1NI2A

Structure of the active ferm domain of ezrin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Active N-terminal Domain of Ezrin. CONFORMATIONAL AND MOBILITY CHANGES IDENTIFY KEYSTONE INTERACTIONS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Ezrin
total genus 80
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ni2A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ni2A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ni2A01
1HB8A 2NS5A 2EJ8A 4FULA 3ULBA 2O6VB 2CS4A 3L08A 1UZXB 2LGYA 4MK0A 2V4LA 2D07B 4FHKA 4ANUA 3PVUA 4Y94A 2QKMA 1R4NI 1AWEA 1TZ1A 2M17A 1I2HA 1QQGA 2N1VA 2RNRB 2C5LC 3IHPC 4NQLB 4F8CB 2DYBA 2K2UA 2BWFA 5HKHA 2V76A 3RT3B 3V62A 3ZTCA 2AWTA 3NY5A 1W1GA 5JHAA 4FHJA 2CU1A 4K2OA 3SO6A 4KDLB 4EOYA 5C5BA 1YJ1A 4HPMB 4AP4C 5L83A 1L2NA 3R3MA 4AUQC 2CHXA 3IG3A 3R7QA 3A8QA 4E3CA 3O96A 2CAYA 4FJYA 4EEWA 2KWVB 4WJQA 5C16A 3UQAA 2RGFA 4C0AA 2N23A 2NPTA 2O6VD 1L7YA 2K2JA 2QHOA 4W9HA 2OOBB 5CTRC 5AZFA 1X11A 1MG8A 2B3AA 2GBNA 1UBQA 4DHJB 2KFKB 5J3QA 1V5OA 3ZTDA 5LXIB 2X18A 2MP2B 2ZZPB 2I1JA 1OQYA 2ELAA 3DOWA 1E8XA 2GJYA 4GSWA 3DXCA 3TVVA 1V6EA 4M8MA 4HAVB 1VD2A 3UZTA 3NOBA 3WAOA 3N30A 3TBLD 2KMAA 3O65B 2LXAA 3SDLC 4HAUB 2NCNA 4MM3A 4WSFA 2BYEA 3P7ZA 4MT7A 2L3ZA 3EPYA 2CY5A 3X0WA 1E8YA 1HBKA 2A4ZA 3EFUA 1DDWA 2JZ3B 1WVHA 2WX1A 5DHAB 2VRRB 1WGYA 4GDKB 4A6KA 1UNQA 2LKOA 3OLMD 4EZLA 3L10B 2DX5B 3TW1A 4TQ1A 2I5CA 3KUCB 1PQSA 2LGXA 3W1SC 3A8PA 1RAXA 2JUOA 4MH0E 3AU4A 1OY2A 4KHOA 2L8JA 3A9JB 4MDKE 2IO0B 3DBRI 5D3VA 3SD5A 4GN1A 2JVCA 4NY0A 5FR6A 1MK9B 2C60A 2FAZA 4XWXA 1WR1A 1ZVRA 2KJRA 4B6WA 3CSTA 4URKA 5C23A 3TIXA 2ZVOA 1X05A 1XODA 3TCAA 4XC2A 4BBNF 2MA9B 2W2XD 3ONSA 1Z87A 2LXCA 1XKEA 1H10A 2GBJA 2KC1A 3APDA 4RM8A 3VDZA 1JRUA 4HK2A 3RCPA 3CIKA 4HWIB 1EVHA 4W9LA 1EO6A 5JHGA 1FHOA 3SNHA 3TO1A 2VKIA 1EF1A 1WY8A 2JPHA 4MGKE 4AJWA 4DHZB 4DDID 3ENEA 2LVQA 1TTNA 1ZKHA 4LDTB 5IJMA 3VTUA 2DLWA 2YS5A 4ASWC 1MK7B 3ALBA 4F1SA 5D7GA 2MBBB 2G35A 2P0FA 4HAXB 2LOZA 5JLJB 1WZ3A 2DAJA 2KFJA 2KMCA 2LUEA 1V9JA 4HCPB 4JQWC 4DHZE 4F7ZA 2KK8A 5CLQB 2BYVE 3V61A 1NTVA 5JH5C 3RD2A 2Z0QA 2RSGA 2HJ8A 3H7PA 3D8FA 1MPHA 1UD7A 1YX5B 2BWES 1U29A 1WYWB 1WG7A 1AARA 2KTFA 2XK5A 3QX1A 2MLBA 3KUZA 3UINB 4M8NA 1V49A 2C7MB 3LJUX 1SIFA 2LRUA 3RCZA 4WVFB 2NBVB 2ZNVC 2NPTB 3RZWC 1GNUA 4K17A 2FUHB 3DXDA 5D3WA 3DBSA 2DZMA 5DPRA 1V5TA 3B0AA 3R66C 3R7RA 1ZM0A 1WX8A 5FI1A 2J0JA 4GZUA 2ZEQA 1PMSA 4HAWB 3APFA 1EUVB 1WXSA 1YIWA 2DHZA 4W9JA 5LXHA 4W9GA 2KVRA 2KDFB 4WAAA 1IYFA 3PG7A 3PP2A 4RMAA 2L0TA 2ZVNA 2C9WB 4K2PA 4GU2A 3H9DA 1EAZA 3A4SC 1CMXB 1NBFC 2FIFA 4LJOB 3PSEB 4WWNA 1WI0A 2KHWB 3VXWA 1U5EA 1Y19B 3K9OB 4MSQB 2Z59B 2W2WA 1LM8B 5D3YA 2JY6A 3AULA 3ML9A 4HCNB 2KLCA 2JP2A 3SHQA 2UZRA 3Q3JA 1M7RA 5J3YA 2JRIB 1Z2MA 2KANA 3QQ8B 4MSMB 4WWPA 2K8BA 2FNJB 4KHBB 1D3ZA 2EMSA 3HQCA 2GOWA 2P8VA 4ANXA 3DCGA 5DPSA 3JYUA 2FCSA 3EC8A 3L17A 2BCJA 1FAOA 4EZKA 1XR0B 5C6RA 3L0WB 4HVBA 2FJ9A 2I1KA 1U2BA 4II2B 2FCMA 3ZVRA 4Z2NA 3MJWA 5CLLB 2L76A 1ZW7A 1YD8U 2C7NB 2W9NA 3OJ4B 3PGEA 4EZJA 2MCNB 2GBRA 4FJZA 4NAWA 1U5DA 1WXVA 2OJRA 1FGYA 2KOXA 2KTRA 4GDLB 4A3PA 1WGDA 2ZNVB 4B9KA 2IFSA 3DVNU 4W9FA 3RZFA 1WRDB 4DX8A 1V80A 1K5GB 3A9KA 1RRPB 1UNRA 1H8CA 1XD3B 3PLVA 2RSUA 1FOEA 4DBBA 2RPQA 5HE2A 4GMVA 4IOYX 1WJNA 2G3QB 4GGQA 2WWZA 4KDIC 4W9CA 2L7RA 3W1YA 3T06A 3ZRCA 5C79A 1GJZA 3ZKJC 3DVGX 3BY4B 4MGZE 4NJ6A 2BPSA 4ZYNA 4A20A 2DYMA 4HATB 1NDDA 2Z0DB 2N9EB 2HE7A 2DHKA 3B1LX 1E8ZA 2DHIA 2NMBA 1RJ2A 3FEHA 3Q3FA 4MEMA 5D2MB 3ZO5B 2GMIC 2K6QA 4BKGA 4HLEA 2QKLA 3DBHI 2FCQA 5E6OA 1BWNA 4KVGB 3UGBB 2O2VA 1J0WA 2W2XC 4DX90 2MRPA 4LJPB 3VUYA 3ZLZA 4NJ7A 2G45B 4HDQA 2UZSA 4B6HA 4IUMB 3GYOA 3T8MA 3D8EA 4CHJA 2N4FA 2HRJA 1Y5OA 1WGRA 4IW0A 2DX5A 2GCJA 1U27A 2IY1B 2D10A 1WJ1A 1ZC3B 4KZCA 1Q0WB 2K39A 3GOEA 2EMTA 5J17A 1BTNA 4DXAB 3P2BA 1V5PA 3IBEA 3FP5A 2KQ7A 1G6JA 5TR5A 1GC7A 1MIZB 2COAA 4HB0B 2DZJA 4JIOU 4IWPA 3VH4B 2PJHA 4PYZA 1KI1B 3VAWA 3F0WA 1P6SA 2BKFA 3ZNHB 2UWQA 4WJPA 1I42A 4IAPA 2UYZB 1WE7A 3WALA 2KX3A 2WH5A 3VTWA 3ZNZB 1RFAA 1LXDA 2VSZA 2KC2A 4IM0A 2PE9A 3RUIB 3QIJA 4EJNA 3M1IB 2V1YA 4CYEA 1WMHB 3KYCD 2KO3A 2G4SA 4YL8A 2NZ8B 1B55A 3DQVA 4IG7B 4B95A 1OQNA 2L2IA 5DPTA 2MFQA 1SE9A 1C3TA 1NI2A 2ROVA 2DX1A 3I3TB 1WI1A 3VUXA 1OEYA 2NBUA 1N3HA 2MWNB 2Y8GA 3U8ZA 4A6FA 1P3RA 2D11A 2COCA 3QCAA 2LI5A 2LVOA 1X1FA 4IM3A 3NZSA 1NTYA 1ST7A 3PSCA 3DBLI 4LCDE 4W9KA 3ML8A 4BFRA 4MELA 4KZ0A 1V88A 3V6EB 3VUWA 2XK5B 1Q67A 1TBEA 2L00B 3A1QB 4I6NB 3ZVVA 4W9IA 2NVUI 3JSVB 1U5GA 2AEHA 3JVZX 1WMHA 2PPHA 1EF5A 4BKSD 1GUAB 4Z2MB 1UBIA 2N9XA 2LZ6A 1V5MA 5J3TA 5FI0A 4K7UA 5J2RA 2LOXA 1X1MA 2Y7BA 4KSKC 4KSLC 4W9EA 2J59M 2CQUA 1IRSA 2V3SA 1WJ4A 4BBNC 1A5RA 2DKPA 3LDZE 4NQKE 1DROA 2DYOA 2K1FA 3VVWB 4KIKA 1X1GA 1WXAA 1P98A 3DDCB 3ZUNA 3SYXA 3MHSD 2GBKA 1TJ6A 1WM3A 2FIDA 3KYDD 1E5WA 2GCLA 4K81A 4CHKA 1SGHA 4F7HA 2DFKA 2DTCA 4PNKA 5JP4A 1GC6A 3D8DA 2LGDA 1OGWA 1YQBA 3U30A 2KWCA 3TJPA 2HD5B 2IO1B 4ZRIA 3NSUA 4KAXB 2UVMA 2Y8FA 3SUZA 1DDVA 1FGZA 3IFWB 1ACAA 5D6JB 3N3KB 5IAAC 4G11A 4TUUA 4XX5A 2IYDB 2D4QA 4HB3B 4HDOA 3A98B 3M62B 2YS3A 1XQQA 5C1ZA 3ML4A 1WE6A 1FHXA 1WJUA 1Y8RC 2GBMA 2KDBA 2KX0A 1OMWA 2MQJA 4DWFA 1DYNA 1OTRB 2KXJA 2YRYA 2CR5A 4F7UP 1QZEA 4WQOB 2IZVB 4PYUA 4FADA 3RULA 3ODOA 2YVCA 3CMMB 2M1MA 3EECA 4KIKB 3QA8A 3V6CB 3ZDMC 5DPWA 4BKTA 4WJ7A 5CHWA 3KUDB 2KCJA 2A5UA 2MBOA 3QC8B 2R2OA 3ULCA 2D9YA 2KN5A 2RD0A 5CHVC 2D9ZA 3M3JA 2M38A 2DKQA 3GYPA 2PEAA 3KRXA 1FXTB 3FSSA 2MX2A 5AZGA 5JHHA 1IP9A 2N9PC 3KY9A 1IPGA 1HE8A 3JSVA 2ELBA 3TMPB 3TL5A 5DI9B 1J8CA 3QWMA 1WGGA 1E8WA 4OVVA 3HHMA 2FDQA 1KZ7A 4FN2A 4WJNA 4HB4B 3HIZA 3PEGA 5LONB 1HB6A 2ASQA 3FLVA 2NR2A 4WWOA 5HE3A 3V60A 5AEKB 1LB1A 2LASA 2BYFA 3WAMA 2LG1A 4W9DA 3AJ4A 3BJIA 4BVUC 3VIAA 3QJZA 1T0YA 1UGMA 2IBIB 2K8HA 2KDEB 3PHXB 2KFKA 2K6DB 4IWQA 4K7SA 1WJ6A 1UEFA 2PZ1A 4RM9A 1WF9A 3TFMA 2N0YA 2R09A 4A6FB 4IM2A 1E7UA 3QARA 2N7DA 4AWJA 2RR9A 3NS8A 2M8SA 1KLVA 3L16A 5KQ4A 2BKRB 3A33B 4HPLB 3ZNID 3S2AA 5C5BB 3PT2B 2P0DA 4K7WA 2CKHB 1ZGUB 2LYDA 3VTVA 1WIAA 2LBBA 2D9XA 2I5FA 1RLFA 3W1SA 1ISNA 2H7EA 3PREA 4DBGA 1KOTA 4JGHB 4P7IA 1PFJA 2M0XA 3QWZB 2WX0A 4ICVA 2O6VA 2D9WA 1WGQA 5GOWB 1RRBA 1V2YA 2DYQA 2FCNA 2YF0A 2JXXA 1EGXA 2KQSA 4PQ0A 2M4NA 2YT0A 3PRPB 4FA6A 4PS8A 3H7PB 1XCGA 2H7DA 2WDTB 3DVNV 1TXDA 3AU5A 2REXA 1WFYA 5CX3A 1K5DB 4EUTA 4IWOA 2AL3A 4YONA 3B08A 3SU8X 3WIMA 1K8RB 1DBHA 2DZIA 2L05A 2LVPA 2NBWB 3ZNGC 5EDSA 3HM3A 2DHJA 3VOQA 4A6HA 4IC7B 3C0RB 3CSFA 4MJSB 4D0NB 5LOPB 1P5TA 1UNPA 2IO3B 3X23A 4TKNA 3UF8A 2KDIA 1P1AA 1M94A 1R4MI 3HK0A 4ZRKA 4KHAA 4A5KA 1S1QB 1XT9B 2DENB 5E6NA 4TQ0A 4F7GA 1DDMA 5HE1A 4BBKA 3OAWA 1M7EA 2N7EA 1E7VA 4G0NB 2YLMA 2CRFA 2JWZA 4LDTD 1I35A 1TQZA 3H1UA 4BOZB 5DHFB 1WM2A 3MDBC 5HE0A 5G2NA 4HAZB 2HTHB 1WX7A 3KW5B 1V5UA 2K00A 3L54A 1KM7A 1WZ0A 5AZHA 1NVLA 1TGZB 1WGHA 1YX6B 2MW5A 2ZJDA 3AI5A 5GMVA 3WANA 3ODXA 4AOFA 4TYZA 4TV3A 4G3XB 3OANA 1XX0A 1FB8A 2L1CA 1U4AA 1SHCA 1Z5SB 2DAFA 2MWSB 3A9KB 5J18A 2RUKB 3UQBA 2ROZB 1W1DA 1U5FA 4GPTB 3LJ3A 3WA0A 4GDLA 4ZRJA 2DN6A 5D27A 2LRWA 1LQBA 2IO2B 2KZRA 4NAWB 1H4RA 3EHVA 2OQBA 4IFSA 3VH3B 4AJYB 1Q5WB 4E71A 1WR6E 2PE6B 3A1QA 2DA0A 3KVFB 4HHVA 3L13A 4JLCA 1V86A 2N1WA 1MAIA 3PHWB 5LLIA 3VFKA 3GZNI 1FHWA 1S3SG 4EMOA 2OTXA 4NSWA 2KUPA 4CO7A 3PZDA 5CHFA 3FM8C 3N32A 4H8SA 1XD4A 4HJKA 2MP2A 3WYFB 3MTNB 3MPXA 1KZGA 2XEWA 1J0GA 5JZEB 2RLOA 1X86A 3H6NA 2D3GA 4WJOA 2ZCCA 2AYOB 4NPNA 2KNBA 2WYQA 3PPAA 1UPQA 2JRHA 2LJ5A 4BOSC 1KJTA 3NZUA 3D32A 3VHTC 1ZSQA 1F9JA 1W1HA 2CHWA 5D94A 4DDGD 5JHBA 2XQNM 3ZIMA 2ZCBA 3APCA 4A3OA 2J0MA 1V89A 1V81A 1VCBA 2C7HA 3PS6A 1C1YB 3OJ3A 3NHEB 2XBBC 5E6PA 3DPDA 2M14A 3U7DA 3ZDTA 3PRZA 4JL9A 5D3XA 4L6EA 4DK5A 2LD9A 2KLGA 1MIXA 2L0FA 3CXBB 4GIVA 1I7AA 4HXDA 1Q1OA 4M0WB 2RVBB 1ZC4B 5L81A 3KH0A 4X57B 2JZZA 3K9PB 5KHQA 4FLHA 4K1RB 2RQ1A 1OEYJ 2IYBA 2ZPYA 2J0KA 3PLUA 2DZKA 5DH9B 2CODA 3F5RA 2ABDA 3PVLA 1MKEA 4HAYB 1WXMA 2KWUB 2BGFA 4FBJB 4G50A 5BO4B 5DCNA 2IY0B 3AXCA 3QBVB 3N7CA 1UELA 2COPA 1UH6A 5EFXA 3VQIA 4ANVA 2MKRA 2D9VA 3G9WA 3PRMB 4EKUA 2R0DA 2JT4B 1GG3A 2BF8B 4PS7A 2YS1A 1WX9A 1LW3A 2ZPNA 3ECIA 1AQCA 3CF6E 5G55A 4FJVB 1V61A 3QK0A 4GXBA 3JW0X 4J6IA 3ZW3A 4XZ4A 2MBHA 3H7SA 3P6AA 2MBQA 3HM6X 2Z0EB 3M95A 3PTFC 1J19A 2Q13A 2CY4A 2DYNA 2O2VB 1NU2A 5KHOA 1LFDA 2AL6A 2KD0A 3M63B 4PS3A 4GB9A 4OVUA 4ZDVA 3UIPB 5IA7A 1P3QU 3QAQA 3SV1A 1BT0A 4GMXB 2Y5BB 1BAKA 2LULA 3RYTA 3T9LA 4MGYE 4EFOA 5L95C 2HTHA 1BTKA 2MSED 3KSYA 2ADZA 2JF5A 3DVGY 3PVWA 2KGXB 4E74A 4HB2B 2Z0OA 2MDXA 3KRWA 2MBEA 4ANWA 2KTRB 4BKSA 3V5WA 2CHZA 3PV1A 3QHTA 2K25A 4MGIE 2K8CA 1P0RA 3IVFA 2Z0PA 3HW2B 2J7QB 1WJMA 2EC1A 4GOCA 2VRWB 3A9JA 2R2QA 3ODWA 5KCVA 1QC6A 1P9DU 1WGUA 4I6LB 2KJHB 4I6PA 2P0HA 2YT1A 4CHMA 3KZ1A 2D2QA 3BINA 4MJSA 3UIOB 3WAPA 2G4DB 2RGNB 2KKCA 4ICUA 3ZRFA 2KJ6A 4GDKA 2EKEC 1E90A 5KQ1A 1PLSA 2YSZA 4KV2A 1UPRA 1NTIA 2COFA 2CB8A 2LWPA 3A4RA 2GS0A 4II3B 4N9F4 4NNJB 4MY6A 2E2XA 4DHJD 5DIFB 3DXEA 2FJLA 1WH3A
chains in the Genus database with same CATH superfamily
