HB3 B;  1IYF A;  2G4S A;  3R66 C;  1E8W A;  2DYB A;  1ZM0 A;  2LWP A;  4B6H A;  1FGY A;  1Y19 B;  3RYT A;  2NS5 A;  1TQZ A;  3KZ1 A;  3EHV A;  1V2Y A;  1WM3 A;  3PRM B;  2A4Z A;  2DYQ A;  2QKM A;  2LXA A;  2WYQ A;  1OEY J;  3HQC A;  4I6P A;  5D2M B;  5AEK B;  3DVN U;  1AQC A;  4BKS A;  4PS3 A;  2ROV A;  1J8C A;  2KDF B;  3NZS A;  1LFD A;  1U27 A;  4A5K A;  2KX3 A;  1UD7 A;  2BPS A;  2UZS A;  3ODO A;  3D32 A;  1OEY A;  2LVQ A;  3V6E B;  3PHX B;  5AZF A;  4DBB A;  1KOT A;  1XOD A;  4A6K A;  3W1S A;  2KDB A;  1Q0W B;  4BFR A;  1XR0 B;  3DVG Y;  1WIA A;  5AZG A;  1WGQ A;  4AOF A;  1S3S G;  2P8V A;  3QIJ A;  2LI5 A;  2HJ8 A;  2MQJ A;  1WJ6 A;  2Z0E B;  3ULC A;  3ZUN A;  1F9J A;  4BBN F;  1E7U A;  3WYF B;  2Z0D B;  2OJR A;  2COC A;  4ASW C;  5J2R A;  2XK5 A;  3VHT C;  5JLJ B;  2MRP A;  4MJS B;  4D0N B;  2BKR B;  2BYV E;  1U4A A;  1WE6 A;  3OAN A;  3U8Z A;  3CF6 E;  2DHK A;  4IM3 A;  2CS4 A;  1N3H A;  1V61 A;  2GBJ A;  2PE6 B;  4PS8 A;  4WJQ A;  1X1F A;  1XCG A;  3KYC D;  4K2P A;  3QX1 A;  2L2I A;  4FJZ A;  2JWZ A;  1ISN A;  5J3T A;  1BAK A;  4GDK A;  4LDT D;  2RSG A;  2JF5 A;  3L0W B;  1WI0 A;  4I6N B;  4B9K A;  2KGX B;  1M7E A;  3PP2 A;  1WZ0 A;  1WJM A;  2N1W A;  1H10 A;  1RLF A;  3OJ4 B;  2IYD B;  2KFJ A;  2LGX A;  1ZC3 B;  5D6J B;  3TJP A;  2DLW A;  1MPH A;  3FP5 A;  4GN1 A;  1WVH A;  1FHO A;  2A5U A;  3SNH A;  4IWQ A;  2LAS A;  2HE7 A;  2DKQ A;  5CX3 A;  3UQA A;  4MT7 A;  4GXB A;  2UWQ A;  4GZU A;  1KJT A;  4W9G A;  4DX8 A;  4NPN A;  2AL3 A;  2GCL A;  1WH3 A;  2K1F A;  1R4N I;  2EKE C;  5FI1 A;  2CB8 A;  2N9P C;  3I3T B;  5E6P A;  5GMV A;  1WGU A;  2V4L A;  3VH3 B;  2MW5 A;  3R7Q A;  1L7Y A;  4HDO A;  2Y7B A;  1OGW A;  2ZEQ A;  1R4M I;  1Z5S B;  2MLB A;  1IP9 A;  3ZRF A;  2IO1 B;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  2CY4 A;  2L76 A;  3TO1 A;  2FID A;  2KHW B;  3MJW A;  4MSQ B;  5KHO A;  2NBW B;  2D9X A;  2M14 A;  4IOY X;  4DHZ E;  5C5B B;  3DBL I;  2CHW A;  3JW0 X;  2DX1 A;  1SE9 A;  4FUL A;  4CHJ A;  3NHE B;  4WJN A;  2LRU A;  2JZZ A;  3JSV A;  4YON A;  3SYX A;  4LJP B;  2KK8 A;  1MG8 A;  5KHQ A;  4LJO B;  1UH6 A;  2PEA A;  1E90 A;  4DDG D;  4A3O A;  3UZT A;  2O2V B;  4MEL A;  4EZJ A;  2J0M A;  1J0W A;  4DX9 0;  3H9D A;  3V5W A;  2NMB A;  4M8M A;  5JP4 A;  2P0F A;  3WAL A;  4HB4 B;  2HD5 B;  2G3Q B;  2KDI A;  2DYN A;  2JVC A;  2ZZP B;  4CYE A;  3DXE A;  4ZRK A;  3P2B A;  4GDL A;  1EO6 A;  3ECI A;  2OOB B;  4KDL B;  3TIX A;  4HVB A;  1P9D U;  2N9X A;  2Y5B B;  4W9E A;  5KCV A;  4KHB B;  4GPT B;  5C23 A;  1YX5 B;  2C5L C;  3VOQ A;  2NZ8 B;  2GMI C;  3ZO5 B;  1RFA A;  4WJP A;  3QBV B;  4OVV A;  1PLS A;  1U5D A;  2DN6 A;  1C1Y B;  3ZNI D;  3KUC B;  2Y8F A;  2O6V B;  3KUD B;  3UF8 A;  5J18 A;  2MP2 B;  3BJI A;  2FAZ A;  3EFU A;  3W1Y A;  5JH5 C;  3DXC A;  1WX9 A;  1Z2M A;  1XD4 A;  1T0Y A;  2Y8G A;  4IWP A;  3SD5 A;  2YS1 A;  3V60 A;  2WWZ A;  1Q1O A;  4EOY A;  4ZRJ A;  1B55 A;  4CHK A;  3ZKJ C;  2BKF A;  5D3Y A;  3M3J A;  2DYM A;  1WXS A;  2ZNV C;  2M38 A;  3QHT A;  5G2N A;  1I35 A;  3W1S C;  1Y5O A;  2RPQ A;  1EF1 A;  2LG1 A;  5DPS A;  3VQI A;  1LQB A;  2K2J A;  4PNK A;  1FGZ A;  2PE9 A;  5JZE B;  2LD9 A;  3A98 B;  4KVG B;  3MTN B;  4FA6 A;  1NVL A;  2DAJ A;  1Z87 A;  2JPH A;  1HBK A;  2GBK A;  2L8J A;  4K7S A;  2DX5 B;  3VTW A;  1DRO A;  1WR1 A;  4MM3 A;  5C16 A;  3PRE A;  3KVF B;  5J3Y A;  4YL8 A;  1YD8 U;  3QQ8 B;  4HCN B;  1FHW A;  4MGZ E;  2YVC A;  3A1Q A;  1RJ2 A;  4RMA A;  2ADZ A;  4FHJ A;  2YT1 A;  4TUU A;  4MGK E;  3VVW B;  1H8C A;  4MSM B;  1I7A A;  2ZCB A;  2HRJ A;  1P98 A;  2O6V D;  4A6F B;  5LXI B;  3PVU A;  1UNP A;  1MIZ B;  3PEG A;  4FN2 A;  3WIM A;  3KSY A;  4KHO A;  5DHA B;  3ZVR A;  4BVU C;  5C5B A;  5DCN A;  2IO3 B;  4XWX A;  5LON B;  1UBQ A;  3WAP A;  3QWM A;  4AJY B;  4MK0 A;  4WVF B;  4F1S A;  4GGQ A;  2LGY A;  2JZ3 B;  1WXM A;  2KTR A;  2J59 M;  2KJH B;  2KXJ A;  2RUK B;  3M63 B;  3ML9 A;  1Q67 A;  3HIZ A;  4ANU A;  1WRD B;  3APD A;  5HE2 A;  5IA7 A;  3HW2 B;  2KVR A;  1QQG A;  3FLV A;  2YSZ A;  2KJR A;  1U29 A;  2XQN M;  5J3Q A;  4PYU A;  4HAV B;  4IUM B;  3A4S C;  4NJ7 A;  1ZVR A;  3ML8 A;  2NR2 A;  4M0W B;  2CRF A;  3PSC A;  1P0R A;  2L1C A;  1HE8 A;  1U5E A;  1X1G A;  2DZI A;  1VCB A;  2ELB A;  2LRW A;  4ANX A;  2I1K A;  2K2U A;  2DX5 A;  3L16 A;  2D10 A;  4PS7 A;  4DBG A;  1WGG A;  5EFX A;  1SHC A;  1E8X A;  1OY2 A;  2HTH B;  3KUZ A;  4W9K A;  3TL5 A;  2K25 A;  3CST A;  4DXA B;  2QKL A;  2MBO A;  2KJ6 A;  3B08 A;  3UGB B;  3ZLZ A;  4BOZ B;  1E8Y A;  4P7I A;  1P5T A;  2K00 A;  3RUI B;  1QZE A;  1EGX A;  2IY1 B;  5E6O A;  2IO2 B;  3F5R A;  3CSF A;  2DAF A;  3TBL D;  2KDE B;  2KAN A;  2KWC A;  4KDI C;  1TTN A;  3PLU A;  1V80 A;  5D7G A;  1DDM A;  2BYF A;  4W9H A;  1UPQ A;  5LXH A;  4WJ7 A;  3SO6 A;  3V6C B;  3ULB A;  3WAM A;  2YS5 A;  4IM2 A;  2MP2 A;  2XK5 B;  4IW0 A;  1V5O A;  2CKH B;  3HHM A;  2LBB A;  3TMP B;  3ZDM C;  4EEW A;  3SDL C;  5CLQ B;  3L13 A;  1I42 A;  2BCJ A;  2DHI A;  2FIF A;  2IY0 B;  4EMO A;  4FJV B;  4XC2 A;  1CMX B;  1NBF C;  2WX1 A;  1KI1 B;  1FXT B;  2J7Q B;  3ALB A;  3NY5 A;  3UIN B;  1U2B A;  2MBQ A;  4DHJ B;  4EFO A;  2Q13 A;  3A9K B;  4K7U A;  5CHF A;  