1NI2A

Structure of the active ferm domain of ezrin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structure of the Active N-terminal Domain of Ezrin. CONFORMATIONAL AND MOBILITY CHANGES IDENTIFY KEYSTONE INTERACTIONS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 80
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ni2A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ni2A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ni2A01
1U29A 2YT1A 3CMMB 2FCQA 2GS0A 1SHCA 4I6NB 4J6IA 3FLVA 1WX8A 3KVFB 2V1YA 1NI2A 2V3SA 3UQAA 2KCJA 2N4FA 2WH5A 1U2BA 2EJ8A 2C9WB 1XODA 3ML4A 2CQUA 1U5FA 2J0KA 4K7WA 4TUUA 3SO6A 3ODXA 5CTRC 4KIKB 1N3HA 1WXSA 1TTNA 2JZ3B 3ENEA 1WXVA 5LOPB 3ZDTA 5JP4A 3HW2B 5LXIB 1DYNA 4AOFA 4DHZE 4W9JA 3EECA 2KFKB 2A5UA 3F5RA 4BVUC 1EUVB 5C6RA 1XT9B 2O6VD 2XEWA 5DPTA 2DAFA 3DXEA 2V4LA 2EMSA 3MJWA 4G0NB 3ODWA 3ZVVA 3ZTDA 1GUAB 2AEHA 3PGEA 1E7UA 1UZXB 1WI1A 2CY5A 2KO3A 1ZKHA 4MELA 1WGQA 3GZNI 3OANA 3RZFA 2M17A 4KHAA 2H7DA 2G3QB 3L10B 1WJNA 3QJZA 4GDKB 2OTXA 4IWPA 3U8ZA 3HM6X 3PTFC 3MDBC 2DTCA 3X23A 1P98A 2N9PC 2ZVOA 1V5UA 1LXDA 4K7SA 5D3XA 1AWEA 2PJHA 1DDMA 4HXDA 2J0MA 3PEGA 1GG3A 5JHHA 3KW5B 2HD5B 3PLVA 2RD0A 2JPHA 2NBUA 3BJIA 1Q67A 2MBHA 4FN2A 2VRWB 2CR5A 4GMXB 2BKRB 4TKNA 2ZPYA 4WJOA 5C1ZA 1HB8A 1V49A 2RSUA 4ZDVA 2L3ZA 1S3SG 4MT7A 3DBHI 3QQ8B 3WAMA 1HBKA 2DAJA 3KYDD 3OJ4B 4DDID 2X18A 4GIVA 2N9EB 3ML9A 2COFA 4M8MA 3PS6A 2XBBC 1ZC4B 4AP4C 2DX1A 1NBFC 3O65B 3A33B 1KJTA 5CX3A 2JRHA 3PHXB 2RQ1A 4WAAA 3VTWA 1XD4A 2J7QB 2NCNA 3B0AA 2Z0EB 4EJNA 4FLHA 1S1QB 1E5WA 3M95A 2ZNVC 2R2OA 1UELA 2KOXA 4I6PA 4A3OA 4WVFB 2Y8FA 3L16A 2W2XD 3L0WB 2GMIC 1TXDA 1M7RA 2LASA 1E8YA 1WGYA 2D4QA 3TO1A 1Y5OA 1RFAA 4G3XB 5C5BB 4M0WB 4E71A 4IM2A 3R7RA 3GYOA 5J3TA 1WMHA 4JIOU 4FJZA 2EKEC 1FB8A 2AL6A 1WE7A 1Y8RC 2K6QA 1ST7A 3UZTA 2MP2B 2D2QA 2IY1B 5E6PA 2KC1A 1IRSA 4CO7A 3CXBB 1YX5B 2CU1A 4HPLB 3ALBA 2KMAA 2RPQA 3QA8A 3X0WA 1NTYA 4L6EA 5KHQA 1X11A 1UEFA 2KZRA 2JUOA 4GSWA 3DDCB 1BTKA 1LQBA 2COAA 1QZEA 4EUTA 3PP2A 5D7GA 2XK5A 5J2RA 1P3RA 2LBBA 2L1CA 4JLCA 3RCZA 1V88A 4HDQA 2KDEB 4XX5A 3TCAA 2M0XA 4IW0A 2K25A 3AXCA 4GMVA 4MM3A 3QIJA 5G55A 5JZEB 2ZCCA 1L7YA 4GB9A 3O96A 5HE1A 1WRDB 1V86A 3UINB 4MJSB 1AQCA 1HE8A 3KY9A 5DCNA 1RAXA 4YL8A 5AZFA 3WANA 2BGFA 2C60A 2LUEA 2LGXA 3Q3JA 2PE9A 1ZM0A 3KSYA 1WFYA 1UBIA 1L2NA 5JHAA 3BINA 1GJZA 3FP5A 3L13A 1WZ3A 1WJUA 2QHOA 2L2IA 1UD7A 2KJ6A 2YVCA 3D8FA 1SIFA 4BFRA 4K2PA 2R0DA 1WVHA 4GZUA 5IAAC 4PNKA 2FJLA 3I3TB 3ZO5B 4DBGA 2FJ9A 1K8RB 4YONA 5DHAB 3DVGY 3K9OB 2MBOA 1V80A 1Q1OA 2FCMA 3PPAA 4GN1A 2DYQA 4ZRIA 2FCNA 2LRUA 5LLIA 1WJ4A 3H7SA 5CHFA 2YF0A 1XD3B 1E8ZA 2BYVE 3RT3B 2DN6A 2P0DA 2NPTB 3ZNZB 4BKTA 4HAUB 3SUZA 1A5RA 4NJ6A 4IUMB 2D9VA 1RLFA 4MK0A 5DIFB 2KNBA 2ZCBA 4W9KA 2MA9B 4ASWC 2AWTA 2VRRB 5J18A 2DX5B 4WWPA 4HB2B 1P9DU 1QQGA 2HTHA 3WIMA 4DX8A 2ZZPB 1UPRA 4MSMB 3P7ZA 5D6JB 3HIZA 3A8QA 4BOSC 3GYPA 4C0AA 5D94A 2O6VB 4K17A 1FGYA 1OY2A 1Y19B 1E8WA 2D3GA 2DZMA 1EVHA 3KRXA 2JT4B 2UZRA 1P0RA 3PLUA 2CS4A 3A9JA 1EO6A 4HDOA 4IFSA 4URKA 4BBKA 1VD2A 2KLGA 1PFJA 2Y8GA 2MRPA 3QK0A 3RD2A 1OEYA 2DLWA 3KUZA 4GOCA 2C5LC 3R7QA 2KKCA 3RCPA 2BF8B 3MHSD 4W9LA 1EAZA 4NY0A 4WJNA 3CSFA 2DYMA 2KX3A 2OOBB 2W9NA 2KC2A 2BWFA 2N9XA 2YT0A 4JGHB 3UGBB 4F7UP 1Q5WB 2LRWA 3T9LA 4TQ1A 3T8MA 1UNQA 2BWES 4G50A 2RGNB 4KV2A 2IFSA 2MX2A 2G35A 3C0RB 4LJOB 1I2HA 4X57B 2M38A 5GOWB 2KDFB 4IWQA 2J0JA 2LJ5A 3ULCA 2I5CA 3DXDA 3A4SC 4NPNA 2KFKA 4W9IA 2KANA 1X1MA 3PG7A 1KLVA 1WM2A 4IOYX 3ZW3A 1W1HA 3JW0X 3N3KB 4Z2NA 3KH0A 2PPHA 2KWCA 2LD9A 1X1GA 4IWOA 5CHWA 3W1YA 3V6EB 4F7GA 1MG8A 2LGDA 3H9DA 3PREA 2KLCA 1DBHA 2IO2B 2LULA 4FA6A 3ZRFA 2R09A 5KHOA 5D3VA 1OTRB 3HM3A 4IG7B 5CLLB 4NQLB 4TQ0A 2Z0OA 2RR9A 3QHTA 4CHKA 3WYFB 4G11A 3TFMA 3A98B 2LXCA 4BKSA 2L0TA 4FJYA 4KZ0A 1EF1A 5TR5A 5AZGA 4ICUA 4FHKA 3ZRCA 3KUCB 1YIWA 2M8SA 2M4NA 3SV1A 1TBEA 1WGUA 2BPSA 4GDLA 1GC7A 3ODOA 1J0GA 1D3ZA 3H1UA 2KUPA 2DZJA 4PQ0A 3U30A 3L08A 4II2B 3JSVB 3HQCA 4A6HA 3A1QA 2K00A 2V76A 2KVRA 1WG7A 3PVLA 2COCA 5L81A 3IHPC 2EMTA 2M1MA 3AU4A 1UNRA 3VOQA 2DA0A 1FHOA 2HRJA 4LCDE 1U5DA 3RZWC 1WY8A 4GGQA 1BT0A 2N7DA 3ZUNA 2I5FA 1SGHA 2UYZB 1NDDA 4W9FA 3D8DA 2KXJA 1V89A 3JVZX 4LDTD 1B55A 2Y7BA 2JY6A 2G4SA 2ZVNA 2MFQA 2MW5A 5FI0A 3NY5A 1MAIA 2UZSA 5E6NA 3VVWB 4EFOA 3VDZA 1DDVA 1WXMA 2JXXA 4HK2A 3A9KB 5CLQB 3QX1A 3NS8A 2D9ZA 2R2QA 3B1LX 4DHZB 4BKSD 2Z0DB 4HB4B 3TBLD 2MBQA 3VFKA 1PMSA 2ABDA 1WMHB 3ULBA 5HE3A 4FJVB 4FBJB 2DKQA 1MK9B 5C5BA 5G2NA 2YS1A 3GOEA 3S2AA 4JQWC 1UPQA 2O2VA 2L7RA 1X1FA 2IY0B 4KZCA 3APFA 1WGGA 2GBRA 4B9KA 2KN5A 2A4ZA 3NZUA 2FCSA 2JVCA 1ZGUB 4EOYA 2MP2A 4GXBA 4HAZB 1E8XA 4HJKA 2K6DB 3NOBA 1TQZA 2MWNB 4PYUA 3TW1A 4A5KA 4KHBB 1FHWA 3ZNID 2KGXB 5JH5C 4HLEA 4IM0A 4JL9A 2RUKB 4BBNF 2LGYA 1IP9A 2FDQA 4DX90 2OQBA 4HAYB 1KOTA 2CODA 1WJ1A 2PE6B 2XK5B 2CKHB 4GPTB 4DHJD 5J17A 3PZDA 2IYDB 4E74A 2I1KA 4Z2MB 3ECIA 3EC8A 4IAPA 1U5EA 2LI5A 2NZ8B 2MBBB 4PS8A 1E90A 1NTIA 2IYBA 1K5GB 2Y5BB 1V5OA 4WSFA 3NHEB 4N9F4 2D10A 1XCGA 4NAWA 4HWIB 2D9YA 2MBEA 3B08A 2KWUB 4AJYB 4W9GA 4TYZA 2BKFA 3TVVA 2K8BA 2GCJA 3N30A 1RRBA 3ZLZA 2ROVA 2Z0QA 2D9WA 4HCNB 4PS7A 4ANWA 5C23A 2W2WA 2GJYA 3DBLI 1ZW7A 4HAWB 2JP2A 4II3B 5IJMA 4XC2A 4DDGD 4KHOA 2WX0A 4ICVA 2ZNVB 2LYDA 1PQSA 2MQJA 2B3AA 2ZPNA 1Z87A 2YSZA 3R66C 3APCA 4K81A 2JWZA 2CY4A 3LJUX 3HK0A 2N1WA 3CF6E 4W9DA 5DI9B 5KQ1A 2REXA 4A6FA 2DHZA 4B6WA 1WF9A 1VCBA 4TV3A 2C7NB 3DBSA 4CYEA 5IA7A 1WGHA 3PSEB 4Y94A 3MPXA 2NBVB 2OJRA 3WALA 4EZJA 4B95A 1J8CA 1EF5A 1PLSA 5HKHA 3IVFA 3PT2B 1WJ6A 4WWOA 2K8CA 1ZC3B 2KDIA 2GBNA 1V5MA 5BO4B 5CHVC 1OQYA 3PHWB 2C7HA 2JZZA 1ISNA 1RJ2A 3ONSA 2N1VA 3KYCD 3LJ3A 1SE9A 2KQSA 1H10A 3H6NA 1NTVA 2KTRA 5EDSA 2PZ1A 2RGFA 2HTHB 2IO3B 4HB3B 4MGYE 1XQQA 1LB1A 3D32A 1DROA 3H7PA 3WAPA 1P5TA 2DHIA 3IG3A 1U27A 3FM8C 3ML8A 2CRFA 4KVGB 4RMAA 3NSUA 4DWFA 4GU2A 3RYTA 1Z2MA 1WYWB 2VSZA 3DBRI 5D3YA 5J3YA 2L05A 4AUQC 3DQVA 3A9JB 2LOZA 2Z59B 3VH4B 4B6HA 2KK8A 4WQOB 1XR0B 3HHMA 3G9WA 2D11A 3F0WA 2CAYA 3DPDA 1C3TA 3SYXA 1E7VA 2NR2A 4MEMA 3PRZA 1K5DB 1FXTB 5LXHA 4IM3A 2MDXA 2ZEQA 1FHXA 3ZKJC 4MSQB 1J0WA 3ZDMC 2BYEA 2WX1A 2ZJDA 3WA0A 2WYQA 5KQ4A 2P0HA 4WJPA 2KD0A 3SU8X 2KDBA 4MGKE 1V9JA 3PV1A 4EZLA 2WWZA 4KIKA 2DYNA 4NQKE 2I1JA 5FR6A 3PSCA 2RLOA 3M1IB 2K1FA 3VH3B 1ZVRA 4NNJB 3APDA 1P6SA 1R4NI 1BWNA 2KMCA 2FIDA 4W9EA 4W9HA 3QAQA 3TJPA 4ANXA 4HB0B 4I6LB 3EPYA 4EMOA 3TIXA 1HB6A 2DKPA 3Q3FA 1YD8U 3KRWA 3T06A 2K2JA 4EKUA 5L83A 1V61A 2LVQA 4CHJA 2BYFA 2LVOA 1WR1A 3OLMD 2YS3A 3VQIA 2K8HA 4DK5A 3N7CA 1WI0A 1WX9A 4HAXB 3V5WA 1WX7A 1UH6A 5D3WA 4P7IA 4LDTB 1RRPB 4D0NB 5FI1A 2NVUI 2MSED 2DFKA 3K9PB 1BTNA 2MWSB 3FSSA 2LXAA 4GDKA 1AARA 2E2XA 3FEHA 5L95C 4WWNA 4PYZA 3BY4B 1WM3A 2GBMA 4ZYNA 2GBJA 3IFWB 2IZVB 1DDWA 4KAXB 5HE0A 5DPRA 4MY6A 2DYBA 2VKIA 1MIXA 2LWPA 1KM7A 2UVMA 3V6CB 3QC8B 3KZ1A 4KDIC 4GDLB 1XX0A 3SDLC 5D2MB 2AYOB 2HJ8A 2IO1B 2YLMA 4HATB 3PVWA 1OGWA 4MGIE 4NJ7A 2KQ7A 3ZIMA 1ACAA 1Q0WB 3A1QB 1YQBA 3V60A 3QARA 2ELBA 2FUHB 1XKEA 4WJQA 2C7MB 4K7UA 2M14A 3JSVA 3R3MA 3VUXA 4OVUA 1X05A 4NSWA 3TL5A 2DHJA 3UF8A 4HPMB 2GCLA 2G4DB 3OAWA 4K2OA 4BBNC 4WJ7A 1IYFA 2PEAA 3SHQA 1NVLA 3ZVRA 3ZNHB 2GBKA 2WDTB 4DHJB 1J19A 2LG1A 2N7EA 4FULA 1X86A 1H4RA 2AL3A 3QBVB 2UWQA 1M7EA 1H8CA 2DZKA 1JRUA 1U5GA 5E6OA 1UGMA 2GOWA 2KFJA 1NU2A 4HCPB 1WXAA 5D27A 4F8CB 1EGXA 3A9KA 1TGZB 1T0YA 1TZ1A 1WH3A 4XZ4A 1R4MI 3A4RA 3TMPB 3V61A 3MTNB 1M94A 2O2VB 4A6KA 1WE6A 5GMVA 3L17A 3OJ3A 1OMWA 3KUDB 1OQNA 1WJMA 2YRYA 2FNJB 2IBIB 1WZ0A 3L54A 2CHZA 4W9CA 4IC7B 1LM8B 3VAWA 1V5TA 3PRMB 1KZ7A 2P0FA 3AULA 2CHXA 5AEKB 1I42A 2RNRB 1ZSQA 5EFXA 4RM8A 1WIAA 5AZHA 4XWXA 2DYOA 1C1YB 1YX6B 5DPSA 3NZSA 3PVUA 3RUIB 3VXWA 4HHVA 4EEWA 1MPHA 1UBQA 3W1SC 3M3JA 1FGZA 4M8NA 2FIFA 1MIZB 2COPA 1CMXB 4HVBA 5DH9B 4ANVA 2Q13A 1V81A 1BAKA 5JLJB 3RULA 4MGZE 2XQNM 4KSLC 2MCNB 4NAWB 4AJWA 4A20A 2KX0A 1W1GA 3UIOB 2IO0B 4EZKA 2N0YA 3P2BA 4F1SA 2RSGA 2RVBB 1UNPA 4FHJA 4KDLB 2LKOA 2BCJA 4DBBA 1TJ6A 2ASQA 4MJSA 3M63B 3P6AA 4FADA 5DPWA 1KZGA 5JHBA 3VTUA 1WR6E 2D9XA 1P3QU 1KI1B 2G45B 1GC6A 2KJRA 2QKLA 4F7HA 3UQBA 3M62B 2DENB 3CSTA 4KSKC 3QCAA 1G6JA 2NS5A 2KJHB 3SNHA 2H7EA 3UIPB 2KHWB 3DOWA 3EFUA 1MKEA 3CIKA 3VTVA 4DXAB 4A6FB 2CB8A 1FOEA 4H8SA 3D8EA 3JYUA 1FAOA 4K1RB 3DVNU 4OVVA 3QWMA 1WGRA 3N32A 4ZRJA 5C79A 1MK7B 3SD5A 4A3PA 1Z5SB 3AI5A 2FAZA 3DCGA 3DVGX 3AU5A 2DZIA 2KWVB 4ZRKA 3VUWA 1U4AA 4HAVB 2P8VA 2CHWA 5DHFB 5JHGA 4PS3A 1LW3A 3V62A 2NPTA 3LDZE 2MKRA 1I7AA 2L8JA 3DVNV 2JRIB 4BKGA 2L0FA 3ZNGC 5C16A 2NMBA 2MLBA 1V2YA 2KTRB 1W1DA 2LOXA 2W2XC 3WAOA 3QWZB 2JF5A 2NBWB 3AJ4A 2K2UA 2D07B 2DHKA 4ANUA 2DX5A 3VIAA 1P1AA 4F7ZA 2K39A 2EC1A 3H7PB 2L76A 5J3QA 4RM9A 2ELAA 3A8PA 2LVPA 3EHVA 1LFDA 3VHTC 4E3CA 2ROZB 1F9JA 3VUYA 5KCVA 1WGDA 2Z0PA 4MH0E 2N23A 2KTFA 3ZTCA 3U7DA 3IBEA 3DXCA 1OEYJ 3W1SA 1V5PA 2O6VA 1YJ1A 2L00B 2J59M 1V6EA 2LZ6A 1QC6A 4LJPB 1I35A 4BOZB 2QKMA 2YS5A 1GNUA 2ADZA 5LONB 4CHMA 5HE2A 2HE7A 3PRPB 1IPGA 4AWJA 4MDKE
chains in the Genus database with same CATH superfamily