3N1XC 4FHKA 1WSPA 3PVUA 3PZ7A 1AWEA 1TZ1A 2M17A 3IHPC 3BVGA 4IOIE 1N61A 2DYBA 2BWFA 3RT3B 5JHAA 3NY5A 2K5PA 4KDLB 5E6JA 3R3MA 1ZXIA 1QOFA 2CAYA 2ONQA 4YTPB 2WXMA 5C16A 4W9HA 3EFCA 2OOBB 3B2FA 2GBNA 1UBQA 2KFKB 1V5OA 1D5XC 3ZTDA 2MP2B 2QJLA 1JWUD 2JYEA 2GJYA 4GSWA 4AQ7A 1V6EA 4HAVB 3NOBA 3UZTA 3WAOA 3O65B 2BB6A 2BYEA 2L3ZA 2JZ3B 4GDKB 4K3BA 2D3AA 2LKOA 3OLMD 2IPKD 4TQ1A 3AE5B 2HDEA 2D3BA 3KUCB 1PQSA 3A8PA 1RAXA 3DBLB 4ZRQA 3AU4A 1OY2A 4KHOA 2N9KA 4MDKE 2IO0B 3DBRI 5D3VA 2PVOD 3B2GA 4ZHOA 3BVMA 4NY0A 1ZVRA 3CSTA 3TIXA 1UWXA 2W2XD 2LXCA 1MG4A 4WAFA 1I4QA 2V3PA 3CIKA 4W9LA 2J53A 1EO6A 3ZXVA 1FHOA 1WY8A 3W5VB 3ENEA 1ZKHA 2YS5A 4F1SA 1JWAD 2P0FA 5JLJB 2KFJA 2LOZA 2Y5CA 4JQWC 3U30A 4DHZE 5CLQB 2BYVE 2J42A 2E3TA 2X38A 1XXGA 1ZUD2 1JROA 2RSGA 3KVFB 2BWES 3QX1A 2XK5A 1NI3A 2MLBA 3FC4A 2C7MB 2K22A 3I63C 2ZNVC 1Q10A 1FEHA 2NPTB 3RZWC 4K17A 5D3WA 2DZMA 3R66C 4RCOA 3R7RA 2INPE 1WX8A 1YIWA 2N0SB 4WAAA 1I4HA 1SE4A 3PP2A 3P4RB 3A4SC 1NBFC 4LJOB 1WI0A 2ACZB 4MSQB 4N58A 2JP2A 3SHQA 2KANA 2FNJB 1FXAA 2EMSA 2GOWA 4ANXA 5DPSA 4B0MA 1IBXA 3JYUA 3EC8A 1XR0B 4RGTA 3ZVRA 4CSQA 1YD8U 4NAWA 4YXDB 2OJRA 2KTRA 4A3PA 1L5PA 5IOIA 2KACA 1D5MC 1WRDB 1XLOA 1V80A 3NG0A 1FOEA 1CJEA 3VR9B 4W9CA 3W1YA 4BKSD 2L7RA 1ESFA 1J7AA 3BY4B 4MGZE 4HATB 2HE7A 3AEDB 3B1LX 4LNOA 4PT5A 3Q3FA 1SSNA 2G1EA 2FCQA 3UGBB 2ZW1A 2W2XC 4DX90 2MRPA 3A58A 4NJ7A 2UZSA 4B6HA 3D8EA 2N4FA 4OHJA 1U27A 2D10A 1FXIA 1L6UA 2H88B 2EMTA 1V5PA 2SEBD 3IBEA 1DOYA 2DZJA 4IWPA 3AEGB 2PJHA 4PYZA 3F0WA 3ZNHB 2UYZB 5FK9C 3VTWA 2SAKA 3W5UB 2FBWB 4CYEA 1MHHE 2QILA 1FCCC 3VR8B 2KDMA 3I5JC 2MFQA 1SE9A 2KMMA 2MJ3A 4MT5A 3GS2A 1WI1A 2NBUA 1NYRA 2MWNB 3U8ZA 5M4YB 1P3RA 1D6EC 3QCAA 4HRSA 4JKCA 4IM3A 1NTYA 4W9KA 2WXQA 4RF1A 3IAS1 4BFRA 5JVLA 3VUWA 2XK5B 3KLSX 4I6NB 3ZVVA 3A1QB 1K51A 1N63A 1FPYA 1KLGD 3E66A 3PO0A 3JVZX 2PPHA 2LFIA 1UBIA 1YMHE 2QCZA 4J3OD 3FKYA 5J2RA 3EGRA 4HEA1 3LDZE 2Z14A 4KIKA 4CQNA 4JX1C 2RMMA 2FIDA 1E5WA 4CHKA 4F7HA 4NJCA 4PNKA 2IO1B 4C7YA 1SE3A 3UI3A 3SUZA 1BMLC 2D4QA 4HB3B 4HDOA 1TKEA 3M62B 1FHXA 3C8YA 1OMWA 5EE9A 1AWDA 4DWFA 2YRYA 2CR5A 2N9LA 4F7UP 4KKIA 2YEPB 2WXRA 4PYUA 4FADA 2MEKA 3EECA 3ABVB 2M1MA 4KGTA 4KIKB 5H92C 4WJ7A 3QC8B 2A5UA 2D9YA 3DBRB 2D9ZA 1OQRA 2DKQA 3GYPA 1ET6A 5AZGA 2N9PC 2H89B 3JSVA 3TMPB 3NVVA 3Q3MC 4MACA 1E8WA 2PIAA 1FFUA 3VRBB 3I9V1 3NS1A 3HIZA 1HB6A 2W54A 3BK1A 3DHIC 1TS2A 1JCKB 1K53A 2LASA 2BYFA 3WAMA 1HA5A 3VIAA 4HROA 2K8HA 1HTQA 2K6DB 1UEFA 3GB1A 2GLSA 3BVZA 2N0YA 4A6FB 4C80A 3QARA 1HTOA 2J52A 3LYYA 4HPLB 4M00A 2P0DA 2RPVA 4FXCA 1ZGUB 1WIAA 1PGAA 1ISNA 1KOTA 4P7IA 2WX0A 4ICVA 2O6VA 4WWNA 2YF0A 4FA6A 2WDTB 3DVNV 2REXA 1KH0A 3B08A 1K8RB 2L05A 4QJ5B 5EE0A 1L6VA 3HM3A 2DHJA 4A6HA 4IC7B 4MJSB 3BWUD 2KDIA 1M94A 2Q5WD 2WXLA 4TQ0A 1WWTA 1XT9B 1AW7A 5G5GA 3OAWA 1GB1A 2CRFA 4BOZB 1IGDA 3MDBC 1WM2A 5G2NA 4HAZB 2HTHB 1WZ0A 1VZ7A 2INDC 2MW5A 1WGHA 4GNKB 3ODXA 3N20C 3OANA 4YTMB 1FB8A 2DAFA 3UQBA 3FVCA 1K52A 2I2YA 3LJ3A 4GDLA 2LRWA 2DN6A 2KYWA 4M02A 3EHVA 2JZPA 4IDIA 1WR6E 3A1QA 2DA0A 2L52A 4HJGE 1V86A 2HJ1A 3VFKA 2KUQA 4XWWA 4EMOA 1R4MB 3N32A 2XN9C 4C7ZA 3MTNB 3SBTA 1KZGA 2XEWA 2LGIA 3H6NA 2WXGA 4YSYB 2KNBA 2WYQA 1SXTA 1HZ5A 2JRHA 3NZUA 1VZ6A 3VHTC 1AN8A 1ZSQA 1CZPA 1W1HA 4A9AA 3APCA 1ENFA 1V89A 1VCBA 4ARIA 5E6PA 4JL9A 5D3XA 3NWFA 2LD9A 3R8BA 3E9PA 1FD6A 4GIVA 5BMIA 2WXFA 1ZC4B 3KH0A 3N1ZC 4FLHA 1OEYJ 4QXAB 1VBGA 3BIID 2DZKA 2AX5A 4HAYB 4B0EA 4FBJB 5BO4B 2DIKA 3QBVB 2COPA 5EFXA 4EKUA 2R0DA 2PMVA 3C19A 1LW3A 4REZA 1AQCA 1UWMA 4J6IA 2WXPA 3H7SA 1UF0A 3HM6X 1P7FA 1J19A 2O2VB 3RNCC 4PS3A 4OVUA 1HEZE 4GOUA 3QAQA 3RMKC 4EFOA 2D5GA 3GE8C 2D3CA 3B9JA 4XDCA 3PVWA 3L4PA 1SJED 2KTRB 5IRSA 2CHZA 4MGIE 2K25A 2K8CA 2Z0PA 4NQKE 4DXFA 1QLBB 1WJMA 4GOCA 4I6PA 3NZ3A 4E3CA 2YT1A 1JW9D 3KZ1A 3UIOB 3ZRFA 2KKCA 1E90A 3T3NA 4WH4A 4N9F4 4NNJB 2CB8A 4II3B 1TYGB 5JXVA 2E2XA 3RFZB 5DIFB 3OG5A 3DXEA 5DCNA 5GMVA 2NS5A 3WCQA 3NW8A 2WDRB 1XLNA 2V4LA 4Y94A 2QKMA 4NQLB 4F8CB 3T3OA 2PTLA 2Z59A 5HKHA 3V62A 3AE4B 4ZHPA 1XEEA 3SO6A 1RM6C 4EOYA 1TS3A 3U7ZA 3A8QA 1C77A 4FJYA 4N6EB 1Y56A 2RGFA 1JRPA 4TSSA 4C0AA 2N23A 2O6VD 2K2JA 5CTRC 1X11A 4QAYA 1GB4A 2WHIA 1JWBD 2L1AA 2Y5PA 4C00A 2ELAA 3N30A 4DDID 3SDLC 3U12A 2NCNA 5C3JB 1WXQA 3EPYA 3X0WA 1DDWA 4DIXA 5DHAB 1WGYA 5HI1A 2DX5B 4R3DA 4C56C 3HIEA 2I5CA 2LHDA 2ICIA 4JE3B 1JQ4A 3HSAA 3NWAA 4GN1A 1WR1A 4URKA 4ZRPA 4BBNF 1ZYIA 2KC1A 1H10A 2GBJA 1MI0A 1DOIA 3RCPA 1EVHA 4QJ3B 3TO1A 3EUB2 1EF1A 2JPHA 3R2IA 1C4AA 2DLWA 1J7CA 4OVVA 4HCPB 1JDEA 3R2TA 3Q14C 1YQ4B 4YTNB 2NBVB 3KWVA 1WG7A 1AARA 2E6XA 3LJUX 2LRUA 3RCZA 3GP7A 3DBSA 1V5TA 3B0AA 1KFYB 1ZM0A 3AE3B 2ZEQA 1PMSA 4HAWB 2KDFB 1EU3A 1IYFA 4RMAA 4TMAB 2ZVNA 1F1HA 1EAZA 2FIFA 3PSEB 2KHWB 1Y19B 3Q8BA 2Z59B 2W2WA 1LM8B 2DLBA 1V1OA 3QQ8B 4MSMB 3J9CA 1T77A 1FAOA 5JH5C 3KWLA 2FJ9A 2I1KA 2L76A 2C7NB 2MCNB 3AH7A 1U5DA 2KOXA 3ZYYX 1FGYA 4GDLB 2BBCA 2ZNVB 2GB1A 3DVNU 3A9KA 5H8YE 1UNRA 3PLVA 1P7EA 1NEKB 5HE2A 2G3QB 3AMZA 5C79A 1QT9A 4NJ6A 2BPSA 2DHKA 1E8ZA 2DHIA 2NMBA 1RJ2A 4MEMA 4YT0B 4BKGA 1N62A 3DBHI 4M01A 1J0WA 4WURA 4LJPB 3VUYA 4HDQA 1XF5L 3W2DA 2W55A 4CHJA 4L23A 2HRJA 3E9SA 2DX5A 4JKEA 1WJ1A 4KZCA 2OEDA 3MC9A 1Q0WB 1TT5B 3P2BA 3Q8EA 2KQ7A 5TR5A 4HB0B 2DNFA 1KI1B 1WYGA 2BKFA 4ACFA 2UWQA 4A55A 1I42A 3AN1A 2KX3A 1JWSD 1RFAA 1LXDA 2VSZA 4JKDA 2PE9A 4EJNA 3M1IB 1PFDA 2NZ8B 2GI9A 1OQNA 4S17A 2L2IA 4WQMA 4ITKA 1NI2A 4Q2JA 2DX1A 3I3TB 3DWMA 3VUXA 1N3HA 4A6FA 4K3CA 2D11A 2LVOA 1X1FA 1TY2A 5FR3A 4LCDE 3ML8A 4MELA 4KZ0A 3V6EB 4DQOC 2L00B 4US9A 4S0RA 1ACCA 2JX5A 4JK9A 1U5GA 2AEHA 3ETRA 1WMHA 2IGGA 4Z2MB 1V5MA 5J3TA 4K7UA 2Y7BA 1TJEA 4KSLC 4W9EA 2BT6A 1IRSA 1A5RA 2JXTA 1T0RC 5BMHA 4OW0A 3VVWB 3DDCB 3ZUNA 3SYXA 2WXHA 2GBKA 1WM3A 3DBHB 4UDUC 1E7PB 4ZOHC 2DTCA 3NSUA 2UVMA 1V1PA 3GZNB 3IFWB 5IAAC 3AE6B 2WDQB 1R4NB 1PGBA 1SB3C 4XX5A 2IYDB 2YS3A 1WJUA 3AEBB 2OHFA 1DYNA 1C79A 1QILA 4NZLB 4WQOB 2IZVB 2QC8A 3RULA 3ODOA 3CMMB 2V0GA 2PLPA 3P4SB 4BAXA 2KCJA 1I7HA 4DDGD 2R2OA 1GOZA 2KN5A 1QOAA 2M38A 2PEAA 1YJJA 5JHHA 2ELBA 3AECB 2FDQA 4WJNA 1L4DB 3V05A 3NJTA 4W9DA 4ILHA 3BJIA 4K7SA 2RDGA 2GRIA 4A90A 5HFYA 1WRIA 3NS8A 4JK7A 2OJWA 5D3DA 2M8SA 3L16A 5KQ4A 2BKRB 3ZNID 2CKHB 4RF0A 2Z8LA 2I5FA 2H7EA 3PREA 4DXGA 4JGHB 4LNFA 2M0XA 4O1NA 4MH8A 3PHXB 1RWSA 2DYQA 2JXXA 1EGXA 2MH7A 2NBVA 1XCGA 3U52E 4H2AA 3AU5A 1K5DB 4EUTA 4IWOA 1N5WA 4KX6B 3WIMA 3SU8X 1DBHA 2NBWB 3VOQA 3C0RB 5LOPB 1P5TA 2BYTA 3UF8A 1R4MI 4ZRKA 1C4PA 1S1QB 1R7SA 2TSSA 3P63A 4G0NB 2JWZA 1TQZA 1RFKA 5BYQA 1WX7A 3TEYA 3L54A 1KM7A 4RH6A 4L1RA 1STEA 5G5HA 2AQ1B 4G3XB 2MWSB 2FUG1 2RUKB 2ZKMX 2GUMA 3WA0A 2KZRA 4NAWB 3SBGA 3AM9A 2OQBA 1XCQL 4AJYB 4E71A 1Q5WB 1I4GA 2HTME 4HHVA 2V3NA 3L13A 2N1WA 1ZDXA 1MAIA 4JWUC 2WXJA 2OTXA 4NSWA 1VBHA 4H8SA 1DOXA 2RLOA 4WJOA 2ZCCA 2QEJC 2CHWA 4OVZA 2XQNM 3ZIMA 2ZCBA 3V3XA 2J0MA 2C7HA 3PS6A 3OJ3A 4L6EA 4DK5A 2NTSA 2L0FA 1I7AA 4M0WB 1Q1OA 5KHQA 2JZZA 3SR6A 3OHMB 1QQRA 2CODA 1MKEA 2K49A 1WXMA 2KWUB 1ZP0B 4G50A 5TSSA 2IY0B 1XLPA 3VQIA 2JSVX 4PS7A 2JT4B 2Z4DA 2YS1A 1WX9A 5G55A 4FJVB 1V61A 4US8A 2WXKA 1FNVA 2L32A 4XZ4A 3N1YC 3P6AA 3M95A 2B76B 2Q13A 2AL6A 1DYQA 4JKHA 3RNFC 1EWCA 3UIPB 1P3QU 1BAKA 2LULA 4JK8A 2HTHA 1C9FA 1XO3A 2MSED 3KSYA 2ADZA 1QKZA 3MC0B 2KGXB 1B9RA 4HB2B 3KRWA 2MBEA 2VZKB 3V5WA 3ZXRA 3QHTA 3AEAB 1P0RA 3HW2B 2EC1A 2G9HD 1KBLA 5KCVA 1L0YB 1WGUA 2KJHB 2RDHA 2P0HA 4CHMA 3BINA 3WAPA 2WXIA 2KJ6A 2EKEC 5KQ1A 1I4PA 4KV2A 1YN5A 2COFA 2LWPA 1KLUD 4MY6A 4DHJD 3V61A 2FJLA 2WS3B 1WH3A 1HB8A 1C4CA 2EJ8A 2O6VB 3L08A 4HKZE 1UZXB 2LGYA 4P6VF 4ANUA 2D07B 1R4NI 2N1VA 1I2HA 1QQGA 1HXYD 4HSIA 2C5LC 1GAQB 3MFGA 2AWTA 1GGOA 1W1GA 2CU1A 2X8XX 4AUQC 1FO4A 2JWUA 2WGSA 3MP9A 2EKIA 4NAMA 2WLBA 4DHJB 2EELA 2ZZPB 4ILGB 4OT1A 1OQYA 3DOWA 5IKCM 2BQQA 4M8MA 3DXCA 3TBLD 2KMAA 2LXAA 4MM3A 4MT7A 1WVHA 2WX1A 2VRRB 1UNQA 3L10B 3TW1A 1M4VA 5EE1A 4C4VA 1FIQA 4YWGG 2LJIA 4MH0E 5AUIA 2I38A 3A9JB 4P1BC 2JVCA 5FR6A 2FAZA 4B6WA 1X05A 1XODA 4XC2A 4OSNA 2MA9B 5T8IA 3ONSA 3APDA 3VDZA 1JRUA 3AE8B 3SNHA 2VKIA 2V9HA 3KQ4A 3RNBC 1SJHD 4DHZB 2LVQA 3LXFA 1NYQA 1TZOA 1TTNA 5IJMA 5D7GA 4HAXB 2KMCA 3ZTCA 2DAJA 4F7ZA 1V9JA 5BYRA 1MHXA 2RDBC 4JWSC 1NTVA 3RD2A 4LLGM 1FNUA 2HJ8A 3D8FA 1UD7A 1YX5B 2KTFA 4XYCA 1TS4A 1ET9A 4M8NA 3NUHB 3O13A 1SIFA 4WVFB 2FUHB 5DPRA 2J0JA 4GZUA 4W9JA 1EUVB 2DHZA 2KVRA 4KKJA 2FE8A 2L0TA 4GU2A 5LG4B 1CMXB 1U5EA 1VDVA 3AULA 3ML9A 3TEXA 2UZRA 3Q3JA 1M7RA 1OQQA 4LTUA 4KHBB 3IXSA 3HQCA 3DCGA 3Q8FA 1VLBA 2FCSA 5C6RA 4II2B 4Z2NA 3MJWA 2KVZA 1E10A 3AE7B 1WXVA 2WXOA 1WGDA 3RNAC 4W9FA 3RZFA 2INNE 1K5GB 1H8CA 2RPQA 2KQ4X 4GMVA 2JQRB 3ZRCA 1GJZA 1TS5A 3HRDD 4A20A 1NDDA 2Z0DB 2N9EB 3LB8C 1T5XD 2GMIC 2QKLA 5E6OA 1BWNA 4KVGB 4ARCA 3ZLZA 4LNIA 4IUMB 3T8MA 3GYOA 4HKQA 1LGRA 1Y5OA 2GCJA 4BZAA 4PK1A 1J7BA 2VH1A 2WU5B 1G6JA 3TEWA 3RNGC 3FP5A 1GC7A 1VJKA 1MIZB 2COAA 3VH4B 3VAWA 3Q8AA 1P6SA 4RGOS 4IAPA 1WE7A 4N59A 3WALA 2WH5A 2W3RA 4IM0A 1D4BA 3KYCD 2KO3A 2N7JA 3PZ8A 1B55A 2KIGA 4B95A 1CK1A 1IBXB 1C3TA 4KHBA 3EA6A 3ZGZA 1L0XB 5IN7A 2COCA 2CJOA 2LI5A 3NZSA 1FRRA 1FRDA 2KT7A 1JALA 3ZJUA 1Q67A 4W9IA 3FAHA 3JSVB 3Q3OC 1GUAB 2NTTA 2N9XA 2LZ6A 3HVZA 5FI0A 2LOXA 1X1MA 2CQUA 5MPOA 3OWEB 1DROA 2DYOA 2K1FA 1WXAA 3DCXA 3MHSD 1TJ6A 2DFKA 5JP4A 2LGDA 3D8DA 3Q6BA 1YQBA 2ON8A 3CWIA 3RNEC 2KWCA 4ZRIA 3DHGC 4LNNA 1YN3A 1DDVA 1FGZA 1ACAA 3HUIA 3A98B 5LNK1 1SEBD 1Y8RC 2KAJA 4XWTA 2KX0A 2BS2B 4L2YA 1OTRB 1QZEA 4CO7A 3V6CB 2YVCA 3QA8A 5DPWA 3SFEB 2YT2A 3ULCA 2RD0A 4L1BA 4M0WA 2K8EA 1ZOYB 2QIEB 3M3JA 1MJDA 3FSSA 2MX2A 3TL5A 5DI9B 1J8CA 1FNWA 1DGJA 3QWMA 1WGGA 1N6ZA 3HHMA 1KZ7A 4HB4B 3PEGA 3V60A 5AEKB 2ASQA 3FLVA 4WWOA 1LB1A 2LG1A 3AJ4A 1AYFA 4BVUC 2IBIB 1UGMA 2KFKA 3RPFC 4OZBA 4RM9A 2PZ1A 1TKGA 2R09A 4IM2A 2N7DA 1ZPSA 1FM0D 1KLVA 4EE2A 3PT2B 4K7WA 4KGSA 3VTVA 2LBBA 2D9XA 2NMQA 1PFJA 3QWZB 4AP4C 4EZJA 1WGQA 1RRBA 1V2YA 2M4NA 4PQ0A 2YT0A 1OFFA 1V97A 2H7DA 1TXDA 2AL3A 4YONA 3DHHC 3ZNGC 4D0NB 1UNPA 2IO3B 4TKNA 1P1AA 3HK0A 4KHAA 3P42A 4A5KA 1DDMA 4BBKA 2N7EA 1MFWA 1V1PB 2YLMA 4D2KA 2CJNA 4LDTD 1PUTA 5DHFB 3AE2B 3U4EG 3B77A 5AZHA 1NVLA 1TGZB 2ZJDA 1YX6B 1D3ZA 3WANA 4TV3A 1U4AA 1Z5SB 1D5ZC 1SHCA 3A9KB 5J18A 2ROZB 1W1DA 1U5FA 4GPTB 2FJUB 5AUKA 4YSXB 2PE6B 4JLCA 2DWQA 3GZNI 1S3SG 2KUPA 3PZDA 5CHFA 3FM8C 1XD4A 3BYYB 4HJKA 2MP2A 3WYFB 3MPXA 5JZEB 1X86A 2D3GA 1UPQA 4BOSC 2W3SA 3D32A 2IJ0A 5JHBA 1QOBA 2R82A 1C1YB 2KIEA 4WIPA 3ZDTA 5FKAC 4A8XC 3CXBB 1N5XA 5L81A 2IYBA 2ZPYA 2LMCA 3PLUA 1I4XA 1TY0A 3F5RA 3PVLA 3AXCA 1UELA 4ANVA 1KRHA 3GE3C 3PRMB 2BF8B 3ECIA 1T0QC 4GXBA 2MBHA 2VH2A 2MBQA 3PTFC 2CY4A 1NU2A 2KD0A 3M63B 5IA7A 2R61A 4MGYE 3Q3NC 1BTKA 1QOGA 1F0ZA 3MC8A 2JF5A 3H8HA 4E74A 2MDXA 4XGAB 4AS1A 4BKSA 2BVCA 4LK0M 4ZYSA 2Z13A 1VZ8A 1UNSA 1C76A 3ZJTA 2R2QA 1P9DU 1F2RC 2D2QA 4GDKA 1E0ZA 1PLSA 4IKGA 2YSZA 2JYTA 2M19A 4FULA 3ULBA 2CS4A 4MK0A 2RNRB 1A70A 3AEFB 2K2UA 2ZW0A 2V76A 1KC7A 4FHJA 4K2OA 5L83A 5C5BA 1YJ1A 2DBYA 4HPMB 3BK2A 