2K8H A;  4HK2 A;  2FCS A;  3UIP B;  3ZNH B;  4JQW C;  1OQN A;  3MPX A;  4HXD A;  4G3X B;  2D9V A;  3GYP A;  2L7R A;  2D9W A;  3N7C A;  3VTV A;  1TGZ B;  3ODX A;  2BGF A;  1KM7 A;  2DEN B;  3H6N A;  4PQ0 A;  2KX0 A;  2DA0 A;  5BO4 B;  3L08 A;  2IO0 B;  1V81 A;  5CTR C;  4AP4 C;  5GOW B;  2AYO B;  2DKP A;  5L83 A;  3HM3 A;  2ZVO A;  3MHS D;  3PRZ A;  4EKU A;  2G45 B;  2MWS B;  3AI5 A;  2RD0 A;  2RSU A;  1P3R A;  5DHF B;  1FB8 A;  4A3P A;  2ZJD A;  3ZTD A;  1W1G A;  5HE3 A;  3A1Q B;  2IFS A;  4MH0 E;  4AJW A;  1VD2 A;  1XD3 B;  2KMA A;  2DYO A;  4NSW A;  2PZ1 A;  2C7M B;  2DHZ A;  2H7D A;  2OQB A;  2DZM A;  4MJS A;  4A6H A;  3A8P A;  1SGH A;  2B3A A;  2REX A;  4K7W A;  3RZW C;  4JLC A;  4GSW A;  4BOS C;  4WWP A;  2X18 A;  4L6E A;  1UGM A;  3B0A A;  4EUT A;  1TJ6 A;  5L95 C;  4KSK C;  4URK A;  1DDV A;  4KHA A;  3S2A A;  1W1H A;  2Z0Q A;  3D8D A;  2LGD A;  2N7D A;  2W9N A;  4JL9 A;  5CHV C;  3LDZ E;  1D3Z A;  3KH0 A;  5C79 A;  2R09 A;  2W2W A;  2KNB A;  2W2X D;  4TYZ A;  2N0Y A;  1M94 A;  2MBE A;  3IFW B;  4GMV A;  3AUL A;  2L3Z A;  3H7P B;  3RCP A;  2LVP A;  2R0D A;  4NY0 A;  2VKI A;  2G35 A;  1WM2 A;  2LVO A;  3A9J A;  3Q3J A;  1GC7 A;  4K17 A;  1EF5 A;  2IBI B;  2VRW B;  3ZIM A;  2KLG A;  5HKH A;  2CHZ A;  3IHP C;  3ZNZ B;  2COD A;  4MDK E;  1XKE A;  2VRR B;  3TFM A;  1V49 A;  4E71 A;  3VXW A;  1FHX A;  4CO7 A;  3ML4 A;  3PZD A;  2RVB B;  3TCA A;  2J0K A;  1Y8R C;  5EDS A;  1V89 A;  4IWO A;  5DIF B;  1K8R B;  2G4D B;  2LXC A;  2FNJ B;  4BBN C;  1FOE A;  3QAR A;  1BT0 A;  3SU8 X;  3ONS A;  3CXB B;  2JY6 A;  4FJY A;  5D94 A;  2KLC A;  2I1J A;  1KZG A;  3R3M A;  1WGY A;  1UNQ A;  4XX5 A;  3U7D A;  1WI1 A;  1LB1 A;  1E7V A;  1JRU A;  1WR6 E;  2GOW A;  2DTC A;  1KLV A;  3NSU A;  2FDQ A;  5L81 A;  1KZ7 A;  2KCJ A;  3QA8 A;  4E74 A;  2XBB C;  2RQ1 A;  3KY9 A;  2O2V A;  3H1U A;  2BF8 B;  5DPR A;  2C60 A;  2EC1 A;  4WSF A;  1GG3 A;  2BWE S;  5JHG A;  3VUW A;  1RAX A;  2M1M A;  2O6V A;  4GMX B;  5DI9 B;  4DHJ D;  2GCJ A;  2RR9 A;  3JSV B;  2ABD A;  2DFK A;  2MKR A;  2BYE A;  1XT9 B;  2K8C A;  4IFS A;  2L0F A;  3QWZ B;  4BBK A;  2ZPY A;  2K6Q A;  2PJH A;  2K39 A;  3PV1 A;  3Q3F A;  2Z59 B;  2OTX A;  3VFK A;  3VUY A;  4ZDV A;  5C1Z A;  4AWJ A;  2KFK A;  4DWF A;  3LJU X; 
#chains in the Genus database with same CATH topology
 3KYD D;  1NVI D;  4YSZ B;  2JWU A;  1VBH A;  4EJN A;  2KT7 A;  4HAY B;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  2KYW A;  3NOB A;  2WXF A;  1MKE A;  3DCG A;  5DPT A;  3K9P B;  2IJ0 A;  3PT2 B;  2HTM E;  3EC8 A;  2GBN A;  1YN5 A;  5JHB A;  2BTE A;  3QAQ A;  2D11 A;  4WAA A;  2MJ3 A;  3I5J C;  3KWV A;  2N9L A;  2YS3 A;  3PG7 A;  1RRP B;  1NEK B;  3RT3 B;  1QOF A;  2C7N B;  2KVZ A;  3W5U B;  2ELA A;  1V8C A;  4TQ0 A;  1EUV B;  1MK7 B;  3Q8A A;  3AEF B;  3PSE B;  2NCN A;  4ZRI A;  2UYZ B;  4KSL C;  2N9K A;  4HAX B;  3NS1 A;  1P6S A;  2KC2 A;  4M0W A;  4XGA B;  4XZ4 A;  2JP2 A;  2N1V A;  3O96 A;  5LG4 B;  3MP9 A;  4H8S A;  4HPM B;  2KFK B;  2NPT A;  3SEB A;  3SHQ A;  3WA0 A;  3AE4 B;  3N20 C;  3M62 B;  4DDI D;  1DIK A;  2KWV B;  2GS0 A;  2V3S A;  1NTY A;  1DBH A;  1LXD A;  3T8M A;  3ODW A;  3N1Y C;  4WWO A;  4HAZ B;  4W9J A;  2QIL A;  1PGB A;  2PPH A;  4ARC A;  1GJZ A;  1AWE A;  3C19 A;  1OTR B;  2KKC A;  3NRZ A;  4JKE A;  2MBB B;  4L1B A;  4JK7 A;  3JVZ X;  1R4M B;  3O65 B;  3D8F A;  4KGS A;  5IAA C;  2IZV B;  2M0A A;  3PPA A;  3SV1 A;  2ZKM X;  2UU7 A;  4FAD A;  4BKG A;  4DK5 A;  1G6J A;  1UNS A;  3A58 A;  1TZ1 A;  3AE5 B;  4JKA A;  4IDI A;  3M1I B;  1C4A A;  1MHH E;  1U5F A;  3OAW A;  2JRH A;  3R2T A;  2K5P A;  2FCN A;  3OJ3 A;  3PZ7 A;  3L17 A;  2D07 B;  3OLM D;  1P1A A;  3UIO B;  2BS3 B;  1XF5 L;  2AQ3 B;  1I2H A;  2V9H A;  5JHA A;  1KTK A;  4KAX B;  2XN9 C;  5IJM A;  2KUP A;  1YQ3 B;  3FIL B;  3IAS 1;  1AAR A;  1E10 A;  2ZNV B;  2V76 A;  4II2 B;  2CR5 A;  3NVZ A;  5CHW A;  4GB9 A;  2COF A;  1IPG A;  2EJ8 A;  2FJU B;  1V9J A;  2WDQ B;  2JX5 A;  4G11 A;  5BMI A;  5D3V A;  1ZGU B;  2LUE A;  2YF0 A;  1PGA A;  2D2Q A;  1WGR A;  4HPL B;  2MX2 A;  2LYD A;  1WJU A;  2FE8 A;  1MIX A;  2CAY A;  3B1L X;  3QC8 B;  1P3Q U;  1J19 A;  3VIA A;  3RNA C;  1XLN A;  3IG3 A;  3Q3N C;  4LCD E;  4P1C C;  4F7G A;  3AEB B;  2OED A;  3PLV A;  2M8S A;  1EVH A;  1YQ4 B;  3LJ3 A;  1WG7 A;  2M17 A;  3BIN A;  2H89 B;  3HRD D;  1ZC4 B;  2YRY A;  1AN8 A;  1C4P A;  2J0J A;  2FUG 1;  3AB5 A;  3B2G A;  4GIV A;  3L4P A;  1FIQ A;  1TYG B;  5D3W A;  2L0T A;  1S1Q B;  3PRP B;  1VLB A;  1A70 A;  2N4F A;  3E9S A;  4REZ A;  4QJ3 B;  4JWS C;  4OVU A;  1NEN B;  5TSS A;  1JDE A;  4HB3 B;  2G4S A;  3U7Z A;  2DYB A;  1I4Q A;  3KZ1 A;  1WM3 A;  2QKM A;  5AEK B;  1OEY J;  5BMH A;  5D2M B;  3DVN U;  1AQC A;  4ZHP A;  2ROV A;  3DWM A;  3NZS A;  4A5K A;  1UD7 A;  2BPS A;  3D32 A;  4JPS A;  3PHX B;  5AZF A;  4LNF A;  4GNK B;  2KQ4 X;  3W1S A;  4C4V B;  3NWF A;  5AZG A;  4AOF A;  2RDH A;  2HJ8 A;  4JKC A;  1V1P A;  1D4B A;  3ULC A;  1OQQ A;  3WYF B;  2XK5 A;  3VHT C;  2BKR B;  1WE6 A;  1FMA D;  1L6U A;  3CF6 E;  4IM3 A;  2GBJ A;  4YSX B;  2PE6 B;  4JX1 C;  3KYC D;  2JWZ A;  1ISN A;  2KN4 A;  4LDT D;  4JKG A;  3P63 A;  4EEW A;  1M7E A;  1WJM A;  1H10 A;  