1U29A 3VRBB 1CK1A 2YT1A 1FIQA 3CMMB 2LJIA 2FCQA 2GS0A 1B1ZA 2WXQA 2FJUB 3Q3NC 1SHCA 3HVZA 3IXSA 4I6NB 4J6IA 1TKYA 3FLVA 4MH8A 3P4QB 4XYCA 2K22A 5C3JB 2V0GA 4A90A 1WX8A 1BMLC 3KVFB 2IDYA 4JX1C 2V1YA 1NI2A 3PZ7A 4OW0A 2V3SA 3UQAA 1UNSA 2KCJA 2N4FA 2WH5A 1U2BA 2EJ8A 1EWCA 2C9WB 3ABVB 1XODA 3ML4A 1CJEA 2CQUA 1U5FA 2J0KA 2BS3B 4K7WA 4TUUA 2W3SA 3SO6A 3ODXA 1HTQA 1E0ZA 5CTRC 4KIKB 1I4RA 1K50A 1EU3A 1L0YB 1N3HA 1PGBA 1WXSA 4YSZB 3BIID 1TTNA 2JZ3B 2RDHA 3ENEA 1WXVA 5LOPB 3ZDTA 5JP4A 1C77A 3RNCC 1ZYIA 3EFCA 3HW2B 5LXIB 1XO3A 4RGTA 1DYNA 2NMQA 4AOFA 4DHZE 4W9JA 3EECA 2LHDA 2GLSA 2R61A 4LNKA 2KFKB 2A5UA 3F5RA 4BVUC 1EUVB 4H2AA 4US8A 2FBWB 5C6RA 1XT9B 2JXTA 2O6VD 2XEWA 5DPTA 2DAFA 2WQYB 3DXEA 2V4LA 1AN8A 1DGJA 1JWSD 3NS1A 2EMSA 1JWMD 2L32A 3MJWA 4G0NB 4LNIA 3ODWA 3RN9C 3ZVVA 3P4RB 3ZTDA 1GGOA 1GUAB 2AEHA 3RNFC 3PGEA 1E7UA 4DQOC 1UZXB 1WI1A 3E66A 2CY5A 2KO3A 4YTPB 1ZKHA 4MELA 1WGQA 4LNOA 3AE9B 1KRHA 3GZNI 3OANA 3RZFA 2M17A 2MJEA 4KHAA 2H7DA 2G3QB 1ZXHA 2CJOA 3L10B 1WJNA 2BT6A 3QJZA 4GDKB 2OTXA 5AUKA 4IWPA 3U8ZA 3GE8C 3NVZA 2M19A 2I2YA 3HM6X 3KLSX 3OWEB 3PTFC 3MDBC 5LNK1 2DTCA 3X23A 1P98A 4USAA 2N9PC 2ZVOA 1TT5B 1V5UA 1LXDA 4K7SA 3FAHA 5D3XA 1JWBD 1AWEA 3B2GA 2PJHA 1DDMA 4HXDA 2J0MA 3PEGA 1F1HA 1GG3A 5JHHA 3KW5B 1NVID 1T0RC 2HD5B 3PLVA 5LG4B 2IPKD 2RD0A 3AB5A 2JPHA 2JYEA 3BJIA 2NBUA 1Q67A 2D3CA 2MBHA 4FN2A 3NWDA 1FM0D 4YTMB 3LYYA 2VRWB 2CR5A 4GMXB 3Q3MC 5HG2A 2BKRB 4TKNA 2ZPYA 4WJOA 5C1ZA 1NEKB 2ON8A 1HB8A 1V49A 2RSUA 4DXFA 4ZDVA 2L3ZA 1S3SG 1C4PA 4MT7A 3DBHI 3QQ8B 4JKGA 3WAMA 1PUTA 1F0ZA 1HBKA 2G1EA 2DAJA 3KYDD 2QC8A 3OJ4B 4DDID 2IGHA 2X18A 3NVYA 4GIVA 2N9EB 3E56A 1L0XB 2LMCA 4C00A 1IBXB 1HQRD 3ML9A 1AYFA 1WRIA 2COFA 4M8MA 2L1AA 4UDUC 3PS6A 2XBBC 1ZC4B 4AP4C 4JKFA 2DX1A 1NBFC 2PVGC 3C8YA 3O65B 1N5WA 3A33B 1KJTA 5CX3A 2JRHA 3PHXB 2RQ1A 4GLSC 4WAAA 3W5UB 3VTWA 1XD4A 3DWMA 1E7PB 2J7QB 2NCNA 3B0AA 2Z0EB 4EJNA 4FLHA 1S1QB 1E5WA 3I5JC 3N1XC 3M95A 4ZHOA 2G9HD 2ZNVC 2R2OA 4YSXB 1UELA 2KOXA 4I6PA 5IOIA 4A3OA 2QIEB 2GUMA 4WVFB 2VH2A 2Y8FA 3L16A 3MC8A 4JKDA 2W2XD 2DLBA 3L0WB 4GOUA 2GMIC 1TXDA 1M7RA 2LASA 4TSSA 1E8YA 1WGYA 2D4QA 3TO1A 1Y5OA 1RFAA 1OQQA 2OJWA 4G3XB 3URYA 5C5BB 4M0WB 4E71A 4IM2A 3R7RA 5FR3A 3GYOA 5J3TA 3B9JA 1WMHA 4JIOU 4FJZA 1KTKA 2EKEC 3BZDB 1FB8A 1XF5L 2AL6A 1WE7A 4C4VB 3HRDD 3ZXVA 1Y8RC 1E10A 5I2SA 2K6QA 1ST7A 3UZTA 2BB5A 2D2QA 2MP2B 2IY1B 5E6PA 2KC1A 1IRSA 4CO7A 3CXBB 4ITKA 1YJJA 1YX5B 2CU1A 4HPLB 3ALBA 2VH1A 2KMAA 2QEJC 4NJCA 2RPQA 3AE5B 3QA8A 3X0WA 2KAJA 4AS1A 4MT5A 1NTYA 4L6EA 5KHQA 1X11A 1UEFA 2KZRA 3TEWA 2JUOA 1STEA 4GSWA 3AEGB 4KHBA 3DDCB 3I63C 2MJDA 1XLNA 1F2RC 1YN4A 1BTKA 1LQBA 4XDDA 2COAA 3ZJVA 1QZEA 4EUTA 3PP2A 2WXHA 4A55A 3R2IA 5D7GA 1KLGD 2XK5A 5J2RA 1P3RA 1HZ5A 3CWIA 2LBBA 2DIKA 2L1CA 3BYTB 4JLCA 3Q8EA 4M02A 3RCZA 5HFYA 1V88A 3NWAA 1ZPSA 4HDQA 2AX5A 3TUOA 2KDEB 4XX5A 3AEAB 3TCAA 2M0XA 1ENFA 3O13A 4LK0M 4S0RA 4PT5A 4B0EA 5IN7A 4IW0A 4XE0A 2J42A 1KBLA 2K25A 4K3BA 5TSSA 3UI3A 1ZE3D 3AXCA 4GMVA 2BBCA 4MM3A 4A9AA 4IDIA 3QIJA 4OZCA 5G55A 5JZEB 2ZCCA 1L7YA 4GB9A 3U4EG 3DCXA 3O96A 5HE1A 1NYRA 1YN3A 1L6UA 3EA6A 1WRDB 2JZPA 1KLUD 1ZUD2 1V86A 3UINB 4MJSB 1AQCA 1HE8A 3KY9A 1RAXA 5DCNA 5BMHA 4YL8A 1UGJA 5AZFA 1MHXA 1HA5A 3WANA 3Q8AA 2BGFA 2C60A 2LUEA 2LGXA 4OHJA 3Q3JA 2PE9A 3BVMA 1ZM0A 3KSYA 1WFYA 1R7SA 5G5GA 1UBIA 1L2NA 5JHAA 3BINA 3BK2A 1GJZA 3FP5A 5IP4D 3L13A 1WZ3A 1WJUA 2QHOA 4IOIE 2L2IA 1UD7A 2KJ6A 2YVCA 3D8FA 1SIFA 4BFRA 4K2PA 4JWUC 1C4CA 2R0DA 1WVHA 4GZUA 5IAAC 2J52A 4PNKA 3SEBA 2FJLA 3ZQ4A 3I3TB 3AE3B 2WXPA 4LLGM 3ZO5B 4DBGA 5EE0A 2LFIA 2FJ9A 1K8RB 4YONA 1HTOA 3GZNB 4WIPA 2QILA 5DHAB 4R3DA 5IKCM 5E6JA 3DVGY 3K9OB 2MBOA 1V80A 1VJKA 1SBBB 1Q1OA 2FCMA 1L0VB 3PPAA 4GN1A 2DYQA 1XLQA 4ZRIA 1WWTA 2FCNA 2LRUA 5LLIA 1WJ4A 3H7SA 5CHFA 2YF0A 1XD3B 2BS4B 1E8ZA 1UUPA 2NBVA 2BYVE 3RT3B 3FILB 1P7FA 2DN6A 2P0DA 2NPTB 3ZNZB 4ZRQA 4BKTA 4HAUB 3SUZA 1A5RA 3Q2AC 3RNAC 3HIEA 2X0SA 4NJ6A 4IUMB 1TS4A 2D9VA 1RLFA 4MK0A 2RDBC 1DOYA 5DIFB 1MI0A 4ZOHC 2INNE 2KNBA 1QKZA 2N7JA 2ZCBA 4W9KA 2MA9B 4ASWC 1ET9A 2AWTA 4QJ3B 2VRRB 5J18A 4XDCA 2DX5B 4WWPA 3IAM1 4HB2B 1P9DU 4REZA 1C79A 1QQGA 1K53A 2HTHA 3WIMA 4DX8A 4ARCA 3BVZA 3NVWA 2ZZPB 1UPRA 4MSMB 3P7ZA 2WNMA 2D3BA 2FUG1 1OFFA 3VR9B 1MHHE 4RCOA 1I4XA 1WXQA 5D6JB 3HIZA 3C19A 3A8QA 4BOSC 5FK9C 3GYPA 3Q3OC 4C0AA 5D94A 4JKHA 1VZ6A 2I38A 2Z4DA 2RPVA 1T6BX 2O6VB 2J53A 4KKJA 4K17A 1FGYA 2QSDA 1OY2A 1Y19B 1E8WA 2D3GA 2DZMA 3ZJTA 1P7EA 1EVHA 2WP9B 3KRXA 3ZJUA 2JT4B 3MJ5A 2RRFA 2UZRA 2XNAC 3L4PA 1P0RA 3PLUA 2CS4A 3A9JA 1EO6A 2Z59A 4HDOA 4IFSA 2H89B 3SBGA 4URKA 4BBKA 1DYQA 1VD2A 2KLGA 1PFJA 3RNBC 2Y8GA 2MRPA 2WS3B 3QK0A 3RD2A 4C80A 1HXYD 1OEYA 1QOFA 2DLWA 3KUZA 4GOCA 2C5LC 2JQRB 2WGSA 3R7QA 4JK7A 3IT4B 2KACA 2KKCA 3RCPA 2GRIA 2BF8B 4RNAA 3MHSD 2HDEA 4W9LA 1EAZA 3VR8B 1T0QC 3AEEB 2ZW1A 4AQ7A 1FRRA 4NY0A 4WJNA 3CSFA 2DYMA 2KX3A 2OOBB 2W9NA 2WXFA 2CJNA 2NTSA 2KC2A 4HSIA 1QT9A 1IGCA 4WWMA 1YN5A 2BWFA 2N9XA 2YT0A 1DOIA 1ROEA 2K3UA 4JGHB 1D5XC 3UGBB 4F7UP 1Q5WB 1RYJA 2LRWA 3T9LA 4TQ1A 4P16A 3T8MA 1UNQA 1T77A 2BWES 4G50A 2IJ0A 4RGOS 2RGNB 4CSQA 4KV2A 2IFSA 2K49A 4L1RA 2H88B 2MX2A 2G35A 3C0RB 4LJOB 3WCQA 1QLBB 1I2HA 4RF1A 2ICIA 4X57B 2M38A 3E9SA 3P42A 3Q8BA 5GOWB 2KDFB 4IWQA 1FO4A 1PGAA 2J0JA 2LJ5A 3ULCA 2I5CA 3DXDA 1XEEA 1WSPA 3A4SC 1DOXA 2R2YA 3W2DA 4NPNA 1TY2A 1VLBA 2KFKA 4W9IA 2KANA 1X1MA 3PG7A 1KLVA 1WM2A 4IOYX 1JWUD 3ZW3A 3RMKC 1W1HA 3JW0X 3N3KB 4Z2NA 3U2SC 4DXGA 3EGRA 3KH0A 2PPHA 2KWCA 1SF0A 2LD9A 1X1GA 4IWOA 5CHWA 3W1YA 3V6EB 2OEDA 4F7GA 2IGDA 2JWUA 1MG8A 1SB3C 2N0SB 3Q8FA 2LGDA 3H9DA 4K3CA 3PREA 5H8YE 2KLCA 1DBHA 2IO2B 2LULA 4FA6A 3ZRFA 2R09A 5KHOA 1T3QA 4YWGG 4JKEA 5D3VA 3ZYYX 2FE8A 2ONQA 2YT2A 1OTRB 3HM3A 4IG7B 5CLLB 2PLPA 4NQLB 4TQ0A 2Z0OA 2RR9A 4HRSA 3QHTA 4CHKA 1K51A 4C7YA 3WYFB 4G11A 3TFMA 3A98B 2LXCA 4BKSA 2L0TA 4FJYA 4KZ0A 1EF1A 5TR5A 5AZGA 3DHGC 1YJIA 4ICUA 2PIAA 4FHKA 2AQ3B 3ZRCA 3KUCB 1YIWA 2INPE 2M8SA 2M4NA 5IRSA 4N59A 2HJ1A 2SEBD 3SV1A 1TBEA 4ARIA 5GXGB 1WGUA 2BPSA 4GDLA 1GC7A 3ODOA 1J0GA 3CIRB 3H1UA 1D3ZA 2KUPA 2DZJA 4PQ0A 1PYWD 3U30A 4JKGB 1F2RI 1IGDA 2WXOA 3L08A 3BK1A 4II2B 1JQ4A 3JSVB 3HQCA 4A6HA 4OVZA 1FCLA 2WDRB 3A1QA 2K00A 1E6EB 2V76A 2KVRA 4J3OD 1WG7A 3PVLA 2COCA 3B77A 5L81A 3IHPC 1TIFA 5C2TB 2EMTA 2M1MA 2BTEA 4RFBA 2WXLA 4JE3B 3AU4A 1UNRA 1V1PA 2V4IB 3VOQA 4KGTA 2DA0A 1FHOA 2HRJA 4LCDE 1U5DA 3RZWC 1WY8A 2WXJA 1GPXA 4GGQA 4HJGE 1BT0A 1N5XA 2N7DA 5I4DA 3ZUNA 3GS2A 2I5FA 1SGHA 2UYZB 1NDDA 4W9FA 3D8DA 2KXJA 2MH7A 1V89A 3JVZX 4LDTD 4B0MA 1B55A 2Y7BA 2MHJA 2JY6A 5BMGA 1YQ3B 2G4SA 2ZVNA 2MFQA 1N60A 2MW5A 3RFZB 5FI0A 3NY5A 1MAIA 2UZSA 1WYGA 5E6NA 3VVWB 4EFOA 3VDZA 1I4GA 2JXXA 1DDVA 1WXMA 4HK2A 1D6EC 3A9KB 5CLQB 3QX1A 3NS8A 2D9ZA 2R2QA 3B1LX 4DHZB 4NZLB 4BKSD 2Z0DB 3AN1A 4HB4B 3TBLD 1A70A 2MBQA 3VFKA 1PMSA 2ABDA 1WMHB 3ULBA 5HE3A 3N20C 1FFVA 4FJVB 2BQQA 4FBJB 3P63A 2DKQA 1MK9B 5C5BA 5G2NA 2YS1A 3GOEA 4JQWC 3S2AA 1UPQA 2JYTA 2O2VA 1KFYB 2L7RA 1YOVB 1X1FA 2IY0B 4KZCA 3APFA 4HEA1 1PFDA 1WGGA 2GBRA 3GE3C 4P6VF 4B9KA 2KN5A 2LHEA 2Y3AA 2A4ZA 3NZUA 1TJEA 2FCSA 2JVCA 2WLBA 1ZGUB 3Q8CA 1XXGA 4EOYA 2MP2A 1AWDA 4GXBA 1QOGA 1TS2A 1ZDVA 4HAZB 5T8IA 2Z13A 2PKOA 3HUIA 1E8XA 2BB6A 4HJKA 2K6DB 1N6ZA 3NOBA 1IUEA 3H8HA 1TQZA 2MWNB 4PYUA 3SFDB 3AE4B 3TW1A 4A5KA 4KHBB 3AM9A 1FHWA 3ZNID 2KIGA 2KGXB 1ESFA 4QAYA 5JH5C 4ZHPA 4HLEA 2WU2B 4IM0A 4JL9A 2RUKB 4BBNF 4D6WA 2LGYA 1IP9A 2FDQA 2KVZA 4DX90 2OQBA 2Q5WD 1RWSA 4HAYB 2AQ2B 4L23A 1KOTA 1RFKA 3LB8C 2CODA 1WJ1A 2PE6B 4ILHA 1MFWA 4GPTB 2CKHB 2XK5B 4DHJD 1FXIA 5J17A 3PZDA 2IYDB 4E74A 2I1KA 4Z2MB 3ECIA 2V3NA 2TSSA 1MPEA 3EC8A 4IAPA 1U5EA 1V1OA 2LI5A 4OZAA 2K8EA 2NZ8B 1JALA 2MBBB 1ET6A 4MM3B 4PS8A 1E90A 1NTIA 2IYBA 1ZP0B 1KF6B 4HKZE 1VRAB 1K5GB 4JKBA 2Y5BB 2WXRA 1V5OA 4WSFA 3NHEB 4RGNA 3Q6BA 4TMAB 2LEKA 4N9F4 1TZOA 4D2KA 2D10A 1XCGA 4NAWA 2NTTA 4HWIB 2D9YA 2MBEA 3B08A 2KWUB 4AJYB 3AE1B 2INCC 3PZ8A 4W9GA 4TYZA 3T3NA 1M4VA 1GAQB 2BKFA 3TVVA 2K8BA 4YT0B 2GCJA 3N30A 4BZAA 1RRBA 3ZLZA 2ROVA 2Z0QA 2D9WA 3NW8A 1EM7A 4HCNB 4O1NA 4PS7A 4ANWA 5C23A 2W2WA 2GJYA 5H92C 3DBLI 1ZW7A 4HAWB 2JP2A 4PK1A 4II3B 3AEBB 5IJMA 4XC2A 2BW2A 4DDGD 4KHOA 1YMHE 1R4NB 2WX0A 2IGGA 5BYQA 1UF0A 3HVDA 3I9V1 4ICVA 2ZNVB 4C56C 4WAFA 2LYDA 1PQSA 2MQJA 3ETRA 2SAKA 2B3AA 2ZPNA 1TY0A 1Z87A 1NENB 2YSZA 3R66C 1F52A 3APCA 4K81A 2JWZA 4M00A 2CY4A 3LJUX 3HK0A 2N1WA 3CF6E 2UU7A 4W9DA 3N9YC 5DI9B 5KQ1A 2REXA 4EE2A 4A6FA 2VZKD 2DHZA 4B6WA 1WF9A 1VCBA 5JVLA 3MC0B 4KGRA 4TV3A 2C7NB 3NG0A 3DBSA 4CYEA 5IA7A 1WGHA 3NUHB 3IT6B 3PSEB 4Y94A 3MPXA 2NBVB 2OJRA 3NRZA 3AEDB 3WALA 4EZJA 1JWAD 4IKGA 4B95A 1J8CA 1B9RA 4A6QA 3MHZA 1EF5A 1PLSA 5HKHA 3IVFA 2EELA 3PT2B 2QMTA 4FXCA 1WJ6A 4WWOA 2K8CA 2ZKMX 1ZC3B 2KDIA 2GBNA 1V5MA 5BO4B 4WURA 5CHVC 2QCZA 5AUIA 1OQYA 2N9LA 3FILA 2CU3A 3PHWB 4JWSC 2C7HA 2JZZA 3AE2B 1ISNA 1RJ2A 1VBHA 3ONSA 2N1VA 3KYCD 3MP9A 3LJ3A 1SE9A 2KQSA 1H10A 1BUIC 1NTVA 1ZDXA 3H6NA 2KTRA 5EDSA 2D3AA 4OZBA 4JPSA 2PZ1A 2RGFA 1XLOA 2HTHB 5BMIA 4Q2JA 2IO3B 4L1BA 4HB3B 2JSVX 4MGYE 1XQQA 1LB1A 2LGSA 3D32A 1DROA 3H7PA 5EE3A 1P5TA 2DHIA 3IG3A 1U27A 3FM8C 3WAPA 5FKAC 4XWTA 3ML8A 2CRFA 4KVGB 4RMAA 3Q69A 1NYQA 2WHIA 3NSUA 2Z8LA 4DWFA 1L4DB 4GU2A 3RYTA 1Z2MA 1SE4A 1WYWB 1Y56A 4P1CC 2VSZA 3DBRI 5D3YA 5J3YA 1VZ7A 2PMVA 2L05A 4RF0A 4AUQC 3DQVA 2L83A 3A9JB 2LOZA 2KT7A 2Z59B 3VH4B 3J9CA 4B6HA 1J7BA 2KK8A 4WQOB 4XWWA 1XR0B 3A58A 5I2MA 1JDEA 3HHMA 3G9WA 2D11A 3F0WA 2CAYA 3DPDA 2ZW0A 1C3TA 1SE2A 1SXTA 1FCCC 2BVCA 3SYXA 3N1ZC 5MPOA 5D3IB 2X8XX 1E7VA 4S17A 2NR2A 4MEMA 3PRZA 2EKIA 1K5DB 1FXTB 5LXHA 4IM3A 2MDXA 1FXAA 1YQ4B 3W5VB 2ZEQA 1FHXA 3ZKJC 4MSQB 3FC4A 2K5PA 1J0WA 2KIEA 3ZDMC 2BYEA 2WX1A 2ZJDA 3WA0A 2WYQA 1R4MB 3BWUD 5KQ4A 2DBYA 4ACFA 2P0HA 2L52A 3BYYB 4WJPA 2KD0A 3SU8X 2KDBA 4MGKE 1V9JA 3PV1A 3FKYA 4EZLA 2WWZA 1XLPA 4KIKA 2DYNA 1I7HA 1RM6C 4NQKE 2I1JA 5FR6A 2KR0A 3PSCA 4LTUA 1T5XD 2RLOA 3M1IB 2K1FA 3VH3B 1MG4A 1ZVRA 4C7ZA 1QQRA 4NNJB 3APDA 1P6SA 1R4NI 4L2YA 1BWNA 4QJ4B 2FIDA 2KMCA 4W9EA 4W9HA 3HSAA 4GNKB 3LXFA 1GB1A 3QAQA 3TJPA 4ANXA 4HB0B 2WXMA 4I6LB 3EPYA 4EMOA 3TIXA 1HB6A 2QDFA 1KC7A 1SIJA 4ILGB 2DKPA 1MJDA 3Q3FA 1D4BA 1YD8U 3KRWA 3T06A 2K2JA 4EKUA 5L83A 1V61A 3AH7A 2LVQA 4CHJA 2BYFA 2LVOA 1WR1A 3OLMD 4OSNA 2YS3A 3VQIA 2K8HA 1ACCA 4DK5A 3N7CA 1WI0A 1WX9A 3P1MA 1SEBD 2MEKA 5BYSA 4OT1A 5HI1A 4KKIA 2M0AA 4HAXB 3V5WA 1WX7A 1UH6A 5D3WA 1FNUA 4P7IA 3TEZA 1TS3A 4LDTB 1RRPB 2K0PA 4D0NB 5FI1A 2NVUI 3KQ4A 4ZRPA 2DWQA 2MSED 2W3RA 2DFKA 1D5ZC 3K9PB 1BTNA 2MWSB 3NWFA 3FSSA 2LXAA 4GDKA 1AARA 2QJLA 3NZ3A 2E2XA 3FEHA 2WDVB 5L95C 4WWNA 4PYZA 5IO9A 2DNFA 3BY4B 1WM3A 2GBMA 4ZYNA 3DHIC 2GBJA 3IFWB 2IZVB 1DDWA 4KAXB 5HE0A 5DPRA 4MY6A 2DYBA 2VKIA 1MIXA 1MVKA 3FVCA 2LWPA 3BVGA 1KM7A 2UVMA 3V6CB 1JROA 3QC8B 3AE8B 3KZ1A 4KDIC 4GDLB 4LNNA 2Y5CA 1XX0A 3DBLB 3SDLC 2N9KA 5D2MB 2RMMA 2AYOB 