2CHXA 3IG3A 1BUIC 3R7QA 3O96A 4EEWA 2KWVB 3E9LA 5IO9A 4WJQA 3UQAA 2NPTA 1L7YA 2QHOA 5AZFA 1MG8A 2B3AA 1MI1A 5J3QA 1FFVA 3NVWA 5LXIB 2X18A 1E6EB 2BW2A 2I1JA 1E8XA 3TVVA 5I2SA 1VD2A 4HAUB 4WSFA 3P7ZA 2CY5A 1NVID 1E8YA 1HBKA 2A4ZA 3EFUA 3Q2AC 4A6KA 3BYTB 1I4RA 4EZLA 1XCTL 4QJ4B 4XE0A 2PW9A 3FILB 2LGXA 3W1SC 2JUOA 2K0PA 5BMGA 2L8JA 3SD5A 3ENBA 1MK9B 2C60A 2KJRA 4XWXA 1BXTA 5C23A 2ZVOA 3TCAA 2LUMA 3NVYA 1Z87A 1XKEA 4RM8A 2PKOA 4HK2A 1JMLA 4HWIB 1CQVA 3P4PB 1YOVB 5JHGA 2WNMA 4AJWA 4ILJA 4MGKE 2INCC 4C4VB 4LDTB 3VTUA 4ASWC 1MK7B 3ALBA 2MBBB 2G35A 1WZ3A 2LUEA 2KK8A 4MM3B 2Z0QA 2V4IB 3H7PA 1NENB 4D6WA 1MPHA 1U29A 1WYWB 3UINB 3I57A 3KUZA 1V49A 3VRAB 2X0SA 2MHJA 1PGXA 1SF0A 1IUEA 1HQRD 2IDYA 1B1ZA 1TKYA 2LEKA 1GNUA 3DXDA 4WWMA 2L83A 2JU6X 5FI1A 3APFA 1J0GA 1WXSA 5LXHA 4W9GA 3PG7A 2C9WB 4K2PA 1SE2A 3H9DA 3VXWA 1F52A 3K9OB 2LHEA 2JY6A 5D3YA 4HCNB 2KLCA 5J3YA 2JRIB 1Z2MA 4WWPA 2K8BA 1T0SC 2P8VA 1EM7A 3L17A 4HVBA 2BCJA 4EZKA 3L0WB 1U2BA 1L0VB 2FCMA 3OJ4B 5CLLB 1EU4A 1ZW7A 2W9NA 3AV8A 3PGEA 2GBRA 4FJZA 1C78A 2CU3A 3BZDB 4B9KA 2YEPF 2IFSA 4DX8A 1RRPB 1XD3B 2RSUA 4DBBA 1WJNA 4IOYX 4KDIC 4GGQA 2WWZA 3T06A 3ZKJC 3DVGX 4ZYNA 2DYMA 1L2NA 3FEHA 2AQ2B 3ZO5B 5D2MB 4HLEA 1YJIA 2K6QA 1JWMD 1T3QA 5D3IB 2O2VA 4USAA 2WP9B 2G45B 3Q69A 1WGRA 2RRFA 4IW0A 2IY1B 3ZQ4A 1ZC3B 2K39A 3GOEA 5J17A 1BTNA 4DXAB 5BYSA 4JIOU 2IGHA 2QMTA 3E9OA 1DIKA 2WQYB 4WJPA 3ZNZB 2KC2A 3RUIB 3QIJA 2V1YA 1WMHB 2M56B 2G4SA 4YL8A 3DQVA 4JKFA 4IG7B 4JKGB 5DPTA 3TUOA 2ROVA 1IGCA 1OEYA 2Y8GA 4JKBA 1PDXA 3DBLI 1ST7A 3PSCA 1V88A 3DWGC 4GLSC 5C2TB 3RN9C 1TBEA 2NVUI 1N60A 2IGDA 5I2MA 2R2YA 1EF5A 1KF6B 1UGJA 5IP4D 4KSKC 4HPPA 4BBNC 2J59M 1V8CA 2V3SA 4RGMA 1WJ4A 5I4DA 2DKPA 4RFBA 4A6QA 1X1GA 1P98A 3KYDD 2GCLA 4K81A 1SGHA 1GC6A 1OGWA 3TJPA 2HD5B 4KAXB 1HZ6A 2KWDA 2Y8FA 5D6JB 3N3KB 4RGNA 4G11A 4TUUA 1YQ3B 1RYJA 1XQQA 5C1ZA 3ML4A 1WE6A 3FILA 3MHZA 2GBMA 2KDBA 2MQJA 2KXJA 4OZCA 3ZDMC 2MJEA 4BKTA 1ZDVA 5CHWA 3KUDB 2MBOA 5CHVC 1KTKA 3KRXA 1FXTB 1T6BX 3NWDA 1LO5D 1IP9A 5HHDG 3KY9A 1IPGA 1HE8A 3IT6B 3NRZA 1VRAB 4FN2A 3ZJVA 5LONB 2J4XA 2NR2A 5HE3A 4XDDA 3QJZA 1T0YA 2KDEB 4IWQA 2LGSA 1WJ6A 1WF9A 3TFMA 1ZE3D 1VR9A 1F77A 1E7UA 4AWJA 3TSSA 2RR9A 4JKGA 2MJDA 1FCLA 3A33B 4OZAA 3S2AA 5C5BB 1PYWD 3IT4B 1ROEA 2LYDA 3W1SA 1RLFA 1L4ZB 4DBGA 3AE9B 2D9WA 5GOWB 2FCNA 2KQSA 3PRPB 4PS8A 3H7PB 1WFYA 3CIRB 5CX3A 2DZIA 2WXNA 2LVPA 5EDSA 3MJ5A 3NVZA 3CSFA 2QSDA 3X23A 2DENB 5E6NA 2BTEA 4F7GA 5HE1A 1M7EA 1E7VA 1I35A 3H1UA 5HE0A 4LNKA 1YNTE 3KW5B 1V5UA 2K00A 2BS4B 2M0AA 1SBBB 3AI5A 2WDVB 4AOFA 4TYZA 1XX0A 1ZXHA 2L1CA 3RI7C 1E9MA 4ZRJA 5D27A 1LQBA 2IO2B 4YSZB 1H4RA 3P1MA 1UUPA 4IFSA 4KGRA 3URYA 3VH3B 2K9XA 1F2RI 3PHWB 5LLIA 2K3UA 1FHWA 5GXGB 4RNAA 2UU7A 2AYOB 4NPNA 3PPAA 1GPXA 2LJ5A 1FMAD 3E56A 1KJTA 3N9YC 1F9JA 5D94A 2KN4A 4JPSA 1EWYC 4A3OA 1V81A 4P16A 5HG2A 3NHEB 2XBBC 5EE3A 3DPDA 2M14A 1XLQA 3U7DA 3PRZA 3AB5A 2KLGA 1MIXA 2AQ3B 4HXDA 2RVBB 4X57B 3K9PB 4K1RB 2RQ1A 3U2SC 1YN4A 2J0KA 5DH9B 2ABDA 2BGFA 3N7CA 1UH6A 2MKRA 2D9VA 3G9WA 1MVKA 1GG3A 2ZPNA 3SFDB 3CF6E 3QK0A 2KR0A 3TEZA 3JW0X 3ZW3A 2WU2B 2BB5A 3SEBA 2Z0EB 3HVDA 3Q8CA 2DYNA 5KHOA 1K50A 1LFDA 4ZDVA 2Y3AA 4GB9A 1QF6A 2PVGC 3SV1A 1BT0A 4GMXB 1TIFA 3AE1B 2Y5BB 3RYTA 5L95C 2VZKD 3T9LA 2W82A 3DVGY 4P1CC 2QDFA 4JKAA 2XNAC 2Z0OA 4ANWA 3PV1A 1WGKA 3IVFA 2J7QB 1SIJA 3IAM1 2VRWB 3A9JA 3ODWA 1QC6A 4I6LB 4MJSA 3P4QB 2G4DB 2RGNB 4ICUA 1UPRA 1NTIA 3A4RA 2GS0A 1MPEA 2BS3B 3W9CB 3AEEB
chains in the Genus database with same CATH topology
4FHKA 3PVUA 1AWEA 1TZ1A 2M17A 3IHPC 2DYBA 2BWFA 3RT3B 5JHAA 3NY5A 4KDLB 3R3MA 2CAYA 5C16A 4W9HA 2OOBB 2GBNA 1UBQA 2KFKB 1V5OA 3ZTDA 2MP2B 2GJYA 4GSWA 1V6EA 4HAVB 3NOBA 3UZTA 3WAOA 3O65B 2BYEA 2L3ZA 2JZ3B 4GDKB 2LKOA 3OLMD 4TQ1A 3KUCB 1PQSA 3A8PA 1RAXA 3AU4A 1OY2A 4KHOA 4MDKE 2IO0B 3DBRI 5D3VA 4NY0A 1ZVRA 3CSTA 3TIXA 2W2XD 2LXCA 3CIKA 4W9LA 1EO6A 1FHOA 1WY8A 3ENEA 1ZKHA 2YS5A 4F1SA 2P0FA 5JLJB 2KFJA 2LOZA 4JQWC 3U30A 4DHZE 5CLQB 2BYVE 2RSGA 3KVFB 2BWES 3QX1A 2XK5A 2MLBA 2C7MB 2ZNVC 2NPTB 3RZWC 4K17A 5D3WA 2DZMA 3R66C 3R7RA 1WX8A 1YIWA 4WAAA 3PP2A 3A4SC 1NBFC 4LJOB 1WI0A 4MSQB 2JP2A 3SHQA 2KANA 2FNJB 2EMSA 2GOWA 4ANXA 5DPSA 3JYUA 3EC8A 1XR0B 3ZVRA 1YD8U 4NAWA 2OJRA 2KTRA 4A3PA 1WRDB 1V80A 1FOEA 4W9CA 3W1YA 4BKSD 2L7RA 3BY4B 4MGZE 4HATB 2HE7A 3B1LX 3Q3FA 2FCQA 3UGBB 2W2XC 4DX90 2MRPA 4NJ7A 2UZSA 4B6HA 3D8EA 2N4FA 1U27A 2D10A 2EMTA 1V5PA 3IBEA 2DZJA 4IWPA 2PJHA 4PYZA 3F0WA 3ZNHB 2UYZB 3VTWA 4CYEA 2MFQA 1SE9A 1WI1A 2NBUA 2MWNB 3U8ZA 1P3RA 3QCAA 4JKCA 4IM3A 1NTYA 4W9KA 4BFRA 5JVLA 3VUWA 2XK5B 4I6NB 3ZVVA 3A1QB 3E66A 3JVZX 2PPHA 1UBIA 5J2RA 3LDZE 4KIKA 2FIDA 1E5WA 4CHKA 4F7HA 4PNKA 2IO1B 3SUZA 2D4QA 4HB3B 4HDOA 3M62B 1FHXA 1OMWA 4DWFA 2YRYA 2CR5A 4F7UP 4PYUA 4FADA 3EECA 2M1MA 4KIKB 4WJ7A 3QC8B 2A5UA 2D9YA 2D9ZA 2DKQA 3GYPA 5AZGA 2N9PC 3JSVA 3TMPB 1E8WA 3HIZA 1HB6A 2LASA 2BYFA 3WAMA 3VIAA 2K8HA 2K6DB 1UEFA 2N0YA 4A6FB 3QARA 4HPLB 2P0DA 1ZGUB 1WIAA 1ISNA 1KOTA 4P7IA 2WX0A 4ICVA 2O6VA 4WWNA 2YF0A 4FA6A 2WDTB 3DVNV 2REXA 3B08A 1K8RB 2L05A 3HM3A 2DHJA 4A6HA 4IC7B 4MJSB 2KDIA 1M94A 4TQ0A 1XT9B 3OAWA 2CRFA 4BOZB 1WM2A 3MDBC 5G2NA 4HAZB 2HTHB 1WZ0A 2MW5A 1WGHA 3ODXA 3OANA 1FB8A 2DAFA 3UQBA 3LJ3A 4GDLA 2LRWA 2DN6A 3EHVA 1WR6E 3A1QA 2DA0A 1V86A 3VFKA 4EMOA 3N32A 3MTNB 3SBTA 1KZGA 2XEWA 3H6NA 2KNBA 2WYQA 2JRHA 3NZUA 3VHTC 1ZSQA 1W1HA 3APCA 1V89A 1VCBA 5E6PA 4JL9A 5D3XA 2LD9A 3E9PA 4GIVA 1ZC4B 3KH0A 4FLHA 1OEYJ 1VBGA 2DZKA 4HAYB 4FBJB 5BO4B 2DIKA 3QBVB 2COPA 5EFXA 4EKUA 2R0DA 1LW3A 1AQCA 4J6IA 3H7SA 3HM6X 1J19A 2O2VB 4PS3A 4OVUA 3QAQA 4EFOA 3PVWA 2KTRB 2CHZA 4MGIE 2K25A 2K8CA 4NQKE 2Z0PA 1WJMA 4GOCA 4I6PA 4E3CA 2YT1A 3UIOB 3KZ1A 3ZRFA 2KKCA 1E90A 4N9F4 4NNJB 2CB8A 4II3B 2E2XA 5GMVA 5DCNA 5DIFB 3DXEA 2NS5A 2V4LA 4Y94A 2QKMA 4NQLB 4F8CB 5HKHA 3V62A 3SO6A 4EOYA 3A8QA 4FJYA 2RGFA 4C0AA 2N23A 2O6VD 2K2JA 5CTRC 1X11A 2ELAA 3N30A 4DDID 3SDLC 2NCNA 3EPYA 3X0WA 1DDWA 5DHAB 1WGYA 2DX5B 2I5CA 4GN1A 1WR1A 4URKA 4BBNF 2KC1A 1H10A 2GBJA 3RCPA 1EVHA 3TO1A 1EF1A 2JPHA 2DLWA 4OVVA 4HCPB 1JDEA 2NBVB 1WG7A 1AARA 3LJUX 2LRUA 3RCZA 3DBSA 1V5TA 3B0AA 1ZM0A 2ZEQA 1PMSA 4HAWB 2KDFB 1IYFA 4RMAA 2ZVNA 1EAZA 2FIFA 3PSEB 2KHWB 1Y19B 2Z59B 2W2WA 1LM8B 3QQ8B 4MSMB 5JH5C 1FAOA 2FJ9A 2I1KA 2L76A 2C7NB 2MCNB 1U5DA 2KOXA 1FGYA 4GDLB 2ZNVB 3DVNU 3A9KA 1UNRA 3PLVA 5HE2A 2G3QB 5C79A 4NJ6A 2BPSA 2DHKA 1E8ZA 2DHIA 2NMBA 1RJ2A 4MEMA 4BKGA 3DBHI 1J0WA 4LJPB 3VUYA 4HDQA 4CHJA 2HRJA 2DX5A 4JKEA 1WJ1A 4KZCA 1Q0WB 3P2BA 2KQ7A 5TR5A 4HB0B 1KI1B 2BKFA 2UWQA 1I42A 2KX3A 1RFAA 1LXDA 2VSZA 4JKDA 2PE9A 4EJNA 3M1IB 2NZ8B 1OQNA 2L2IA 1NI2A 2DX1A 3I3TB 3VUXA 1N3HA 4A6FA 2D11A 2LVOA 1X1FA 4LCDE 3ML8A 4MELA 4KZ0A 3V6EB 2L00B 4JK9A 1U5GA 2AEHA 1WMHA 4Z2MB 1V5MA 5J3TA 4K7UA 2Y7BA 4KSLC 4W9EA 1IRSA 1A5RA 3VVWB 3ZUNA 3DDCB 3SYXA 2GBKA 1WM3A 2DTCA 3NSUA 2UVMA 3IFWB 5IAAC 4XX5A 2IYDB 2YS3A 1WJUA 1DYNA 4WQOB 2IZVB 3RULA 3ODOA 3CMMB 2KCJA 4DDGD 2R2OA 2KN5A 2M38A 2PEAA 5JHHA 2ELBA 2FDQA 4WJNA 4W9DA 4ILHA 3BJIA 4K7SA 3NS8A 4JK7A 2M8SA 3L16A 5KQ4A 2BKRB 3ZNID 2CKHB 2I5FA 2H7EA 3PREA 4JGHB 2M0XA 3PHXB 2DYQA 2JXXA 1EGXA 1XCGA 3AU5A 1K5DB 4EUTA 4IWOA 3WIMA 3SU8X 1DBHA 2NBWB 3VOQA 3C0RB 5LOPB 1P5TA 3UF8A 1R4MI 4ZRKA 1S1QB 4G0NB 2JWZA 1TQZA 1WX7A 3L54A 1KM7A 4G3XB 2MWSB 2RUKB 3WA0A 2KZRA 4NAWB 3SBGA 2OQBA 4AJYB 4E71A 1Q5WB 4HHVA 3L13A 2N1WA 1MAIA 2OTXA 4NSWA 1VBHA 4H8SA 2RLOA 4WJOA 2ZCCA 2CHWA 2XQNM 3ZIMA 2ZCBA 2J0MA 2C7HA 3PS6A 3OJ3A 4L6EA 4DK5A 2L0FA 1I7AA 4M0WB 1Q1OA 5KHQA 2JZZA 2CODA 1MKEA 1WXMA 2KWUB 4G50A 2IY0B 3VQIA 4PS7A 2JT4B 2YS1A 1WX9A 5G55A 4FJVB 1V61A 4XZ4A 3P6AA 3M95A 2Q13A 2AL6A 4JKHA 3UIPB 1P3QU 1BAKA 2LULA 4JK8A 2HTHA 2MSED 3KSYA 2ADZA 2KGXB 4HB2B 3KRWA 2MBEA 3V5WA 3QHTA 1P0RA 3HW2B 2EC1A 1KBLA 5KCVA 1WGUA 2KJHB 2P0HA 4CHMA 3BINA 3WAPA 2KJ6A 2EKEC 5KQ1A 4KV2A 2COFA 2LWPA 4MY6A 4DHJD 3V61A 2FJLA 1WH3A 1HB8A 2EJ8A 2O6VB 3L08A 1UZXB 2LGYA 4ANUA 2D07B 1R4NI 2N1VA 1I2HA 1QQGA 2C5LC 2AWTA 1GGOA 1W1GA 2CU1A 4AUQC 4DHJB 2ZZPB 4ILGB 1OQYA 3DOWA 4M8MA 3DXCA 3TBLD 2KMAA 2LXAA 4MM3A 4MT7A 1WVHA 2WX1A 2VRRB 1UNQA 3L10B 3TW1A 4MH0E 3A9JB 2JVCA 5FR6A 2FAZA 4B6WA 1X05A 1XODA 4XC2A 2MA9B 3ONSA 3APDA 3VDZA 1JRUA 3SNHA 2VKIA 4DHZB 2LVQA 1TTNA 5IJMA 5D7GA 4HAXB 2KMCA 3ZTCA 2DAJA 4F7ZA 1V9JA 1NTVA 3RD2A 2HJ8A 3D8FA 1UD7A 1YX5B 2KTFA 4M8NA 1SIFA 4WVFB 2FUHB 5DPRA 2J0JA 4GZUA 4W9JA 1EUVB 2DHZA 2KVRA 2L0TA 4GU2A 1CMXB 1U5EA 3AULA 3ML9A 2UZRA 3Q3JA 1M7RA 4KHBB 3HQCA 3DCGA 2FCSA 5C6RA 4II2B 4Z2NA 3MJWA 1WXVA 1WGDA 4W9FA 3RZFA 1K5GB 1H8CA 2RPQA 4GMVA 3ZRCA 1GJZA 4A20A 1NDDA 2Z0DB 2N9EB 2GMIC 2QKLA 5E6OA 1BWNA 4KVGB 3ZLZA 4IUMB 3T8MA 3GYOA 1Y5OA 2GCJA 1G6JA 3FP5A 1GC7A 1MIZB 2COAA 3VH4B 3VAWA 1P6SA 4IAPA 1WE7A 3WALA 2WH5A 4IM0A 3KYCD 2KO3A 1B55A 4B95A 1C3TA 2COCA 2LI5A 3NZSA 1Q67A 4W9IA 3JSVB 1GUAB 2N9XA 2LZ6A 5FI0A 2LOXA 1X1MA 2CQUA 1DROA 2DYOA 2K1FA 1WXAA 3MHSD 1TJ6A 2DFKA 5JP4A 2LGDA 3D8DA 1YQBA 2KWCA 4ZRIA 1DDVA 1FGZA 1ACAA 3A98B 1Y8RC 2KX0A 1OTRB 1QZEA 4CO7A 3V6CB 2YVCA 3QA8A 5DPWA 3ULCA 2RD0A 3M3JA 3FSSA 2MX2A 3TL5A 5DI9B 1J8CA 3QWMA 1WGGA 3HHMA 1KZ7A 4HB4B 3PEGA 3V60A 5AEKB 2ASQA 3FLVA 4WWOA 1LB1A 2LG1A 3AJ4A 4BVUC 2IBIB 1UGMA 2KFKA 4RM9A 2PZ1A 2R09A 4IM2A 2N7DA 1KLVA 3PT2B 4K7WA 3VTVA 2LBBA 2D9XA 1PFJA 4AP4C 3QWZB 4EZJA 1WGQA 1RRBA 1V2YA 2M4NA 4PQ0A 2YT0A 2H7DA 1TXDA 2AL3A 4YONA 3ZNGC 4D0NB 1UNPA 2IO3B 4TKNA 1P1AA 3HK0A 4KHAA 4A5KA 1DDMA 4BBKA 2N7EA 2YLMA 4LDTD 5DHFB 1D3ZA 5AZHA 1NVLA 1TGZB 1YX6B 2ZJDA 3WANA 4TV3A 1U4AA 1Z5SB 1SHCA 3A9KB 5J18A 2ROZB 1W1DA 1U5FA 4GPTB 2PE6B 4JLCA 3GZNI 1S3SG 2KUPA 3PZDA 5CHFA 3FM8C 1XD4A 4HJKA 2MP2A 3WYFB 3MPXA 5JZEB 1X86A 2D3GA 1UPQA 4BOSC 3D32A 5JHBA 2R82A 1C1YB 3ZDTA 3CXBB 5L81A 2IYBA 2ZPYA 3PLUA 3F5RA 3PVLA 3AXCA 1UELA 4ANVA 3PRMB 2BF8B 3ECIA 4GXBA 2MBHA 2MBQA 3PTFC 2CY4A 1NU2A 2KD0A 3M63B 5IA7A 4MGYE 1BTKA 2JF5A 4E74A 2MDXA 4BKSA 2R2QA 1P9DU 2D2QA 4GDKA 1PLSA 2YSZA 4FULA 3ULBA 2CS4A 4MK0A 2RNRB 2K2UA 2V76A 