2IYD B;  2R82 A;  5HHD G;  1MPH A;  3FP5 A;  3Q8E A;  4DIX A;  3SNH A;  3UQA A;  4GXB A;  4GZU A;  2L32 A;  2AL3 A;  1BUI C;  5GMV A;  2YT2 A;  1L7Y A;  1OGW A;  1R4M I;  1Z5S B;  4MSQ B;  3TO1 A;  2FID A;  2KIE A;  2M14 A;  2V4I B;  5C5B B;  2K9X A;  1SE9 A;  3NHE B;  3SYX A;  1MG8 A;  1E90 A;  4EZJ A;  2O2V B;  2J0M A;  2BBC A;  1P7E A;  2K3U A;  1VDV A;  1EWY C;  2HD5 B;  4ZRK A;  3TIX A;  1EO6 A;  1XEE A;  1B1Z A;  2AQ2 B;  4HKQ A;  3ZO5 B;  4WJP A;  3QBV B;  2WNM A;  4XE0 A;  2Y8F A;  2O6V B;  4A6Q A;  2FBW B;  1Z2M A;  1XD4 A;  2Y8G A;  1V97 A;  3MJ5 A;  2BKF A;  1J7A A;  4XDD A;  2DYM A;  1WXS A;  4JE3 B;  3AE6 B;  2WXP A;  2RPQ A;  2NMQ A;  2PE9 A;  3IAM 1;  2PW9 A;  4M01 A;  1OQR A;  3MTN B;  4FA6 A;  2DAJ A;  1Z87 A;  4K7S A;  2L8J A;  2DX5 B;  3PRE A;  3A1Q A;  4TUU A;  3TEY A;  2LEK A;  2YT1 A;  4MGK E;  1H8C A;  4MSM B;  2ZCB A;  1P98 A;  4P6V F;  3WIM A;  4KHO A;  2IPK D;  2QCZ A;  2IO3 B;  5LON B;  4AQ7 A;  3AEA B;  3QWM A;  4AJY B;  1OFF A;  4F1S A;  1FNU A;  1WXM A;  1JWA D;  2J59 M;  3ML9 A;  1WRD B;  1M4V A;  3APD A;  3HW2 B;  4PYU A;  2YSZ A;  4IUM B;  4NJ7 A;  1I4P A;  3R8B A;  5FR3 A;  3PSC A;  2L1C A;  2K8E A;  1HE8 A;  5BYR A;  4OZC A;  2I1K A;  2K2U A;  4DBG A;  1SHC A;  3CST A;  1VZ6 A;  3B08 A;  2WXK A;  1P5T A;  3RUI B;  3MC8 A;  2IY1 B;  2J4X A;  3ZGZ A;  4QXA B;  1LO5 D;  4KDI C;  1QT9 A;  1UPQ A;  5LXH A;  4IM2 A;  2MP2 A;  2Z8L A;  3KWL A;  5I2M A;  2Y5P A;  2BCJ A;  3Q14 C;  1KI1 B;  1FCC C;  2J7Q B;  1ESF A;  3V3X A;  1U2B A;  4EFO A;  1UUP A;  4ITK A;  3UIP B;  4HXD A;  4G3X B;  4NZL B;  2D9W A;  3N7C A;  2GUM A;  3VTV A;  1T3Q A;  2BGF A;  5BO4 B;  3L08 A;  1V81 A;  4AP4 C;  1KLU D;  2QC8 A;  3MHS D;  3LYY A;  1P3R A;  3ZTD A;  3KLS X;  1I7H A;  1XD3 B;  2KMA A;  4NSW A;  3V60 A;  2B3A A;  4K7W A;  3RZW C;  2OHF A;  4JLC A;  4BOS C;  1N5X A;  4URK A;  2BS4 B;  3S2A A;  2Z0Q A;  1D3Z A;  2PTL A;  1DOY A;  1FO4 A;  2N0Y A;  1M94 A;  2VZK D;  3RNF C;  4GMV A;  4PK1 A;  3H7P B;  2IBI B;  2VRW B;  3GE3 C;  3ZIM A;  2KLG A;  3IHP C;  5H8Y E;  2COD A;  4YWG G;  1XKE A;  2NBV A;  2VRR B;  1FHX A;  3ML4 A;  1WYG A;  2GRI A;  2GB1 A;  2G4D B;  1PFD A;  2IND C;  3FVC A;  2FNJ B;  3RNE C;  1FOE A;  3MFG A;  3SU8 X;  4FJY A;  4KKJ A;  5D94 A;  2KLC A;  1KZG A;  1WGY A;  3BVZ A;  1WI1 A;  1FFV A;  3P42 A;  2WGS A;  3H1U A;  2O2V A;  2C60 A;  4WSF A;  1GG3 A;  3VUW A;  2O6V A;  1E0Z A;  2ABD A;  2BYE A;  1XT9 B;  3QWZ B;  2KAC A;  2K6Q A;  2PJH A;  2WDR B;  3LXF A;  3PV1 A;  3URY A;  2Z59 B;  1SB3 C;  2KFK A;  2KZR A;  4B6W A;  2V1Y A;  2AWT A;  2KUQ A;  1EWC A;  1V5M A;  3OHM B;  4HHV A;  3RZF A;  2D4Q A;  1ZW7 A;  2MWN B;  1JWB D;  1BTN A;  2Z0O A;  1TT5 B;  4FBJ B;  3J9C A;  1SIJ A;  3QHT A;  2D3G A;  2KWU B;  1RFK A;  1WFY A;  1ZSQ A;  1WZ3 A;  4RGN A;  3V05 A;  2JYT A;  3E9P A;  2Z0P A;  5E6N A;  2X8X X;  3FEH A;  2WXH A;  5HE1 A;  4ANV A;  4WQO B;  3EPY A;  5AZH A;  3AEC B;  2N0S B;  1YJI A;  3W2D A;  1KLG D;  3IBE A;  1Q10 A;  2XEW A;  3PHW B;  4TQ1 A;  1QIL A;  5D3X A;  2SEB D;  2I5C A;  3VUX A;  2ZVN A;  4MAC A;  5C6R A;  2AL6 A;  4ANW A;  2ASQ A;  2WDV B;  4BZA A;  3PTF C;  2ZPN A;  3FSS A;  3U2S C;  4HB2 B;  3MC0 B;  3BY4 B;  5DH9 B;  1GB1 A;  1XLO A;  1GB4 A;  1ZE3 D;  4X57 B;  1ACA A;  4HJK A;  1YX6 B;  1SEB D;  2YLM A;  2AX5 A;  2RLO A;  1BTK A;  4TSS A;  4KIK B;  2RGN B;  4HCP B;  4IOI E;  1FRD A;  2LUL A;  3HVD A;  4USA A;  4RGO S;  2JXX A;  4IM0 A;  3BYT B;  2EMS A;  2E2X A;  3PGE A;  1FNW A;  1X86 A;  3U52 E;  1H4R A;  3BK2 A;  4NQL B;  3ZJV A;  1V5T A;  3DHH C;  3P4R B;  2RGF A;  1RWS A;  1HTQ A;  3QK0 A;  1X11 A;  1SBB B;  4MEM A;  3M95 A;  5E6J A;  2MA9 B;  3D8E A;  5FKA C;  1GNU A;  3RD2 A;  1R4N B;  2W55 A;  4BKS D;  2NPT B;  4GDL B;  2L00 B;  2KN5 A;  3ZW3 A;  4GU2 A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  4JKD A;  2YT0 A;  3NZU A;  4LDT B;  1KH0 A;  4NAW B;  2LOX A;  5D3I B;  5HFY A;  2VH1 A;  1CJE A;  3H7P A;  1PFJ A;  3PVL A;  4GOU A;  4TV3 A;  3WAO A;  2PIA A;  1NDD A;  4J6I A;  2WDT B;  1DYQ A;  3T3O A;  3DXD A;  3DCX A;  4G50 A;  1WGH A;  3T9L A;  1VRA B;  1QOA A;  5FK9 C;  2MFQ A;  1TKY A;  5JXV A;  1QC6 A;  1K53 A;  4FHJ A;  2CU1 A;  3PZ8 A;  1WMH A;  5G5H A;  3MDB C;  5FI0 A;  3AU4 A;  2GBM A;  1NI3 A;  4BAX A;  1WF9 A;  1YNT E;  1ZKH A;  1F2R I;  2RNR B;  4CHM A;  4N59 A;  4EZL A;  1XQQ A;  5LOP B;  1X1M A;  3APC A;  3AE1 B;  1YN4 A;  2EKI A;  1UGJ A;  3BZD B;  4I6L B;  2QEJ C;  2NBV B;  2WH5 A;  1GGO A;  5EE0 A;  3DVG X;  3DPD A;  2WXN A;  1WY8 A;  3F0W A;  3ZRC A;  1JAL A;  2AQ1 B;  2D9Z A;  2BYT A;  4P1B C;  1YJ1 A;  2MHJ A;  2N23 A;  4K2O A;  4YTP B;  4NNJ B;  1FXA A;  4W9F A;  1UNR A;  1EAZ A;  1QF6 A;  1QOB A;  1AYF A;  1AWD A;  1ACC A;  1K50 A;  3KRX A;  2H7E A;  3Q8C A;  4HDQ A;  1SIF A;  1WMH B;  1TXD A;  2KDM A;  2LKO A;  4A8X C;  2MH7 A;  1N63 A;  2LWP A;  4B6H A;  1N61 A;  2NS5 A;  5EE9 A;  2DYQ A;  2DNF A;  1E9M A;  4BKS A;  1U27 A;  4LNI A;  1FFU A;  3AMZ A;  2UZS A;  2IGD A;  1OEY A;  2LVQ A;  1SXT A;  4YT0 B;  4A6K A;  1FD6 A;  2KDB A;  2QSD A;  1WIA A;  1WJ6 A;  3UI3 A;  1MG4 A;  2Z0D B;  4XYC A;  4JKB A;  5JLJ B;  3OAN A;  1UWM A;  