2HJ8A 2IO1B 2YLMA 3ZGZA 4HATB 4RH6A 3SFEB 3PVWA 1OGWA 4MGIE 1QILA 4NJ7A 1MI1A 2KQ7A 3ZIMA 1ACAA 2MJ3A 1Q0WB 4KX6B 3A1QB 3DHHC 4US9A 1YQBA 3KWLA 3P4PB 3V60A 1HEZE 3QARA 2JU6X 2ELBA 2FUHB 1XKEA 3I57A 4WJQA 2C7MB 4K7UA 2M14A 3GB1A 3JSVA 3R3MA 3VUXA 4OVUA 1X05A 4NSWA 3TL5A 2DHJA 1V1PB 3UF8A 1IBXA 2YEPF 1GOZA 4HPMB 2GCLA 2G4DB 3OAWA 1N63A 4K2OA 1JCKB 2JX5A 4WJ7A 4BBNC 1I4PA 1IYFA 2PEAA 4QJ5B 3SHQA 1K52A 1F77A 1NVLA 4HPPA 1LO5D 4N58A 3ZVRA 3R2TA 2Z14A 3ZNHB 1QF6A 1T0SC 2GBKA 2WDTB 4DHJB 1J19A 2LG1A 2N7EA 4FULA 1X86A 1H4RA 3IAS1 1UWXA 4WQMA 4CQNA 5G5HA 2AL3A 3QBVB 4ZYSA 2UWQA 2KN4A 1M7EA 1H8CA 1FMAD 2DZKA 1I4HA 1JRUA 1U5GA 5E6OA 1UGMA 2GOWA 3AMZA 2KFJA 1EU4A 1NU2A 4HCPB 1WXAA 5D27A 1JMLA 4F8CB 1EGXA 3A9KA 1DIKA 1TGZB 1I4QA 1T0YA 1TZ1A 3P4SB 1N61A 1ZOYB 1WH3A 2W82A 4XZ4A 1R4MI 3A4RA 4M0WA 3TMPB 2XN9C 3V61A 3MTNB 1M94A 5HHDG 2O2VB 4A6KA 1WE6A 4MACA 5GMVA 3EUB2 3L17A 2KDMA 2OHFA 3OJ3A 1OMWA 4C4VA 3KUDB 1OQNA 1WJMA 1XCQL 3PO0A 2R82A 2YRYA 1E9MA 2FNJB 1FNVA 2IBIB 4HROA 2YEPB 2D5GA 5EE1A 1WZ0A 3L54A 2CHZA 4W9CA 4IC7B 2INDC 3AV8A 2Y5PA 1LM8B 1TKEA 3ZXRA 3VAWA 1KH0A 1V5TA 1JRPA 3PRMB 1KZ7A 2P0FA 3V3XA 3AULA 4NAMA 4XGAB 2CHXA 2KMMA 5AEKB 1I42A 2RNRB 2BS2B 5EE9A 1ZSQA 3AE6B 5EFXA 4RM8A 2M56B 1WIAA 5AZHA 5JXVA 3U12A 1FPYA 4XWXA 1TKGA 3DBRB 2DYOA 2WU5B 1FFUA 3OG5A 4ILJA 1Q10A 1C1YB 2KQ4X 1QOBA 3DWGC 1YX6B 5DPSA 5D3DA 3NZSA 2J4XA 3E9PA 1L6VA 1SSNA 5BYRA 1SE3A 3PVUA 3RUIB 3VXWA 4HHVA 1JW9D 4EEWA 1MPHA 4JKAA 1UBQA 3TEXA 3B2FA 3W1SC 2VZKB 3M3JA 1FGZA 3E9LA 4M8NA 2FIFA 1LGRA 1MIZB 3TSSA 2COPA 1CMXB 4HVBA 5DH9B 4ANVA 4YXDB 2V3PA 2LGIA 3N1YC 2Q13A 1V81A 1BAKA 5JLJB 3TEYA 2PTLA 3RULA 4MGZE 2XQNM 3RI7C 1OQRA 4KSLC 2MCNB 3AE7B 4NAWB 4AJWA 2KYWA 4A20A 2KX0A 1W1GA 3RPFC 1N62A 3UIOB 2IO0B 4EZKA 4DIXA 1J7CA 2N0YA 1QOAA 3P2BA 2WDQB 1C76A 4F1SA 1HZ6A 2RSGA 2RVBB 1UNPA 1VDVA 4FHJA 4KDLB 2WXKA 2LKOA 2BCJA 4DBBA 2AQ1B 2W54A 1TJ6A 2ASQA 2E3TA 4MJSA 3OHMB 3P6AA 3M63B 4FADA 3W9CB 5DPWA 1KZGA 5JHBA 2HTME 1SJHD 3VTUA 1WR6E 2D9XA 3V05A 1C4AA 1P3QU 3SBTA 1KI1B 2G45B 1GC6A 2KJRA 4YTNB 1CZPA 2WXNA 2QKLA 4F7HA 2PW9A 3UQBA 2PVOD 3M62B 1FRDA 2DENB 3CSTA 4KSKC 1V8CA 3QCAA 1G6JA 2NS5A 2KJHB 3SNHA 1CQVA 2H7EA 3UIPB 3RNEC 2KHWB 3DOWA 3EFUA 1VBGA 1TS5A 1MKEA 1FNWA 1NI3A 3CIKA 3VTVA 4BAXA 4DXAB 4A6FB 2CB8A 2KWDA 1FOEA 2V9HA 4JK9A 4H8SA 3D8EA 3JYUA 2X38A 1FAOA 2B76B 3DVNU 4K1RB 4OVVA 3QWMA 1WGRA 3RNGC 4N6EB 3N32A 4ZRJA 3MFGA 5C79A 1MK7B 3SD5A 3E9OA 4A3PA 2KUQA 1Z5SB 3U52E 3AI5A 2FAZA 3DCGA 3DVGX 3AU5A 2DZIA 2KWVB 3KWVA 4ZRKA 3VUWA 1U4AA 4HAVB 3GP7A 2P8VA 2CHWA 5DHFB 5JHGA 4PS3A 1LW3A 3V62A 2NPTA 1XCTL 2BYTA 3LDZE 2MKRA 3R8BA 1I7AA 1VR9A 2L8JA 3ENBA 3DVNV 2JRIB 4BKGA 2L0FA 3U7ZA 3ZNGC 5C16A 1UWMA 2NMBA 2MLBA 1V2YA 3Q14C 2KTRB 1W1DA 1EWYC 4M01A 1FEHA 4JK8A 3VRAB 2LOXA 2W2XC 3WAOA 2ACZB 3QWZB 2JF5A 1YNTE 2NBWB 4JKCA 1D5MC 3AJ4A 2K2UA 2D07B 2DHKA 4ANUA 2DX5A 3T3OA 4WH4A 3VIAA 1J7AA 1P1AA 2GI9A 4F7ZA 2K39A 2WXIA 2EC1A 3H7PB 2L76A 1L5PA 5J3QA 4RM9A 2ELAA 3A8PA 2W55A 3DBHB 3AECB 2LVPA 1ZXIA 1WGKA 1AW7A 1LFDA 3EHVA 3VHTC 4E3CA 2ROZB 1BXTA 1FD6A 1F9JA 3VUYA 2K9XA 5KCVA 4YSYB 1C9FA 1GB4A 1WGDA 2Z0PA 4MH0E 1PDXA 1V97A 2WXGA 2N23A 4RGMA 2KTFA 3ZTCA 3U7DA 3IBEA 3DXCA 1OEYJ 3SR6A 3W1SA 4QXAB 4LNFA 4HKQA 1V5PA 2O6VA 2LUMA 1YJ1A 2L00B 1PGXA 2J59M 1TYGB 3AEFB 1V6EA 2GB1A 5M4YB 2LZ6A 1QC6A 1C78A 3NVVA 2RDGA 1L4ZB 4LJPB 1I35A 2E6XA 4BOZB 2QKMA 2YS5A 1GNUA 2ADZA 5LONB 1VZ8A 3MC9A 4KGSA 4CHMA 4A8XC 1SJED 3NJTA 5HE2A 2HE7A 3PRPB 1IPGA 4AWJA 4P1BC 4MDKE
chains in the Genus database with same CATH topology
1U29A 2YT1A 3CMMB 2FCQA 2GS0A 1SHCA 4I6NB 4J6IA 3FLVA 1WX8A 3KVFB 2V1YA 1NI2A 2V3SA 3UQAA 2KCJA 2N4FA 2WH5A 1U2BA 2EJ8A 2C9WB 1XODA 3ML4A 2CQUA 1U5FA 2J0KA 4K7WA 4TUUA 3SO6A 3ODXA 5CTRC 4KIKB 1N3HA 1WXSA 1TTNA 2JZ3B 3ENEA 1WXVA 5LOPB 3ZDTA 5JP4A 3HW2B 5LXIB 1DYNA 4AOFA 4DHZE 4W9JA 3EECA 2KFKB 2A5UA 3F5RA 4BVUC 1EUVB 5C6RA 1XT9B 2O6VD 2XEWA 5DPTA 2DAFA 3DXEA 2V4LA 2EMSA 3MJWA 4G0NB 3ODWA 3ZVVA 3ZTDA 1GGOA 1GUAB 2AEHA 3PGEA 1E7UA 1UZXB 1WI1A 3E66A 2CY5A 2KO3A 1ZKHA 4MELA 1WGQA 3GZNI 3OANA 3RZFA 2M17A 4KHAA 2H7DA 2G3QB 3L10B 1WJNA 3QJZA 4GDKB 2OTXA 4IWPA 3U8ZA 3HM6X 3PTFC 3MDBC 2DTCA 3X23A 1P98A 2N9PC 2ZVOA 1V5UA 1LXDA 4K7SA 5D3XA 1AWEA 2PJHA 1DDMA 4HXDA 2J0MA 3PEGA 1GG3A 5JHHA 3KW5B 2HD5B 3PLVA 2RD0A 2JPHA 2NBUA 3BJIA 1Q67A 2MBHA 4FN2A 2VRWB 2CR5A 4GMXB 2BKRB 4TKNA 2ZPYA 4WJOA 5C1ZA 1HB8A 1V49A 2RSUA 4ZDVA 2L3ZA 1S3SG 4MT7A 3DBHI 3QQ8B 4JKGA 3WAMA 1HBKA 2DAJA 3KYDD 3OJ4B 4DDID 2X18A 4GIVA 2N9EB 3ML9A 2COFA 4M8MA 3PS6A 2XBBC 1ZC4B 4AP4C 4JKFA 2DX1A 1NBFC 3O65B 3A33B 1KJTA 5CX3A 2JRHA 3PHXB 2RQ1A 4WAAA 3VTWA 1XD4A 2J7QB 2NCNA 3B0AA 2Z0EB 4EJNA 4FLHA 1S1QB 1E5WA 3M95A 2ZNVC 2R2OA 1UELA 2KOXA 4I6PA 4A3OA 4WVFB 2Y8FA 3L16A 4JKDA 2W2XD 3L0WB 2GMIC 1TXDA 1M7RA 2LASA 1E8YA 1WGYA 2D4QA 3TO1A 1Y5OA 1RFAA 4G3XB 5C5BB 4M0WB 4E71A 4IM2A 3R7RA 3GYOA 5J3TA 1WMHA 4JIOU 4FJZA 2EKEC 1FB8A 2AL6A 1WE7A 1Y8RC 2K6QA 1ST7A 3UZTA 2MP2B 2D2QA 2IY1B 5E6PA 2KC1A 1IRSA 4CO7A 3CXBB 1YX5B 2CU1A 4HPLB 3ALBA 2KMAA 2RPQA 3QA8A 3X0WA 1NTYA 4L6EA 5KHQA 1X11A 1UEFA 2KZRA 2JUOA 4GSWA 3DDCB 1BTKA 1LQBA 2COAA 1QZEA 4EUTA 3PP2A 5D7GA 2XK5A 5J2RA 1P3RA 2LBBA 2DIKA 2L1CA 4JLCA 3RCZA 1V88A 4HDQA 2KDEB 4XX5A 3TCAA 2M0XA 4IW0A 1KBLA 2K25A 3AXCA 4GMVA 4MM3A 3QIJA 5G55A 5JZEB 2ZCCA 1L7YA 4GB9A 3O96A 5HE1A 1WRDB 1V86A 3UINB 4MJSB 1AQCA 1HE8A 3KY9A 5DCNA 1RAXA 4YL8A 5AZFA 3WANA 2BGFA 2C60A 2LUEA 2LGXA 3Q3JA 2PE9A 1ZM0A 3KSYA 1WFYA 1UBIA 1L2NA 5JHAA 3BINA 1GJZA 3FP5A 3L13A 1WZ3A 1WJUA 2QHOA 2L2IA 1UD7A 2KJ6A 2YVCA 3D8FA 1SIFA 4BFRA 4K2PA 2R0DA 1WVHA 4GZUA 5IAAC 4PNKA 2FJLA 3I3TB 3ZO5B 4DBGA 2FJ9A 1K8RB 4YONA 5DHAB 3DVGY 3K9OB 2MBOA 1V80A 1Q1OA 2FCMA 3PPAA 4GN1A 2DYQA 4ZRIA 2FCNA 2LRUA 5LLIA 1WJ4A 3H7SA 5CHFA 2YF0A 1XD3B 1E8ZA 2BYVE 3RT3B 2DN6A 2P0DA 2NPTB 3ZNZB 4BKTA 4HAUB 3SUZA 1A5RA 2X0SA 4NJ6A 4IUMB 2D9VA 1RLFA 4MK0A 5DIFB 2KNBA 2ZCBA 4W9KA 2MA9B 4ASWC 2AWTA 2VRRB 5J18A 2DX5B 4WWPA 4HB2B 1P9DU 1QQGA 2HTHA 3WIMA 4DX8A 2ZZPB 1UPRA 4MSMB 3P7ZA 5D6JB 3HIZA 3A8QA 4BOSC 3GYPA 4C0AA 5D94A 4JKHA 2O6VB 4K17A 1FGYA 1OY2A 1Y19B 1E8WA 2D3GA 2DZMA 1EVHA 3KRXA 2JT4B 2UZRA 1P0RA 3PLUA 2CS4A 3A9JA 1EO6A 4HDOA 4IFSA 3SBGA 4URKA 4BBKA 1VD2A 2KLGA 1PFJA 2Y8GA 2MRPA 3QK0A 3RD2A 1OEYA 2DLWA 3KUZA 4GOCA 2C5LC 3R7QA 4JK7A 2KKCA 3RCPA 2BF8B 3MHSD 4W9LA 1EAZA 4NY0A 4WJNA 3CSFA 2DYMA 2KX3A 2OOBB 2W9NA 2KC2A 2BWFA 2N9XA 2YT0A 4JGHB 3UGBB 4F7UP 1Q5WB 2LRWA 3T9LA 4TQ1A 3T8MA 1UNQA 2BWES 4G50A 2RGNB 4KV2A 2IFSA 2MX2A 2G35A 3C0RB 4LJOB 1I2HA 4X57B 2M38A 5GOWB 2KDFB 4IWQA 2J0JA 2LJ5A 3ULCA 2I5CA 3DXDA 3A4SC 4NPNA 2KFKA 4W9IA 2KANA 1X1MA 3PG7A 1KLVA 1WM2A 4IOYX 3ZW3A 1W1HA 3JW0X 3N3KB 4Z2NA 3KH0A 2PPHA 2KWCA 2LD9A 1X1GA 4IWOA 5CHWA 3W1YA 3V6EB 4F7GA 1MG8A 2LGDA 3H9DA 3PREA 2KLCA 1DBHA 2IO2B 2LULA 4FA6A 3ZRFA 2R09A 5KHOA 4JKEA 5D3VA 1OTRB 3HM3A 4IG7B 5CLLB 4NQLB 4TQ0A 2Z0OA 2RR9A 3QHTA 4CHKA 3WYFB 4G11A 3TFMA 3A98B 2LXCA 4BKSA 2L0TA 4FJYA 4KZ0A 1EF1A 5TR5A 5AZGA 4ICUA 4FHKA 3ZRCA 3KUCB 1YIWA 2M8SA 2M4NA 3SV1A 1TBEA 1WGUA 2BPSA 4GDLA 1GC7A 3ODOA 1J0GA 1D3ZA 3H1UA 2KUPA 2DZJA 4PQ0A 3U30A 4JKGB 3L08A 4II2B 3JSVB 3HQCA 4A6HA 3A1QA 2K00A 2V76A 2KVRA 1WG7A 3PVLA 2COCA 5L81A 3IHPC 2EMTA 2M1MA 3AU4A 1UNRA 3VOQA 2DA0A 1FHOA 2HRJA 4LCDE 1U5DA 3RZWC 1WY8A 4GGQA 1BT0A 2N7DA 3ZUNA 2I5FA 1SGHA 2UYZB 1NDDA 4W9FA 3D8DA 2KXJA 1V89A 3JVZX 4LDTD 1B55A 2Y7BA 2JY6A 2G4SA 2ZVNA 2MFQA 2MW5A 5FI0A 3NY5A 1MAIA 2UZSA 5E6NA 3VVWB 4EFOA 3VDZA 1DDVA 1WXMA 2JXXA 4HK2A 3A9KB 5CLQB 3QX1A 3NS8A 2D9ZA 2R2QA 3B1LX 4DHZB 4BKSD 2Z0DB 4HB4B 3TBLD 2MBQA 3VFKA 1PMSA 2ABDA 1WMHB 3ULBA 5HE3A 4FJVB 4FBJB 2DKQA 1MK9B 5C5BA 5G2NA 2YS1A 3GOEA 3S2AA 4JQWC 1UPQA 2O2VA 2L7RA 1X1FA 2IY0B 4KZCA 3APFA 1WGGA 2GBRA 4B9KA 2KN5A 2A4ZA 3NZUA 2FCSA 2JVCA 1ZGUB 4EOYA 2MP2A 4GXBA 4HAZB 1E8XA 4HJKA 2K6DB 3NOBA 1TQZA 2MWNB 4PYUA 3TW1A 4A5KA 4KHBB 1FHWA 3ZNID 2KGXB 5JH5C 4HLEA 4IM0A 4JL9A 2RUKB 4BBNF 2LGYA 1IP9A 2FDQA 4DX90 2OQBA 4HAYB 1KOTA 2CODA 1WJ1A 2PE6B 4ILHA 2CKHB 4GPTB 2XK5B 4DHJD 5J17A 3PZDA 2IYDB 4E74A 2I1KA 4Z2MB 3ECIA 3EC8A 4IAPA 1U5EA 2LI5A 2NZ8B 2MBBB 4PS8A 1E90A 1NTIA 2IYBA 1K5GB 4JKBA 2Y5BB 1V5OA 4WSFA 3NHEB 4N9F4 2D10A 1XCGA 4NAWA 4HWIB 2D9YA 2MBEA 3B08A 2KWUB 4AJYB 4W9GA 4TYZA 2BKFA 3TVVA 2K8BA 2GCJA 3N30A 1RRBA 3ZLZA 2ROVA 2Z0QA 2D9WA 4HCNB 4PS7A 4ANWA 5C23A 2W2WA 2GJYA 3DBLI 1ZW7A 4HAWB 2JP2A 4II3B 5IJMA 4XC2A 4DDGD 4KHOA 2WX0A 4ICVA 2ZNVB 2LYDA 1PQSA 2MQJA 2B3AA 2ZPNA 1Z87A 2YSZA 3R66C 3APCA 4K81A 2JWZA 2CY4A 3LJUX 3HK0A 2N1WA 3CF6E 4W9DA 5DI9B 5KQ1A 2REXA 4A6FA 2DHZA 4B6WA 1WF9A 1VCBA 5JVLA 4TV3A 2C7NB 3DBSA 4CYEA 5IA7A 1WGHA 3PSEB 4Y94A 3MPXA 2NBVB 2OJRA 3WALA 4EZJA 4B95A 1J8CA 1EF5A 1PLSA 5HKHA 3IVFA 3PT2B 1WJ6A 4WWOA 2K8CA 1ZC3B 2KDIA 2GBNA 1V5MA 5BO4B 5CHVC 1OQYA 3PHWB 2C7HA 2JZZA 1ISNA 1RJ2A 1VBHA 3ONSA 2N1VA 3KYCD 3LJ3A 1SE9A 2KQSA 1H10A 3H6NA 1NTVA 2KTRA 5EDSA 2PZ1A 2RGFA 2HTHB 2IO3B 4HB3B 4MGYE 1XQQA 1LB1A 3D32A 1DROA 3H7PA 3WAPA 1P5TA 2DHIA 3IG3A 1U27A 3FM8C 3ML8A 2CRFA 4KVGB 4RMAA 3NSUA 4DWFA 4GU2A 3RYTA 1Z2MA 1WYWB 2VSZA 3DBRI 5D3YA 5J3YA 2L05A 4AUQC 3DQVA 3A9JB 2LOZA 2Z59B 3VH4B 4B6HA 2KK8A 4WQOB 1XR0B 1JDEA 3HHMA 3G9WA 2D11A 3F0WA 2CAYA 3DPDA 1C3TA 3SYXA 1E7VA 2NR2A 4MEMA 3PRZA 1K5DB 1FXTB 5LXHA 4IM3A 2MDXA 2ZEQA 1FHXA 3ZKJC 4MSQB 1J0WA 3ZDMC 2BYEA 2WX1A 2ZJDA 3WA0A 2WYQA 5KQ4A 2P0HA 4WJPA 2KD0A 3SU8X 2KDBA 4MGKE 1V9JA 3PV1A 4EZLA 2WWZA 4KIKA 2DYNA 4NQKE 2I1JA 5FR6A 3PSCA 2RLOA 3M1IB 2K1FA 3VH3B 1ZVRA 4NNJB 3APDA 1P6SA 1R4NI 1BWNA 2KMCA 2FIDA 4W9EA 4W9HA 3QAQA 3TJPA 4ANXA 4HB0B 4I6LB 3EPYA 4EMOA 3TIXA 1HB6A 1KC7A 4ILGB 2DKPA 3Q3FA 1YD8U 3KRWA 3T06A 2K2JA 4EKUA 5L83A 1V61A 2LVQA 4CHJA 2BYFA 2LVOA 1WR1A 3OLMD 2YS3A 3VQIA 2K8HA 4DK5A 3N7CA 1WI0A 1WX9A 4HAXB 3V5WA 1WX7A 1UH6A 5D3WA 4P7IA 4LDTB 1RRPB 4D0NB 5FI1A 2NVUI 2MSED 2DFKA 3K9PB 1BTNA 2MWSB 3FSSA 2LXAA 4GDKA 1AARA 2E2XA 3FEHA 