1KC7A 4FHJA 4K2OA 5L83A 5C5BA 1YJ1A 4HPMB 2CHXA 3IG3A 3R7QA 3O96A 4EEWA 2KWVB 3E9LA 4WJQA 3UQAA 2NPTA 1L7YA 2QHOA 5AZFA 1MG8A 2B3AA 5J3QA 5LXIB 2X18A 2I1JA 1E8XA 3TVVA 1VD2A 4HAUB 4WSFA 3P7ZA 2CY5A 1E8YA 1HBKA 2A4ZA 3EFUA 4A6KA 4EZLA 2LGXA 3W1SC 2JUOA 2L8JA 3SD5A 3ENBA 1MK9B 2C60A 2KJRA 4XWXA 5C23A 2ZVOA 3TCAA 1Z87A 1XKEA 4RM8A 4HK2A 4HWIB 5JHGA 4AJWA 4ILJA 4MGKE 4LDTB 3VTUA 4ASWC 1MK7B 3ALBA 2MBBB 2G35A 1WZ3A 2LUEA 2KK8A 2Z0QA 3H7PA 1MPHA 1U29A 1WYWB 3UINB 3KUZA 1V49A 2X0SA 1GNUA 3DXDA 5FI1A 3APFA 1J0GA 1WXSA 5LXHA 4W9GA 3PG7A 2C9WB 4K2PA 3H9DA 3VXWA 3K9OB 2JY6A 5D3YA 4HCNB 2KLCA 5J3YA 2JRIB 1Z2MA 4WWPA 2K8BA 2P8VA 3L17A 4HVBA 2BCJA 4EZKA 3L0WB 1U2BA 2FCMA 3OJ4B 5CLLB 2W9NA 1ZW7A 3PGEA 2GBRA 4FJZA 4B9KA 2IFSA 4DX8A 1RRPB 1XD3B 2RSUA 4DBBA 1WJNA 4IOYX 4KDIC 4GGQA 2WWZA 3T06A 3ZKJC 3DVGX 4ZYNA 2DYMA 1L2NA 3FEHA 3ZO5B 5D2MB 4HLEA 2K6QA 2O2VA 2G45B 1WGRA 4IW0A 2IY1B 1ZC3B 2K39A 3GOEA 5J17A 1BTNA 4DXAB 4JIOU 3E9OA 1DIKA 4WJPA 3ZNZB 2KC2A 3RUIB 3QIJA 2V1YA 1WMHB 3DQVA 2G4SA 4YL8A 4JKFA 4IG7B 4JKGB 5DPTA 2ROVA 1OEYA 2Y8GA 4JKBA 3DBLI 1ST7A 3PSCA 1V88A 1TBEA 2NVUI 1EF5A 4KSKC 4BBNC 2J59M 2V3SA 1WJ4A 2DKPA 1X1GA 1P98A 3KYDD 2GCLA 4K81A 1SGHA 1GC6A 1OGWA 3TJPA 2HD5B 4KAXB 2Y8FA 5D6JB 3N3KB 4G11A 4TUUA 1XQQA 5C1ZA 3ML4A 1WE6A 2GBMA 2KDBA 2MQJA 2KXJA 3ZDMC 4BKTA 5CHWA 3KUDB 2MBOA 5CHVC 3KRXA 1FXTB 1IP9A 3KY9A 1IPGA 1HE8A 4FN2A 5LONB 2NR2A 5HE3A 3QJZA 1T0YA 2KDEB 4IWQA 1WJ6A 1WF9A 3TFMA 1E7UA 4AWJA 2RR9A 4JKGA 3A33B 3S2AA 5C5BB 2LYDA 3W1SA 1RLFA 4DBGA 2D9WA 5GOWB 2FCNA 2KQSA 3PRPB 4PS8A 3H7PB 1WFYA 5CX3A 2DZIA 2LVPA 5EDSA 3CSFA 3X23A 2DENB 5E6NA 4F7GA 5HE1A 1M7EA 1E7VA 1I35A 3H1UA 5HE0A 3KW5B 1V5UA 2K00A 3AI5A 4AOFA 4TYZA 1XX0A 2L1CA 4ZRJA 5D27A 1LQBA 2IO2B 1H4RA 4IFSA 3VH3B 3PHWB 5LLIA 1FHWA 2AYOB 4NPNA 3PPAA 2LJ5A 1KJTA 1F9JA 5D94A 4A3OA 1V81A 3NHEB 2XBBC 3DPDA 2M14A 3U7DA 3PRZA 2KLGA 1MIXA 4HXDA 2RVBB 4X57B 3K9PB 4K1RB 2RQ1A 2J0KA 5DH9B 2ABDA 2BGFA 3N7CA 1UH6A 2MKRA 2D9VA 3G9WA 1GG3A 2ZPNA 3CF6E 3QK0A 3JW0X 3ZW3A 2Z0EB 2DYNA 5KHOA 1LFDA 4ZDVA 4GB9A 3SV1A 1BT0A 4GMXB 2Y5BB 3RYTA 5L95C 3T9LA 3DVGY 4JKAA 2Z0OA 4ANWA 3PV1A 3IVFA 2J7QB 2VRWB 3A9JA 3ODWA 1QC6A 4I6LB 4MJSA 2G4DB 2RGNB 4ICUA 1UPRA 1NTIA 3A4RA 2GS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HB8 A;  2NS5 A;  2EJ8 A;  4FUL A;  3ULB A;  2O6V B;  2CS4 A;  3L08 A;  1UZX B;  2LGY A;  4MK0 A;  2V4L A;  2D07 B;  4FHK A;  4ANU A;  3PVU A;  4Y94 A;  2QKM A;  1R4N I;  1AWE A;  1TZ1 A;  2M17 A;  1I2H A;  1QQG A;  2N1V A;  2RNR B;  2C5L C;  3IHP C;  4NQL B;  4F8C B;  2DYB A;  2K2U A;  2BWF A;  5HKH A;  2V76 A;  3RT3 B;  3V62 A;  3ZTC A;  2AWT A;  3NY5 A;  1W1G A;  5JHA A;  4FHJ A;  2CU1 A;  4K2O A;  3SO6 A;  4KDL B;  4EOY A;  5C5B A;  1YJ1 A;  4HPM B;  4AP4 C;  5L83 A;  1L2N A;  3R3M A;  4AUQ C;  2CHX A;  3IG3 A;  3R7Q A;  3A8Q A;  4E3C A;  3O96 A;  2CAY A;  4FJY A;  4EEW A;  2KWV B;  4WJQ A;  5C16 A;  3UQA A;  2RGF A;  4C0A A;  2N23 A;  2NPT A;  2O6V D;  1L7Y A;  2K2J A;  2QHO A;  4W9H A;  2OOB B;  5CTR C;  5AZF A;  1X11 A;  1MG8 A;  2B3A A;  2GBN A;  1UBQ A;  4DHJ B;  2KFK B;  5J3Q A;  1V5O A;  3ZTD A;  5LXI B;  2X18 A;  2MP2 B;  2ZZP B;  2I1J A;  1OQY A;  2ELA A;  3DOW A;  1E8X A;  2GJY A;  4GSW A;  3DXC A;  3TVV A;  1V6E A;  4M8M A;  4HAV B;  1VD2 A;  3UZT A;  3NOB A;  3WAO A;  3N30 A;  3TBL D;  2KMA A;  3O65 B;  2LXA A;  3SDL C;  4HAU B;  2NCN A;  4MM3 A;  4WSF A;  2BYE A;  3P7Z A;  4MT7 A;  2L3Z A;  3EPY A;  2CY5 A;  3X0W A;  1E8Y A;  1HBK A;  2A4Z A;  3EFU A;  1DDW A;  2JZ3 B;  1WVH A;  2WX1 A;  5DHA B;  2VRR B;  1WGY A;  4GDK B;  4A6K A;  1UNQ A;  2LKO A;  3OLM D;  4EZL A;  3L10 B;  2DX5 B;  3TW1 A;  4TQ1 A;  2I5C A;  3KUC B;  1PQS A;  2LGX A;  3W1S C;  3A8P A;  1RAX A;  2JUO A;  4MH0 E;  3AU4 A;  1OY2 A;  4KHO A;  2L8J A;  3A9J B;  4MDK E;  2IO0 B;  3DBR I;  5D3V A;  3SD5 A;  4GN1 A;  2JVC A;  4NY0 A;  5FR6 A;  1MK9 B;  2C60 A;  2FAZ A;  4XWX A;  1WR1 A;  1ZVR A;  2KJR A;  4B6W A;  3CST A;  4URK A;  5C23 A;  3TIX A;  2ZVO A;  1X05 A;  1XOD A;  3TCA A;  4XC2 A;  4BBN F;  2MA9 B;  2W2X D;  3ONS A;  1Z87 A;  2LXC A;  1XKE A;  1H10 A;  2GBJ A;  2KC1 A;  3APD A;  4RM8 A;  3VDZ A;  1JRU A;  4HK2 A;  3RCP A;  3CIK A;  4HWI B;  1EVH A;  4W9L A;  1EO6 A;  5JHG A;  1FHO A;  3SNH A;  3TO1 A;  2VKI A;  1EF1 A;  1WY8 A;  2JPH A;  4MGK E;  4AJW A;  4DHZ B;  4DDI D;  3ENE A;  2LVQ A;  1TTN A;  1ZKH A;  4LDT B;  5IJM A;  3VTU A;  2DLW A;  2YS5 A;  4ASW C;  1MK7 B;  3ALB A;  4F1S A;  5D7G A;  2MBB B;  2G35 A;  2P0F A;  4HAX B;  2LOZ A;  5JLJ B;  1WZ3 A;  2DAJ A;  2KFJ A;  2KMC A;  2LUE A;  1V9J A;  4HCP B;  4JQW C;  4DHZ E;  4F7Z A;  2KK8 A;  5CLQ B;  2BYV E;  3V61 A;  1NTV A;  5JH5 C;  3RD2 A;  2Z0Q A;  2RSG A;  2HJ8 A;  3H7P A;  3D8F A;  1MPH A;  1UD7 A;  1YX5 B;  2BWE S;  1U29 A;  1WYW B;  1WG7 A;  1AAR A;  2KTF A;  2XK5 A;  3QX1 A;  2MLB A;  3KUZ A;  3UIN B;  4M8N A;  1V49 A;  2C7M B;  3LJU X;  1SIF A;  2LRU A;  3RCZ A;  4WVF B;  2NBV B;  2ZNV C;  2NPT B;  3RZW C;  1GNU A;  4K17 A;  2FUH B;  3DXD A;  5D3W A;  3DBS A;  2DZM A;  5DPR A;  1V5T A;  3B0A A;  3R66 C;  3R7R A;  1ZM0 A;  1WX8 A;  5FI1 A;  2J0J A;  4GZU A;  2ZEQ A;  1PMS A;  4HAW B;  3APF A;  1EUV B;  1WXS A;  1YIW A;  2DHZ A;  4W9J A;  5LXH A;  4W9G A;  2KVR A;  2KDF B;  4WAA A;  1IYF A;  3PG7 A;  3PP2 A;  4RMA A;  2L0T A;  2ZVN A;  2C9W B;  4K2P A;  4GU2 A;  3H9D A;  1EAZ A;  3A4S C;  1CMX B;  1NBF C;  2FIF A;  4LJO B;  3PSE B;  4WWN A;  1WI0 A;  2KHW B;  3VXW A;  1U5E A;  1Y19 B;  3K9O B;  4MSQ B;  2Z59 B;  2W2W A;  1LM8 B;  5D3Y A;  2JY6 A;  3AUL A;  3ML9 A;  4HCN B;  2KLC A;  2JP2 A;  3SHQ A;  2UZR A;  3Q3J A;  1M7R A;  5J3Y A;  2JRI B;  1Z2M A;  2KAN A;  3QQ8 B;  4MSM B;  4WWP A;  2K8B A;  2FNJ B;  4KHB B;  1D3Z A;  2EMS A;  3HQC A;  2GOW A;  2P8V A;  4ANX A;  3DCG A;  5DPS A;  3JYU A;  2FCS A;  3EC8 A;  3L17 A;  2BCJ A;  1FAO A;  4EZK A;  1XR0 B;  5C6R A;  3L0W B;  4HVB A;  2FJ9 A;  2I1K A;  1U2B A;  4II2 B;  2FCM A;  3ZVR A;  4Z2N A;  3MJW A;  5CLL B;  2L76 A;  1ZW7 A;  1YD8 U;  2C7N B;  2W9N A;  3OJ4 B;  3PGE A;  4EZJ A;  2MCN B;  2GBR A;  4FJZ A;  4NAW A;  1U5D A;  1WXV A;  2OJR A;  1FGY A;  2KOX A;  2KTR A;  4GDL B;  4A3P A;  1WGD A;  2ZNV B;  4B9K A;  2IFS A;  3DVN U;  4W9F A;  3RZF A;  1WRD B;  4DX8 A;  1V80 A;  1K5G B;  3A9K A;  1RRP B;  1UNR A;  1H8C A;  1XD3 B;  3PLV A;  2RSU A;  1FOE A;  4DBB A;  2RPQ A;  5HE2 A;  4GMV A;  4IOY X;  1WJN A;  2G3Q B;  4GGQ A;  2WWZ A;  4KDI C;  4W9C A;  2L7R A;  3W1Y A;  3T06 A;  3ZRC A;  5C79 A;  1GJZ A;  3ZKJ C;  3DVG X;  3BY4 B;  4MGZ E;  4NJ6 A;  2BPS A;  4ZYN A;  4A20 A;  2DYM A;  4HAT B;  1NDD A;  2Z0D B;  2N9E B;  2HE7 A;  2DHK A;  3B1L X;  1E8Z A;  2DHI A;  2NMB A;  1RJ2 A;  3FEH A;  3Q3F A;  4MEM A;  5D2M B;  3ZO5 B;  2GMI C;  2K6Q A;  4BKG A;  4HLE A;  2QKL A;  3DBH I;  2FCQ A;  5E6O A;  1BWN A;  4KVG B;  3UGB B;  2O2V A;  1J0W A;  2W2X C;  4DX9 0;  2MRP A;  4LJP B;  3VUY A;  3ZLZ A;  4NJ7 A;  2G45 B;  4HDQ A;  2UZS A;  4B6H A;  4IUM B;  3GYO A;  3T8M A;  3D8E A;  4CHJ A;  2N4F A;  2HRJ A;  1Y5O A;  1WGR A;  4IW0 A;  2DX5 A;  2GCJ A;  1U27 A;  2IY1 B;  2D10 A;  1WJ1 A;  1ZC3 B;  4KZC A;  1Q0W B;  2K39 A;  3GOE A;  2EMT A;  5J17 A;  1BTN A;  4DXA B;  3P2B A;  1V5P A;  3IBE A;  3FP5 A;  2KQ7 A;  1G6J A;  5TR5 A;  1GC7 A;  1MIZ B;  2COA A;  4HB0 B;  2DZJ A;  4JIO U;  4IWP A;  3VH4 B;  2PJH A;  4PYZ A;  1KI1 B;  3VAW A;  3F0W A;  1P6S A;  2BKF A;  3ZNH B;  2UWQ A;  4WJP A;  1I42 A;  4IAP A;  2UYZ B;  1WE7 A;  3WAL A;  2KX3 A;  2WH5 A;  3VTW A;  3ZNZ B;  1RFA A;  1LXD A;  2VSZ A;  2KC2 A;  4IM0 A;  2PE9 A;  3RUI B;  3QIJ A;  4EJN A;  3M1I B;  2V1Y A;  4CYE A;  1WMH B;  3KYC D;  2KO3 A;  2G4S A;  4YL8 A;  2NZ8 B;  1B55 A;  3DQV A;  4IG7 B;  4B95 A;  1OQN A;  2L2I A;  5DPT A;  2MFQ A;  1SE9 A;  1C3T A;  1NI2 A;  2ROV A;  2DX1 A;  3I3T B;  1WI1 A;  3VUX A;  1OEY A;  2NBU A;  1N3H A;  2MWN B;  2Y8G A;  3U8Z A;  4A6F A;  1P3R A;  2D11 A;  2COC A;  3QCA A;  2LI5 A;  2LVO A;  1X1F A;  4IM3 A;  3NZS A;  1NTY A;  1ST7 A;  3PSC A;  3DBL I;  4LCD E;  4W9K A;  3ML8 A;  4BFR A;  4MEL A;  4KZ0 A;  1V88 A;  3V6E B;  3VUW A;  2XK5 B;  1Q67 A;  1TBE A;  2L00 B;  3A1Q B;  4I6N B;  3ZVV A;  4W9I A;  2NVU I;  3JSV B;  1U5G A;  2AEH A;  3JVZ X;  1WMH A;  2PPH A;  1EF5 A;  4BKS D;  1GUA B;  4Z2M B;  1UBI A;  2N9X A;  2LZ6 A;  1V5M A;  5J3T A;  5FI0 A;  4K7U A;  5J2R A;  2LOX A;  1X1M A;  2Y7B A;  4KSK C;  4KSL C;  4W9E A;  2J59 M;  2CQU A;  1IRS A;  2V3S A;  1WJ4 A;  4BBN C;  1A5R A;  2DKP A;  3LDZ E;  4NQK E;  1DRO A;  2DYO A;  2K1F A;  3VVW B;  4KIK A;  1X1G A;  1WXA A;  1P98 A;  3DDC B;  3ZUN A;  3SYX A;  3MHS D;  2GBK A;  1TJ6 A;  1WM3 A;  2FID A;  3KYD D;  1E5W A;  2GCL A;  4K81 A;  4CHK A;  1SGH A;  4F7H A;  2DFK A;  2DTC A;  4PNK A;  5JP4 A;  1GC6 A;  3D8D A;  2LGD A;  1OGW A;  1YQB A;  3U30 A;  2KWC A;  3TJP A;  2HD5 B;  2IO1 B;  4ZRI A;  3NSU A;  4KAX B;  2UVM A;  2Y8F A;  3SUZ A;  1DDV A;  1FGZ A;  3IFW B;  1ACA A;  5D6J B;  3N3K B;  5IAA C;  4G11 A;  4TUU A;  4XX5 A;  2IYD B;  2D4Q A;  4HB3 B;  4HDO A;  3A98 B;  3M62 B;  2YS3 A;  1XQQ A;  5C1Z A;  3ML4 A;  1WE6 A;  1FHX A;  1WJU A;  1Y8R C;  2GBM A;  2KDB A;  2KX0 A;  1OMW A;  2MQJ A;  4DWF A;  1DYN A;  1OTR B;  2KXJ A;  2YRY A;  2CR5 A;  4F7U P;  1QZE A;  4WQO B;  2IZV B;  4PYU A;  4FAD A;  3RUL A;  3ODO A;  2YVC A;  3CMM B;  2M1M A;  3EEC A;  4KIK B;  3QA8 A;  3V6C B;  3ZDM C;  5DPW A;  4BKT A;  4WJ7 A;  5CHW A;  3KUD B;  2KCJ A;  2A5U A;  2MBO A;  3QC8 B;  2R2O A;  3ULC A;  2D9Y A;  2KN5 A;  2RD0 A;  5CHV C;  2D9Z A;  3M3J A;  2M38 A;  2DKQ A;  3GYP A;  2PEA A;  3KRX A;  1FXT B;  3FSS A;  2MX2 A;  5AZG A;  5JHH A;  1IP9 A;  2N9P C;  3KY9 A;  1IPG A;  1HE8 A;  3JSV A;  2ELB A;  3TMP B;  3TL5 A;  5DI9 B;  1J8C A;  3QWM A;  1WGG A;  1E8W A;  4OVV A;  3HHM A;  2FDQ A;  1KZ7 A;  4FN2 A;  4WJN A;  4HB4 B;  3HIZ A;  3PEG A;  5LON B;  1HB6 A;  2ASQ A;  3FLV A;  2NR2 A;  4WWO A;  5HE3 A;  3V60 A;  5AEK B;  1LB1 A;  2LAS A;  2BYF A;  3WAM A;  2LG1 A;  4W9D A;  3AJ4 A;  3BJI A;  4BVU C;  3VIA A;  3QJZ A;  1T0Y A;  1UGM A;  2IBI B;  2K8H A;  2KDE B;  3PHX B;  2KFK A;  2K6D B;  4IWQ A;  4K7S A;  1WJ6 A;  1UEF A;  2PZ1 A;  4RM9 A;  1WF9 A;  3TFM A;  2N0Y A;  2R09 A;  4A6F B;  4IM2 A;  1E7U A;  3QAR A;  2N7D A;  4AWJ A;  2RR9 A;  3NS8 A;  2M8S A;  1KLV A;  3L16 A;  5KQ4 A;  2BKR B;  3A33 B;  4HPL B;  3ZNI D;  3S2A A;  5C5B B;  3PT2 B;  2P0D A;  4K7W A;  2CKH B;  1ZGU B;  2LYD A;  3VTV A;  1WIA A;  2LBB A;  2D9X A;  2I5F A;  1RLF A;  3W1S A;  1ISN A;  2H7E A;  3PRE A;  4DBG A;  1KOT A;  4JGH B;  4P7I A;  1PFJ A;  2M0X A;  3QWZ B;  2WX0 A;  4ICV A;  2O6V A;  2D9W A;  1WGQ A;  5GOW B;  1RRB A;  1V2Y A;  2DYQ A;  2FCN A;  2YF0 A;  2JXX A;  1EGX A;  2KQS A;  4PQ0 A;  2M4N A;  2YT0 A;  3PRP B;  4FA6 A;  4PS8 A;  3H7P B;  1XCG A;  2H7D A;  2WDT B;  3DVN V;  1TXD A;  3AU5 A;  2REX A;  1WFY A;  5CX3 A;  1K5D B;  4EUT A;  4IWO A;  2AL3 A;  4YON A;  3B08 A;  3SU8 X;  3WIM A;  1K8R B;  1DBH A;  2DZI A;  2L05 A;  2LVP A;  2NBW B;  3ZNG C;  5EDS A;  3HM3 A;  2DHJ A;  3VOQ A;  4A6H A;  4IC7 B;  3C0R B;  3CSF A;  4MJS B;  4D0N B;  5LOP B;  1P5T A;  1UNP A;  2IO3 B;  3X23 A;  4TKN A;  3UF8 A;  2KDI A;  1P1A A;  1M94 A;  1R4M I;  3HK0 A;  4ZRK A;  4KHA A;  4A5K A;  1S1Q B;  1XT9 B;  2DEN B;  5E6N A;  4TQ0 A;  4F7G A;  1DDM A;  5HE1 A;  4BBK A;  3OAW A;  1M7E A;  2N7E A;  1E7V A;  4G0N B;  2YLM A;  2CRF A;  2JWZ A;  4LDT D;  1I35 A;  1TQZ A;  3H1U A;  4BOZ B;  5DHF B;  1WM2 A;  3MDB C;  5HE0 A;  5G2N A;  4HAZ B;  2HTH B;  1WX7 A;  3KW5 B;  1V5U A;  2K00 A;  3L54 A;  1KM7 A;  1WZ0 A;  5AZH A;  1NVL A;  1TGZ B;  1WGH A;  1YX6 B;  2MW5 A;  2ZJD A;  3AI5 A;  5GMV A;  3WAN A;  3ODX A;  4AOF A;  4TYZ A;  4TV3 A;  4G3X B;  3OAN A;  1XX0 A;  1FB8 A;  2L1C A;  1U4A A;  1SHC A;  1Z5S B;  2DAF A;  2MWS B;  3A9K B;  5J18 A;  2RUK B;  3UQB A;  2ROZ B;  1W1D A;  1U5F A;  4GPT B;  3LJ3 A;  3WA0 A;  4GDL A;  4ZRJ A;  2DN6 A;  5D27 A;  2LRW A;  1LQB A;  2IO2 B;  2KZR A;  4NAW B;  1H4R A;  3EHV A;  2OQB A;  4IFS A;  3VH3 B;  4AJY B;  1Q5W B;  4E71 A;  1WR6 E;  2PE6 B;  3A1Q A;  2DA0 A;  3KVF B;  4HHV A;  3L13 A;  4JLC A;  1V86 A;  2N1W A;  1MAI A;  3PHW B;  5LLI A;  3VFK A;  3GZN I;  1FHW A;  1S3S G;  4EMO A;  2OTX A;  4NSW A;  2KUP A;  4CO7 A;  3PZD A;  5CHF A;  3FM8 C;  3N32 A;  4H8S A;  1XD4 A;  4HJK A;  2MP2 A;  3WYF B;  3MTN B;  3MPX A;  1KZG A;  2XEW A;  1J0G A;  5JZE B;  2RLO A;  1X86 A;  3H6N A;  2D3G A;  4WJO A;  2ZCC A;  2AYO B;  4NPN A;  2KNB A;  2WYQ A;  3PPA A;  1UPQ A;  2JRH A;  2LJ5 A;  4BOS C;  1KJT A;  3NZU A;  3D32 A;  3VHT C;  1ZSQ A;  1F9J A;  1W1H A;  2CHW A;  5D94 A;  4DDG D;  5JHB A;  2XQN M;  3ZIM A;  2ZCB A;  3APC A;  4A3O A;  2J0M A;  1V89 A;  1V81 A;  1VCB A;  2C7H A;  3PS6 A;  1C1Y B;  3OJ3 A;  3NHE B;  2XBB C;  5E6P A;  3DPD A;  2M14 A;  3U7D A;  3ZDT A;  3PRZ A;  4JL9 A;  5D3X A;  4L6E A;  4DK5 A;  2LD9 A;  2KLG A;  1MIX A;  2L0F A;  3CXB B;  4GIV A;  1I7A A;  4HXD A;  1Q1O A;  4M0W B;  2RVB B;  1ZC4 B;  5L81 A;  3KH0 A;  4X57 B;  2JZZ A;  3K9P B;  5KHQ A;  4FLH A;  4K1R B;  2RQ1 A;  1OEY J;  2IYB A;  2ZPY A;  2J0K A;  3PLU A;  2DZK A;  5DH9 B;  2COD A;  3F5R A;  2ABD A;  3PVL A;  1MKE A;  4HAY B;  1WXM A;  2KWU B;  2BGF A;  4FBJ B;  4G50 A;  5BO4 B;  5DCN A;  2IY0 B;  3AXC A;  3QBV B;  3N7C A;  1UEL A;  2COP A;  1UH6 A;  5EFX A;  3VQI A;  4ANV A;  2MKR A;  2D9V A;  3G9W A;  3PRM B;  4EKU A;  2R0D A;  2JT4 B;  1GG3 A;  2BF8 B;  4PS7 A;  2YS1 A;  1WX9 A;  1LW3 A;  2ZPN A;  3ECI A;  1AQC A;  3CF6 E;  5G55 A;  4FJV B;  1V61 A;  3QK0 A;  4GXB A;  3JW0 X;  4J6I A;  3ZW3 A;  4XZ4 A;  2MBH A;  3H7S A;  3P6A A;  2MBQ A;  3HM6 X;  2Z0E B;  3M95 A;  3PTF C;  1J19 A;  2Q13 A;  2CY4 A;  2DYN A;  2O2V B;  1NU2 A;  5KHO A;  1LFD A;  2AL6 A;  2KD0 A;  3M63 B;  4PS3 A;  4GB9 A;  4OVU A;  4ZDV A;  3UIP B;  5IA7 A;  1P3Q U;  3QAQ A;  3SV1 A;  1BT0 A;  4GMX B;  2Y5B B;  1BAK A;  2LUL A;  3RYT A;  3T9L A;  4MGY E;  4EFO A;  5L95 C;  2HTH A;  1BTK A;  2MSE D;  3KSY A;  2ADZ A;  2JF5 A;  3DVG Y;  3PVW A;  2KGX B;  4E74 A;  4HB2 B;  2Z0O A;  2MDX A;  3KRW A;  2MBE A;  4ANW A;  2KTR B;  4BKS A;  3V5W A;  2CHZ A;  3PV1 A;  3QHT A;  2K25 A;  4MGI E;  2K8C A;  1P0R A;  3IVF A;  2Z0P A;  3HW2 B;  2J7Q B;  1WJM A;  2EC1 A;  4GOC A;  2VRW B;  3A9J A;  2R2Q A;  3ODW A;  5KCV A;  1QC6 A;  1P9D U;  1WGU A;  4I6L B;  2KJH B;  4I6P A;  2P0H A;  2YT1 A;  4CHM A;  3KZ1 A;  2D2Q A;  3BIN A;  4MJS A;  3UIO B;  3WAP A;  2G4D B;  2RGN B;  2KKC A;  4ICU A;  3ZRF A;  2KJ6 A;  4GDK A;  2EKE C;  1E90 A;  5KQ1 A;  1PLS A;  2YSZ A;  4KV2 A;  1UPR A;  1NTI A;  2COF A;  2CB8 A;  2LWP A;  3A4R A;  2GS0 A;  4II3 B;  4N9F 4;  4NNJ B;  4MY6 A;  2E2X A;  4DHJ D;  5DIF B;  3DXE A;  2FJL A;  1WH3 A; 
#chains in the Genus database with same CATH topology
 3N1X C;  4FHK A;  1WSP A;  3PVU A;  3PZ7 A;  1AWE A;  1TZ1 A;  2M17 A;  3IHP C;  3BVG A;  4IOI E;  1N61 A;  2DYB A;  2BWF A;  3RT3 B;  5JHA A;  3NY5 A;  2K5P A;  4KDL B;  5E6J A;  3R3M A;  1ZXI A;  1QOF A;  2CAY A;  2ONQ A;  4YTP B;  2WXM A;  5C16 A;  4W9H A;  3EFC A;  2OOB B;  3B2F A;  2GBN A;  1UBQ A;  2KFK B;  1V5O A;  1D5X C;  3ZTD A;  2MP2 B;  2QJL A;  1JWU D;  2JYE A;  2GJY A;  4GSW A;  4AQ7 A;  1V6E A;  4HAV B;  3NOB A;  3UZT A;  3WAO A;  3O65 B;  2BB6 A;  2BYE A;  2L3Z A;  2JZ3 B;  4GDK B;  4K3B A;  2D3A A;  2LKO A;  3OLM D;  2IPK D;  4TQ1 A;  3AE5 B;  2HDE A;  2D3B A;  3KUC B;  1PQS A;  3A8P A;  1RAX A;  3DBL B;  4ZRQ A;  3AU4 A;  1OY2 A;  4KHO A;  2N9K A;  4MDK E;  2IO0 B;  3DBR I;  5D3V A;  2PVO D;  3B2G A;  4ZHO A;  3BVM A;  4NY0 A;  1ZVR A;  3CST A;  3TIX A;  1UWX A;  2W2X D;  2LXC A;  1MG4 A;  4WAF A;  1I4Q A;  2V3P A;  3CIK A;  4W9L A;  2J53 A;  1EO6 A;  3ZXV A;  1FHO A;  1WY8 A;  3W5V B;  3ENE A;  1ZKH A;  2YS5 A;  4F1S A;  1JWA D;  2P0F A;  5JLJ B;  2KFJ A;  2LOZ A;  2Y5C A;  4JQW C;  3U30 A;  4DHZ E;  5CLQ B;  2BYV E;  2J42 A;  2E3T A;  2X38 A;  1XXG A;  1ZUD 2;  1JRO A;  2RSG A;  3KVF B;  2BWE S;  3QX1 A;  2XK5 A;  1NI3 A;  2MLB A;  3FC4 A;  2C7M B;  2K22 A;  3I63 C;  2ZNV C;  1Q10 A;  1FEH A;  2NPT B;  3RZW C;  4K17 A;  5D3W A;  2DZM A;  3R66 C;  4RCO A;  3R7R A;  2INP E;  1WX8 A;  1YIW A;  2N0S B;  4WAA A;  1I4H A;  1SE4 A;  3PP2 A;  3P4R B;  3A4S C;  1NBF C;  4LJO B;  1WI0 A;  2ACZ B;  4MSQ B;  4N58 A;  2JP2 A;  3SHQ A;  2KAN A;  2FNJ B;  1FXA A;  2EMS A;  2GOW A;  4ANX A;  5DPS A;  4B0M A;  1IBX A;  3JYU A;  3EC8 A;  1XR0 B;  4RGT A;  3ZVR A;  4CSQ A;  1YD8 U;  4NAW A;  4YXD B;  2OJR A;  2KTR A;  4A3P A;  1L5P A;  5IOI A;  2KAC A;  1D5M C;  1WRD B;  1XLO A;  1V80 A;  3NG0 A;  1FOE A;  1CJE A;  3VR9 B;  4W9C A;  3W1Y A;  4BKS D;  2L7R A;  1ESF A;  1J7A A;  3BY4 B;  4MGZ E;  4HAT B;  2HE7 A;  3AED B;  3B1L X;  4LNO A;  4PT5 A;  3Q3F A;  1SSN A;  2G1E A;  2FCQ A;  3UGB B;  2ZW1 A;  2W2X C;  4DX9 0;  2MRP A;  3A58 A;  4NJ7 A;  2UZS A;  4B6H A;  3D8E A;  2N4F A;  4OHJ A;  1U27 A;  2D10 A;  1FXI A;  1L6U A;  2H88 B;  2EMT A;  1V5P A;  2SEB D;  3IBE A;  1DOY A;  2DZJ A;  4IWP A;  3AEG B;  2PJH A;  4PYZ A;  3F0W A;  3ZNH B;  2UYZ B;  5FK9 C;  3VTW A;  2SAK A;  3W5U B;  2FBW B;  4CYE A;  1MHH E;  2QIL A;  1FCC C;  3VR8 B;  2KDM A;  3I5J C;  2MFQ A;  1SE9 A;  2KMM A;  2MJ3 A;  4MT5 A;  3GS2 A;  1WI1 A;  2NBU A;  1NYR A;  2MWN B;  3U8Z A;  5M4Y B;  1P3R A;  1D6E C;  3QCA A;  4HRS A;  4JKC A;  4IM3 A;  1NTY A;  4W9K A;  2WXQ A;  4RF1 A;  3IAS 1;  4BFR A;  5JVL A;  3VUW A;  2XK5 B;  3KLS X;  4I6N B;  3ZVV A;  3A1Q B;  1K51 A;  1N63 A;  1FPY A;  1KLG D;  3E66 A;  3PO0 A;  3JVZ X;  2PPH A;  2LFI A;  1UBI A;  1YMH E;  2QCZ A;  4J3O D;  3FKY A;  5J2R A;  3EGR A;  4HEA 1;  3LDZ E;  2Z14 A;  4KIK A;  4CQN A;  4JX1 C;  2RMM A;  2FID A;  1E5W A;  4CHK A;  4F7H A;  4NJC A;  4PNK A;  2IO1 B;  4C7Y A;  1SE3 A;  3UI3 A;  3SUZ A;  1BML C;  2D4Q A;  4HB3 B;  4HDO A;  1TKE A;  3M62 B;  1FHX A;  3C8Y A;  1OMW A;  5EE9 A;  1AWD A;  4DWF A;  2YRY A;  2CR5 A;  2N9L A;  4F7U P;  4KKI A;  2YEP B;  2WXR A;  4PYU A;  4FAD A;  2MEK A;  3EEC A;  3ABV B;  2M1M A;  4KGT A;  4KIK B;  5H92 C;  4WJ7 A;  3QC8 B;  2A5U A;  2D9Y A;  3DBR B;  2D9Z A;  1OQR A;  2DKQ A;  3GYP A;  1ET6 A;  5AZG A;  2N9P C;  2H89 B;  3JSV A;  3TMP B;  3NVV A;  3Q3M C;  4MAC A;  1E8W A;  2PIA A;  1FFU A;  3VRB B;  3I9V 1;  3NS1 A;  3HIZ A;  1HB6 A;  2W54 A;  3BK1 A;  3DHI C;  1TS2 A;  1JCK B;  1K53 A;  2LAS A;  2BYF A;  3WAM A;  1HA5 A;  3VIA A;  4HRO A;  2K8H A;  1HTQ A;  2K6D B;  1UEF A;  3GB1 A;  2GLS A;  3BVZ A;  2N0Y A;  4A6F B;  4C80 A;  3QAR A;  1HTO A;  2J52 A;  3LYY A;  4HPL B;  4M00 A;  2P0D A;  2RPV A;  4FXC A;  1ZGU B;  1WIA A;  1PGA A;  1ISN A;  1KOT A;  4P7I A;  2WX0 A;  4ICV A;  2O6V A;  4WWN A;  2YF0 A;  4FA6 A;  2WDT B;  3DVN V;  2REX A;  1KH0 A;  3B08 A;  1K8R B;  2L05 A;  4QJ5 B;  5EE0 A;  1L6V A;  3HM3 A;  2DHJ A;  4A6H A;  4IC7 B;  4MJS B;  3BWU D;  2KDI A;  1M94 A;  2Q5W D;  2WXL A;  4TQ0 A;  1WWT A;  1XT9 B;  1AW7 A;  5G5G A;  3OAW A;  1GB1 A;  2CRF A;  4BOZ B;  1IGD A;  3MDB C;  1WM2 A;  5G2N A;  4HAZ B;  2HTH B;  1WZ0 A;  1VZ7 A;  2IND C;  2MW5 A;  1WGH A;  4GNK B;  3ODX A;  3N20 C;  3OAN A;  4YTM B;  1FB8 A;  2DAF A;  3UQB A;  3FVC A;  1K52 A;  2I2Y A;  3LJ3 A;  4GDL A;  2LRW A;  2DN6 A;  2KYW A;  4M02 A;  3EHV A;  2JZP A;  4IDI A;  1WR6 E;  3A1Q A;  2DA0 A;  2L52 A;  4HJG E;  1V86 A;  2HJ1 A;  3VFK A;  2KUQ A;  4XWW A;  4EMO A;  1R4M B;  3N32 A;  2XN9 C;  4C7Z A;  3MTN B;  3SBT A;  1KZG A;  2XEW A;  2LGI A;  3H6N A;  2WXG A;  4YSY B;  2KNB A;  2WYQ A;  1SXT A;  1HZ5 A;  2JRH A;  3NZU A;  1VZ6 