4P16 A;  2DHK A;  2INN E;  2CS4 A;  1V61 A;  3GB1 A;  4WJQ A;  1X1F A;  1ZXI A;  1ZDV A;  2JF5 A;  5H92 C;  1WZ0 A;  2KFJ A;  2LGX A;  2BVC A;  5D6J B;  2JQR B;  4EE2 A;  2HE7 A;  1ZPS A;  1WH3 A;  2K1F A;  2EKE C;  5E6P A;  1UF0 A;  2V4L A;  2MW5 A;  3R7Q A;  4H2A A;  1NYR A;  1CZP A;  2IO1 B;  3SBT A;  2CY4 A;  1L5P A;  2NBW B;  3AH7 A;  2W3R A;  2CHW A;  2D5G A;  4WJN A;  3RNC C;  1ZP0 B;  5KHQ A;  2PEA A;  4GLS C;  4DDG D;  3UZT A;  3AE2 B;  1SJH D;  1MHX A;  4C56 C;  2WXG A;  4DX9 0;  3V5W A;  2NMB A;  4M8M A;  4HB4 B;  1GOZ A;  2KDI A;  2JVC A;  2ZZP B;  3DXE A;  2YEP F;  4GDL A;  4C00 A;  4HVB A;  1P9D U;  2LGS A;  4W9E A;  5KCV A;  2WS3 B;  4KHB B;  1F52 A;  4GPT B;  2W54 A;  1MI1 A;  2RPV A;  2NZ8 B;  1R7S A;  4OVV A;  1PLS A;  3ZNI D;  3UF8 A;  2BQQ A;  2FAZ A;  1YN3 A;  2MP2 B;  3OG5 A;  5EE1 A;  5AUK A;  3DXC A;  4R3D A;  1T0Y A;  2YS1 A;  1YMH E;  4CHK A;  5D3Y A;  3M3J A;  2ZNV C;  3W1S C;  1Y5O A;  1I4X A;  2K2J A;  5JZE B;  1MVK A;  2WXQ A;  3VRB B;  1K51 A;  4KVG B;  2QJL A;  1KF6 B;  2JPH A;  1HBK A;  2CJN A;  2GBK A;  3VTW A;  4MM3 A;  3KVF B;  5J3Y A;  4HCN B;  1RJ2 A;  3TEZ A;  1I7A A;  2HRJ A;  2O6V D;  4A6F B;  2JYE A;  1UNP A;  1MIZ B;  3KSY A;  3ZVR A;  5I4D A;  2PMV A;  5C5B A;  5DCN A;  4XWX A;  3E9L A;  1VR9 A;  2LGY A;  2JZ3 B;  3DBH B;  2KJH B;  2RMM A;  5IA7 A;  1QQG A;  2XQN M;  5J3Q A;  4HAV B;  5HI1 A;  3ML8 A;  2NR2 A;  1P0R A;  2G9H D;  1V1O A;  1F2R C;  3NWA A;  1L4D B;  2ELB A;  4IKG A;  4ANX A;  3BWU D;  2DIK A;  1E8X A;  3KUZ A;  4KGT A;  1T0S C;  4AS1 A;  2KJ6 A;  2BS2 B;  1E8Y A;  4P7I A;  3Q69 A;  3RN9 C;  2K00 A;  4US8 A;  4J3O D;  1QZE A;  4OZB A;  3CSF A;  2KIG A;  4HJG E;  4YXD B;  2KWC A;  3PLU A;  4RCO A;  1NYQ A;  1DDM A;  2BYF A;  4W9H A;  1XCT L;  4WJ7 A;  2V0G A;  3WAM A;  4UDU C;  2XK5 B;  4IW0 A;  3FAH A;  2CJO A;  3HHM A;  3Q2A C;  3TMP B;  3ETR A;  3ZDM C;  5BMG A;  3L13 A;  2KAJ A;  2IY0 B;  4FJV B;  3I9V 1;  1ET6 A;  2Z59 A;  4L2Y A;  1FXT B;  3DWG C;  3NY5 A;  1VZ8 A;  4C80 A;  1J7B A;  2Q13 A;  5CHF A;  2K8H A;  1YJJ A;  3ENB A;  1TGZ B;  3ODX A;  4PQ0 A;  4KX6 B;  3Q3M C;  5GOW B;  1IBX A;  1I4R A;  2MWS B;  3FC4 A;  4A3P A;  1W1G A;  5HE3 A;  1FNV A;  3A1Q B;  4WH4 A;  2J53 A;  1VD2 A;  4AJW A;  4D6W A;  4YTN B;  2PZ1 A;  1WGK A;  1J7C A;  3TSS A;  3NWD A;  2REX A;  3U4E G;  4WWP A;  5L95 C;  3BVM A;  3NW8 A;  3RNG C;  4KSK C;  4KKI A;  1DDV A;  3AN1 A;  3D8D A;  4A90 A;  3LDZ E;  3KH0 A;  2KNB A;  2W2X D;  2WXI A;  3IFW B;  3P4S B;  2LVP A;  2G35 A;  2L1A A;  1EF5 A;  3LB8 C;  2QIE B;  2CHZ A;  1I4G A;  1L0V B;  3ZNZ B;  4C7Y A;  3TFM A;  1V49 A;  1VJK A;  4E71 A;  3AEG B;  4CO7 A;  3FKY A;  4WWM A;  1V89 A;  2LXC A;  2DBY A;  3ONS A;  4PT5 A;  4XX5 A;  1UNQ A;  2IGH A;  1LB1 A;  1SSN A;  1JRU A;  1WR6 E;  1KLV A;  1KZ7 A;  2KCJ A;  4WAF A;  2RQ1 A;  3EGR A;  5JHG A;  1D5X C;  1RAX A;  5DI9 B;  2GCJ A;  3JSV B;  2QDF A;  4HEA 1;  2K8C A;  4IFS A;  4BBK A;  2ZPY A;  5C1Z A;  3VUY A;  3I57 A;  4HAU B;  5JVL A;  3QCA A;  1EM7 A;  1J0G A;  2FCM A;  5BYQ A;  1W1D A;  1L2N A;  5CLL B;  1PYW D;  2YEP B;  1WJ4 A;  1E5W A;  3GYO A;  3U30 A;  3ZDT A;  3ENE A;  3SFD B;  2KQ7 A;  2R2Q A;  4YSY B;  2UVM A;  3ZNG C;  3TEW A;  1BML C;  1SJE D;  4D2K A;  2K8B A;  4LNO A;  3A9J B;  4ICV A;  1WJ1 A;  2KOX A;  1V1P B;  2JSV X;  2P0H A;  2MBH A;  2V3N A;  1MAI A;  4RFB A;  4G0N B;  3L10 B;  4BKT A;  4JIO U;  4C4V A;  2M4N A;  4BVU C;  4FLH A;  3R7R A;  4NJC A;  3ZJU A;  4JGH B;  3CIK A;  1WGD A;  3IT6 B;  4CQN A;  1QLB B;  2MSE D;  1JW9 D;  5I2S A;  2Y3A A;  1GUA B;  3DBS A;  3W5V B;  5JHH A;  2KD0 A;  1V5P A;  4OT1 A;  5IRS A;  2HTH A;  4GDK B;  2INC C;  4K3C A;  2MDX A;  3TW1 A;  2KQS A;  4IG7 B;  2WQY B;  1HQR D;  2L05 A;  3VR9 B;  4C0A A;  2LJ5 A;  3V62 A;  1X05 A;  3V61 A;  1XO3 A;  1UEL A;  1A5R A;  4IAP A;  3AU5 A;  3AXC A;  3KW5 B;  3AEE B;  2LUM A;  3BYY B;  3N1Z C;  3DVN V;  1TS3 A;  1BWN A;  2INP E;  2C9W B;  3X23 A;  3RI7 C;  1MI0 A;  2COP A;  4M8N A;  4ZYN A;  2M56 B;  5TR5 A;  2LOZ A;  3KRW A;  1XX0 A;  1T77 A;  2K6D B;  1ZOY B;  2ZW1 A;  2RDB C;  3VAW A;  1Q5W B;  2IDY A;  3HM6 X;  1C77 A;  3SR6 A;  3WAN A;  2DHJ A;  4M00 A;  2KC1 A;  3DOW A;  1IBX B;  2ZCC A;  4WWN A;  3P1M A;  2ZW0 A;  4F7H A;  4MGY E;  4M02 A;  3PVW A;  5LLI A;  4OHJ A;  4MGI E;  2GI9 A;  2R61 A;  3GZN I;  4DHZ B;  3A8Q A;  4KIK A;  3FM8 C;  1KC7 A;  3GE8 C;  5IP4 D;  4HK2 A;  3MHZ A;  3WAP A;  1YQB A;  3B2F A;  2MJE A;  2CQU A;  1U5G A;  1F77 A;  3N30 A;  2D9Y A;  4MY6 A;  1DOX A;  3X0W A;  1RM6 C;  2Q5W D;  4RM9 A;  3UQB A;  1QQR A;  1GC6 A;  1NI2 A;  2GBR A;  3BVG A;  2KO3 A;  1ST7 A;  2W2X C;  1PMS A;  1Y56 A;  4IC7 B;  4AUQ C;  1T5X D;  3O13 A;  1MK9 B;  2N7E A;  2FCQ A;  3NUH B;  1YOV B;  1V88 A;  1OQY A;  1B9R A;  3T06 A;  3C0R B;  1TJE A;  4NJ6 A;  1TS4 A;  3DDC B;  4Z2M B;  1TS5 A;  2DLB A;  4K3B A;  4F8C B;  2EMT A;  1STE A;  4Z2N A;  5DPW A;  1IRS A;  1V5U A;  1VBG A;  4OW0 A;  3NG0 A;  1Y19 B;  4FXC A;  2NTS A;  3EHV A;  1V2Y A;  1WRI A;  2A4Z A;  1TS2 A;  1JML A;  2WYQ A;  4I6P A;  2LHD A;  1JRO A;  1AW7 A;  3ODO A;  4DBB A;  2BB5 A;  3DBL B;  1ZDX A;  1Q0W B;  1XR0 B;  3DVG Y;  