5L95C 4WWNA 4PYZA 3BY4B 1WM3A 2GBMA 4ZYNA 2GBJA 3IFWB 2IZVB 1DDWA 4KAXB 5HE0A 5DPRA 4MY6A 2DYBA 2VKIA 1MIXA 2LWPA 1KM7A 2UVMA 3V6CB 3QC8B 3KZ1A 4KDIC 4GDLB 1XX0A 3SDLC 5D2MB 2AYOB 2HJ8A 2IO1B 2YLMA 4HATB 3PVWA 1OGWA 4MGIE 4NJ7A 2KQ7A 3ZIMA 1ACAA 1Q0WB 3A1QB 1YQBA 3V60A 3QARA 2ELBA 2FUHB 1XKEA 4WJQA 2C7MB 4K7UA 2M14A 3JSVA 3R3MA 3VUXA 4OVUA 1X05A 4NSWA 3TL5A 2DHJA 3UF8A 4HPMB 2GCLA 2G4DB 3OAWA 4K2OA 4BBNC 4WJ7A 1IYFA 2PEAA 3SHQA 1NVLA 3ZVRA 3ZNHB 2GBKA 2WDTB 4DHJB 1J19A 2LG1A 2N7EA 4FULA 1X86A 1H4RA 2AL3A 3QBVB 2UWQA 1M7EA 1H8CA 2DZKA 1JRUA 1U5GA 5E6OA 1UGMA 2GOWA 2KFJA 1NU2A 4HCPB 1WXAA 5D27A 4F8CB 1EGXA 3A9KA 1DIKA 1TGZB 1T0YA 1TZ1A 1WH3A 4XZ4A 1R4MI 3A4RA 3TMPB 3V61A 3MTNB 1M94A 2O2VB 4A6KA 1WE6A 5GMVA 3L17A 3OJ3A 1OMWA 3KUDB 1OQNA 1WJMA 2R82A 2YRYA 2FNJB 2IBIB 1WZ0A 3L54A 2CHZA 4W9CA 4IC7B 1LM8B 3VAWA 1V5TA 3PRMB 1KZ7A 2P0FA 3AULA 2CHXA 5AEKB 1I42A 2RNRB 1ZSQA 5EFXA 4RM8A 1WIAA 5AZHA 4XWXA 2DYOA 4ILJA 1C1YB 1YX6B 5DPSA 3NZSA 3E9PA 3PVUA 3RUIB 3VXWA 4HHVA 4EEWA 1MPHA 4JKAA 1UBQA 3W1SC 3M3JA 1FGZA 3E9LA 4M8NA 2FIFA 1MIZB 2COPA 1CMXB 4HVBA 5DH9B 4ANVA 2Q13A 1V81A 1BAKA 5JLJB 3RULA 4MGZE 2XQNM 4KSLC 2MCNB 4NAWB 4AJWA 4A20A 2KX0A 1W1GA 3UIOB 2IO0B 4EZKA 2N0YA 3P2BA 4F1SA 2RSGA 2RVBB 1UNPA 4FHJA 4KDLB 2LKOA 2BCJA 4DBBA 1TJ6A 2ASQA 4MJSA 3M63B 3P6AA 4FADA 5DPWA 1KZGA 5JHBA 3VTUA 1WR6E 2D9XA 1P3QU 3SBTA 1KI1B 2G45B 1GC6A 2KJRA 2QKLA 4F7HA 3UQBA 3M62B 2DENB 3CSTA 4KSKC 3QCAA 1G6JA 2NS5A 2KJHB 3SNHA 2H7EA 3UIPB 2KHWB 3DOWA 3EFUA 1VBGA 1MKEA 3CIKA 3VTVA 4DXAB 4A6FB 2CB8A 1FOEA 4JK9A 4H8SA 3D8EA 3JYUA 1FAOA 4K1RB 3DVNU 4OVVA 3QWMA 1WGRA 3N32A 4ZRJA 5C79A 1MK7B 3SD5A 3E9OA 4A3PA 1Z5SB 3AI5A 2FAZA 3DCGA 3DVGX 3AU5A 2DZIA 2KWVB 4ZRKA 3VUWA 1U4AA 4HAVB 2P8VA 2CHWA 5DHFB 5JHGA 4PS3A 1LW3A 3V62A 2NPTA 3LDZE 2MKRA 1I7AA 2L8JA 3ENBA 3DVNV 2JRIB 4BKGA 2L0FA 3ZNGC 5C16A 2NMBA 2MLBA 1V2YA 2KTRB 1W1DA 4JK8A 2LOXA 2W2XC 3WAOA 3QWZB 2JF5A 2NBWB 4JKCA 3AJ4A 2K2UA 2D07B 2DHKA 4ANUA 2DX5A 3VIAA 1P1AA 4F7ZA 2K39A 2EC1A 3H7PB 2L76A 5J3QA 4RM9A 2ELAA 3A8PA 2LVPA 3EHVA 1LFDA 3VHTC 4E3CA 2ROZB 1F9JA 3VUYA 5KCVA 1WGDA 2Z0PA 4MH0E 2N23A 2KTFA 3ZTCA 3U7DA 3IBEA 3DXCA 1OEYJ 3W1SA 1V5PA 2O6VA 1YJ1A 2L00B 2J59M 1V6EA 2LZ6A 1QC6A 4LJPB 1I35A 4BOZB 2QKMA 2YS5A 1GNUA 2ADZA 5LONB 4CHMA 5HE2A 2HE7A 3PRPB 1IPGA 4AWJA 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U29 A;  2YT1 A;  3CMM B;  2FCQ A;  2GS0 A;  1SHC A;  4I6N B;  4J6I A;  3FLV A;  1WX8 A;  3KVF B;  2V1Y A;  1NI2 A;  2V3S A;  3UQA A;  2KCJ A;  2N4F A;  2WH5 A;  1U2B A;  2EJ8 A;  2C9W B;  1XOD A;  3ML4 A;  2CQU A;  1U5F A;  2J0K A;  4K7W A;  4TUU A;  3SO6 A;  3ODX A;  5CTR C;  4KIK B;  1N3H A;  1WXS A;  1TTN A;  2JZ3 B;  3ENE A;  1WXV A;  5LOP B;  3ZDT A;  5JP4 A;  3HW2 B;  5LXI B;  1DYN A;  4AOF A;  4DHZ E;  4W9J A;  3EEC A;  2KFK B;  2A5U A;  3F5R A;  4BVU C;  1EUV B;  5C6R A;  1XT9 B;  2O6V D;  2XEW A;  5DPT A;  2DAF A;  3DXE A;  2V4L A;  2EMS A;  3MJW A;  4G0N B;  3ODW A;  3ZVV A;  3ZTD A;  1GUA B;  2AEH A;  3PGE A;  1E7U A;  1UZX B;  1WI1 A;  2CY5 A;  2KO3 A;  1ZKH A;  4MEL A;  1WGQ A;  3GZN I;  3OAN A;  3RZF A;  2M17 A;  4KHA A;  2H7D A;  2G3Q B;  3L10 B;  1WJN A;  3QJZ A;  4GDK B;  2OTX A;  4IWP A;  3U8Z A;  3HM6 X;  3PTF C;  3MDB C;  2DTC A;  3X23 A;  1P98 A;  2N9P C;  2ZVO A;  1V5U A;  1LXD A;  4K7S A;  5D3X A;  1AWE A;  2PJH A;  1DDM A;  4HXD A;  2J0M A;  3PEG A;  1GG3 A;  5JHH A;  3KW5 B;  2HD5 B;  3PLV A;  2RD0 A;  2JPH A;  2NBU A;  3BJI A;  1Q67 A;  2MBH A;  4FN2 A;  2VRW B;  2CR5 A;  4GMX B;  2BKR B;  4TKN A;  2ZPY A;  4WJO A;  5C1Z A;  1HB8 A;  1V49 A;  2RSU A;  4ZDV A;  2L3Z A;  1S3S G;  4MT7 A;  3DBH I;  3QQ8 B;  3WAM A;  1HBK A;  2DAJ A;  3KYD D;  3OJ4 B;  4DDI D;  2X18 A;  4GIV A;  2N9E B;  3ML9 A;  2COF A;  4M8M A;  3PS6 A;  2XBB C;  1ZC4 B;  4AP4 C;  2DX1 A;  1NBF C;  3O65 B;  3A33 B;  1KJT A;  5CX3 A;  2JRH A;  3PHX B;  2RQ1 A;  4WAA A;  3VTW A;  1XD4 A;  2J7Q B;  2NCN A;  3B0A A;  2Z0E B;  4EJN A;  4FLH A;  1S1Q B;  1E5W A;  3M95 A;  2ZNV C;  2R2O A;  1UEL A;  2KOX A;  4I6P A;  4A3O A;  4WVF B;  2Y8F A;  3L16 A;  2W2X D;  3L0W B;  2GMI C;  1TXD A;  1M7R A;  2LAS A;  1E8Y A;  1WGY A;  2D4Q A;  3TO1 A;  1Y5O A;  1RFA A;  4G3X B;  5C5B B;  4M0W B;  4E71 A;  4IM2 A;  3R7R A;  3GYO A;  5J3T A;  1WMH A;  4JIO U;  4FJZ A;  2EKE C;  1FB8 A;  2AL6 A;  1WE7 A;  1Y8R C;  2K6Q A;  1ST7 A;  3UZT A;  2MP2 B;  2D2Q A;  2IY1 B;  5E6P A;  2KC1 A;  1IRS A;  4CO7 A;  3CXB B;  1YX5 B;  2CU1 A;  4HPL B;  3ALB A;  2KMA A;  2RPQ A;  3QA8 A;  3X0W A;  1NTY A;  4L6E A;  5KHQ A;  1X11 A;  1UEF A;  2KZR A;  2JUO A;  4GSW A;  3DDC B;  1BTK A;  1LQB A;  2COA A;  1QZE A;  4EUT A;  3PP2 A;  5D7G A;  2XK5 A;  5J2R A;  1P3R A;  2LBB A;  2L1C A;  4JLC A;  3RCZ A;  1V88 A;  4HDQ A;  2KDE B;  4XX5 A;  3TCA A;  2M0X A;  4IW0 A;  2K25 A;  3AXC A;  4GMV A;  4MM3 A;  3QIJ A;  5G55 A;  5JZE B;  2ZCC A;  1L7Y A;  4GB9 A;  3O96 A;  5HE1 A;  1WRD B;  1V86 A;  3UIN B;  4MJS B;  1AQC A;  1HE8 A;  3KY9 A;  5DCN A;  1RAX A;  4YL8 A;  5AZF A;  3WAN A;  2BGF A;  2C60 A;  2LUE A;  2LGX A;  3Q3J A;  2PE9 A;  1ZM0 A;  3KSY A;  1WFY A;  1UBI A;  1L2N A;  5JHA A;  3BIN A;  1GJZ A;  3FP5 A;  3L13 A;  1WZ3 A;  1WJU A;  2QHO A;  2L2I A;  1UD7 A;  2KJ6 A;  2YVC A;  3D8F A;  1SIF A;  4BFR A;  4K2P A;  2R0D A;  1WVH A;  4GZU A;  5IAA C;  4PNK A;  2FJL A;  3I3T B;  3ZO5 B;  4DBG A;  2FJ9 A;  1K8R B;  4YON A;  5DHA B;  3DVG Y;  3K9O B;  2MBO A;  1V80 A;  1Q1O A;  2FCM A;  3PPA A;  4GN1 A;  2DYQ A;  4ZRI A;  2FCN A;  2LRU A;  5LLI A;  1WJ4 A;  3H7S A;  5CHF A;  2YF0 A;  1XD3 B;  1E8Z A;  2BYV E;  3RT3 B;  2DN6 A;  2P0D A;  2NPT B;  3ZNZ B;  4BKT A;  4HAU B;  3SUZ A;  1A5R A;  4NJ6 A;  4IUM B;  2D9V A;  1RLF A;  4MK0 A;  5DIF B;  2KNB A;  2ZCB A;  4W9K A;  2MA9 B;  4ASW C;  2AWT A;  2VRR B;  5J18 A;  2DX5 B;  4WWP A;  4HB2 B;  1P9D U;  1QQG A;  2HTH A;  3WIM A;  4DX8 A;  2ZZP B;  1UPR A;  4MSM B;  3P7Z A;  5D6J B;  3HIZ A;  3A8Q A;  4BOS C;  3GYP A;  4C0A A;  5D94 A;  2O6V B;  4K17 A;  1FGY A;  1OY2 A;  1Y19 B;  1E8W A;  2D3G A;  2DZM A;  1EVH A;  3KRX A;  2JT4 B;  2UZR A;  1P0R A;  3PLU A;  2CS4 A;  3A9J A;  1EO6 A;  4HDO A;  4IFS A;  4URK A;  4BBK A;  1VD2 A;  2KLG A;  1PFJ A;  2Y8G A;  2MRP A;  3QK0 A;  3RD2 A;  1OEY A;  2DLW A;  3KUZ A;  4GOC A;  2C5L C;  3R7Q A;  2KKC A;  3RCP A;  2BF8 B;  3MHS D;  4W9L A;  1EAZ A;  4NY0 A;  4WJN A;  3CSF A;  2DYM A;  2KX3 A;  2OOB B;  2W9N A;  2KC2 A;  2BWF A;  2N9X A;  2YT0 A;  4JGH B;  3UGB B;  4F7U P;  1Q5W B;  2LRW A;  3T9L A;  4TQ1 A;  3T8M A;  1UNQ A;  2BWE S;  4G50 A;  2RGN B;  4KV2 A;  2IFS A;  2MX2 A;  2G35 A;  3C0R B;  4LJO B;  1I2H A;  4X57 B;  2M38 A;  5GOW B;  2KDF B;  4IWQ A;  2J0J A;  2LJ5 A;  3ULC A;  2I5C A;  3DXD A;  3A4S C;  4NPN A;  2KFK A;  4W9I A;  2KAN A;  1X1M A;  3PG7 A;  1KLV A;  1WM2 A;  4IOY X;  3ZW3 A;  1W1H A;  3JW0 X;  3N3K B;  4Z2N A;  3KH0 A;  2PPH A;  2KWC A;  2LD9 A;  1X1G A;  4IWO A;  5CHW A;  3W1Y A;  3V6E B;  4F7G A;  1MG8 A;  2LGD A;  3H9D A;  3PRE A;  2KLC A;  1DBH A;  2IO2 B;  2LUL A;  4FA6 A;  3ZRF A;  2R09 A;  5KHO A;  5D3V A;  1OTR B;  3HM3 A;  4IG7 B;  5CLL B;  4NQL B;  4TQ0 A;  2Z0O A;  2RR9 A;  3QHT A;  4CHK A;  3WYF B;  4G11 A;  3TFM A;  3A98 B;  2LXC A;  4BKS A;  2L0T A;  4FJY A;  4KZ0 A;  1EF1 A;  5TR5 A;  5AZG A;  4ICU A;  4FHK A;  3ZRC A;  3KUC B;  1YIW A;  2M8S A;  2M4N A;  3SV1 A;  1TBE A;  1WGU A;  2BPS A;  4GDL A;  1GC7 A;  3ODO A;  1J0G A;  1D3Z A;  3H1U A;  2KUP A;  2DZJ A;  4PQ0 A;  3U30 A;  3L08 A;  4II2 B;  3JSV B;  3HQC A;  4A6H A;  3A1Q A;  2K00 A;  2V76 A;  2KVR A;  1WG7 A;  3PVL A;  2COC A;  5L81 A;  3IHP C;  2EMT A;  2M1M A;  3AU4 A;  1UNR A;  3VOQ A;  2DA0 A;  1FHO A;  2HRJ A;  4LCD E;  1U5D A;  3RZW C;  1WY8 A;  4GGQ A;  1BT0 A;  2N7D A;  3ZUN A;  2I5F A;  1SGH A;  2UYZ B;  1NDD A;  4W9F A;  3D8D A;  2KXJ A;  1V89 A;  3JVZ X;  4LDT D;  1B55 A;  2Y7B A;  2JY6 A;  2G4S A;  2ZVN A;  2MFQ A;  2MW5 A;  5FI0 A;  3NY5 A;  1MAI A;  2UZS A;  5E6N A;  3VVW B;  4EFO A;  3VDZ A;  1DDV A;  1WXM A;  2JXX A;  4HK2 A;  3A9K B;  5CLQ B;  3QX1 A;  3NS8 A;  2D9Z A;  2R2Q A;  3B1L X;  4DHZ B;  4BKS D;  2Z0D B;  4HB4 B;  3TBL D;  2MBQ A;  3VFK A;  1PMS A;  2ABD A;  1WMH B;  3ULB A;  5HE3 A;  4FJV B;  4FBJ B;  2DKQ A;  1MK9 B;  5C5B A;  5G2N A;  2YS1 A;  3GOE A;  3S2A A;  4JQW C;  1UPQ A;  2O2V A;  2L7R A;  1X1F A;  2IY0 B;  4KZC A;  3APF A;  1WGG A;  2GBR A;  4B9K A;  2KN5 A;  2A4Z A;  3NZU A;  2FCS A;  2JVC A;  1ZGU B;  4EOY A;  2MP2 A;  4GXB A;  4HAZ B;  1E8X A;  4HJK A;  2K6D B;  3NOB A;  1TQZ A;  2MWN B;  4PYU A;  3TW1 A;  4A5K A;  4KHB B;  1FHW A;  3ZNI D;  2KGX B;  5JH5 C;  4HLE A;  4IM0 A;  4JL9 A;  2RUK B;  4BBN F;  2LGY A;  1IP9 A;  2FDQ A;  4DX9 0;  2OQB A;  4HAY B;  1KOT A;  2COD A;  1WJ1 A;  2PE6 B;  2XK5 B;  2CKH B;  4GPT B;  4DHJ D;  5J17 A;  3PZD A;  2IYD B;  4E74 A;  2I1K A;  4Z2M B;  3ECI A;  3EC8 A;  4IAP A;  1U5E A;  2LI5 A;  2NZ8 B;  2MBB B;  4PS8 A;  1E90 A;  1NTI A;  2IYB A;  1K5G B;  2Y5B B;  1V5O A;  4WSF A;  3NHE B;  4N9F 4;  2D10 A;  1XCG A;  4NAW A;  4HWI B;  2D9Y A;  2MBE A;  3B08 A;  2KWU B;  4AJY B;  4W9G A;  4TYZ A;  2BKF A;  3TVV A;  2K8B A;  2GCJ A;  3N30 A;  1RRB A;  3ZLZ A;  2ROV A;  2Z0Q A;  2D9W A;  4HCN B;  4PS7 A;  4ANW A;  5C23 A;  2W2W A;  2GJY A;  3DBL I;  1ZW7 A;  4HAW B;  2JP2 A;  4II3 B;  5IJM A;  4XC2 A;  4DDG D;  4KHO A;  2WX0 A;  4ICV A;  2ZNV B;  2LYD A;  1PQS A;  2MQJ A;  2B3A A;  2ZPN A;  1Z87 A;  2YSZ A;  3R66 C;  3APC A;  4K81 A;  2JWZ A;  2CY4 A;  3LJU X;  3HK0 A;  2N1W A;  3CF6 E;  4W9D A;  5DI9 B;  5KQ1 A;  2REX A;  4A6F A;  2DHZ A;  4B6W A;  1WF9 A;  1VCB A;  4TV3 A;  2C7N B;  3DBS A;  4CYE A;  5IA7 A;  1WGH A;  3PSE B;  4Y94 A;  3MPX A;  2NBV B;  2OJR A;  3WAL A;  4EZJ A;  4B95 A;  1J8C A;  1EF5 A;  1PLS A;  5HKH A;  3IVF A;  3PT2 B;  1WJ6 A;  4WWO A;  2K8C A;  1ZC3 B;  2KDI A;  2GBN A;  1V5M A;  5BO4 B;  5CHV C;  1OQY A;  3PHW B;  2C7H A;  2JZZ A;  1ISN A;  1RJ2 A;  3ONS A;  2N1V A;  3KYC D;  3LJ3 A;  1SE9 A;  2KQS A;  1H10 A;  3H6N A;  1NTV A;  2KTR A;  5EDS A;  2PZ1 A;  2RGF A;  2HTH B;  2IO3 B;  4HB3 B;  4MGY E;  1XQQ A;  1LB1 A;  3D32 A;  1DRO A;  3H7P A;  3WAP A;  1P5T A;  2DHI A;  3IG3 A;  1U27 A;  3FM8 C;  3ML8 A;  2CRF A;  4KVG B;  4RMA A;  3NSU A;  4DWF A;  4GU2 A;  3RYT A;  1Z2M A;  1WYW B;  2VSZ A;  3DBR I;  5D3Y A;  5J3Y A;  2L05 A;  4AUQ C;  3DQV A;  3A9J B;  2LOZ A;  2Z59 B;  3VH4 B;  4B6H A;  2KK8 A;  4WQO B;  1XR0 B;  3HHM A;  3G9W A;  2D11 A;  3F0W A;  2CAY A;  3DPD A;  1C3T A;  3SYX A;  1E7V A;  2NR2 A;  4MEM A;  3PRZ A;  1K5D B;  1FXT B;  5LXH A;  4IM3 A;  2MDX A;  2ZEQ A;  1FHX A;  3ZKJ C;  4MSQ B;  1J0W A;  3ZDM C;  2BYE A;  2WX1 A;  2ZJD A;  3WA0 A;  2WYQ A;  5KQ4 A;  2P0H A;  4WJP A;  2KD0 A;  3SU8 X;  2KDB A;  4MGK E;  1V9J A;  3PV1 A;  4EZL A;  2WWZ A;  4KIK A;  2DYN A;  4NQK E;  2I1J A;  5FR6 A;  3PSC A;  2RLO A;  3M1I B;  2K1F A;  3VH3 B;  1ZVR A;  4NNJ B;  3APD A;  1P6S A;  1R4N I;  1BWN A;  2KMC A;  2FID A;  4W9E A;  4W9H A;  3QAQ A;  3TJP A;  4ANX A;  4HB0 B;  4I6L B;  3EPY A;  4EMO A;  3TIX A;  1HB6 A;  2DKP A;  3Q3F A;  1YD8 U;  3KRW A;  3T06 A;  2K2J A;  4EKU A;  5L83 A;  1V61 A;  2LVQ A;  4CHJ A;  2BYF A;  2LVO A;  1WR1 A;  3OLM D;  2YS3 A;  3VQI A;  2K8H A;  4DK5 A;  3N7C A;  1WI0 A;  1WX9 A;  4HAX B;  3V5W A;  1WX7 A;  1UH6 A;  5D3W A;  4P7I A;  4LDT B;  1RRP B;  4D0N B;  5FI1 A;  2NVU I;  2MSE D;  2DFK A;  3K9P B;  1BTN A;  2MWS B;  3FSS A;  2LXA A;  4GDK A;  1AAR A;  2E2X A;  3FEH A;  5L95 C;  4WWN A;  4PYZ A;  3BY4 B;  1WM3 A;  2GBM A;  4ZYN A;  2GBJ A;  3IFW B;  2IZV B;  1DDW A;  4KAX B;  5HE0 A;  5DPR A;  4MY6 A;  2DYB A;  2VKI A;  1MIX A;  2LWP A;  1KM7 A;  2UVM A;  3V6C B;  3QC8 B;  3KZ1 A;  4KDI C;  4GDL B;  1XX0 A;  3SDL C;  5D2M B;  2AYO B;  2HJ8 A;  2IO1 B;  2YLM A;  4HAT B;  3PVW A;  1OGW A;  4MGI E;  4NJ7 A;  2KQ7 A;  3ZIM A;  1ACA A;  1Q0W B;  3A1Q B;  1YQB A;  3V60 A;  3QAR A;  2ELB A;  2FUH B;  1XKE A;  4WJQ A;  2C7M B;  4K7U A;  2M14 A;  3JSV A;  3R3M A;  3VUX A;  4OVU A;  1X05 A;  4NSW A;  3TL5 A;  2DHJ A;  3UF8 A;  4HPM B;  2GCL A;  2G4D B;  3OAW A;  4K2O A;  4BBN C;  4WJ7 A;  1IYF A;  2PEA A;  3SHQ A;  1NVL A;  3ZVR A;  3ZNH B;  2GBK A;  2WDT B;  4DHJ B;  1J19 A;  2LG1 A;  2N7E A;  4FUL A;  1X86 A;  1H4R A;  2AL3 A;  3QBV B;  2UWQ A;  1M7E A;  1H8C A;  2DZK A;  1JRU A;  1U5G A;  5E6O A;  1UGM A;  2GOW A;  2KFJ A;  1NU2 A;  4HCP B;  1WXA A;  5D27 A;  4F8C B;  1EGX A;  3A9K A;  1TGZ B;  1T0Y A;  1TZ1 A;  1WH3 A;  4XZ4 A;  1R4M I;  3A4R A;  3TMP B;  3V61 A;  3MTN B;  1M94 A;  2O2V B;  4A6K A;  1WE6 A;  5GMV A;  3L17 A;  3OJ3 A;  1OMW A;  3KUD B;  1OQN A;  1WJM A;  2YRY A;  2FNJ B;  2IBI B;  1WZ0 A;  3L54 A;  2CHZ A;  4W9C A;  4IC7 B;  1LM8 B;  3VAW A;  1V5T A;  3PRM B;  1KZ7 A;  2P0F A;  3AUL A;  2CHX A;  5AEK B;  1I42 A;  2RNR B;  1ZSQ A;  5EFX A;  4RM8 A;  1WIA A;  5AZH A;  4XWX A;  2DYO A;  1C1Y B;  1YX6 B;  5DPS A;  3NZS A;  3PVU A;  3RUI B;  3VXW A;  4HHV A;  4EEW A;  1MPH A;  1UBQ A;  3W1S C;  3M3J A;  1FGZ A;  4M8N A;  2FIF A;  1MIZ B;  2COP A;  1CMX B;  4HVB A;  5DH9 B;  4ANV A;  2Q13 A;  1V81 A;  1BAK A;  5JLJ B;  3RUL A;  4MGZ E;  2XQN M;  4KSL C;  2MCN B;  4NAW B;  4AJW A;  4A20 A;  2KX0 A;  1W1G A;  3UIO B;  2IO0 B;  4EZK A;  2N0Y A;  3P2B A;  4F1S A;  2RSG A;  2RVB B;  1UNP A;  4FHJ A;  4KDL B;  2LKO A;  2BCJ A;  4DBB A;  1TJ6 A;  2ASQ A;  4MJS A;  3M63 B;  3P6A A;  4FAD A;  5DPW A;  1KZG A;  5JHB A;  3VTU A;  1WR6 E;  2D9X A;  1P3Q U;  1KI1 B;  2G45 B;  1GC6 A;  2KJR A;  2QKL A;  4F7H A;  3UQB A;  3M62 B;  2DEN B;  3CST A;  4KSK C;  3QCA A;  1G6J A;  2NS5 A;  2KJH B;  3SNH A;  2H7E A;  3UIP B;  2KHW B;  3DOW A;  3EFU A;  1MKE A;  3CIK A;  3VTV A;  4DXA B;  4A6F B;  2CB8 A;  1FOE A;  4H8S A;  3D8E A;  3JYU A;  1FAO A;  4K1R B;  3DVN U;  4OVV A;  3QWM A;  1WGR A;  3N32 A;  4ZRJ A;  5C79 A;  1MK7 B;  3SD5 A;  4A3P A;  1Z5S B;  3AI5 A;  2FAZ A;  3DCG A;  3DVG X;  3AU5 A;  2DZI A;  2KWV B;  4ZRK A;  3VUW A;  1U4A A;  4HAV B;  2P8V A;  2CHW A;  5DHF B;  5JHG A;  4PS3 A;  1LW3 A;  3V62 A;  2NPT A;  3LDZ E;  2MKR A;  1I7A A;  2L8J A;  3DVN V;  2JRI B;  4BKG A;  2L0F A;  3ZNG C;  5C16 A;  2NMB A;  2MLB A;  1V2Y A;  2KTR B;  1W1D A;  2LOX A;  2W2X C;  3WAO A;  3QWZ B;  2JF5 A;  2NBW B;  3AJ4 A;  2K2U A;  2D07 B;  2DHK A;  4ANU A;  2DX5 A;  3VIA A;  1P1A A;  4F7Z A;  2K39 A;  2EC1 A;  3H7P B;  2L76 A;  5J3Q A;  4RM9 A;  2ELA A;  3A8P A;  2LVP A;  3EHV A;  1LFD A;  3VHT C;  4E3C A;  2ROZ B;  1F9J A;  3VUY A;  5KCV A;  1WGD A;  2Z0P A;  4MH0 E;  2N23 A;  2KTF A;  3ZTC A;  3U7D A;  3IBE A;  3DXC A;  1OEY J;  3W1S A;  1V5P A;  2O6V A;  1YJ1 A;  2L00 B;  2J59 M;  1V6E A;  2LZ6 A;  1QC6 A;  4LJP B;  1I35 A;  4BOZ B;  2QKM A;  2YS5 A;  1GNU A;  2ADZ A;  5LON B;  4CHM A;  5HE2 A;  2HE7 A;  3PRP B;  1IPG A;  4AWJ A;  4MDK E; 
#chains in the Genus database with same CATH topology
 1U29 A;  3VRB B;  1CK1 A;  2YT1 A;  1FIQ A;  3CMM B;  2LJI A;  2FCQ A;  2GS0 A;  1B1Z A;  2WXQ A;  2FJU B;  3Q3N C;  1SHC A;  3HVZ A;  3IXS A;  4I6N B;  4J6I A;  1TKY A;  3FLV A;  4MH8 A;  3P4Q B;  4XYC A;  2K22 A;  5C3J B;  2V0G A;  4A90 A;  1WX8 A;  1BML C;  3KVF B;  2IDY A;  4JX1 C;  2V1Y A;  1NI2 A;  3PZ7 A;  4OW0 A;  2V3S A;  3UQA A;  1UNS A;  2KCJ A;  2N4F A;  2WH5 A;  1U2B A;  2EJ8 A;  1EWC A;  2C9W B;  3ABV B;  1XOD A;  3ML4 A;  1CJE A;  2CQU A;  1U5F A;  2J0K A;  2BS3 B;  4K7W A;  4TUU A;  2W3S A;  3SO6 A;  3ODX A;  1HTQ A;  1E0Z A;  5CTR C;  4KIK B;  1I4R A;  1K50 A;  1EU3 A;  1L0Y B;  1N3H A;  1PGB A;  1WXS A;  4YSZ B;  3BII D;  1TTN A;  2JZ3 B;  2RDH A;  3ENE A;  1WXV A;  5LOP B;  3ZDT A;  5JP4 A;  1C77 A;  3RNC C;  1ZYI A;  3EFC A;  3HW2 B;  5LXI B;  1XO3 A;  4RGT A;  1DYN A;  2NMQ A;  4AOF A;  4DHZ E;  4W9J A;  3EEC A;  2LHD A;  2GLS A;  2R61 A;  4LNK A;  2KFK B;  2A5U A;  3F5R A;  4BVU C;  1EUV B;  4H2A A;  4US8 A;  2FBW B;  5C6R A;  1XT9 B;  2JXT A;  2O6V D;  2XEW A;  5DPT A;  2DAF A;  2WQY B;  3DXE A;  2V4L A;  1AN8 A;  1DGJ A;  1JWS D;  3NS1 A;  2EMS A;  1JWM D;  2L32 A;  3MJW A;  4G0N B;  4LNI A;  3ODW A;  3RN9 C;  3ZVV A;  3P4R B;  3ZTD A;  1GGO A;  1GUA B;  2AEH A;  3RNF C;  3PGE A;  1E7U A;  4DQO C;  1UZX B;  1WI1 A;  3E66 A;  2CY5 A;  2KO3 A;  4YTP B;  1ZKH A;  4MEL A;  1WGQ A;  4LNO A;  3AE9 B;  1KRH A;  3GZN I;  3OAN A;  3RZF A;  2M17 A;  2MJE A;  4KHA A;  2H7D A;  2G3Q B;  1ZXH A;  2CJO A;  3L10 B;  1WJN A;  2BT6 A;  3QJZ A;  4GDK B;  2OTX A;  5AUK A;  4IWP A;  3U8Z A;  3GE8 C;  3NVZ A;  2M19 A;  2I2Y A;  3HM6 X;  3KLS X;  3OWE B;  3PTF C;  3MDB C;  5LNK 1;  2DTC A;  3X23 A;  1P98 A;  4USA A;  2N9P C;  2ZVO A;  1TT5 B;  1V5U A;  1LXD A;  4K7S A;  3FAH A;  5D3X A;  1JWB D;  1AWE A;  3B2G A;  2PJH A;  1DDM A;  4HXD A;  2J0M A;  3PEG A;  1F1H A;  1GG3 A;  5JHH A;  3KW5 B;  1NVI D;  1T0R C;  2HD5 B;  3PLV A;  5LG4 B;  2IPK D;  2RD0 A;  3AB5 A;  2JPH A;  2JYE A;  3BJI A;  2NBU A;  1Q67 A;  2D3C A;  2MBH A;  4FN2 A;  3NWD A;  1FM0 D;  4YTM B;  3LYY A;  2VRW B;  2CR5 A;  4GMX B;  3Q3M C;  5HG2 A;  2BKR B;  4TKN A;  2ZPY A;  4WJO A;  5C1Z A;  1NEK B;  2ON8 A;  1HB8 A;  1V49 A;  2RSU A;  4DXF A;  4ZDV A;  2L3Z A;  1S3S G;  1C4P A;  4MT7 A;  3DBH I;  3QQ8 B;  4JKG A;  3WAM A;  1PUT A;  1F0Z A;  1HBK A;  2G1E A;  2DAJ A;  3KYD D;  2QC8 A;  3OJ4 B;  4DDI D;  2IGH A;  2X18 A;  3NVY A;  4GIV A;  2N9E B;  3E56 A;  1L0X B;  2LMC A;  4C00 A;  1IBX B;  1HQR D;  3ML9 A;  1AYF A;  1WRI A;  2COF A;  4M8M A;  2L1A A;  4UDU C;  3PS6 A;  2XBB C;  1ZC4 B;  4AP4 C;  4JKF A;  2DX1 A;  1NBF C;  2PVG C;  3C8Y A;  3O65 B;  1N5W A;  3A33 B;  1KJT A;  5CX3 A;  2JRH A;  3PHX B;  2RQ1 A;  4GLS C;  4WAA A;  3W5U B;  3VTW A;  1XD4 A;  3DWM A;  1E7P B;  2J7Q B;  2NCN A;  3B0A A;  2Z0E B;  4EJN A;  4FLH A;  1S1Q B;  1E5W A;  3I5J C;  3N1X C;  3M95 A;  4ZHO A;  2G9H D;  2ZNV C;  2R2O A;  4YSX B;  1UEL A;  2KOX A;  4I6P A;  5IOI A;  4A3O A;  2QIE B;  2GUM A;  4WVF B;  2VH2 A;  2Y8F A;  3L16 A;  3MC8 A;  4JKD A;  2W2X D;  2DLB A;  3L0W B;  4GOU A;  2GMI C;  1TXD A;  1M7R A;  2LAS A;  4TSS A;  1E8Y A;  1WGY A;  2D4Q A;  3TO1 A;  1Y5O A;  1RFA A;  1OQQ A;  2OJW A;  4G3X B;  3URY A;  5C5B B;  4M0W B;  4E71 A;  4IM2 A;  3R7R A;  5FR3 A;  3GYO A;  5J3T A;  3B9J A;  1WMH A;  4JIO U;  4FJZ A;  1KTK A;  2EKE C;  3BZD B;  1FB8 A;  1XF5 L;  2AL6 A;  1WE7 A;  4C4V B;  3HRD D;  3ZXV A;  1Y8R C;  1E10 A;  5I2S A;  2K6Q A;  1ST7 A;  3UZT A;  2BB5 A;  2D2Q A;  2MP2 B;  2IY1 B;  5E6P A;  2KC1 A;  1IRS A;  4CO7 A;  3CXB B;  4ITK A;  1YJJ A;  1YX5 B;  2CU1 A;  4HPL B;  3ALB A;  2VH1 A;  2KMA A;  2QEJ C;  4NJC A;  2RPQ A;  3AE5 B;  3QA8 A;  3X0W A;  2KAJ A;  4AS1 A;  4MT5 A;  1NTY A;  4L6E A;  5KHQ A;  1X11 A;  1UEF A;  2KZR A;  3TEW A;  2JUO A;  1STE A;  4GSW A;  3AEG B;  4KHB A;  3DDC B;  3I63 C;  2MJD A;  1XLN A;  1F2R C;  1YN4 A;  1BTK A;  1LQB A;  4XDD A;  2COA A;  3ZJV A;  1QZE A;  4EUT A;  3PP2 A;  2WXH A;  4A55 A;  3R2I A;  5D7G A;  1KLG D;  2XK5 A;  5J2R A;  1P3R A;  1HZ5 A;  3CWI A;  2LBB A;  2DIK A;  2L1C A;  3BYT B;  4JLC A;  3Q8E A;  4M02 A;  3RCZ A;  5HFY A;  1V88 A;  3NWA A;  1ZPS A;  4HDQ A;  2AX5 A;  3TUO A;  2KDE B;  4XX5 A;  3AEA B;  3TCA A;  2M0X A;  1ENF A;  3O13 A;  4LK0 M;  4S0R A;  4PT5 A;  4B0E A;  5IN7 A;  4IW0 A;  4XE0 A;  2J42 A;  1KBL A;  2K25 A;  4K3B A;  5TSS A;  3UI3 A;  1ZE3 D;  3AXC A;  4GMV A;  2BBC A;  4MM3 A;  4A9A A;  4IDI A;  3QIJ A;  4OZC A;  5G55 A;  5JZE B;  2ZCC A;  1L7Y A;  4GB9 A;  3U4E G;  3DCX A;  3O96 A;  5HE1 A;  1NYR A;  