A;  3VHT C;  1AN8 A;  1ZSQ A;  1CZP A;  1W1H A;  4A9A A;  3APC A;  1ENF A;  1V89 A;  1VCB A;  4ARI A;  5E6P A;  4JL9 A;  5D3X A;  3NWF A;  2LD9 A;  3R8B A;  3E9P A;  1FD6 A;  4GIV A;  5BMI A;  2WXF A;  1ZC4 B;  3KH0 A;  3N1Z C;  4FLH A;  1OEY J;  4QXA B;  1VBG A;  3BII D;  2DZK A;  2AX5 A;  4HAY B;  4B0E A;  4FBJ B;  5BO4 B;  2DIK A;  3QBV B;  2COP A;  5EFX A;  4EKU A;  2R0D A;  2PMV A;  3C19 A;  1LW3 A;  4REZ A;  1AQC A;  1UWM A;  4J6I A;  2WXP A;  3H7S A;  1UF0 A;  3HM6 X;  1P7F A;  1J19 A;  2O2V B;  3RNC C;  4PS3 A;  4OVU A;  1HEZ E;  4GOU A;  3QAQ A;  3RMK C;  4EFO A;  2D5G A;  3GE8 C;  2D3C A;  3B9J A;  4XDC A;  3PVW A;  3L4P A;  1SJE D;  2KTR B;  5IRS A;  2CHZ A;  4MGI E;  2K25 A;  2K8C A;  2Z0P A;  4NQK E;  4DXF A;  1QLB B;  1WJM A;  4GOC A;  4I6P A;  3NZ3 A;  4E3C A;  2YT1 A;  1JW9 D;  3KZ1 A;  3UIO B;  3ZRF A;  2KKC A;  1E90 A;  3T3N A;  4WH4 A;  4N9F 4;  4NNJ B;  2CB8 A;  4II3 B;  1TYG B;  5JXV A;  2E2X A;  3RFZ B;  5DIF B;  3OG5 A;  3DXE A;  5DCN A;  5GMV A;  2NS5 A;  3WCQ A;  3NW8 A;  2WDR B;  1XLN A;  2V4L A;  4Y94 A;  2QKM A;  4NQL B;  4F8C B;  3T3O A;  2PTL A;  2Z59 A;  5HKH A;  3V62 A;  3AE4 B;  4ZHP A;  1XEE A;  3SO6 A;  1RM6 C;  4EOY A;  1TS3 A;  3U7Z A;  3A8Q A;  1C77 A;  4FJY A;  4N6E B;  1Y56 A;  2RGF A;  1JRP A;  4TSS A;  4C0A A;  2N23 A;  2O6V D;  2K2J A;  5CTR C;  1X11 A;  4QAY A;  1GB4 A;  2WHI A;  1JWB D;  2L1A A;  2Y5P A;  4C00 A;  2ELA A;  3N30 A;  4DDI D;  3SDL C;  3U12 A;  2NCN A;  5C3J B;  1WXQ A;  3EPY A;  3X0W A;  1DDW A;  4DIX A;  5DHA B;  1WGY A;  5HI1 A;  2DX5 B;  4R3D A;  4C56 C;  3HIE A;  2I5C A;  2LHD A;  2ICI A;  4JE3 B;  1JQ4 A;  3HSA A;  3NWA A;  4GN1 A;  1WR1 A;  4URK A;  4ZRP A;  4BBN F;  1ZYI A;  2KC1 A;  1H10 A;  2GBJ A;  1MI0 A;  1DOI A;  3RCP A;  1EVH A;  4QJ3 B;  3TO1 A;  3EUB 2;  1EF1 A;  2JPH A;  3R2I A;  1C4A A;  2DLW A;  1J7C A;  4OVV A;  4HCP B;  1JDE A;  3R2T A;  3Q14 C;  1YQ4 B;  4YTN B;  2NBV B;  3KWV A;  1WG7 A;  1AAR A;  2E6X A;  3LJU X;  2LRU A;  3RCZ A;  3GP7 A;  3DBS A;  1V5T A;  3B0A A;  1KFY B;  1ZM0 A;  3AE3 B;  2ZEQ A;  1PMS A;  4HAW B;  2KDF B;  1EU3 A;  1IYF A;  4RMA A;  4TMA B;  2ZVN A;  1F1H A;  1EAZ A;  2FIF A;  3PSE B;  2KHW B;  1Y19 B;  3Q8B A;  2Z59 B;  2W2W A;  1LM8 B;  2DLB A;  1V1O A;  3QQ8 B;  4MSM B;  3J9C A;  1T77 A;  1FAO A;  5JH5 C;  3KWL A;  2FJ9 A;  2I1K A;  2L76 A;  2C7N B;  2MCN B;  3AH7 A;  1U5D A;  2KOX A;  3ZYY X;  1FGY A;  4GDL B;  2BBC A;  2ZNV B;  2GB1 A;  3DVN U;  3A9K A;  5H8Y E;  1UNR A;  3PLV A;  1P7E A;  1NEK B;  5HE2 A;  2G3Q B;  3AMZ A;  5C79 A;  1QT9 A;  4NJ6 A;  2BPS A;  2DHK A;  1E8Z A;  2DHI A;  2NMB A;  1RJ2 A;  4MEM A;  4YT0 B;  4BKG A;  1N62 A;  3DBH I;  4M01 A;  1J0W A;  4WUR A;  4LJP B;  3VUY A;  4HDQ A;  1XF5 L;  3W2D A;  2W55 A;  4CHJ A;  4L23 A;  2HRJ A;  3E9S A;  2DX5 A;  4JKE A;  1WJ1 A;  4KZC A;  2OED A;  3MC9 A;  1Q0W B;  1TT5 B;  3P2B A;  3Q8E A;  2KQ7 A;  5TR5 A;  4HB0 B;  2DNF A;  1KI1 B;  1WYG A;  2BKF A;  4ACF A;  2UWQ A;  4A55 A;  1I42 A;  3AN1 A;  2KX3 A;  1JWS D;  1RFA A;  1LXD A;  2VSZ A;  4JKD A;  2PE9 A;  4EJN A;  3M1I B;  1PFD A;  2NZ8 B;  2GI9 A;  1OQN A;  4S17 A;  2L2I A;  4WQM A;  4ITK A;  1NI2 A;  4Q2J A;  2DX1 A;  3I3T B;  3DWM A;  3VUX A;  1N3H A;  4A6F A;  4K3C A;  2D11 A;  2LVO A;  1X1F A;  1TY2 A;  5FR3 A;  4LCD E;  3ML8 A;  4MEL A;  4KZ0 A;  3V6E B;  4DQO C;  2L00 B;  4US9 A;  4S0R A;  1ACC A;  2JX5 A;  4JK9 A;  1U5G A;  2AEH A;  3ETR A;  1WMH A;  2IGG A;  4Z2M B;  1V5M A;  5J3T A;  4K7U A;  2Y7B A;  1TJE A;  4KSL C;  4W9E A;  2BT6 A;  1IRS A;  1A5R A;  2JXT A;  1T0R C;  5BMH A;  4OW0 A;  3VVW B;  3DDC B;  3ZUN A;  3SYX A;  2WXH A;  2GBK A;  1WM3 A;  3DBH B;  4UDU C;  1E7P B;  4ZOH C;  2DTC A;  3NSU A;  2UVM A;  1V1P A;  3GZN B;  3IFW B;  5IAA C;  3AE6 B;  2WDQ B;  1R4N B;  1PGB A;  1SB3 C;  4XX5 A;  2IYD B;  2YS3 A;  1WJU A;  3AEB B;  2OHF A;  1DYN A;  1C79 A;  1QIL A;  4NZL B;  4WQO B;  2IZV B;  2QC8 A;  3RUL A;  3ODO A;  3CMM B;  2V0G A;  2PLP A;  3P4S B;  4BAX A;  2KCJ A;  1I7H A;  4DDG D;  2R2O A;  1GOZ A;  2KN5 A;  1QOA A;  2M38 A;  2PEA A;  1YJJ A;  5JHH A;  2ELB A;  3AEC B;  2FDQ A;  4WJN A;  1L4D B;  3V05 A;  3NJT A;  4W9D A;  4ILH A;  3BJI A;  4K7S A;  2RDG A;  2GRI A;  4A90 A;  5HFY A;  1WRI A;  3NS8 A;  4JK7 A;  2OJW A;  5D3D A;  2M8S A;  3L16 A;  5KQ4 A;  2BKR B;  3ZNI D;  2CKH B;  4RF0 A;  2Z8L A;  2I5F A;  2H7E A;  3PRE A;  4DXG A;  4JGH B;  4LNF A;  2M0X A;  4O1N A;  4MH8 A;  3PHX B;  1RWS A;  2DYQ A;  2JXX A;  1EGX A;  2MH7 A;  2NBV A;  1XCG A;  3U52 E;  4H2A A;  3AU5 A;  1K5D B;  4EUT A;  4IWO A;  1N5W A;  4KX6 B;  3WIM A;  3SU8 X;  1DBH A;  2NBW B;  3VOQ A;  3C0R B;  5LOP B;  1P5T A;  2BYT A;  3UF8 A;  1R4M I;  4ZRK A;  1C4P A;  1S1Q B;  1R7S A;  2TSS A;  3P63 A;  4G0N B;  2JWZ A;  1TQZ A;  1RFK A;  5BYQ A;  1WX7 A;  3TEY A;  3L54 A;  1KM7 A;  4RH6 A;  4L1R A;  1STE A;  5G5H A;  2AQ1 B;  4G3X B;  2MWS B;  2FUG 1;  2RUK B;  2ZKM X;  2GUM A;  3WA0 A;  2KZR A;  4NAW B;  3SBG A;  3AM9 A;  2OQB A;  1XCQ L;  4AJY B;  4E71 A;  1Q5W B;  1I4G A;  2HTM E;  4HHV A;  2V3N A;  3L13 A;  2N1W A;  1ZDX A;  1MAI A;  4JWU C;  2WXJ A;  2OTX A;  4NSW A;  1VBH A;  4H8S A;  1DOX A;  2RLO A;  4WJO A;  2ZCC A;  2QEJ C;  2CHW A;  4OVZ A;  2XQN M;  3ZIM A;  2ZCB A;  3V3X A;  2J0M A;  2C7H A;  3PS6 A;  3OJ3 A;  4L6E A;  4DK5 A;  2NTS A;  2L0F A;  1I7A A;  4M0W B;  1Q1O A;  5KHQ A;  2JZZ A;  3SR6 A;  3OHM B;  1QQR A;  2COD A;  1MKE A;  2K49 A;  1WXM A;  2KWU B;  1ZP0 B;  4G50 A;  5TSS A;  2IY0 B;  1XLP A;  3VQI A;  2JSV X;  4PS7 A;  2JT4 B;  2Z4D A;  2YS1 A;  1WX9 A;  5G55 A;  4FJV B;  1V61 A;  4US8 A;  2WXK A;  1FNV A;  2L32 A;  4XZ4 A;  3N1Y C;  3P6A A;  3M95 A;  2B76 B;  2Q13 A;  2AL6 A;  1DYQ A;  4JKH A;  3RNF C;  1EWC A;  3UIP B;  1P3Q U;  1BAK A;  2LUL A;  4JK8 A;  2HTH A;  1C9F A;  1XO3 A;  2MSE D;  3KSY A;  2ADZ A;  1QKZ A;  3MC0 B;  2KGX B;  1B9R A;  4HB2 B;  3KRW A;  2MBE A;  2VZK B;  3V5W A;  3ZXR A;  3QHT A;  3AEA B;  1P0R A;  3HW2 B;  2EC1 A;  2G9H D;  1KBL A;  5KCV A;  1L0Y B;  1WGU A;  2KJH B;  2RDH A;  2P0H A;  4CHM A;  3BIN A;  3WAP A;  2WXI A;  2KJ6 A;  2EKE C;  5KQ1 A;  1I4P A;  4KV2 A;  1YN5 A;  2COF A;  2LWP A;  1KLU D;  4MY6 A;  4DHJ D;  3V61 A;  2FJL A;  2WS3 B;  1WH3 A;  1HB8 A;  1C4C A;  2EJ8 A;  2O6V B;  3L08 A;  4HKZ E;  1UZX B;  2LGY A;  4P6V F;  4ANU A;  2D07 B;  1R4N I;  2N1V A;  1I2H A;  1QQG A;  1HXY D;  4HSI A;  2C5L C;  1GAQ B;  3MFG A;  2AWT A;  1GGO A;  1W1G A;  2CU1 A;  2X8X X;  4AUQ C;  1FO4 A;  2JWU A;  2WGS A;  3MP9 A;  2EKI A;  4NAM A;  2WLB A;  4DHJ B;  2EEL A;  2ZZP B;  4ILG B;  4OT1 A;  1OQY A;  3DOW A;  5IKC M;  2BQQ A;  4M8M A;  3DXC A;  3TBL D;  2KMA A;  2LXA A;  4MM3 A;  4MT7 A;  1WVH A;  2WX1 A;  2VRR B;  1UNQ A;  3L10 B;  3TW1 A;  1M4V A;  5EE1 A;  4C4V A;  1FIQ A;  4YWG G;  2LJI A;  4MH0 E;  5AUI A;  2I38 A;  3A9J B;  4P1B C;  2JVC A;  5FR6 A;  2FAZ A;  4B6W A;  1X05 A;  1XOD A;  4XC2 A;  4OSN A;  2MA9 B;  5T8I A;  3ONS A;  3APD A;  3VDZ A;  1JRU A;  3AE8 B;  3SNH A;  2VKI A;  2V9H A;  3KQ4 A;  3RNB C;  1SJH D;  4DHZ B;  2LVQ A;  3LXF A;  1NYQ A;  1TZO A;  1TTN A;  5IJM A;  5D7G A;  4HAX B;  2KMC A;  3ZTC A;  2DAJ A;  4F7Z A;  1V9J A;  5BYR A;  1MHX A;  2RDB C;  4JWS C;  1NTV A;  3RD2 A;  4LLG M;  1FNU A;  2HJ8 A;  3D8F A;  1UD7 A;  1YX5 B;  2KTF A;  4XYC A;  1TS4 A;  1ET9 A;  4M8N A;  3NUH B;  3O13 A;  1SIF A;  4WVF B;  2FUH B;  5DPR A;  2J0J A;  4GZU A;  4W9J A;  1EUV B;  2DHZ A;  2KVR A;  4KKJ A;  2FE8 A;  2L0T A;  4GU2 A;  5LG4 B;  1CMX B;  1U5E A;  1VDV A;  3AUL A;  3ML9 A;  3TEX A;  2UZR A;  3Q3J A;  1M7R A;  1OQQ A;  4LTU A;  4KHB B;  3IXS A;  3HQC A;  3DCG A;  3Q8F A;  1VLB A;  2FCS A;  5C6R A;  4II2 B;  4Z2N A;  3MJW A;  2KVZ A;  1E10 A;  3AE7 B;  1WXV A;  2WXO A;  1WGD A;  3RNA C;  4W9F A;  3RZF A;  2INN E;  1K5G B;  1H8C A;  2RPQ A;  2KQ4 X;  4GMV A;  2JQR B;  3ZRC A;  1GJZ A;  1TS5 A;  3HRD D;  4A20 A;  1NDD A;  2Z0D B;  2N9E B;  3LB8 C;  1T5X D;  2GMI C;  2QKL A;  5E6O A;  1BWN A;  4KVG B;  4ARC A;  3ZLZ A;  4LNI A;  4IUM B;  3T8M A;  3GYO A;  4HKQ A;  1LGR A;  1Y5O A;  2GCJ A;  4BZA A;  4PK1 A;  1J7B A;  2VH1 A;  2WU5 B;  1G6J A;  3TEW A;  3RNG C;  3FP5 A;  1GC7 A;  1VJK A;  1MIZ B;  2COA A;  3VH4 B;  3VAW A;  3Q8A A;  1P6S A;  4RGO S;  4IAP A;  1WE7 A;  4N59 A;  3WAL A;  2WH5 A;  2W3R A;  4IM0 A;  1D4B A;  3KYC D;  2KO3 A;  2N7J A;  3PZ8 A;  1B55 A;  2KIG A;  4B95 A;  1CK1 A;  1IBX B;  1C3T A;  4KHB A;  3EA6 A;  3ZGZ A;  1L0X B;  5IN7 A;  2COC A;  2CJO A;  2LI5 A;  3NZS A;  1FRR A;  1FRD A;  2KT7 A;  1JAL A;  3ZJU A;  1Q67 A;  4W9I A;  3FAH A;  3JSV B;  3Q3O C;  1GUA B;  2NTT A;  2N9X A;  2LZ6 A;  3HVZ A;  5FI0 A;  2LOX A;  1X1M A;  2CQU A;  5MPO A;  3OWE B;  1DRO A;  2DYO A;  2K1F A;  1WXA A;  3DCX A;  3MHS D;  1TJ6 A;  2DFK A;  5JP4 A;  2LGD A;  3D8D A;  3Q6B A;  1YQB A;  2ON8 A;  3CWI A;  3RNE C;  2KWC A;  4ZRI A;  3DHG C;  4LNN A;  1YN3 A;  1DDV A;  1FGZ A;  1ACA A;  3HUI A;  3A98 B;  5LNK 1;  1SEB D;  1Y8R C;  2KAJ A;  4XWT A;  2KX0 A;  2BS2 B;  4L2Y A;  1OTR B;  1QZE A;  4CO7 A;  3V6C B;  2YVC A;  3QA8 A;  5DPW A;  3SFE B;  2YT2 A;  3ULC A;  2RD0 A;  4L1B A;  4M0W A;  2K8E A;  1ZOY B;  2QIE B;  3M3J A;  1MJD A;  3FSS A;  2MX2 A;  3TL5 A;  5DI9 B;  1J8C A;  1FNW A;  1DGJ A;  3QWM A;  1WGG A;  1N6Z A;  3HHM A;  1KZ7 A;  4HB4 B;  3PEG A;  3V60 A;  5AEK B;  2ASQ A;  3FLV A;  4WWO A;  1LB1 A;  2LG1 A;  3AJ4 A;  1AYF A;  4BVU C;  2IBI B;  1UGM A;  2KFK A;  3RPF C;  4OZB A;  4RM9 A;  2PZ1 A;  1TKG A;  2R09 A;  4IM2 A;  2N7D A;  1ZPS A;  1FM0 D;  1KLV A;  4EE2 A;  3PT2 B;  4K7W A;  4KGS A;  3VTV A;  2LBB A;  2D9X A;  2NMQ A;  1PFJ A;  3QWZ B;  4AP4 C;  4EZJ A;  1WGQ A;  1RRB A;  1V2Y A;  2M4N A;  4PQ0 A;  2YT0 A;  1OFF A;  1V97 A;  2H7D