1WGQ A;  2MQJ A;  3ZUN A;  1F9J A;  4BBN F;  5J2R A;  4KHB A;  2OJR A;  2COC A;  3C8Y A;  4ASW C;  4WIP A;  4MJS B;  3T3N A;  2BYV E;  1U4A A;  1QOG A;  3WCQ A;  4PS8 A;  1XCG A;  4K2P A;  3QX1 A;  2L2I A;  1TZO A;  4FJZ A;  4GDK A;  2RSG A;  3L0W B;  2XNA C;  1WI0 A;  4B9K A;  3PP2 A;  3VFK A;  4ILH A;  3AE8 B;  2SAK A;  2DLW A;  4N6E B;  1FHO A;  2A5U A;  4IWQ A;  2DKQ A;  4MT7 A;  1HXY D;  1N60 A;  4W9G A;  4DX8 A;  2Z13 A;  1FCL A;  2GCL A;  5M4Y B;  3I3T B;  4ZRQ A;  2N9P C;  5FI1 A;  2CB8 A;  1E6E B;  3VH3 B;  4HDO A;  2ZEQ A;  1IP9 A;  2RDG A;  4JK8 A;  3ZRF A;  2L76 A;  4RF1 A;  4IOY X;  2CU3 A;  3DBL I;  2DX1 A;  4FUL A;  3IXS A;  2LRU A;  2JZZ A;  4YON A;  4LJP B;  2KK8 A;  2X38 A;  4LJO B;  1PGX A;  1UH6 A;  4QJ4 B;  4MEL A;  3RMK C;  1J0W A;  3H9D A;  5BYS A;  2K49 A;  2P0F A;  3WAL A;  2TSS A;  2G3Q B;  2DYN A;  4CYE A;  4KDL B;  1DOI A;  2JXT A;  2Y5B B;  2N9X A;  2PLP A;  5C23 A;  1FEH A;  2MEK A;  1RFA A;  1U5D A;  2DN6 A;  1C1Y B;  3KUC B;  5J18 A;  3BJI A;  5JH5 C;  4IWP A;  2WWZ A;  1Q1O A;  4EOY A;  1D5Z C;  3HIE A;  3H8H A;  5DPS A;  1N62 A;  3VQI A;  1LQB A;  3IT4 B;  4WUR A;  1FGZ A;  5HG2 A;  3A98 B;  1NVL A;  2EEL A;  4B0M A;  1MJD A;  1WR1 A;  3Q8F A;  1ET9 A;  4YL8 A;  1YD8 U;  4MGZ E;  1FHW A;  2YVC A;  2ADZ A;  1P7F A;  4QJ5 B;  3GS2 A;  3EUB 2;  4YTM B;  3DHG C;  1EU3 A;  4B0E A;  4MK0 A;  4WVF B;  2KXJ A;  2KTR A;  2RUK B;  1Q67 A;  2N7J A;  3HIZ A;  5HE2 A;  2KVR A;  2KJR A;  3FLV A;  3DBR B;  1U29 A;  3ABV B;  2K22 A;  2LHE A;  3A4S C;  1ZVR A;  2CRF A;  4OZA A;  1U5E A;  2D3B A;  4DXG A;  2HDE A;  1KFY B;  2DX5 A;  2D10 A;  3B77 A;  4W9K A;  3TL5 A;  4DXA B;  2MBO A;  3UGB B;  2PVO D;  3ZLZ A;  4BOZ B;  5E6O A;  2ON8 A;  3F5R A;  2DAF A;  3TBL D;  4CSQ A;  1V80 A;  3I63 C;  1FM0 D;  2RRF A;  3SO6 A;  3V6C B;  3ULB A;  2YS5 A;  3OWE B;  1V5O A;  2LBB A;  3HVZ A;  3SDL C;  4XC2 A;  4EMO A;  2L52 A;  1CMX B;  1NBF C;  2WX1 A;  3B9J A;  4DHJ B;  1JWU D;  2MBQ A;  5IKC M;  2FCS A;  3CIR B;  3MPX A;  2D9V A;  2L7R A;  1C78 A;  3H6N A;  4HRS A;  2KX0 A;  1JQ4 A;  2G1E A;  5L83 A;  2DKP A;  3HM3 A;  2ZVO A;  3PRZ A;  4EKU A;  2G45 B;  2BB6 A;  5DHF B;  1FB8 A;  1TKG A;  2ZJD A;  5AUI A;  1D6E C;  2DYO A;  2DHZ A;  2H7D A;  2OQB A;  1FXI A;  4MJS A;  1F0Z A;  1SGH A;  2J42 A;  3AM9 A;  4GSW A;  4EUT A;  2X18 A;  4L6E A;  1UGM A;  2WXL A;  2E6X A;  1CQV A;  4KHA A;  4JL9 A;  2HJ1 A;  1L0X B;  5CHV C;  5C79 A;  2R09 A;  2W2W A;  1C9F A;  2L3Z A;  5D3D A;  2VKI A;  2R0D A;  4NY0 A;  1WM2 A;  2LVO A;  3A9J A;  1GC7 A;  1GAQ B;  4JKH A;  3VXW A;  2R2Y A;  3TCA A;  3N9Y C;  5EDS A;  1XLP A;  4IWO A;  5DIF B;  1VZ7 A;  1HZ5 A;  2BT6 A;  1BT0 A;  1D5M C;  3CXB B;  2JY6 A;  2FDQ A;  4E74 A;  1C76 A;  3KY9 A;  2B76 B;  2BF8 B;  2EC1 A;  5LNK 1;  2BWE S;  1IGD A;  1MPE A;  3AE7 B;  4MM3 B;  4DHJ D;  2M1M A;  1KBL A;  4A55 A;  2RR9 A;  3P4Q B;  4ZDV A;  2OTX A;  4AWJ A;  1JWM D;  4W9D A;  2FJL A;  3DQV A;  1LM8 B;  3RCZ A;  2Z14 A;  4C7Z A;  1LGR A;  4LTU A;  3ZTC A;  4WQM A;  2IYB A;  3AED B;  2DZJ A;  2KMC A;  2WXO A;  3DHI C;  5KQ1 A;  3SFE B;  1UBI A;  2WP9 B;  1NTI A;  2FJ9 A;  3HK0 A;  1ENF A;  5EE3 A;  4HPP A;  1WX8 A;  2NTT A;  3PS6 A;  1NU2 A;  1M7R A;  3TVV A;  3VH4 B;  2R2O A;  3ZQ4 A;  3FIL A;  2C7H A;  4LK0 M;  3P7Z A;  2COA A;  3EFC A;  2J52 A;  4LNK A;  4HB0 B;  1FRR A;  3VR8 B;  4GOC A;  3A4R A;  4A9A A;  3VRA B;  1WXV A;  4HAW B;  4PYZ A;  3RNB C;  2JRI B;  4ICU A;  3GOE A;  1I4H A;  1PQS A;  1WSP A;  4NQK E;  1FAO A;  1HB8 A;  1HB6 A;  1C3T A;  3ZXR A;  2I2Y A;  2WX0 A;  5G55 A;  3VDZ A;  2PVG C;  3E9O A;  2WXR A;  1WYW B;  1WX7 A;  1F1H A;  3P6A A;  3DBH I;  3RUL A;  2KTF A;  4JWU C;  3RFZ B;  1L0Y B;  3AJ4 A;  1ROE A;  3NS8 A;  4DQO C;  4JKF A;  1GPX A;  4W9I A;  1SE2 A;  1UPR A;  1DDW A;  1NTV A;  3AE3 B;  3N32 A;  2H88 B;  3L54 A;  2JT4 B;  4F7U P;  3SUZ A;  1JCK B;  3QJZ A;  3HSA A;  3H7S A;  4B95 A;  2CY5 A;  5GXG B;  1MFW A;  1HZ6 A;  1ZUD 2;  1T6B X;  5D27 A;  4EZK A;  2LZ6 A;  4KZC A;  5KQ4 A;  1TBE A;  1UZX B;  3MC9 A;  3BII D;  3NVV A;  2I5F A;  2JUO A;  3A33 B;  3ZXV A;  3E66 A;  2M0X A;  2NVU I;  4W9L A;  1WJN A;  2E3T A;  3U12 A;  5C3J B;  3A9K A;  2DWQ A;  4K81 A;  1JWS D;  2P0D A;  5FR6 A;  4TKN A;  2WXJ A;  3K9O B;  4ACF A;  1DYN A;  4KGR A;  4HAT B;  3IVF A;  4S17 A;  4HKZ E;  2N9E B;  1LW3 A;  4KZ0 A;  1CK1 A;  4A6F A;  1V86 A;  1V6E A;  3G9W A;  2V3P A;  3DBR I;  1WXA A;  2JZP A;  4HLE A;  4N9F 4;  2AEH A;  3Q8B A;  4HRO A;  2KMM A;  2VSZ A;  2CHX A;  4OVZ A;  4L1R A;  1K5D B;  1WE7 A;  4E3C A;  4DXF A;  1XCQ L;  2FUH B;  3W9C B;  3APF A;  2GJY A;  4HWI B;  2DZK A;  3TEX A;  1K5G B;  4II3 B;  3AV8 A;  1ZXH A;  2BW2 A;  2W3S A;  2UZR A;  3ZVV A;  4QAY A;  4Y94 A;  5HE0 A;  4ZYS A;  3VTU A;  2ROZ B;  1N6Z A;  4NAW A;  2NBU A;  1KRH A;  1OMW A;  1HTO A;  3Q3O C;  1UEF A;  4XDC A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  2MCN B;  4O1N A;  3JYU A;  2ACZ B;  1IYF A;  3R66 C;  1E8W A;  1L6V A;  4RGM A;  4XWT A;  1ZM0 A;  1FGY A;  3RYT A;  1TQZ A;  1PDX A;  3PRM B;  2LGI A;  2LXA A;  1L4Z B;  3HQC A;  4PS3 A;  1J8C A;  2KDF B;  1T0R C;  1LFD A;  2KX3 A;  1TIF A;  