1YN3 A;  1L6U A;  3EA6 A;  1WRD B;  2JZP A;  1KLU D;  1ZUD 2;  1V86 A;  3UIN B;  4MJS B;  1AQC A;  1HE8 A;  3KY9 A;  1RAX A;  5DCN A;  5BMH A;  4YL8 A;  1UGJ A;  5AZF A;  1MHX A;  1HA5 A;  3WAN A;  3Q8A A;  2BGF A;  2C60 A;  2LUE A;  2LGX A;  4OHJ A;  3Q3J A;  2PE9 A;  3BVM A;  1ZM0 A;  3KSY A;  1WFY A;  1R7S A;  5G5G A;  1UBI A;  1L2N A;  5JHA A;  3BIN A;  3BK2 A;  1GJZ A;  3FP5 A;  5IP4 D;  3L13 A;  1WZ3 A;  1WJU A;  2QHO A;  4IOI E;  2L2I A;  1UD7 A;  2KJ6 A;  2YVC A;  3D8F A;  1SIF A;  4BFR A;  4K2P A;  4JWU C;  1C4C A;  2R0D A;  1WVH A;  4GZU A;  5IAA C;  2J52 A;  4PNK A;  3SEB A;  2FJL A;  3ZQ4 A;  3I3T B;  3AE3 B;  2WXP A;  4LLG M;  3ZO5 B;  4DBG A;  5EE0 A;  2LFI A;  2FJ9 A;  1K8R B;  4YON A;  1HTO A;  3GZN B;  4WIP A;  2QIL A;  5DHA B;  4R3D A;  5IKC M;  5E6J A;  3DVG Y;  3K9O B;  2MBO A;  1V80 A;  1VJK A;  1SBB B;  1Q1O A;  2FCM A;  1L0V B;  3PPA A;  4GN1 A;  2DYQ A;  1XLQ A;  4ZRI A;  1WWT A;  2FCN A;  2LRU A;  5LLI A;  1WJ4 A;  3H7S A;  5CHF A;  2YF0 A;  1XD3 B;  2BS4 B;  1E8Z A;  1UUP A;  2NBV A;  2BYV E;  3RT3 B;  3FIL B;  1P7F A;  2DN6 A;  2P0D A;  2NPT B;  3ZNZ B;  4ZRQ A;  4BKT A;  4HAU B;  3SUZ A;  1A5R A;  3Q2A C;  3RNA C;  3HIE A;  2X0S A;  4NJ6 A;  4IUM B;  1TS4 A;  2D9V A;  1RLF A;  4MK0 A;  2RDB C;  1DOY A;  5DIF B;  1MI0 A;  4ZOH C;  2INN E;  2KNB A;  1QKZ A;  2N7J A;  2ZCB A;  4W9K A;  2MA9 B;  4ASW C;  1ET9 A;  2AWT A;  4QJ3 B;  2VRR B;  5J18 A;  4XDC A;  2DX5 B;  4WWP A;  3IAM 1;  4HB2 B;  1P9D U;  4REZ A;  1C79 A;  1QQG A;  1K53 A;  2HTH A;  3WIM A;  4DX8 A;  4ARC A;  3BVZ A;  3NVW A;  2ZZP B;  1UPR A;  4MSM B;  3P7Z A;  2WNM A;  2D3B A;  2FUG 1;  1OFF A;  3VR9 B;  1MHH E;  4RCO A;  1I4X A;  1WXQ A;  5D6J B;  3HIZ A;  3C19 A;  3A8Q A;  4BOS C;  5FK9 C;  3GYP A;  3Q3O C;  4C0A A;  5D94 A;  4JKH A;  1VZ6 A;  2I38 A;  2Z4D A;  2RPV A;  1T6B X;  2O6V B;  2J53 A;  4KKJ A;  4K17 A;  1FGY A;  2QSD A;  1OY2 A;  1Y19 B;  1E8W A;  2D3G A;  2DZM A;  3ZJT A;  1P7E A;  1EVH A;  2WP9 B;  3KRX A;  3ZJU A;  2JT4 B;  3MJ5 A;  2RRF A;  2UZR A;  2XNA C;  3L4P A;  1P0R A;  3PLU A;  2CS4 A;  3A9J A;  1EO6 A;  2Z59 A;  4HDO A;  4IFS A;  2H89 B;  3SBG A;  4URK A;  4BBK A;  1DYQ A;  1VD2 A;  2KLG A;  1PFJ A;  3RNB C;  2Y8G A;  2MRP A;  2WS3 B;  3QK0 A;  3RD2 A;  4C80 A;  1HXY D;  1OEY A;  1QOF A;  2DLW A;  3KUZ A;  4GOC A;  2C5L C;  2JQR B;  2WGS A;  3R7Q A;  4JK7 A;  3IT4 B;  2KAC A;  2KKC A;  3RCP A;  2GRI A;  2BF8 B;  4RNA A;  3MHS D;  2HDE A;  4W9L A;  1EAZ A;  3VR8 B;  1T0Q C;  3AEE B;  2ZW1 A;  4AQ7 A;  1FRR A;  4NY0 A;  4WJN A;  3CSF A;  2DYM A;  2KX3 A;  2OOB B;  2W9N A;  2WXF A;  2CJN A;  2NTS A;  2KC2 A;  4HSI A;  1QT9 A;  1IGC A;  4WWM A;  1YN5 A;  2BWF A;  2N9X A;  2YT0 A;  1DOI A;  1ROE A;  2K3U A;  4JGH B;  1D5X C;  3UGB B;  4F7U P;  1Q5W B;  1RYJ A;  2LRW A;  3T9L A;  4TQ1 A;  4P16 A;  3T8M A;  1UNQ A;  1T77 A;  2BWE S;  4G50 A;  2IJ0 A;  4RGO S;  2RGN B;  4CSQ A;  4KV2 A;  2IFS A;  2K49 A;  4L1R A;  2H88 B;  2MX2 A;  2G35 A;  3C0R B;  4LJO B;  3WCQ A;  1QLB B;  1I2H A;  4RF1 A;  2ICI A;  4X57 B;  2M38 A;  3E9S A;  3P42 A;  3Q8B A;  5GOW B;  2KDF B;  4IWQ A;  1FO4 A;  1PGA A;  2J0J A;  2LJ5 A;  3ULC A;  2I5C A;  3DXD A;  1XEE A;  1WSP A;  3A4S C;  1DOX A;  2R2Y A;  3W2D A;  4NPN A;  1TY2 A;  1VLB A;  2KFK A;  4W9I A;  2KAN A;  1X1M A;  3PG7 A;  1KLV A;  1WM2 A;  4IOY X;  1JWU D;  3ZW3 A;  3RMK C;  1W1H A;  3JW0 X;  3N3K B;  4Z2N A;  3U2S C;  4DXG A;  3EGR A;  3KH0 A;  2PPH A;  2KWC A;  1SF0 A;  2LD9 A;  1X1G A;  4IWO A;  5CHW A;  3W1Y A;  3V6E B;  2OED A;  4F7G A;  2IGD A;  2JWU A;  1MG8 A;  1SB3 C;  2N0S B;  3Q8F A;  2LGD A;  3H9D A;  4K3C A;  3PRE A;  5H8Y E;  2KLC A;  1DBH A;  2IO2 B;  2LUL A;  4FA6 A;  3ZRF A;  2R09 A;  5KHO A;  1T3Q A;  4YWG G;  4JKE A;  5D3V A;  3ZYY X;  2FE8 A;  2ONQ A;  2YT2 A;  1OTR B;  3HM3 A;  4IG7 B;  5CLL B;  2PLP A;  4NQL B;  4TQ0 A;  2Z0O A;  2RR9 A;  4HRS A;  3QHT A;  4CHK A;  1K51 A;  4C7Y A;  3WYF B;  4G11 A;  3TFM A;  3A98 B;  2LXC A;  4BKS A;  2L0T A;  4FJY A;  4KZ0 A;  1EF1 A;  5TR5 A;  5AZG A;  3DHG C;  1YJI A;  4ICU A;  2PIA A;  4FHK A;  2AQ3 B;  3ZRC A;  3KUC B;  1YIW A;  2INP E;  2M8S A;  2M4N A;  5IRS A;  4N59 A;  2HJ1 A;  2SEB D;  3SV1 A;  1TBE A;  4ARI A;  5GXG B;  1WGU A;  2BPS A;  4GDL A;  1GC7 A;  3ODO A;  1J0G A;  3CIR B;  3H1U A;  1D3Z A;  2KUP A;  2DZJ A;  4PQ0 A;  1PYW D;  3U30 A;  4JKG B;  1F2R I;  1IGD A;  2WXO A;  3L08 A;  3BK1 A;  4II2 B;  1JQ4 A;  3JSV B;  3HQC A;  4A6H A;  4OVZ A;  1FCL A;  2WDR B;  3A1Q A;  2K00 A;  1E6E B;  2V76 A;  2KVR A;  4J3O D;  1WG7 A;  3PVL A;  2COC A;  3B77 A;  5L81 A;  3IHP C;  1TIF A;  5C2T B;  2EMT A;  2M1M A;  2BTE A;  4RFB A;  2WXL A;  4JE3 B;  3AU4 A;  1UNR A;  1V1P A;  2V4I B;  3VOQ A;  4KGT A;  2DA0 A;  1FHO A;  2HRJ A;  4LCD E;  1U5D A;  3RZW C;  1WY8 A;  2WXJ A;  1GPX A;  4GGQ A;  4HJG E;  1BT0 A;  1N5X A;  2N7D A;  5I4D A;  3ZUN A;  3GS2 A;  2I5F A;  1SGH A;  2UYZ B;  1NDD A;  4W9F A;  3D8D A;  2KXJ A;  2MH7 A;  1V89 A;  3JVZ X;  4LDT D;  4B0M A;  1B55 A;  2Y7B A;  2MHJ A;  2JY6 A;  5BMG A;  1YQ3 B;  2G4S A;  2ZVN A;  2MFQ A;  1N60 A;  2MW5 A;  3RFZ B;  5FI0 A;  3NY5 A;  1MAI A;  2UZS A;  1WYG A;  5E6N A;  3VVW B;  4EFO A;  3VDZ A;  1I4G A;  2JXX A;  1DDV A;  1WXM A;  4HK2 A;  1D6E C;  3A9K B;  5CLQ B;  3QX1 A;  3NS8 A;  2D9Z A;  2R2Q A;  3B1L X;  4DHZ B;  4NZL B;  4BKS D;  2Z0D B;  3AN1 A;  4HB4 B;  3TBL D;  1A70 A;  2MBQ A;  3VFK A;  1PMS A;  2ABD A;  1WMH B;  3ULB A;  5HE3 A;  3N20 C;  1FFV A;  4FJV B;  2BQQ A;  4FBJ B;  3P63 A;  2DKQ A;  1MK9 B;  5C5B A;  5G2N A;  2YS1 A;  3GOE A;  4JQW C;  3S2A A;  1UPQ A;  2JYT A;  2O2V A;  1KFY B;  2L7R A;  1YOV B;  1X1F A;  2IY0 B;  4KZC A;  3APF A;  4HEA 1;  1PFD A;  1WGG A;  2GBR A;  3GE3 C;  4P6V F;  4B9K A;  2KN5 A;  2LHE A;  2Y3A A;  2A4Z A;  3NZU A;  1TJE A;  2FCS A;  2JVC A;  2WLB A;  1ZGU B;  3Q8C A;  1XXG A;  4EOY A;  2MP2 A;  1AWD A;  4GXB A;  1QOG A;  1TS2 A;  1ZDV A;  4HAZ B;  5T8I A;  2Z13 A;  2PKO A;  3HUI A;  1E8X A;  2BB6 A;  4HJK A;  2K6D B;  1N6Z A;  3NOB A;  1IUE A;  3H8H A;  1TQZ A;  2MWN B;  4PYU A;  3SFD B;  3AE4 B;  3TW1 A;  4A5K A;  4KHB B;  3AM9 A;  1FHW A;  3ZNI D;  2KIG A;  2KGX B;  1ESF A;  4QAY A;  5JH5 C;  4ZHP A;  4HLE A;  2WU2 B;  4IM0 A;  4JL9 A;  2RUK B;  4BBN F;  4D6W A;  2LGY A;  1IP9 A;  2FDQ A;  2KVZ A;  4DX9 0;  2OQB A;  2Q5W D;  1RWS A;  4HAY B;  2AQ2 B;  4L23 A;  1KOT A;  1RFK A;  3LB8 C;  2COD A;  1WJ1 A;  2PE6 B;  4ILH A;  1MFW A;  4GPT B;  2CKH B;  2XK5 B;  4DHJ D;  1FXI A;  5J17 A;  3PZD A;  2IYD B;  4E74 A;  2I1K A;  4Z2M B;  3ECI A;  2V3N A;  2TSS A;  1MPE A;  3EC8 A;  4IAP A;  1U5E A;  1V1O A;  2LI5 A;  4OZA A;  2K8E A;  2NZ8 B;  1JAL A;  2MBB B;  1ET6 A;  4MM3 B;  4PS8 A;  1E90 A;  1NTI A;  2IYB A;  1ZP0 B;  1KF6 B;  4HKZ E;  1VRA B;  1K5G B;  4JKB A;  2Y5B B;  2WXR A;  1V5O A;  4WSF A;  3NHE B;  4RGN A;  3Q6B A;  4TMA B;  2LEK A;  4N9F 4;  1TZO A;  4D2K A;  2D10 A;  1XCG A;  4NAW A;  2NTT A;  4HWI B;  2D9Y A;  2MBE A;  3B08 A;  2KWU B;  4AJY B;  3AE1 B;  2INC C;  3PZ8 A;  4W9G A;  4TYZ A;  3T3N A;  1M4V A;  1GAQ B;  2BKF A;  3TVV A;  2K8B A;  4YT0 B;  2GCJ A;  3N30 A;  4BZA A;  1RRB A;  3ZLZ A;  2ROV A;  2Z0Q A;  2D9W A;  3NW8 A;  1EM7 A;  4HCN B;  4O1N A;  4PS7 A;  4ANW A;  5C23 A;  2W2W A;  2GJY A;  5H92 C;  3DBL I;  1ZW7 A;  4HAW B;  2JP2 A;  4PK1 A;  4II3 B;  3AEB B;  5IJM A;  4XC2 A;  2BW2 A;  4DDG D;  4KHO A;  1YMH E;  1R4N B;  2WX0 A;  2IGG A;  5BYQ A;  1UF0 A;  3HVD A;  3I9V 1;  4ICV A;  2ZNV B;  4C56 C;  4WAF A;  2LYD A;  1PQS A;  2MQJ A;  3ETR A;  2SAK A;  2B3A A;  2ZPN A;  1TY0 A;  1Z87 A;  1NEN B;  2YSZ A;  3R66 C;  1F52 A;  3APC A;  4K81 A;  2JWZ A;  4M00 A;  2CY4 A;  3LJU X;  3HK0 A;  2N1W A;  3CF6 E;  2UU7 A;  4W9D A;  3N9Y C;  5DI9 B;  5KQ1 A;  2REX A;  4EE2 A;  4A6F A;  2VZK D;  2DHZ A;  4B6W A;  1WF9 A;  1VCB A;  5JVL A;  3MC0 B;  4KGR A;  4TV3 A;  2C7N B;  3NG0 A;  3DBS A;  4CYE A;  5IA7 A;  1WGH A;  3NUH B;  3IT6 B;  3PSE B;  4Y94 A;  3MPX A;  2NBV B;  2OJR A;  3NRZ A;  3AED B;  3WAL A;  4EZJ A;  1JWA D;  4IKG A;  4B95 A;  1J8C A;  1B9R A;  4A6Q A;  3MHZ A;  1EF5 A;  1PLS A;  5HKH A;  3IVF A;  2EEL A;  3PT2 B;  2QMT A;  4FXC A;  1WJ6 A;  4WWO A;  2K8C A;  2ZKM X;  1ZC3 B;  2KDI A;  2GBN A;  1V5M A;  5BO4 B;  4WUR A;  5CHV C;  2QCZ A;  5AUI A;  1OQY A;  2N9L A;  3FIL A;  2CU3 A;  3PHW B;  4JWS C;  2C7H A;  2JZZ A;  3AE2 B;  1ISN A;  1RJ2 A;  1VBH A;  3ONS A;  2N1V A;  3KYC D;  3MP9 A;  3LJ3 A;  1SE9 A;  2KQS A;  1H10 A;  1BUI C;  1NTV A;  1ZDX A;  3H6N A;  2KTR A;  5EDS A;  2D3A A;  4OZB A;  4JPS A;  2PZ1 A;  2RGF A;  1XLO A;  2HTH B;  5BMI A;  4Q2J A;  2IO3 B;  4L1B A;  4HB3 B;  2JSV X;  4MGY E;  1XQQ A;  1LB1 A;  2LGS A;  3D32 A;  1DRO A;  3H7P A;  5EE3 A;  1P5T A;  2DHI A;  3IG3 A;  1U27 A;  3FM8 C;  3WAP A;  5FKA C;  4XWT A;  3ML8 A;  2CRF A;  4KVG B;  4RMA A;  3Q69 A;  1NYQ A;  2WHI A;  3NSU A;  2Z8L A;  4DWF A;  1L4D B;  4GU2 A;  3RYT A;  1Z2M A;  1SE4 A;  1WYW B;  1Y56 A;  4P1C C;  2VSZ A;  3DBR I;  5D3Y A;  5J3Y A;  1VZ7 A;  2PMV A;  2L05 A;  4RF0 A;  4AUQ C;  3DQV A;  2L83 A;  3A9J B;  2LOZ A;  2KT7 A;  2Z59 B;  3VH4 B;  3J9C A;  4B6H A;  1J7B A;  2KK8 A;  4WQO B;  4XWW A;  1XR0 B;  3A58 A;  5I2M A;  1JDE A;  3HHM A;  3G9W A;  2D11 A;  3F0W A;  2CAY A;  3DPD A;  2ZW0 A;  1C3T A;  1SE2 A;  1SXT A;  1FCC C;  2BVC A;  3SYX A;  3N1Z C;  5MPO A;  5D3I B;  2X8X X;  1E7V A;  4S17 A;  2NR2 A;  4MEM A;  3PRZ A;  2EKI A;  1K5D B;  1FXT B;  5LXH A;  4IM3 A;  2MDX A;  1FXA A;  1YQ4 B;  3W5V B;  2ZEQ A;  1FHX A;  3ZKJ C;  4MSQ B;  3FC4 A;  2K5P A;  1J0W A;  2KIE A;  3ZDM C;  2BYE A;  2WX1 A;  2ZJD A;  3WA0 A;  2WYQ A;  1R4M B;  3BWU D;  5KQ4 A;  2DBY A;  4ACF A;  2P0H A;  2L52 