A;  1TXD A;  2AL3 A;  4YON A;  3DHH C;  3ZNG C;  4D0N B;  1UNP A;  2IO3 B;  4TKN A;  1P1A A;  3HK0 A;  4KHA A;  3P42 A;  4A5K A;  1DDM A;  4BBK A;  2N7E A;  1MFW A;  1V1P B;  2YLM A;  4D2K A;  2CJN A;  4LDT D;  1PUT A;  5DHF B;  3AE2 B;  3U4E G;  3B77 A;  5AZH A;  1NVL A;  1TGZ B;  2ZJD A;  1YX6 B;  1D3Z A;  3WAN A;  4TV3 A;  1U4A A;  1Z5S B;  1D5Z C;  1SHC A;  3A9K B;  5J18 A;  2ROZ B;  1W1D A;  1U5F A;  4GPT B;  2FJU B;  5AUK A;  4YSX B;  2PE6 B;  4JLC A;  2DWQ A;  3GZN I;  1S3S G;  2KUP A;  3PZD A;  5CHF A;  3FM8 C;  1XD4 A;  3BYY B;  4HJK A;  2MP2 A;  3WYF B;  3MPX A;  5JZE B;  1X86 A;  2D3G A;  1UPQ A;  4BOS C;  2W3S A;  3D32 A;  2IJ0 A;  5JHB A;  1QOB A;  2R82 A;  1C1Y B;  2KIE A;  4WIP A;  3ZDT A;  5FKA C;  4A8X C;  3CXB B;  1N5X A;  5L81 A;  2IYB A;  2ZPY A;  2LMC A;  3PLU A;  1I4X A;  1TY0 A;  3F5R A;  3PVL A;  3AXC A;  1UEL A;  4ANV A;  1KRH A;  3GE3 C;  3PRM B;  2BF8 B;  3ECI A;  1T0Q C;  4GXB A;  2MBH A;  2VH2 A;  2MBQ A;  3PTF C;  2CY4 A;  1NU2 A;  2KD0 A;  3M63 B;  5IA7 A;  2R61 A;  4MGY E;  3Q3N C;  1BTK A;  1QOG A;  1F0Z A;  3MC8 A;  2JF5 A;  3H8H A;  4E74 A;  2MDX A;  4XGA B;  4AS1 A;  4BKS A;  2BVC A;  4LK0 M;  4ZYS A;  2Z13 A;  1VZ8 A;  1UNS A;  1C76 A;  3ZJT A;  2R2Q A;  1P9D U;  1F2R C;  2D2Q A;  4GDK A;  1E0Z A;  1PLS A;  4IKG A;  2YSZ A;  2JYT A;  2M19 A;  4FUL A;  3ULB A;  2CS4 A;  4MK0 A;  2RNR B;  1A70 A;  3AEF B;  2K2U A;  2ZW0 A;  2V76 A;  1KC7 A;  4FHJ A;  4K2O A;  5L83 A;  5C5B A;  1YJ1 A;  2DBY A;  4HPM B;  3BK2 A;  2CHX A;  3IG3 A;  1BUI C;  3R7Q A;  3O96 A;  4EEW A;  2KWV B;  3E9L A;  5IO9 A;  4WJQ A;  3UQA A;  2NPT A;  1L7Y A;  2QHO A;  5AZF A;  1MG8 A;  2B3A A;  1MI1 A;  5J3Q A;  1FFV A;  3NVW A;  5LXI B;  2X18 A;  1E6E B;  2BW2 A;  2I1J A;  1E8X A;  3TVV A;  5I2S A;  1VD2 A;  4HAU B;  4WSF A;  3P7Z A;  2CY5 A;  1NVI D;  1E8Y A;  1HBK A;  2A4Z A;  3EFU A;  3Q2A C;  4A6K A;  3BYT B;  1I4R A;  4EZL A;  1XCT L;  4QJ4 B;  4XE0 A;  2PW9 A;  3FIL B;  2LGX A;  3W1S C;  2JUO A;  2K0P A;  5BMG A;  2L8J A;  3SD5 A;  3ENB A;  1MK9 B;  2C60 A;  2KJR A;  4XWX A;  1BXT A;  5C23 A;  2ZVO A;  3TCA A;  2LUM A;  3NVY A;  1Z87 A;  1XKE A;  4RM8 A;  2PKO A;  4HK2 A;  1JML A;  4HWI B;  1CQV A;  3P4P B;  1YOV B;  5JHG A;  2WNM A;  4AJW A;  4ILJ A;  4MGK E;  2INC C;  4C4V B;  4LDT B;  3VTU A;  4ASW C;  1MK7 B;  3ALB A;  2MBB B;  2G35 A;  1WZ3 A;  2LUE A;  2KK8 A;  4MM3 B;  2Z0Q A;  2V4I B;  3H7P A;  1NEN B;  4D6W A;  1MPH A;  1U29 A;  1WYW B;  3UIN B;  3I57 A;  3KUZ A;  1V49 A;  3VRA B;  2X0S A;  2MHJ A;  1PGX A;  1SF0 A;  1IUE A;  1HQR D;  2IDY A;  1B1Z A;  1TKY A;  2LEK A;  1GNU A;  3DXD A;  4WWM A;  2L83 A;  2JU6 X;  5FI1 A;  3APF A;  1J0G A;  1WXS A;  5LXH A;  4W9G A;  3PG7 A;  2C9W B;  4K2P A;  1SE2 A;  3H9D A;  3VXW A;  1F52 A;  3K9O B;  2LHE A;  2JY6 A;  5D3Y A;  4HCN B;  2KLC A;  5J3Y A;  2JRI B;  1Z2M A;  4WWP A;  2K8B A;  1T0S C;  2P8V A;  1EM7 A;  3L17 A;  4HVB A;  2BCJ A;  4EZK A;  3L0W B;  1U2B A;  1L0V B;  2FCM A;  3OJ4 B;  5CLL B;  1EU4 A;  1ZW7 A;  2W9N A;  3AV8 A;  3PGE A;  2GBR A;  4FJZ A;  1C78 A;  2CU3 A;  3BZD B;  4B9K A;  2YEP F;  2IFS A;  4DX8 A;  1RRP B;  1XD3 B;  2RSU A;  4DBB A;  1WJN A;  4IOY X;  4KDI C;  4GGQ A;  2WWZ A;  3T06 A;  3ZKJ C;  3DVG X;  4ZYN A;  2DYM A;  1L2N A;  3FEH A;  2AQ2 B;  3ZO5 B;  5D2M B;  4HLE A;  1YJI A;  2K6Q A;  1JWM D;  1T3Q A;  5D3I B;  2O2V A;  4USA A;  2WP9 B;  2G45 B;  3Q69 A;  1WGR A;  2RRF A;  4IW0 A;  2IY1 B;  3ZQ4 A;  1ZC3 B;  2K39 A;  3GOE A;  5J17 A;  1BTN A;  4DXA B;  5BYS A;  4JIO U;  2IGH A;  2QMT A;  3E9O A;  1DIK A;  2WQY B;  4WJP A;  3ZNZ B;  2KC2 A;  3RUI B;  3QIJ A;  2V1Y A;  1WMH B;  2M56 B;  2G4S A;  4YL8 A;  3DQV A;  4JKF A;  4IG7 B;  4JKG B;  5DPT A;  3TUO A;  2ROV A;  1IGC A;  1OEY A;  2Y8G A;  4JKB A;  1PDX A;  3DBL I;  1ST7 A;  3PSC A;  1V88 A;  3DWG C;  4GLS C;  5C2T B;  3RN9 C;  1TBE A;  2NVU I;  1N60 A;  2IGD A;  5I2M A;  2R2Y A;  1EF5 A;  1KF6 B;  1UGJ A;  5IP4 D;  4KSK C;  4HPP A;  4BBN C;  2J59 M;  1V8C A;  2V3S A;  4RGM A;  1WJ4 A;  5I4D A;  2DKP A;  4RFB A;  4A6Q A;  1X1G A;  1P98 A;  3KYD D;  2GCL A;  4K81 A;  1SGH A;  1GC6 A;  1OGW A;  3TJP A;  2HD5 B;  4KAX B;  1HZ6 A;  2KWD A;  2Y8F A;  5D6J B;  3N3K B;  4RGN A;  4G11 A;  4TUU A;  1YQ3 B;  1RYJ A;  1XQQ A;  5C1Z A;  3ML4 A;  1WE6 A;  3FIL A;  3MHZ A;  2GBM A;  2KDB A;  2MQJ A;  2KXJ A;  4OZC A;  3ZDM C;  2MJE A;  4BKT A;  1ZDV A;  5CHW A;  3KUD B;  2MBO A;  5CHV C;  1KTK A;  3KRX A;  1FXT B;  1T6B X;  3NWD A;  1LO5 D;  1IP9 A;  5HHD G;  3KY9 A;  1IPG A;  1HE8 A;  3IT6 B;  3NRZ A;  1VRA B;  4FN2 A;  3ZJV A;  5LON B;  2J4X A;  2NR2 A;  5HE3 A;  4XDD A;  3QJZ A;  1T0Y A;  2KDE B;  4IWQ A;  2LGS A;  1WJ6 A;  1WF9 A;  3TFM A;  1ZE3 D;  1VR9 A;  1F77 A;  1E7U A;  4AWJ A;  3TSS A;  2RR9 A;  4JKG A;  2MJD A;  1FCL A;  3A33 B;  4OZA A;  3S2A A;  5C5B B;  1PYW D;  3IT4 B;  1ROE A;  2LYD A;  3W1S A;  1RLF A;  1L4Z B;  4DBG A;  3AE9 B;  2D9W A;  5GOW B;  2FCN A;  2KQS A;  3PRP B;  4PS8 A;  3H7P B;  1WFY A;  3CIR B;  5CX3 A;  2DZI A;  2WXN A;  2LVP A;  5EDS A;  3MJ5 A;  3NVZ A;  3CSF A;  2QSD A;  3X23 A;  2DEN B;  5E6N A;  2BTE A;  4F7G A;  5HE1 A;  1M7E A;  1E7V A;  1I35 A;  3H1U A;  5HE0 A;  4LNK A;  1YNT E;  3KW5 B;  1V5U A;  2K00 A;  2BS4 B;  2M0A A;  1SBB B;  3AI5 A;  2WDV B;  4AOF A;  4TYZ A;  1XX0 A;  1ZXH A;  2L1C A;  3RI7 C;  1E9M A;  4ZRJ A;  5D27 A;  1LQB A;  2IO2 B;  4YSZ B;  1H4R A;  3P1M A;  1UUP A;  4IFS A;  4KGR A;  3URY A;  3VH3 B;  2K9X A;  1F2R I;  3PHW B;  5LLI A;  2K3U A;  1FHW A;  5GXG B;  4RNA A;  2UU7 A;  2AYO B;  4NPN A;  3PPA A;  1GPX A;  2LJ5 A;  1FMA D;  3E56 A;  1KJT A;  3N9Y C;  1F9J A;  5D94 A;  2KN4 A;  4JPS A;  1EWY C;  4A3O A;  1V81 A;  4P16 A;  5HG2 A;  3NHE B;  2XBB C;  5EE3 A;  3DPD A;  2M14 A;  1XLQ A;  3U7D A;  3PRZ A;  3AB5 A;  2KLG A;  1MIX A;  2AQ3 B;  4HXD A;  2RVB B;  4X57 B;  3K9P B;  4K1R B;  2RQ1 A;  3U2S C;  1YN4 A;  2J0K A;  5DH9 B;  2ABD A;  2BGF A;  3N7C A;  1UH6 A;  2MKR A;  2D9V A;  3G9W A;  1MVK A;  1GG3 A;  2ZPN A;  3SFD B;  3CF6 E;  3QK0 A;  2KR0 A;  3TEZ A;  3JW0 X;  3ZW3 A;  2WU2 B;  2BB5 A;  3SEB A;  2Z0E B;  3HVD A;  3Q8C A;  2DYN A;  5KHO A;  1K50 A;  1LFD A;  4ZDV A;  2Y3A A;  4GB9 A;  1QF6 A;  2PVG C;  3SV1 A;  1BT0 A;  4GMX B;  1TIF A;  3AE1 B;  2Y5B B;  3RYT A;  5L95 C;  2VZK D;  3T9L A;  2W82 A;  3DVG Y;  4P1C C;  2QDF A;  4JKA A;  2XNA C;  2Z0O A;  4ANW A;  3PV1 A;  1WGK A;  3IVF A;  2J7Q B;  1SIJ A;  3IAM 1;  2VRW B;  3A9J A;  3ODW A;  1QC6 A;  4I6L B;  4MJS A;  3P4Q B;  2G4D B;  2RGN B;  4ICU A;  1UPR A;  1NTI A;  3A4R A;  2GS0 A;  1MPE A;  2BS3 B;  3W9C B;  3AEE B; 
#chains in the Genus database with same CATH homology
 4FHK A;  3PVU A;  1AWE A;  1TZ1 A;  2M17 A;  3IHP C;  2DYB A;  2BWF A;  3RT3 B;  5JHA A;  3NY5 A;  4KDL B;  3R3M A;  2CAY A;  5C16 A;  4W9H A;  2OOB B;  2GBN A;  1UBQ A;  2KFK B;  1V5O A;  3ZTD A;  2MP2 B;  2GJY A;  4GSW A;  1V6E A;  4HAV B;  3NOB A;  3UZT A;  3WAO A;  3O65 B;  2BYE A;  2L3Z A;  2JZ3 B;  4GDK B;  2LKO A;  3OLM D;  4TQ1 A;  3KUC B;  1PQS A;  3A8P A;  1RAX A;  3AU4 A;  1OY2 A;  4KHO A;  4MDK E;  2IO0 B;  3DBR I;  5D3V A;  4NY0 A;  1ZVR A;  3CST A;  3TIX A;  2W2X D;  2LXC A;  3CIK A;  4W9L A;  1EO6 A;  1FHO A;  1WY8 A;  3ENE A;  1ZKH A;  2YS5 A;  4F1S A;  2P0F A;  5JLJ B;  2KFJ A;  2LOZ A;  4JQW C;  3U30 A;  4DHZ E;  5CLQ B;  2BYV E;  2RSG A;  3KVF B;  2BWE S;  3QX1 A;  2XK5 A;  2MLB A;  2C7M B;  2ZNV C;  2NPT B;  3RZW C;  4K17 A;  5D3W A;  2DZM A;  3R66 C;  3R7R A;  1WX8 A;  1YIW A;  4WAA A;  3PP2 A;  3A4S C;  1NBF C;  4LJO B;  1WI0 A;  4MSQ B;  2JP2 A;  3SHQ A;  2KAN A;  2FNJ B;  2EMS A;  2GOW A;  4ANX A;  5DPS A;  3JYU A;  3EC8 A;  1XR0 B;  3ZVR A;  1YD8 U;  4NAW A;  2OJR A;  2KTR A;  4A3P A;  1WRD B;  1V80 A;  1FOE A;  4W9C A;  3W1Y A;  4BKS D;  2L7R A;  3BY4 B;  4MGZ E;  4HAT B;  2HE7 A;  3B1L X;  3Q3F A;  2FCQ A;  3UGB B;  2W2X C;  4DX9 0;  2MRP A;  4NJ7 A;  2UZS A;  4B6H A;  3D8E A;  2N4F A;  1U27 A;  2D10 A;  2EMT A;  1V5P A;  3IBE A;  2DZJ A;  4IWP A;  2PJH A;  4PYZ A;  3F0W A;  3ZNH B;  2UYZ B;  3VTW A;  4CYE A;  2MFQ A;  1SE9 A;  1WI1 A;  2NBU A;  2MWN B;  3U8Z A;  1P3R A;  3QCA A;  4JKC A;  4IM3 A;  1NTY A;  4W9K A;  4BFR A;  5JVL A;  3VUW A;  2XK5 B;  4I6N B;  3ZVV A;  3A1Q B;  3E66 A;  3JVZ X;  2PPH A;  1UBI A;  5J2R A;  3LDZ E;  4KIK A;  2FID A;  1E5W A;  4CHK A;  4F7H A;  4PNK A;  2IO1 B;  3SUZ A;  2D4Q A;  4HB3 B;  4HDO A;  3M62 B;  1FHX A;  1OMW A;  4DWF A;  2YRY A;  2CR5 A;  4F7U P;  4PYU A;  4FAD A;  3EEC A;  2M1M A;  4KIK B;  4WJ7 A;  3QC8 B;  2A5U A;  2D9Y A;  2D9Z A;  2DKQ A;  3GYP A;  5AZG A;  2N9P C;  3JSV A;  3TMP B;  1E8W A;  3HIZ A;  1HB6 A;  2LAS A;  2BYF A;  3WAM A;  3VIA A;  2K8H A;  2K6D B;  1UEF A;  2N0Y A;  4A6F B;  3QAR A;  4HPL B;  2P0D A;  1ZGU B;  1WIA A;  1ISN A;  1KOT A;  4P7I A;  2WX0 A;  4ICV A;  2O6V A;  4WWN A;  2YF0 A;  4FA6 A;  2WDT B;  3DVN V;  2REX A;  3B08 A;  1K8R B;  2L05 A;  3HM3 A;  2DHJ A;  4A6H A;  4IC7 B;  4MJS B;  2KDI A;  1M94 A;  4TQ0 A;  1XT9 B;  3OAW A;  2CRF A;  4BOZ B;  1WM2 A;  3MDB C;  5G2N A;  4HAZ B;  2HTH B;  1WZ0 A;  2MW5 A;  1WGH A;  3ODX A;  3OAN A;  1FB8 A;  2DAF A;  3UQB A;  3LJ3 A;  4GDL A;  2LRW A;  2DN6 A;  3EHV A;  1WR6 E;  3A1Q A;  2DA0 A;  1V86 A;  3VFK A;  4EMO A;  3N32 A;  3MTN B;  3SBT A;  1KZG A;  2XEW A;  3H6N A;  2KNB A;  2WYQ A;  2JRH A;  3NZU A;  3VHT C;  1ZSQ A;  1W1H A;  3APC A;  1V89 A;  1VCB A;  5E6P A;  4JL9 A;  5D3X A;  2LD9 A;  3E9P A;  4GIV A;  1ZC4 B;  3KH0 A;  4FLH A;  1OEY J;  1VBG A;  2DZK A;  4HAY B;  4FBJ B;  5BO4 B;  2DIK A;  3QBV B;  2COP A;  5EFX A;  4EKU A;  2R0D A;  1LW3 A;  1AQC A;  4J6I A;  3H7S A;  3HM6 X;  1J19 A;  2O2V B;  4PS3 A;  4OVU A;  3QAQ A;  4EFO A;  3PVW A;  2KTR B;  