2D3C A;  3V6E B;  1KOT A;  1XOD A;  3Q6B A;  4RNA A;  1SE3 A;  3BK1 A;  4XWW A;  4BFR A;  1S3S G;  2P8V A;  3QIJ A;  2LI5 A;  3NVW A;  2Z0E B;  1E7U A;  4US9 A;  4MH8 A;  2KR0 A;  2Y5C A;  2MRP A;  4D0N B;  2M19 A;  3U8Z A;  3KQ4 A;  3NJT A;  4TMA B;  1N3H A;  2GLS A;  3EA6 A;  3PO0 A;  5J3T A;  1BAK A;  4I6N B;  2KGX B;  4ARI A;  3OJ4 B;  2N1W A;  1RLF A;  3TJP A;  1IGC A;  1ZC3 B;  2LJI A;  2Z4D A;  1WVH A;  4GN1 A;  2LAS A;  4ILJ A;  2L83 A;  5CX3 A;  2UWQ A;  1KJT A;  4NPN A;  1R4N I;  5T8I A;  1TKE A;  1WGU A;  1C79 A;  2Y7B A;  2MLB A;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  3MJW A;  4MT5 A;  2KHW B;  2WXM A;  5KHO A;  4A20 A;  3NZ3 A;  2D9X A;  4DHZ E;  3P4P B;  3JW0 X;  1RYJ A;  4CHJ A;  1BXT A;  3JSV A;  1PUT A;  4A3O A;  5JP4 A;  3GP7 A;  3P2B A;  2D3A A;  3ECI A;  1N5W A;  2OOB B;  2QMT A;  1IUE A;  3ZYY X;  1YX5 B;  2C5L C;  3VOQ A;  2GMI C;  5G5G A;  3CWI A;  3KUD B;  3EFU A;  1WX9 A;  3W1Y A;  3SD5 A;  2I38 A;  4ZRJ A;  1B55 A;  3ZKJ C;  5G2N A;  2M38 A;  1I35 A;  1EF1 A;  2LG1 A;  4N58 A;  4PNK A;  1T0Q C;  3SBG A;  2LD9 A;  1TY0 A;  1DRO A;  5C16 A;  4OSN A;  2LFI A;  3QQ8 B;  5IO9 A;  4RMA A;  1SF0 A;  1XXG A;  2W82 A;  3VVW B;  1K52 A;  1HA5 A;  5LXI B;  1WWT A;  3PVU A;  4S0R A;  3PEG A;  1ZYI A;  1WXQ A;  4FN2 A;  1HEZ E;  5DHA B;  1UBQ A;  4GGQ A;  3R2I A;  2WLB A;  4ILG B;  2VH2 A;  3M63 B;  4ANU A;  1XLQ A;  3AE9 B;  4M0W B;  3GZN B;  1X1G A;  2DZI A;  2WHI A;  1VCB A;  2ICI A;  2LRW A;  4L23 A;  3L16 A;  4PS7 A;  1WGG A;  5EFX A;  3N1X C;  1OY2 A;  2HTH B;  4ZHO A;  2K25 A;  2QKL A;  5C2T B;  4ZOH C;  2K0P A;  1EGX A;  4LNN A;  4ZRP A;  2IO2 B;  2IGG A;  2KDE B;  2KAN A;  5D7G A;  1TTN A;  3RPF C;  2CKH B;  5CLQ B;  1I42 A;  2DHI A;  2FIF A;  2PKO A;  4RGT A;  2JU6 X;  3ALB A;  4JKG B;  3UIN B;  5IOI A;  2LMC A;  3A9K B;  4K7U A;  3NVY A;  3ZNH B;  4JQW C;  4JK9 A;  2WU5 B;  1OQN A;  3GYP A;  1E7P B;  2VZK B;  2DEN B;  1KM7 A;  5MPO A;  2DA0 A;  2IO0 B;  1JRP A;  5CTR C;  2AYO B;  3AI5 A;  2RD0 A;  2RSU A;  2WU2 B;  3ZJT A;  4MH0 E;  2IFS A;  2DZM A;  2C7M B;  4A6H A;  3A8P A;  4LLG M;  4RF0 A;  3E56 A;  4RH6 A;  1C4C A;  3B0A A;  1TJ6 A;  1QKZ A;  4HSI A;  2MJD A;  2ONQ A;  1W1H A;  2LGD A;  2W9N A;  2N7D A;  3TUO A;  4TYZ A;  2MBE A;  3AUL A;  3N3K B;  3RCP A;  3Q3J A;  4K17 A;  5IN7 A;  5HKH A;  4NAM A;  4MDK E;  2OJW A;  3PZD A;  2RVB B;  2J0K A;  1Y8R C;  1K8R B;  4BBN C;  3QAR A;  3HUI A;  1UWX A;  1DGJ A;  2I1J A;  3R3M A;  1SE4 A;  3U7D A;  2GOW A;  1E7V A;  2DTC A;  3NSU A;  5L81 A;  2KWD A;  3QA8 A;  1TY2 A;  2XBB C;  2X0S A;  5DPR A;  1EU4 A;  4GMX B;  2DFK A;  2MKR A;  2L0F A;  1FPY A;  2K39 A;  3Q3F A;  4Q2J A;  4DWF A;  3LJU X; 
#chains in the Genus database with same CATH homology
 3KYD D;  1VBH A;  4EJN A;  4HAY B;  1YIW A;  4KV2 A;  4F7Z A;  4W9C A;  3NOB A;  1MKE A;  3DCG A;  5DPT A;  3K9P B;  3PT2 B;  3EC8 A;  2GBN A;  5JHB A;  3QAQ A;  2D11 A;  4WAA A;  2YS3 A;  3PG7 A;  1RRP B;  3RT3 B;  2C7N B;  2ELA A;  4TQ0 A;  1EUV B;  1MK7 B;  3PSE B;  2NCN A;  4ZRI A;  2UYZ B;  4KSL C;  4HAX B;  1P6S A;  2KC2 A;  4XZ4 A;  2JP2 A;  2N1V A;  3O96 A;  4H8S A;  4HPM B;  2KFK B;  2NPT A;  3SHQ A;  3WA0 A;  3M62 B;  4DDI D;  1DIK A;  2KWV B;  2GS0 A;  2V3S A;  1NTY A;  1DBH A;  1LXD A;  3T8M A;  3ODW A;  4WWO A;  4HAZ B;  4W9J A;  2PPH A;  1GJZ A;  1AWE A;  1OTR B;  2KKC A;  4JKE A;  2MBB B;  4JK7 A;  3JVZ X;  3O65 B;  3D8F A;  5IAA C;  2IZV B;  3PPA A;  3SV1 A;  4FAD A;  4BKG A;  4DK5 A;  1G6J A;  1TZ1 A;  4JKA A;  3M1I B;  1U5F A;  3OAW A;  2JRH A;  2FCN A;  3OJ3 A;  3L17 A;  3OLM D;  2D07 B;  1P1A A;  3UIO B;  5JHA A;  1I2H A;  4KAX B;  5IJM A;  2KUP A;  1AAR A;  2ZNV B;  2V76 A;  4II2 B;  2CR5 A;  5CHW A;  4GB9 A;  2COF A;  1IPG A;  2EJ8 A;  1V9J A;  4G11 A;  5D3V A;  1ZGU B;  2LUE A;  2YF0 A;  4HPL B;  2D2Q A;  1WGR A;  2MX2 A;  2LYD A;  1WJU A;  1MIX A;  2CAY A;  3B1L X;  3QC8 B;  1P3Q U;  1J19 A;  3VIA A;  3IG3 A;  4LCD E;  4F7G A;  3PLV A;  2M8S A;  1EVH A;  3LJ3 A;  1WG7 A;  2M17 A;  3BIN A;  1ZC4 B;  2YRY A;  2J0J A;  4GIV A;  5D3W A;  2L0T A;  1S1Q B;  3PRP B;  2N4F A;  4OVU A;  1JDE A;  4HB3 B;  2G4S A;  2DYB A;  3KZ1 A;  1WM3 A;  2QKM A;  5AEK B;  1OEY J;  5D2M B;  3DVN U;  1AQC A;  2ROV A;  3NZS A;  4A5K A;  1UD7 A;  2BPS A;  3D32 A;  3PHX B;  5AZF A;  3W1S A;  5AZG A;  4AOF A;  2HJ8 A;  4JKC A;  3ULC A;  3WYF B;  2XK5 A;  3VHT C;  2BKR B;  1WE6 A;  3CF6 E;  4IM3 A;  2GBJ A;  2PE6 B;  3KYC D;  2JWZ A;  1ISN A;  4LDT D;  4JKG A;  4EEW A;  1M7E A;  1WJM A;  1H10 A;  2IYD B;  2R82 A;  1MPH A;  3FP5 A;  3UQA A;  3SNH A;  4GXB A;  4GZU A;  2AL3 A;  5GMV A;  1L7Y A;  1OGW A;  1R4M I;  1Z5S B;  4MSQ B;  3TO1 A;  2FID A;  2M14 A;  5C5B B;  1SE9 A;  3NHE B;  3SYX A;  1MG8 A;  1E90 A;  4EZJ A;  2O2V B;  2J0M A;  2HD5 B;  4ZRK A;  3TIX A;  1EO6 A;  3ZO5 B;  4WJP A;  3QBV B;  2Y8F A;  2O6V B;  1Z2M A;  1XD4 A;  2Y8G A;  2BKF A;  2DYM A;  1WXS A;  2RPQ A;  2PE9 A;  3MTN B;  4FA6 A;  2DAJ A;  1Z87 A;  4K7S A;  2L8J A;  2DX5 B;  3PRE A;  3A1Q A;  4TUU A;  2YT1 A;  4MGK E;  1H8C A;  4MSM B;  2ZCB A;  1P98 A;  3WIM A;  4KHO A;  2IO3 B;  5LON B;  3QWM A;  4AJY B;  4F1S A;  1WXM A;  