A;  3BYY B;  4WJP A;  2KD0 A;  3SU8 X;  2KDB A;  4MGK E;  1V9J A;  3PV1 A;  3FKY A;  4EZL A;  2WWZ A;  1XLP A;  4KIK A;  2DYN A;  1I7H A;  1RM6 C;  4NQK E;  2I1J A;  5FR6 A;  2KR0 A;  3PSC A;  4LTU A;  1T5X D;  2RLO A;  3M1I B;  2K1F A;  3VH3 B;  1MG4 A;  1ZVR A;  4C7Z A;  1QQR A;  4NNJ B;  3APD A;  1P6S A;  1R4N I;  4L2Y A;  1BWN A;  4QJ4 B;  2FID A;  2KMC A;  4W9E A;  4W9H A;  3HSA A;  4GNK B;  3LXF A;  1GB1 A;  3QAQ A;  3TJP A;  4ANX A;  4HB0 B;  2WXM A;  4I6L B;  3EPY A;  4EMO A;  3TIX A;  1HB6 A;  2QDF A;  1KC7 A;  1SIJ A;  4ILG B;  2DKP A;  1MJD A;  3Q3F A;  1D4B A;  1YD8 U;  3KRW A;  3T06 A;  2K2J A;  4EKU A;  5L83 A;  1V61 A;  3AH7 A;  2LVQ A;  4CHJ A;  2BYF A;  2LVO A;  1WR1 A;  3OLM D;  4OSN A;  2YS3 A;  3VQI A;  2K8H A;  1ACC A;  4DK5 A;  3N7C A;  1WI0 A;  1WX9 A;  3P1M A;  1SEB D;  2MEK A;  5BYS A;  4OT1 A;  5HI1 A;  4KKI A;  2M0A A;  4HAX B;  3V5W A;  1WX7 A;  1UH6 A;  5D3W A;  1FNU A;  4P7I A;  3TEZ A;  1TS3 A;  4LDT B;  1RRP B;  2K0P A;  4D0N B;  5FI1 A;  2NVU I;  3KQ4 A;  4ZRP A;  2DWQ A;  2MSE D;  2W3R A;  2DFK A;  1D5Z C;  3K9P B;  1BTN A;  2MWS B;  3NWF A;  3FSS A;  2LXA A;  4GDK A;  1AAR A;  2QJL A;  3NZ3 A;  2E2X A;  3FEH A;  2WDV B;  5L95 C;  4WWN A;  4PYZ A;  5IO9 A;  2DNF A;  3BY4 B;  1WM3 A;  2GBM A;  4ZYN A;  3DHI C;  2GBJ A;  3IFW B;  2IZV B;  1DDW A;  4KAX B;  5HE0 A;  5DPR A;  4MY6 A;  2DYB A;  2VKI A;  1MIX A;  1MVK A;  3FVC A;  2LWP A;  3BVG A;  1KM7 A;  2UVM A;  3V6C B;  1JRO A;  3QC8 B;  3AE8 B;  3KZ1 A;  4KDI C;  4GDL B;  4LNN A;  2Y5C A;  1XX0 A;  3DBL B;  3SDL C;  2N9K A;  5D2M B;  2RMM A;  2AYO B;  2HJ8 A;  2IO1 B;  2YLM A;  3ZGZ A;  4HAT B;  4RH6 A;  3SFE B;  3PVW A;  1OGW A;  4MGI E;  1QIL A;  4NJ7 A;  1MI1 A;  2KQ7 A;  3ZIM A;  1ACA A;  2MJ3 A;  1Q0W B;  4KX6 B;  3A1Q B;  3DHH C;  4US9 A;  1YQB A;  3KWL A;  3P4P B;  3V60 A;  1HEZ E;  3QAR A;  2JU6 X;  2ELB A;  2FUH B;  1XKE A;  3I57 A;  4WJQ A;  2C7M B;  4K7U A;  2M14 A;  3GB1 A;  3JSV A;  3R3M A;  3VUX A;  4OVU A;  1X05 A;  4NSW A;  3TL5 A;  2DHJ A;  1V1P B;  3UF8 A;  1IBX A;  2YEP F;  1GOZ A;  4HPM B;  2GCL A;  2G4D B;  3OAW A;  1N63 A;  4K2O A;  1JCK B;  2JX5 A;  4WJ7 A;  4BBN C;  1I4P A;  1IYF A;  2PEA A;  4QJ5 B;  3SHQ A;  1K52 A;  1F77 A;  1NVL A;  4HPP A;  1LO5 D;  4N58 A;  3ZVR A;  3R2T A;  2Z14 A;  3ZNH B;  1QF6 A;  1T0S C;  2GBK A;  2WDT B;  4DHJ B;  1J19 A;  2LG1 A;  2N7E A;  4FUL A;  1X86 A;  1H4R A;  3IAS 1;  1UWX A;  4WQM A;  4CQN A;  5G5H A;  2AL3 A;  3QBV B;  4ZYS A;  2UWQ A;  2KN4 A;  1M7E A;  1H8C A;  1FMA D;  2DZK A;  1I4H A;  1JRU A;  1U5G A;  5E6O A;  1UGM A;  2GOW A;  3AMZ A;  2KFJ A;  1EU4 A;  1NU2 A;  4HCP B;  1WXA A;  5D27 A;  1JML A;  4F8C B;  1EGX A;  3A9K A;  1DIK A;  1TGZ B;  1I4Q A;  1T0Y A;  1TZ1 A;  3P4S B;  1N61 A;  1ZOY B;  1WH3 A;  2W82 A;  4XZ4 A;  1R4M I;  3A4R A;  4M0W A;  3TMP B;  2XN9 C;  3V61 A;  3MTN B;  1M94 A;  5HHD G;  2O2V B;  4A6K A;  1WE6 A;  4MAC A;  5GMV A;  3EUB 2;  3L17 A;  2KDM A;  2OHF A;  3OJ3 A;  1OMW A;  4C4V A;  3KUD B;  1OQN A;  1WJM A;  1XCQ L;  3PO0 A;  2R82 A;  2YRY A;  1E9M A;  2FNJ B;  1FNV A;  2IBI B;  4HRO A;  2YEP B;  2D5G A;  5EE1 A;  1WZ0 A;  3L54 A;  2CHZ A;  4W9C A;  4IC7 B;  2IND C;  3AV8 A;  2Y5P A;  1LM8 B;  1TKE A;  3ZXR A;  3VAW A;  1KH0 A;  1V5T A;  1JRP A;  3PRM B;  1KZ7 A;  2P0F A;  3V3X A;  3AUL A;  4NAM A;  4XGA B;  2CHX A;  2KMM A;  5AEK B;  1I42 A;  2RNR B;  2BS2 B;  5EE9 A;  1ZSQ A;  3AE6 B;  5EFX A;  4RM8 A;  2M56 B;  1WIA A;  5AZH A;  5JXV A;  3U12 A;  1FPY A;  4XWX A;  1TKG A;  3DBR B;  2DYO A;  2WU5 B;  1FFU A;  3OG5 A;  4ILJ A;  1Q10 A;  1C1Y B;  2KQ4 X;  1QOB A;  3DWG C;  1YX6 B;  5DPS A;  5D3D A;  3NZS A;  2J4X A;  3E9P A;  1L6V A;  1SSN A;  5BYR A;  1SE3 A;  3PVU A;  3RUI B;  3VXW A;  4HHV A;  1JW9 D;  4EEW A;  1MPH A;  4JKA A;  1UBQ A;  3TEX A;  3B2F A;  3W1S C;  2VZK B;  3M3J A;  1FGZ A;  3E9L A;  4M8N A;  2FIF A;  1LGR A;  1MIZ B;  3TSS A;  2COP A;  1CMX B;  4HVB A;  5DH9 B;  4ANV A;  4YXD B;  2V3P A;  2LGI A;  3N1Y C;  2Q13 A;  1V81 A;  1BAK A;  5JLJ B;  3TEY A;  2PTL A;  3RUL A;  4MGZ E;  2XQN M;  3RI7 C;  1OQR A;  4KSL C;  2MCN B;  3AE7 B;  4NAW B;  4AJW A;  2KYW A;  4A20 A;  2KX0 A;  1W1G A;  3RPF C;  1N62 A;  3UIO B;  2IO0 B;  4EZK A;  4DIX A;  1J7C A;  2N0Y A;  1QOA A;  3P2B A;  2WDQ B;  1C76 A;  4F1S A;  1HZ6 A;  2RSG A;  2RVB B;  1UNP A;  1VDV A;  4FHJ A;  4KDL B;  2WXK A;  2LKO A;  2BCJ A;  4DBB A;  2AQ1 B;  2W54 A;  1TJ6 A;  2ASQ A;  2E3T A;  4MJS A;  3OHM B;  3P6A A;  3M63 B;  4FAD A;  3W9C B;  5DPW A;  1KZG A;  5JHB A;  2HTM E;  1SJH D;  3VTU A;  1WR6 E;  2D9X A;  3V05 A;  1C4A A;  1P3Q U;  3SBT A;  1KI1 B;  2G45 B;  1GC6 A;  2KJR A;  4YTN B;  1CZP A;  2WXN A;  2QKL A;  4F7H A;  2PW9 A;  3UQB A;  2PVO D;  3M62 B;  1FRD A;  2DEN B;  3CST A;  4KSK C;  1V8C A;  3QCA A;  1G6J A;  2NS5 A;  2KJH B;  3SNH A;  1CQV A;  2H7E A;  3UIP B;  3RNE C;  2KHW B;  3DOW A;  3EFU A;  1VBG A;  1TS5 A;  1MKE A;  1FNW A;  1NI3 A;  3CIK A;  3VTV A;  4BAX A;  4DXA B;  4A6F B;  2CB8 A;  2KWD A;  1FOE A;  2V9H A;  4JK9 A;  4H8S A;  3D8E A;  3JYU A;  2X38 A;  1FAO A;  2B76 B;  3DVN U;  4K1R B;  4OVV A;  3QWM A;  1WGR A;  3RNG C;  4N6E B;  3N32 A;  4ZRJ A;  3MFG A;  5C79 A;  1MK7 B;  3SD5 A;  3E9O A;  4A3P A;  2KUQ A;  1Z5S B;  3U52 E;  3AI5 A;  2FAZ A;  3DCG A;  3DVG X;  3AU5 A;  2DZI A;  2KWV B;  3KWV A;  4ZRK A;  3VUW A;  1U4A A;  4HAV B;  3GP7 A;  2P8V A;  2CHW A;  5DHF B;  5JHG A;  4PS3 A;  1LW3 A;  3V62 A;  2NPT A;  1XCT L;  2BYT A;  3LDZ E;  2MKR A;  3R8B A;  1I7A A;  1VR9 A;  2L8J A;  3ENB A;  3DVN V;  2JRI B;  4BKG A;  2L0F A;  3U7Z A;  3ZNG C;  5C16 A;  1UWM A;  2NMB A;  2MLB A;  1V2Y A;  3Q14 C;  2KTR B;  1W1D A;  1EWY C;  4M01 A;  1FEH A;  4JK8 A;  3VRA B;  2LOX A;  2W2X C;  3WAO A;  2ACZ B;  3QWZ B;  2JF5 A;  1YNT E;  2NBW B;  4JKC A;  1D5M C;  3AJ4 A;  2K2U A;  2D07 B;  2DHK A;  4ANU A;  2DX5 A;  3T3O A;  4WH4 A;  3VIA A;  1J7A A;  1P1A A;  2GI9 A;  4F7Z A;  2K39 A;  2WXI A;  2EC1 A;  3H7P B;  2L76 A;  1L5P A;  5J3Q A;  4RM9 A;  2ELA A;  3A8P A;  2W55 A;  3DBH B;  3AEC B;  2LVP A;  1ZXI A;  1WGK A;  1AW7 A;  1LFD A;  3EHV A;  3VHT C;  4E3C A;  2ROZ B;  1BXT A;  1FD6 A;  1F9J A;  3VUY A;  2K9X A;  5KCV A;  4YSY B;  1C9F A;  1GB4 A;  1WGD A;  2Z0P A;  4MH0 E;  1PDX A;  1V97 A;  2WXG A;  2N23 A;  4RGM A;  2KTF A;  3ZTC A;  3U7D A;  3IBE A;  3DXC A;  1OEY J;  3SR6 A;  3W1S A;  4QXA B;  4LNF A;  4HKQ A;  1V5P A;  2O6V A;  2LUM A;  1YJ1 A;  2L00 B;  1PGX A;  2J59 M;  1TYG B;  3AEF B;  1V6E A;  2GB1 A;  5M4Y B;  2LZ6 A;  1QC6 A;  1C78 A;  3NVV A;  2RDG A;  1L4Z B;  4LJP B;  1I35 A;  2E6X A;  4BOZ B;  2QKM A;  2YS5 A;  1GNU A;  2ADZ A;  5LON B;  1VZ8 A;  3MC9 A;  4KGS A;  4CHM A;  4A8X C;  1SJE D;  3NJT A;  5HE2 A;  2HE7 A;  3PRP B;  1IPG A;  4AWJ A;  4P1B C;  4MDK E; 
#chains in the Genus database with same CATH homology
 1U29 A;  2YT1 A;  3CMM B;  2FCQ A;  2GS0 A;  1SHC A;  4I6N B;  4J6I A;  3FLV A;  1WX8 A;  3KVF B;  2V1Y A;  1NI2 A;  2V3S A;  3UQA A;  2KCJ A;  2N4F A;  2WH5 A;  1U2B A;  2EJ8 A;  2C9W B;  1XOD A;  3ML4 A;  2CQU A;  1U5F A;  2J0K A;  4K7W A;  4TUU A;  3SO6 A;  3ODX A;  5CTR C;  4KIK B;  1N3H A;  1WXS A;  1TTN A;  2JZ3 B;  3ENE A;  1WXV A;  5LOP B;  3ZDT A;  5JP4 A;  3HW2 B;  5LXI B;  1DYN A;  4AOF A;  4DHZ E;  4W9J A;  3EEC A;  2KFK B;  2A5U A;  3F5R A;  4BVU C;  1EUV B;  5C6R A;  1XT9 B;  2O6V D;  2XEW A;  5DPT A;  2DAF A;  3DXE A;  2V4L A;  2EMS A;  3MJW A;  4G0N B;  3ODW A;  3ZVV A;  3ZTD A;  1GGO A;  1GUA B;  2AEH A;  3PGE A;  1E7U A;  1UZX B;  1WI1 A;  3E66 A;  2CY5 A;  2KO3 A;  1ZKH A;  4MEL A;  1WGQ A;  3GZN I;  3OAN A;  3RZF A;  2M17 A;  4KHA A;  2H7D A;  2G3Q B;  3L10 B;  1WJN A;  3QJZ A;  4GDK B;  2OTX A;  4IWP A;  3U8Z A;  3HM6 X;  3PTF C;  3MDB C;  2DTC A;  3X23 A;  1P98 A;  2N9P C;  2ZVO A;  1V5U A;  1LXD A;  4K7S A;  5D3X A;  1AWE A;  2PJH A;  1DDM A;  4HXD A;  2J0M A;  3PEG A;  1GG3 A;  5JHH A;  3KW5 B;  2HD5 B;  3PLV A;  2RD0 A;  2JPH A;  2NBU A;  3BJI A;  1Q67 A;  2MBH A;  4FN2 A;  2VRW B;  2CR5 A;  4GMX B;  2BKR B;  4TKN A;  2ZPY A;  4WJO A;  5C1Z A;  1HB8 A;  1V49 A;  2RSU A;  4ZDV A;  2L3Z A;  1S3S G;  4MT7 A;  3DBH I;  3QQ8 B;  4JKG A;  3WAM A;  1HBK A;  2DAJ A;  3KYD D;  3OJ4 B;  4DDI D;  2X18 A;  4GIV A;  2N9E B;  3ML9 A;  2COF A;  4M8M A;  3PS6 A;  2XBB C;  1ZC4 B;  4AP4 C;  4JKF A;  2DX1 A;  1NBF C;  3O65 B;  3A33 B;  1KJT A;  5CX3 A;  2JRH A;  3PHX B;  2RQ1 A;  4WAA A;  3VTW A;  1XD4 A;  2J7Q B;  2NCN A;  3B0A A;  2Z0E B;  4EJN A;  4FLH A;  1S1Q B;  1E5W A;  3M95 A;  2ZNV C;  2R2O A;  1UEL A;  2KOX A;  4I6P A;  4A3O A;  4WVF B;  2Y8F A;  3L16 A;  4JKD A;  2W2X D;  3L0W B;  2GMI C;  1TXD A;  1M7R A;  2LAS A;  1E8Y A;  1WGY A;  2D4Q A;  3TO1 A;  1Y5O A;  1RFA A;  4G3X B;  5C5B B;  4M0W B;  4E71 A;  4IM2 A;  3R7R A;  3GYO A;  5J3T A;  1WMH A;  4JIO U;  4FJZ A;  2EKE C;  1FB8 A;  2AL6 A;  1WE7 A;  1Y8R C;  2K6Q A;  1ST7 A;  3UZT A;  2MP2 B;  2D2Q A;  2IY1 B;  5E6P A;  2KC1 A;  1IRS A;  4CO7 A;  3CXB B;  1YX5 B;  2CU1 A;  4HPL B;  3ALB A;  2KMA A;  2RPQ A;  3QA8 A;  3X0W A;  1NTY A;  4L6E A;  5KHQ A;  1X11 A;  1UEF A;  2KZR A;  2JUO A;  4GSW A;  3DDC B;  1BTK A;  1LQB A;  2COA A;  1QZE A;  4EUT A;  3PP2 A;  5D7G A;  2XK5 A;  5J2R A;  1P3R A;  2LBB A;  2DIK A;  2L1C A;  4JLC A;  3RCZ A;  1V88 A;  4HDQ A;  2KDE B;  4XX5 A;  3TCA A;  2M0X A;  4IW0 A;  1KBL A;  2K25 A;  3AXC A;  4GMV A;  4MM3 A;  3QIJ A;  5G55 A;  5JZE B;  2ZCC A;  1L7Y A;  4GB9 A;  3O96 A;  5HE1 A;  1WRD B;  1V86 A;  3UIN B;  4MJS B;  1AQC A;  1HE8 A;  3KY9 A;  5DCN A;  1RAX A;  4YL8 A;  5AZF A;  3WAN A;  2BGF A;  2C60 A;  2LUE A;  2LGX A;  3Q3J A;  2PE9 A;  1ZM0 A;  3KSY A;  1WFY A;  1UBI A;  1L2N A;  5JHA A;  3BIN