2CHZ A;  4MGI E;  2K25 A;  2K8C A;  4NQK E;  2Z0P A;  1WJM A;  4GOC A;  4I6P A;  4E3C A;  2YT1 A;  3UIO B;  3KZ1 A;  3ZRF A;  2KKC A;  1E90 A;  4N9F 4;  4NNJ B;  2CB8 A;  4II3 B;  2E2X A;  5GMV A;  5DCN A;  5DIF B;  3DXE A;  2NS5 A;  2V4L A;  4Y94 A;  2QKM A;  4NQL B;  4F8C B;  5HKH A;  3V62 A;  3SO6 A;  4EOY A;  3A8Q A;  4FJY A;  2RGF A;  4C0A A;  2N23 A;  2O6V D;  2K2J A;  5CTR C;  1X11 A;  2ELA A;  3N30 A;  4DDI D;  3SDL C;  2NCN A;  3EPY A;  3X0W A;  1DDW A;  5DHA B;  1WGY A;  2DX5 B;  2I5C A;  4GN1 A;  1WR1 A;  4URK A;  4BBN F;  2KC1 A;  1H10 A;  2GBJ A;  3RCP A;  1EVH A;  3TO1 A;  1EF1 A;  2JPH A;  2DLW A;  4OVV A;  4HCP B;  1JDE A;  2NBV B;  1WG7 A;  1AAR A;  3LJU X;  2LRU A;  3RCZ A;  3DBS A;  1V5T A;  3B0A A;  1ZM0 A;  2ZEQ A;  1PMS A;  4HAW B;  2KDF B;  1IYF A;  4RMA A;  2ZVN A;  1EAZ A;  2FIF A;  3PSE B;  2KHW B;  1Y19 B;  2Z59 B;  2W2W A;  1LM8 B;  3QQ8 B;  4MSM B;  5JH5 C;  1FAO A;  2FJ9 A;  2I1K A;  2L76 A;  2C7N B;  2MCN B;  1U5D A;  2KOX A;  1FGY A;  4GDL B;  2ZNV B;  3DVN U;  3A9K A;  1UNR A;  3PLV A;  5HE2 A;  2G3Q B;  5C79 A;  4NJ6 A;  2BPS A;  2DHK A;  1E8Z A;  2DHI A;  2NMB A;  1RJ2 A;  4MEM A;  4BKG A;  3DBH I;  1J0W A;  4LJP B;  3VUY A;  4HDQ A;  4CHJ A;  2HRJ A;  2DX5 A;  4JKE A;  1WJ1 A;  4KZC A;  1Q0W B;  3P2B A;  2KQ7 A;  5TR5 A;  4HB0 B;  1KI1 B;  2BKF A;  2UWQ A;  1I42 A;  2KX3 A;  1RFA A;  1LXD A;  2VSZ A;  4JKD A;  2PE9 A;  4EJN A;  3M1I B;  2NZ8 B;  1OQN A;  2L2I A;  1NI2 A;  2DX1 A;  3I3T B;  3VUX A;  1N3H A;  4A6F A;  2D11 A;  2LVO A;  1X1F A;  4LCD E;  3ML8 A;  4MEL A;  4KZ0 A;  3V6E B;  2L00 B;  4JK9 A;  1U5G A;  2AEH A;  1WMH A;  4Z2M B;  1V5M A;  5J3T A;  4K7U A;  2Y7B A;  4KSL C;  4W9E A;  1IRS A;  1A5R A;  3VVW B;  3ZUN A;  3DDC B;  3SYX A;  2GBK A;  1WM3 A;  2DTC A;  3NSU A;  2UVM A;  3IFW B;  5IAA C;  4XX5 A;  2IYD B;  2YS3 A;  1WJU A;  1DYN A;  4WQO B;  2IZV B;  3RUL A;  3ODO A;  3CMM B;  2KCJ A;  4DDG D;  2R2O A;  2KN5 A;  2M38 A;  2PEA A;  5JHH A;  2ELB A;  2FDQ A;  4WJN A;  4W9D A;  4ILH A;  3BJI A;  4K7S A;  3NS8 A;  4JK7 A;  2M8S A;  3L16 A;  5KQ4 A;  2BKR B;  3ZNI D;  2CKH B;  2I5F A;  2H7E A;  3PRE A;  4JGH B;  2M0X A;  3PHX B;  2DYQ A;  2JXX A;  1EGX A;  1XCG A;  3AU5 A;  1K5D B;  4EUT A;  4IWO A;  3WIM A;  3SU8 X;  1DBH A;  2NBW B;  3VOQ A;  3C0R B;  5LOP B;  1P5T A;  3UF8 A;  1R4M I;  4ZRK A;  1S1Q B;  4G0N B;  2JWZ A;  1TQZ A;  1WX7 A;  3L54 A;  1KM7 A;  4G3X B;  2MWS B;  2RUK B;  3WA0 A;  2KZR A;  4NAW B;  3SBG A;  2OQB A;  4AJY B;  4E71 A;  1Q5W B;  4HHV A;  3L13 A;  2N1W A;  1MAI A;  2OTX A;  4NSW A;  1VBH A;  4H8S A;  2RLO A;  4WJO A;  2ZCC A;  2CHW A;  2XQN M;  3ZIM A;  2ZCB A;  2J0M A;  2C7H A;  3PS6 A;  3OJ3 A;  4L6E A;  4DK5 A;  2L0F A;  1I7A A;  4M0W B;  1Q1O A;  5KHQ A;  2JZZ A;  2COD A;  1MKE A;  1WXM A;  2KWU B;  4G50 A;  2IY0 B;  3VQI A;  4PS7 A;  2JT4 B;  2YS1 A;  1WX9 A;  5G55 A;  4FJV B;  1V61 A;  4XZ4 A;  3P6A A;  3M95 A;  2Q13 A;  2AL6 A;  4JKH A;  3UIP B;  1P3Q U;  1BAK A;  2LUL A;  4JK8 A;  2HTH A;  2MSE D;  3KSY A;  2ADZ A;  2KGX B;  4HB2 B;  3KRW A;  2MBE A;  3V5W A;  3QHT A;  1P0R A;  3HW2 B;  2EC1 A;  1KBL A;  5KCV A;  1WGU A;  2KJH B;  2P0H A;  4CHM A;  3BIN A;  3WAP A;  2KJ6 A;  2EKE C;  5KQ1 A;  4KV2 A;  2COF A;  2LWP A;  4MY6 A;  4DHJ D;  3V61 A;  2FJL A;  1WH3 A;  1HB8 A;  2EJ8 A;  2O6V B;  3L08 A;  1UZX B;  2LGY A;  4ANU A;  2D07 B;  1R4N I;  2N1V A;  1I2H A;  1QQG A;  2C5L C;  2AWT A;  1GGO A;  1W1G A;  2CU1 A;  4AUQ C;  4DHJ B;  2ZZP B;  4ILG B;  1OQY A;  3DOW A;  4M8M A;  3DXC A;  3TBL D;  2KMA A;  2LXA A;  4MM3 A;  4MT7 A;  1WVH A;  2WX1 A;  2VRR B;  1UNQ A;  3L10 B;  3TW1 A;  4MH0 E;  3A9J B;  2JVC A;  5FR6 A;  2FAZ A;  4B6W A;  1X05 A;  1XOD A;  4XC2 A;  2MA9 B;  3ONS A;  3APD A;  3VDZ A;  1JRU A;  3SNH A;  2VKI A;  4DHZ B;  2LVQ A;  1TTN A;  5IJM A;  5D7G A;  4HAX B;  2KMC A;  3ZTC A;  2DAJ A;  4F7Z A;  1V9J A;  1NTV A;  3RD2 A;  2HJ8 A;  3D8F A;  1UD7 A;  1YX5 B;  2KTF A;  4M8N A;  1SIF A;  4WVF B;  2FUH B;  5DPR A;  2J0J A;  4GZU A;  4W9J A;  1EUV B;  2DHZ A;  2KVR A;  2L0T A;  4GU2 A;  1CMX B;  1U5E A;  3AUL A;  3ML9 A;  2UZR A;  3Q3J A;  1M7R A;  4KHB B;  3HQC A;  3DCG A;  2FCS A;  5C6R A;  4II2 B;  4Z2N A;  3MJW A;  1WXV A;  1WGD A;  4W9F A;  3RZF A;  1K5G B;  1H8C A;  2RPQ A;  4GMV A;  3ZRC A;  1GJZ A;  4A20 A;  1NDD A;  2Z0D B;  2N9E B;  2GMI C;  2QKL A;  5E6O A;  1BWN A;  4KVG B;  3ZLZ A;  4IUM B;  3T8M A;  3GYO A;  1Y5O A;  2GCJ A;  1G6J A;  3FP5 A;  1GC7 A;  1MIZ B;  2COA A;  3VH4 B;  3VAW A;  1P6S A;  4IAP A;  1WE7 A;  3WAL A;  2WH5 A;  4IM0 A;  3KYC D;  2KO3 A;  1B55 A;  4B95 A;  1C3T A;  2COC A;  2LI5 A;  3NZS A;  1Q67 A;  4W9I A;  3JSV B;  1GUA B;  2N9X A;  2LZ6 A;  5FI0 A;  2LOX A;  1X1M A;  2CQU A;  1DRO A;  2DYO A;  2K1F A;  1WXA A;  3MHS D;  1TJ6 A;  2DFK A;  5JP4 A;  2LGD A;  3D8D A;  1YQB A;  2KWC A;  4ZRI A;  1DDV A;  1FGZ A;  1ACA A;  3A98 B;  1Y8R C;  2KX0 A;  1OTR B;  1QZE A;  4CO7 A;  3V6C B;  2YVC A;  3QA8 A;  5DPW A;  3ULC A;  2RD0 A;  3M3J A;  3FSS A;  2MX2 A;  3TL5 A;  5DI9 B;  1J8C A;  3QWM A;  1WGG A;  3HHM A;  1KZ7 A;  4HB4 B;  3PEG A;  3V60 A;  5AEK B;  2ASQ A;  3FLV A;  4WWO A;  1LB1 A;  2LG1 A;  3AJ4 A;  4BVU C;  2IBI B;  1UGM A;  2KFK A;  4RM9 A;  2PZ1 A;  2R09 A;  4IM2 A;  2N7D A;  1KLV A;  3PT2 B;  4K7W A;  3VTV A;  2LBB A;  2D9X A;  1PFJ A;  4AP4 C;  3QWZ B;  4EZJ A;  1WGQ A;  1RRB A;  1V2Y A;  2M4N A;  4PQ0 A;  2YT0 A;  2H7D A;  1TXD A;  2AL3 A;  4YON A;  3ZNG C;  4D0N B;  1UNP A;  2IO3 B;  4TKN A;  1P1A A;  3HK0 A;  4KHA A;  4A5K A;  1DDM A;  4BBK A;  2N7E A;  2YLM A;  4LDT D;  5DHF B;  1D3Z A;  5AZH A;  1NVL A;  1TGZ B;  1YX6 B;  2ZJD A;  3WAN A;  4TV3 A;  1U4A A;  1Z5S B;  1SHC A;  3A9K B;  5J18 A;  2ROZ B;  1W1D A;  1U5F A;  4GPT B;  2PE6 B;  4JLC A;  3GZN I;  1S3S G;  2KUP A;  3PZD A;  5CHF A;  3FM8 C;  1XD4 A;  4HJK A;  2MP2 A;  3WYF B;  3MPX A;  5JZE B;  1X86 A;  2D3G A;  1UPQ A;  4BOS C;  3D32 A;  5JHB A;  2R82 A;  1C1Y B;  3ZDT A;  3CXB B;  5L81 A;  2IYB A;  2ZPY A;  3PLU A;  3F5R A;  3PVL A;  3AXC A;  1UEL A;  4ANV A;  3PRM B;  2BF8 B;  3ECI A;  4GXB A;  2MBH A;  2MBQ A;  3PTF C;  2CY4 A;  1NU2 A;  2KD0 A;  3M63 B;  5IA7 A;  4MGY E;  1BTK A;  2JF5 A;  4E74 A;  2MDX A;  4BKS A;  2R2Q A;  1P9D U;  2D2Q A;  4GDK A;  1PLS A;  2YSZ A;  4FUL A;  3ULB A;  2CS4 A;  4MK0 A;  2RNR B;  2K2U A;  2V76 A;  1KC7 A;  4FHJ A;  4K2O A;  5L83 A;  5C5B A;  1YJ1 A;  4HPM B;  2CHX A;  3IG3 A;  3R7Q A;  3O96 A;  4EEW A;  2KWV B;  3E9L A;  4WJQ A;  3UQA A;  2NPT A;  1L7Y A;  2QHO A;  5AZF A;  1MG8 A;  2B3A A;  5J3Q A;  5LXI B;  2X18 A;  2I1J A;  1E8X A;  3TVV A;  1VD2 A;  4HAU B;  4WSF A;  3P7Z A;  2CY5 A;  1E8Y A;  1HBK A;  2A4Z A;  3EFU A;  4A6K A;  4EZL A;  2LGX A;  3W1S C;  2JUO A;  2L8J A;  3SD5 A;  3ENB A;  1MK9 B;  2C60 A;  2KJR A;  4XWX A;  5C23 A;  2ZVO A;  3TCA A;  1Z87 A;  1XKE A;  4RM8 A;  4HK2 A;  4HWI B;  5JHG A;  4AJW A;  4ILJ A;  4MGK E;  4LDT B;  3VTU A;  4ASW C;  1MK7 B;  3ALB A;  2MBB B;  2G35 A;  1WZ3 A;  2LUE A;  2KK8 A;  2Z0Q A;  3H7P A;  1MPH A;  1U29 A;  1WYW B;  3UIN B;  3KUZ A;  1V49 A;  2X0S A;  1GNU A;  3DXD A;  5FI1 A;  3APF A;  1J0G A;  1WXS A;  5LXH A;  4W9G A;  3PG7 A;  2C9W B;  4K2P A;  3H9D A;  3VXW A;  3K9O B;  2JY6 A;  5D3Y A;  4HCN B;  2KLC A;  5J3Y A;  2JRI B;  1Z2M A;  4WWP A;  2K8B A;  2P8V A;  3L17 A;  4HVB A;  2BCJ A;  4EZK A;  3L0W B;  1U2B A;  2FCM A;  3OJ4 B;  5CLL B;  2W9N A;  1ZW7 A;  3PGE A;  2GBR A;  4FJZ A;  4B9K A;  2IFS A;  4DX8 A;  1RRP B;  1XD3 B;  2RSU A;  4DBB A;  1WJN A;  4IOY X;  4KDI C;  4GGQ A;  2WWZ A;  3T06 A;  3ZKJ C;  3DVG X;  4ZYN A;  2DYM A;  1L2N A;  3FEH A;  3ZO5 B;  5D2M B;  4HLE A;  2K6Q A;  2O2V A;  2G45 B;  1WGR A;  4IW0 A;  2IY1 B;  1ZC3 B;  2K39 A;  3GOE A;  5J17 A;  1BTN A;  4DXA B;  4JIO U;  3E9O A;  1DIK A;  4WJP A;  3ZNZ B;  2KC2 A;  3RUI B;  3QIJ A;  2V1Y A;  1WMH B;  3DQV A;  2G4S A;  4YL8 A;  4JKF A;  4IG7 B;  4JKG B;  5DPT A;  2ROV A;  1OEY A;  2Y8G A;  4JKB A;  3DBL I;  1ST7 A;  3PSC A;  1V88 A;  1TBE A;  2NVU I;  1EF5 A;  4KSK C;  4BBN C;  2J59 M;  2V3S A;  1WJ4 A;  2DKP A;  1X1G A;  1P98 A;  3KYD D;  2GCL A;  4K81 A;  1SGH A;  1GC6 A;  1OGW A;  3TJP A;  2HD5 B;  4KAX B;  2Y8F A;  5D6J B;  3N3K B;  4G11 A;  4TUU A;  1XQQ A;  5C1Z A;  3ML4 A;  1WE6 A;  2GBM A;  2KDB A;  2MQJ A;  2KXJ A;  3ZDM C;  4BKT A;  5CHW A;  3KUD B;  2MBO A;  5CHV C;  3KRX A;  1FXT B;  1IP9 A;  3KY9 A;  1IPG A;  1HE8 A;  4FN2 A;  5LON B;  2NR2 A;  5HE3 A;  3QJZ A;  1T0Y A;  2KDE B;  4IWQ A;  1WJ6 A;  1WF9 A;  3TFM A;  1E7U A;  4AWJ A;  2RR9 A;  4JKG A;  3A33 B;  3S2A A;  5C5B B;  2LYD A;  3W1S A;  1RLF A;  4DBG A;  2D9W A;  5GOW B;  2FCN A;  2KQS A;  3PRP B;  4PS8 A;  3H7P B;  1WFY A;  5CX3 A;  2DZI A;  2LVP A;  5EDS A;  3CSF A;  3X23 A;  2DEN B;  5E6N A;  4F7G A;  5HE1 A;  1M7E A;  1E7V A;  1I35 A;  3H1U A;  5HE0 A;  3KW5 B;  1V5U A;  2K00 A;  3AI5 A;  4AOF A;  4TYZ A;  1XX0 A;  2L1C A;  4ZRJ A;  5D27 A;  1LQB A;  2IO2 B;  1H4R A;  4IFS A;  3VH3 B;  3PHW B;  5LLI A;  1FHW A;  2AYO B;  4NPN A;  3PPA A;  2LJ5 A;  1KJT A;  1F9J A;  5D94 A;  4A3O A;  1V81 A;  3NHE B;  2XBB C;  3DPD A;  2M14 A;  3U7D A;  3PRZ A;  2KLG A;  1MIX A;  4HXD A;  2RVB B;  4X57 B;  3K9P B;  4K1R B;  2RQ1 A;  2J0K A;  5DH9 B;  2ABD A;  2BGF A;  3N7C A;  1UH6 A;  2MKR A;  2D9V A;  3G9W A;  1GG3 A;  2ZPN A;  3CF6 E;  3QK0 A;  3JW0 X;  3ZW3 A;  2Z0E B;  2DYN A;  5KHO A;  1LFD A;  4ZDV A;  4GB9 A;  3SV1 A;  1BT0 A;  4GMX B;  2Y5B B;  3RYT A;  5L95 C;  3T9L A;  3DVG Y;  4JKA A;  2Z0O A;  4ANW A;  3PV1 A;  3IVF A;  2J7Q B;  2VRW B;  3A9J A;  3ODW A;  1QC6 A;  4I6L B;  4MJS A;  2G4D B;  2RGN B;  4ICU A;  1UPR A;  1NTI A;  3A4R A;  2GS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...