2J59 M;  3ML9 A;  1WRD B;  3APD A;  3HW2 B;  4PYU A;  2YSZ A;  4IUM B;  4NJ7 A;  3PSC A;  2L1C A;  1HE8 A;  2I1K A;  2K2U A;  4DBG A;  1SHC A;  3CST A;  3B08 A;  1P5T A;  3RUI B;  2IY1 B;  4KDI C;  1UPQ A;  5LXH A;  4IM2 A;  2MP2 A;  2BCJ A;  1KI1 B;  2J7Q B;  1U2B A;  4EFO A;  3UIP B;  4HXD A;  4G3X B;  2D9W A;  3N7C A;  3VTV A;  2BGF A;  5BO4 B;  3L08 A;  1V81 A;  4AP4 C;  3MHS D;  1P3R A;  3ZTD A;  1XD3 B;  2KMA A;  4NSW A;  3V60 A;  2B3A A;  4K7W A;  3RZW C;  4JLC A;  4BOS C;  4URK A;  3S2A A;  2Z0Q A;  1D3Z A;  2N0Y A;  1M94 A;  4GMV A;  3H7P B;  2IBI B;  2VRW B;  3ZIM A;  2KLG A;  3IHP C;  2COD A;  1XKE A;  2VRR B;  1FHX A;  3ML4 A;  2G4D B;  2FNJ B;  1FOE A;  3SU8 X;  4FJY A;  5D94 A;  2KLC A;  1KZG A;  1WGY A;  1WI1 A;  3H1U A;  2O2V A;  2C60 A;  4WSF A;  1GG3 A;  3VUW A;  2O6V A;  2ABD A;  2BYE A;  1XT9 B;  3QWZ B;  2K6Q A;  2PJH A;  3PV1 A;  2Z59 B;  2KFK A;  2KZR A;  4B6W A;  2V1Y A;  2AWT A;  1V5M A;  4HHV A;  3RZF A;  2D4Q A;  1ZW7 A;  2MWN B;  1BTN A;  2Z0O A;  4FBJ B;  3QHT A;  2D3G A;  2KWU B;  1WFY A;  1ZSQ A;  1WZ3 A;  3E9P A;  2Z0P A;  5E6N A;  3FEH A;  5HE1 A;  4ANV A;  4WQO B;  3EPY A;  5AZH A;  3IBE A;  2XEW A;  3PHW B;  4TQ1 A;  5D3X A;  2I5C A;  3VUX A;  2ZVN A;  5C6R A;  2AL6 A;  4ANW A;  2ASQ A;  3PTF C;  2ZPN A;  3FSS A;  4HB2 B;  3BY4 B;  5DH9 B;  4X57 B;  1ACA A;  4HJK A;  1YX6 B;  2YLM A;  2RLO A;  1BTK A;  4KIK B;  2RGN B;  4HCP B;  2LUL A;  2JXX A;  4IM0 A;  2EMS A;  2E2X A;  3PGE A;  1X86 A;  1H4R A;  4NQL B;  1V5T A;  2RGF A;  3QK0 A;  1X11 A;  4MEM A;  3M95 A;  2MA9 B;  3D8E A;  1GNU A;  3RD2 A;  4BKS D;  2NPT B;  4GDL B;  2L00 B;  2KN5 A;  3ZW3 A;  4GU2 A;  2QHO A;  3CMM B;  4FHK A;  4K1R B;  4JKD A;  2YT0 A;  3NZU A;  4LDT B;  4NAW B;  2LOX A;  3H7P A;  1PFJ A;  3PVL A;  4TV3 A;  3WAO A;  1NDD A;  4J6I A;  2WDT B;  3DXD A;  4G50 A;  1WGH A;  3T9L A;  2MFQ A;  1QC6 A;  4FHJ A;  2CU1 A;  1WMH A;  3MDB C;  5FI0 A;  3AU4 A;  2GBM A;  1WF9 A;  1ZKH A;  2RNR B;  4CHM A;  4EZL A;  1XQQ A;  5LOP B;  1X1M A;  3APC A;  4I6L B;  2WH5 A;  2NBV B;  1GGO A;  3DVG X;  3DPD A;  1WY8 A;  3F0W A;  3ZRC A;  2D9Z A;  1YJ1 A;  2N23 A;  4K2O A;  4NNJ B;  4W9F A;  1UNR A;  1EAZ A;  3KRX A;  2H7E A;  4HDQ A;  1SIF A;  1WMH B;  1TXD A;  2LKO A;  2LWP A;  4B6H A;  2NS5 A;  2DYQ A;  4BKS A;  1U27 A;  2UZS A;  1OEY A;  2LVQ A;  4A6K A;  2KDB A;  1WIA A;  1WJ6 A;  2Z0D B;  4JKB A;  5JLJ B;  3OAN A;  2DHK A;  2CS4 A;  1V61 A;  4WJQ A;  1X1F A;  2JF5 A;  1WZ0 A;  2KFJ A;  2LGX A;  5D6J B;  2HE7 A;  1WH3 A;  2K1F A;  2EKE C;  5E6P A;  2V4L A;  2MW5 A;  3R7Q A;  2IO1 B;  3SBT A;  2CY4 A;  2NBW B;  2CHW A;  4WJN A;  5KHQ A;  2PEA A;  4DDG D;  3UZT A;  4DX9 0;  3V5W A;  2NMB A;  4M8M A;  4HB4 B;  2KDI A;  2JVC A;  2ZZP B;  3DXE A;  4GDL A;  4HVB A;  1P9D U;  4W9E A;  5KCV A;  4KHB B;  4GPT B;  2NZ8 B;  4OVV A;  1PLS A;  3ZNI D;  3UF8 A;  2MP2 B;  2FAZ A;  3DXC A;  1T0Y A;  2YS1 A;  4CHK A;  5D3Y A;  3M3J A;  2ZNV C;  3W1S C;  1Y5O A;  2K2J A;  5JZE B;  4KVG B;  2JPH A;  1HBK A;  2GBK A;  3VTW A;  4MM3 A;  3KVF B;  5J3Y A;  4HCN B;  1RJ2 A;  1I7A A;  2HRJ A;  2O6V D;  4A6F B;  1UNP A;  1MIZ B;  3KSY A;  3ZVR A;  5C5B A;  5DCN A;  4XWX A;  3E9L A;  2LGY A;  2JZ3 B;  2KJH B;  5IA7 A;  1QQG A;  2XQN M;  5J3Q A;  4HAV B;  3ML8 A;  2NR2 A;  1P0R A;  2ELB A;  4ANX A;  2DIK A;  1E8X A;  3KUZ A;  2KJ6 A;  1E8Y A;  4P7I A;  2K00 A;  1QZE A;  3CSF A;  2KWC A;  3PLU A;  1DDM A;  2BYF A;  4W9H A;  4WJ7 A;  3WAM A;  2XK5 B;  4IW0 A;  3HHM A;  3TMP B;  3ZDM C;  3L13 A;  2IY0 B;  4FJV B;  1FXT B;  3NY5 A;  2Q13 A;  5CHF A;  2K8H A;  3ENB A;  1TGZ B;  3ODX A;  4PQ0 A;  5GOW B;  2MWS B;  4A3P A;  1W1G A;  5HE3 A;  3A1Q B;  4AJW A;  1VD2 A;  2PZ1 A;  2REX A;  4WWP A;  5L95 C;  4KSK C;  1DDV A;  3D8D A;  3LDZ E;  3KH0 A;  2KNB A;  2W2X D;  3IFW B;  2LVP A;  2G35 A;  1EF5 A;  2CHZ A;  3ZNZ B;  3TFM A;  1V49 A;  4E71 A;  4CO7 A;  1V89 A;  2LXC A;  3ONS A;  4XX5 A;  1UNQ A;  1LB1 A;  1WR6 E;  1JRU A;  1KLV A;  1KZ7 A;  2KCJ A;  2RQ1 A;  5JHG A;  1RAX A;  5DI9 B;  2GCJ A;  3JSV B;  2K8C A;  4IFS A;  4BBK A;  2ZPY A;  5C1Z A;  3VUY A;  4HAU B;  5JVL A;  3QCA A;  1J0G A;  2FCM A;  1W1D A;  1L2N A;  5CLL B;  1WJ4 A;  1E5W A;  3GYO A;  3U30 A;  3ZDT A;  3ENE A;  2KQ7 A;  2R2Q A;  2UVM A;  3ZNG C;  2K8B A;  3A9J B;  4ICV A;  1WJ1 A;  2KOX A;  2P0H A;  2MBH A;  1MAI A;  4G0N B;  3L10 B;  4BKT A;  4JIO U;  2M4N A;  4BVU C;  4FLH A;  3R7R A;  4JGH B;  3CIK A;  1WGD A;  2MSE D;  1GUA B;  3DBS A;  5JHH A;  2KD0 A;  1V5P A;  2HTH A;  4GDK B;  2MDX A;  3TW1 A;  2KQS A;  4IG7 B;  2L05 A;  4C0A A;  2LJ5 A;  3V62 A;  1X05 A;  3V61 A;  1UEL A;  1A5R A;  4IAP A;  3AU5 A;  3AXC A;  3KW5 B;  3DVN V;  1BWN A;  2C9W B;  3X23 A;  2COP A;  4M8N A;  4ZYN A;  5TR5 A;  2LOZ A;  3KRW A;  1XX0 A;  2K6D B;  3VAW A;  1Q5W B;  3HM6 X;  3WAN A;  2DHJ A;  2KC1 A;  3DOW A;  2ZCC A;  4WWN A;  4F7H A;  4MGY E;  3PVW A;  5LLI A;  4MGI E;  3GZN I;  4DHZ B;  3A8Q A;  4KIK A;  3FM8 C;  1KC7 A;  4HK2 A;  3WAP A;  1YQB A;  2CQU A;  1U5G A;  3N30 A;  2D9Y A;  4MY6 A;  3X0W A;  4RM9 A;  3UQB A;  1GC6 A;  1NI2 A;  2GBR A;  2KO3 A;  1ST7 A;  2W2X C;  1PMS A;  4IC7 B;  4AUQ C;  1MK9 B;  2N7E A;  2FCQ A;  1V88 A;  1OQY A;  3T06 A;  3C0R B;  4NJ6 A;  3DDC B;  4Z2M B;  4F8C B;  2EMT A;  4Z2N A;  5DPW A;  1IRS A;  1V5U A;  1VBG A;  1Y19 B;  3EHV A;  1V2Y A;  2A4Z A;  2WYQ A;  4I6P A;  3ODO A;  4DBB A;  1Q0W B;  1XR0 B;  3DVG Y;  1WGQ A;  2MQJ A;  3ZUN A;  1F9J A;  4BBN F;  5J2R A;  2OJR A;  2COC A;  4ASW C;  4MJS B;  2BYV E;  1U4A A;  4PS8 A;  1XCG A;  4K2P A;  3QX1 A;  2L2I A;  4FJZ A;  4GDK A;  2RSG A;  3L0W B;  1WI0 A;  4B9K A;  3PP2 A;  3VFK A;  4ILH A;  2DLW A;  1FHO A;  2A5U A;  4IWQ A;  2DKQ A;  4MT7 A;  4W9G A;  4DX8 A;  2GCL A;  3I3T B;  2N9P C;  5FI1 A;  2CB8 A;  3VH3 B;  4HDO A;  2ZEQ A;  1IP9 A;  4JK8 A;  3ZRF A;  2L76 A;  4IOY X;  3DBL I;  2DX1 A;  4FUL A;  2LRU A;  2JZZ A;  4YON A;  4LJP B;  2KK8 A;  4LJO B;  1UH6 A;  4MEL A;  1J0W A;  3H9D A;  2P0F A;  3WAL A;  2G3Q B;  2DYN A;  4CYE A;  4KDL B;  2Y5B B;  2N9X A;  5C23 A;  1RFA A;  1U5D A;  2DN6 A;  1C1Y B;  3KUC B;  5J18 A;  3BJI A;  5JH5 C;  4IWP A;  2WWZ A;  1Q1O A;  4EOY A;  5DPS A;  3VQI A;  1LQB A;  1FGZ A;  3A98 B;  1NVL A;  1WR1 A;  4YL8 A;  1YD8 U;  4MGZ E;  1FHW A;  2YVC A;  2ADZ A;  4MK0 A;  4WVF B;  2KXJ A;  2KTR A;  2RUK B;  1Q67 A;  3HIZ A;  5HE2 A;  2KVR A;  2KJR A;  3FLV A;  1U29 A;  3A4S C;  1ZVR A;  2CRF A;  1U5E A;  2DX5 A;  2D10 A;  4W9K A;  3TL5 A;  4DXA B;  2MBO A;  3UGB B;  3ZLZ A;  4BOZ B;  5E6O A;  3F5R A;  2DAF A;  3TBL D;  1V80 A;  3SO6 A;  3V6C B;  3ULB A;  2YS5 A;  1V5O A;  2LBB A;  3SDL C;  4XC2 A;  4EMO A;  1CMX B;  1NBF C;  2WX1 A;  4DHJ B;  2MBQ A;  2FCS A;  3MPX A;  2D9V A;  2L7R A;  3H6N A;  2KX0 A;  5L83 A;  2DKP A;  3HM3 A;  2ZVO A;  3PRZ A;  4EKU A;  2G45 B;  5DHF B;  1FB8 A;  2ZJD A;  2DYO A;  2DHZ A;  2H7D A;  2OQB A;  4MJS A;  1SGH A;  4GSW A;  4EUT A;  2X18 A;  4L6E A;  1UGM A;  4KHA A;  4JL9 A;  5CHV C;  5C79 A;  2R09 A;  2W2W A;  2L3Z A;  2VKI A;  2R0D A;  4NY0 A;  1WM2 A;  2LVO A;  3A9J A;  1GC7 A;  4JKH A;  3VXW A;  3TCA A;  5EDS A;  4IWO A;  5DIF B;  1BT0 A;  3CXB B;  2JY6 A;  2FDQ A;  4E74 A;  3KY9 A;  2BF8 B;  2EC1 A;  2BWE S;  4DHJ D;  2M1M A;  1KBL A;  2RR9 A;  4ZDV A;  2OTX A;  4AWJ A;  4W9D A;  2FJL A;  3DQV A;  1LM8 B;  3RCZ A;  3ZTC A;  2IYB A;  2DZJ A;  2KMC A;  5KQ1 A;  1UBI A;  1NTI A;  2FJ9 A;  3HK0 A;  1WX8 A;  3PS6 A;  1NU2 A;  1M7R A;  3TVV A;  3VH4 B;  2R2O A;  2C7H A;  3P7Z A;  2COA A;  4HB0 B;  4GOC A;  3A4R A;  1WXV A;  4HAW B;  4PYZ A;  2JRI B;  4ICU A;  3GOE A;  1PQS A;  4NQK E;  1FAO A;  1HB8 A;  1HB6 A;  1C3T A;  2WX0 A;  5G55 A;  3VDZ A;  3E9O A;  1WYW B;  1WX7 A;  3P6A A;  3DBH I;  3RUL A;  2KTF A;  3AJ4 A;  3NS8 A;  4JKF A;  4W9I A;  1UPR A;  1DDW A;  1NTV A;  3N32 A;  3L54 A;  2JT4 B;  4F7U P;  3SUZ A;  3QJZ A;  3H7S A;  4B95 A;  2CY5 A;  5D27 A;  4EZK A;  2LZ6 A;  4KZC A;  5KQ4 A;  1TBE A;  1UZX B;  2I5F A;  2JUO A;  3A33 B;  3E66 A;  2M0X A;  2NVU I;  4W9L A;  1WJN A;  3A9K A;  4K81 A;  2P0D A;  5FR6 A;  4TKN A;  3K9O B;  1DYN A;  4HAT B;  3IVF A;  2N9E B;  1LW3 A;  4KZ0 A;  4A6F A;  1V86 A;  1V6E A;  3G9W A;  3DBR I;  1WXA A;  4HLE A;  4N9F 4;  2AEH A;  2VSZ A;  2CHX A;  1K5D B;  1WE7 A;  4E3C A;  2FUH B;  3APF A;  2GJY A;  4HWI B;  2DZK A;  1K5G B;  4II3 B;  2UZR A;  3ZVV A;  4Y94 A;  5HE0 A;  3VTU A;  2ROZ B;  4NAW A;  2NBU A;  1OMW A;  1UEF A;  5J17 A;  1RRB A;  4WJO A;  3EEC A;  2MCN B;  3JYU A;  1IYF A;  3R66 C;  1E8W A;  1ZM0 A;  1FGY A;  3RYT A;  1TQZ A;  3PRM B;  2LXA A;  3HQC A;  4PS3 A;  1J8C A;  2KDF B;  1LFD A;  2KX3 A;  3V6E B;  1KOT A;  1XOD A;  4BFR A;  1S3S G;  2P8V A;  3QIJ A;  2LI5 A;  2Z0E B;  1E7U A;  2MRP A;  4D0N B;  3U8Z A;  1N3H A;  5J3T A;  1BAK A;  4I6N B;  2KGX B;  3OJ4 B;  2N1W A;  1RLF A;  3TJP A;  1ZC3 B;  4GN1 A;  1WVH A;  2LAS A;  4ILJ A;  5CX3 A;  2UWQ A;  1KJT A;  4NPN A;  1R4N I;  1WGU A;  2Y7B A;  2MLB A;  4A20 A;  4RM8 A;  1E8Z A;  2KTR B;  2BWF A;  3MJW A;  2KHW B;  5KHO A;  2D9X A;  4DHZ E;  3JW0 X;  4CHJ A;  3JSV A;  4A3O A;  5JP4 A;  3P2B A;  3ECI A;  2OOB B;  1YX5 B;  2C5L C;  3VOQ A;  2GMI C;  3KUD B;  3EFU A;  1WX9 A;  3W1Y A;  3SD5 A;  4ZRJ A;  1B55 A;  3ZKJ C;  5G2N A;  2M38 A;  1I35 A;  1EF1 A;  2LG1 A;  4PNK A;  3SBG A;  2LD9 A;  1DRO A;  5C16 A;  3QQ8 B;  4RMA A;  3VVW B;  5LXI B;  3PVU A;  3PEG A;  4FN2 A;  5DHA B;  1UBQ A;  4GGQ A;  4ILG B;  3M63 B;  4ANU A;  4M0W B;  1X1G A;  2DZI A;  1VCB A;  2LRW A;  3L16 A;  4PS7 A;  1WGG A;  5EFX A;  1OY2 A;  2HTH B;  2K25 A;  2QKL A;  1EGX A;  2IO2 B;  2KDE B;  2KAN A;  5D7G A;  1TTN A;  2CKH B;  5CLQ B;  1I42 A;  2DHI A;  2FIF A;  3ALB A;  4JKG B;  3UIN B;  3A9K B;  4K7U A;  3ZNH B;  4JQW C;  4JK9 A;  1OQN A;  3GYP A;  2DEN B;  1KM7 A;  2DA0 A;  2IO0 B;  5CTR C;  2AYO B;  3AI5 A;  2RD0 A;  2RSU A;  4MH0 E;  2IFS A;  2DZM A;  2C7M B;  4A6H A;  3A8P A;  3B0A A;  1TJ6 A;  1W1H A;  2LGD A;  2W9N A;  2N7D A;  4TYZ A;  2MBE A;  3AUL A;  3N3K B;  3RCP A;  3Q3J A;  4K17 A;  5HKH A;  4MDK E;  3PZD A;  2RVB B;  2J0K A;  1Y8R C;  1K8R B;  4BBN C;  3QAR A;  2I1J A;  3R3M A;  3U7D A;  2GOW A;  1E7V A;  2DTC A;  3NSU A;  5L81 A;  3QA8 A;  2XBB C;  2X0S A;  5DPR A;  4GMX B;  2DFK A;  2MKR A;  2L0F A;  2K39 A;  3Q3F A;  4DWF A;  3LJU X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...