A;  1GJZ A;  3FP5 A;  3L13 A;  1WZ3 A;  1WJU A;  2QHO A;  2L2I A;  1UD7 A;  2KJ6 A;  2YVC A;  3D8F A;  1SIF A;  4BFR A;  4K2P A;  2R0D A;  1WVH A;  4GZU A;  5IAA C;  4PNK A;  2FJL A;  3I3T B;  3ZO5 B;  4DBG A;  2FJ9 A;  1K8R B;  4YON A;  5DHA B;  3DVG Y;  3K9O B;  2MBO A;  1V80 A;  1Q1O A;  2FCM A;  3PPA A;  4GN1 A;  2DYQ A;  4ZRI A;  2FCN A;  2LRU A;  5LLI A;  1WJ4 A;  3H7S A;  5CHF A;  2YF0 A;  1XD3 B;  1E8Z A;  2BYV E;  3RT3 B;  2DN6 A;  2P0D A;  2NPT B;  3ZNZ B;  4BKT A;  4HAU B;  3SUZ A;  1A5R A;  2X0S A;  4NJ6 A;  4IUM B;  2D9V A;  1RLF A;  4MK0 A;  5DIF B;  2KNB A;  2ZCB A;  4W9K A;  2MA9 B;  4ASW C;  2AWT A;  2VRR B;  5J18 A;  2DX5 B;  4WWP A;  4HB2 B;  1P9D U;  1QQG A;  2HTH A;  3WIM A;  4DX8 A;  2ZZP B;  1UPR A;  4MSM B;  3P7Z A;  5D6J B;  3HIZ A;  3A8Q A;  4BOS C;  3GYP A;  4C0A A;  5D94 A;  4JKH A;  2O6V B;  4K17 A;  1FGY A;  1OY2 A;  1Y19 B;  1E8W A;  2D3G A;  2DZM A;  1EVH A;  3KRX A;  2JT4 B;  2UZR A;  1P0R A;  3PLU A;  2CS4 A;  3A9J A;  1EO6 A;  4HDO A;  4IFS A;  3SBG A;  4URK A;  4BBK A;  1VD2 A;  2KLG A;  1PFJ A;  2Y8G A;  2MRP A;  3QK0 A;  3RD2 A;  1OEY A;  2DLW A;  3KUZ A;  4GOC A;  2C5L C;  3R7Q A;  4JK7 A;  2KKC A;  3RCP A;  2BF8 B;  3MHS D;  4W9L A;  1EAZ A;  4NY0 A;  4WJN A;  3CSF A;  2DYM A;  2KX3 A;  2OOB B;  2W9N A;  2KC2 A;  2BWF A;  2N9X A;  2YT0 A;  4JGH B;  3UGB B;  4F7U P;  1Q5W B;  2LRW A;  3T9L A;  4TQ1 A;  3T8M A;  1UNQ A;  2BWE S;  4G50 A;  2RGN B;  4KV2 A;  2IFS A;  2MX2 A;  2G35 A;  3C0R B;  4LJO B;  1I2H A;  4X57 B;  2M38 A;  5GOW B;  2KDF B;  4IWQ A;  2J0J A;  2LJ5 A;  3ULC A;  2I5C A;  3DXD A;  3A4S C;  4NPN A;  2KFK A;  4W9I A;  2KAN A;  1X1M A;  3PG7 A;  1KLV A;  1WM2 A;  4IOY X;  3ZW3 A;  1W1H A;  3JW0 X;  3N3K B;  4Z2N A;  3KH0 A;  2PPH A;  2KWC A;  2LD9 A;  1X1G A;  4IWO A;  5CHW A;  3W1Y A;  3V6E B;  4F7G A;  1MG8 A;  2LGD A;  3H9D A;  3PRE A;  2KLC A;  1DBH A;  2IO2 B;  2LUL A;  4FA6 A;  3ZRF A;  2R09 A;  5KHO A;  4JKE A;  5D3V A;  1OTR B;  3HM3 A;  4IG7 B;  5CLL B;  4NQL B;  4TQ0 A;  2Z0O A;  2RR9 A;  3QHT A;  4CHK A;  3WYF B;  4G11 A;  3TFM A;  3A98 B;  2LXC A;  4BKS A;  2L0T A;  4FJY A;  4KZ0 A;  1EF1 A;  5TR5 A;  5AZG A;  4ICU A;  4FHK A;  3ZRC A;  3KUC B;  1YIW A;  2M8S A;  2M4N A;  3SV1 A;  1TBE A;  1WGU A;  2BPS A;  4GDL A;  1GC7 A;  3ODO A;  1J0G A;  1D3Z A;  3H1U A;  2KUP A;  2DZJ A;  4PQ0 A;  3U30 A;  4JKG B;  3L08 A;  4II2 B;  3JSV B;  3HQC A;  4A6H A;  3A1Q A;  2K00 A;  2V76 A;  2KVR A;  1WG7 A;  3PVL A;  2COC A;  5L81 A;  3IHP C;  2EMT A;  2M1M A;  3AU4 A;  1UNR A;  3VOQ A;  2DA0 A;  1FHO A;  2HRJ A;  4LCD E;  1U5D A;  3RZW C;  1WY8 A;  4GGQ A;  1BT0 A;  2N7D A;  3ZUN A;  2I5F A;  1SGH A;  2UYZ B;  1NDD A;  4W9F A;  3D8D A;  2KXJ A;  1V89 A;  3JVZ X;  4LDT D;  1B55 A;  2Y7B A;  2JY6 A;  2G4S A;  2ZVN A;  2MFQ A;  2MW5 A;  5FI0 A;  3NY5 A;  1MAI A;  2UZS A;  5E6N A;  3VVW B;  4EFO A;  3VDZ A;  1DDV A;  1WXM A;  2JXX A;  4HK2 A;  3A9K B;  5CLQ B;  3QX1 A;  3NS8 A;  2D9Z A;  2R2Q A;  3B1L X;  4DHZ B;  4BKS D;  2Z0D B;  4HB4 B;  3TBL D;  2MBQ A;  3VFK A;  1PMS A;  2ABD A;  1WMH B;  3ULB A;  5HE3 A;  4FJV B;  4FBJ B;  2DKQ A;  1MK9 B;  5C5B A;  5G2N A;  2YS1 A;  3GOE A;  3S2A A;  4JQW C;  1UPQ A;  2O2V A;  2L7R A;  1X1F A;  2IY0 B;  4KZC A;  3APF A;  1WGG A;  2GBR A;  4B9K A;  2KN5 A;  2A4Z A;  3NZU A;  2FCS A;  2JVC A;  1ZGU B;  4EOY A;  2MP2 A;  4GXB A;  4HAZ B;  1E8X A;  4HJK A;  2K6D B;  3NOB A;  1TQZ A;  2MWN B;  4PYU A;  3TW1 A;  4A5K A;  4KHB B;  1FHW A;  3ZNI D;  2KGX B;  5JH5 C;  4HLE A;  4IM0 A;  4JL9 A;  2RUK B;  4BBN F;  2LGY A;  1IP9 A;  2FDQ A;  4DX9 0;  2OQB A;  4HAY B;  1KOT A;  2COD A;  1WJ1 A;  2PE6 B;  4ILH A;  2CKH B;  4GPT B;  2XK5 B;  4DHJ D;  5J17 A;  3PZD A;  2IYD B;  4E74 A;  2I1K A;  4Z2M B;  3ECI A;  3EC8 A;  4IAP A;  1U5E A;  2LI5 A;  2NZ8 B;  2MBB B;  4PS8 A;  1E90 A;  1NTI A;  2IYB A;  1K5G B;  4JKB A;  2Y5B B;  1V5O A;  4WSF A;  3NHE B;  4N9F 4;  2D10 A;  1XCG A;  4NAW A;  4HWI B;  2D9Y A;  2MBE A;  3B08 A;  2KWU B;  4AJY B;  4W9G A;  4TYZ A;  2BKF A;  3TVV A;  2K8B A;  2GCJ A;  3N30 A;  1RRB A;  3ZLZ A;  2ROV A;  2Z0Q A;  2D9W A;  4HCN B;  4PS7 A;  4ANW A;  5C23 A;  2W2W A;  2GJY A;  3DBL I;  1ZW7 A;  4HAW B;  2JP2 A;  4II3 B;  5IJM A;  4XC2 A;  4DDG D;  4KHO A;  2WX0 A;  4ICV A;  2ZNV B;  2LYD A;  1PQS A;  2MQJ A;  2B3A A;  2ZPN A;  1Z87 A;  2YSZ A;  3R66 C;  3APC A;  4K81 A;  2JWZ A;  2CY4 A;  3LJU X;  3HK0 A;  2N1W A;  3CF6 E;  4W9D A;  5DI9 B;  5KQ1 A;  2REX A;  4A6F A;  2DHZ A;  4B6W A;  1WF9 A;  1VCB A;  5JVL A;  4TV3 A;  2C7N B;  3DBS A;  4CYE A;  5IA7 A;  1WGH A;  3PSE B;  4Y94 A;  3MPX A;  2NBV B;  2OJR A;  3WAL A;  4EZJ A;  4B95 A;  1J8C A;  1EF5 A;  1PLS A;  5HKH A;  3IVF A;  3PT2 B;  1WJ6 A;  4WWO A;  2K8C A;  1ZC3 B;  2KDI A;  2GBN A;  1V5M A;  5BO4 B;  5CHV C;  1OQY A;  3PHW B;  2C7H A;  2JZZ A;  1ISN A;  1RJ2 A;  1VBH A;  3ONS A;  2N1V A;  3KYC D;  3LJ3 A;  1SE9 A;  2KQS A;  1H10 A;  3H6N A;  1NTV A;  2KTR A;  5EDS A;  2PZ1 A;  2RGF A;  2HTH B;  2IO3 B;  4HB3 B;  4MGY E;  1XQQ A;  1LB1 A;  3D32 A;  1DRO A;  3H7P A;  3WAP A;  1P5T A;  2DHI A;  3IG3 A;  1U27 A;  3FM8 C;  3ML8 A;  2CRF A;  4KVG B;  4RMA A;  3NSU A;  4DWF A;  4GU2 A;  3RYT A;  1Z2M A;  1WYW B;  2VSZ A;  3DBR I;  5D3Y A;  5J3Y A;  2L05 A;  4AUQ C;  3DQV A;  3A9J B;  2LOZ A;  2Z59 B;  3VH4 B;  4B6H A;  2KK8 A;  4WQO B;  1XR0 B;  1JDE A;  3HHM A;  3G9W A;  2D11 A;  3F0W A;  2CAY A;  3DPD A;  1C3T A;  3SYX A;  1E7V A;  2NR2 A;  4MEM A;  3PRZ A;  1K5D B;  1FXT B;  5LXH A;  4IM3 A;  2MDX A;  2ZEQ A;  1FHX A;  3ZKJ C;  4MSQ B;  1J0W A;  3ZDM C;  2BYE A;  2WX1 A;  2ZJD A;  3WA0 A;  2WYQ A;  5KQ4 A;  2P0H A;  4WJP A;  2KD0 A;  3SU8 X;  2KDB A;  4MGK E;  1V9J A;  3PV1 A;  4EZL A;  2WWZ A;  4KIK A;  2DYN A;  4NQK E;  2I1J A;  5FR6 A;  3PSC A;  2RLO A;  3M1I B;  2K1F A;  3VH3 B;  1ZVR A;  4NNJ B;  3APD A;  1P6S A;  1R4N I;  1BWN A;  2KMC A;  2FID A;  4W9E A;  4W9H A;  3QAQ A;  3TJP A;  4ANX A;  4HB0 B;  4I6L B;  3EPY A;  4EMO A;  3TIX A;  1HB6 A;  1KC7 A;  4ILG B;  2DKP A;  3Q3F A;  1YD8 U;  3KRW A;  3T06 A;  2K2J A;  4EKU A;  5L83 A;  1V61 A;  2LVQ A;  4CHJ A;  2BYF A;  2LVO A;  1WR1 A;  3OLM D;  2YS3 A;  3VQI A;  2K8H A;  4DK5 A;  3N7C A;  1WI0 A;  1WX9 A;  4HAX B;  3V5W A;  1WX7 A;  1UH6 A;  5D3W A;  4P7I A;  4LDT B;  1RRP B;  4D0N B;  5FI1 A;  2NVU I;  2MSE D;  2DFK A;  3K9P B;  1BTN A;  2MWS B;  3FSS A;  2LXA A;  4GDK A;  1AAR A;  2E2X A;  3FEH A;  5L95 C;  4WWN A;  4PYZ A;  3BY4 B;  1WM3 A;  2GBM A;  4ZYN A;  2GBJ A;  3IFW B;  2IZV B;  1DDW A;  4KAX B;  5HE0 A;  5DPR A;  4MY6 A;  2DYB A;  2VKI A;  1MIX A;  2LWP A;  1KM7 A;  2UVM A;  3V6C B;  3QC8 B;  3KZ1 A;  4KDI C;  4GDL B;  1XX0 A;  3SDL C;  5D2M B;  2AYO B;  2HJ8 A;  2IO1 B;  2YLM A;  4HAT B;  3PVW A;  1OGW A;  4MGI E;  4NJ7 A;  2KQ7 A;  3ZIM A;  1ACA A;  1Q0W B;  3A1Q B;  1YQB A;  3V60 A;  3QAR A;  2ELB A;  2FUH B;  1XKE A;  4WJQ A;  2C7M B;  4K7U A;  2M14 A;  3JSV A;  3R3M A;  3VUX A;  4OVU A;  1X05 A;  4NSW A;  3TL5 A;  2DHJ A;  3UF8 A;  4HPM B;  2GCL A;  2G4D B;  3OAW A;  4K2O A;  4BBN C;  4WJ7 A;  1IYF A;  2PEA A;  3SHQ A;  1NVL A;  3ZVR A;  3ZNH B;  2GBK A;  2WDT B;  4DHJ B;  1J19 A;  2LG1 A;  2N7E A;  4FUL A;  1X86 A;  1H4R A;  2AL3 A;  3QBV B;  2UWQ A;  1M7E A;  1H8C A;  2DZK A;  1JRU A;  1U5G A;  5E6O A;  1UGM A;  2GOW A;  2KFJ A;  1NU2 A;  4HCP B;  1WXA A;  5D27 A;  4F8C B;  1EGX A;  3A9K A;  1DIK A;  1TGZ B;  1T0Y A;  1TZ1 A;  1WH3 A;  4XZ4 A;  1R4M I;  3A4R A;  3TMP B;  3V61 A;  3MTN B;  1M94 A;  2O2V B;  4A6K A;  1WE6 A;  5GMV A;  3L17 A;  3OJ3 A;  1OMW A;  3KUD B;  1OQN A;  1WJM A;  2R82 A;  2YRY A;  2FNJ B;  2IBI B;  1WZ0 A;  3L54 A;  2CHZ A;  4W9C A;  4IC7 B;  1LM8 B;  3VAW A;  1V5T A;  3PRM B;  1KZ7 A;  2P0F A;  3AUL A;  2CHX A;  5AEK B;  1I42 A;  2RNR B;  1ZSQ A;  5EFX A;  4RM8 A;  1WIA A;  5AZH A;  4XWX A;  2DYO A;  4ILJ A;  1C1Y B;  1YX6 B;  5DPS A;  3NZS A;  3E9P A;  3PVU A;  3RUI B;  3VXW A;  4HHV A;  4EEW A;  1MPH A;  4JKA A;  1UBQ A;  3W1S C;  3M3J A;  1FGZ A;  3E9L A;  4M8N A;  2FIF A;  1MIZ B;  2COP A;  1CMX B;  4HVB A;  5DH9 B;  4ANV A;  2Q13 A;  1V81 A;  1BAK A;  5JLJ B;  3RUL A;  4MGZ E;  2XQN M;  4KSL C;  2MCN B;  4NAW B;  4AJW A;  4A20 A;  2KX0 A;  1W1G A;  3UIO B;  2IO0 B;  4EZK A;  2N0Y A;  3P2B A;  4F1S A;  2RSG A;  2RVB B;  1UNP A;  4FHJ A;  4KDL B;  2LKO A;  2BCJ A;  4DBB A;  1TJ6 A;  2ASQ A;  4MJS A;  3M63 B;  3P6A A;  4FAD A;  5DPW A;  1KZG A;  5JHB A;  3VTU A;  1WR6 E;  2D9X A;  1P3Q U;  3SBT A;  1KI1 B;  2G45 B;  1GC6 A;  2KJR A;  2QKL A;  4F7H A;  3UQB A;  3M62 B;  2DEN B;  3CST A;  4KSK C;  3QCA A;  1G6J A;  2NS5 A;  2KJH B;  3SNH A;  2H7E A;  3UIP B;  2KHW B;  3DOW A;  3EFU A;  1VBG A;  1MKE A;  3CIK A;  3VTV A;  4DXA B;  4A6F B;  2CB8 A;  1FOE A;  4JK9 A;  4H8S A;  3D8E A;  3JYU A;  1FAO A;  4K1R B;  3DVN U;  4OVV A;  3QWM A;  1WGR A;  3N32 A;  4ZRJ A;  5C79 A;  1MK7 B;  3SD5 A;  3E9O A;  4A3P A;  1Z5S B;  3AI5 A;  2FAZ A;  3DCG A;  3DVG X;  3AU5 A;  2DZI A;  2KWV B;  4ZRK A;  3VUW A;  1U4A A;  4HAV B;  2P8V A;  2CHW A;  5DHF B;  5JHG A;  4PS3 A;  1LW3 A;  3V62 A;  2NPT A;  3LDZ E;  2MKR A;  1I7A A;  2L8J A;  3ENB A;  3DVN V;  2JRI B;  4BKG A;  2L0F A;  3ZNG C;  5C16 A;  2NMB A;  2MLB A;  1V2Y A;  2KTR B;  1W1D A;  4JK8 A;  2LOX A;  2W2X C;  3WAO A;  3QWZ B;  2JF5 A;  2NBW B;  4JKC A;  3AJ4 A;  2K2U A;  2D07 B;  2DHK A;  4ANU A;  2DX5 A;  3VIA A;  1P1A A;  4F7Z A;  2K39 A;  2EC1 A;  3H7P B;  2L76 A;  5J3Q A;  4RM9 A;  2ELA A;  3A8P A;  2LVP A;  3EHV A;  1LFD A;  3VHT C;  4E3C A;  2ROZ B;  1F9J A;  3VUY A;  5KCV A;  1WGD A;  2Z0P A;  4MH0 E;  2N23 A;  2KTF A;  3ZTC A;  3U7D A;  3IBE A;  3DXC A;  1OEY J;  3W1S A;  1V5P A;  2O6V A;  1YJ1 A;  2L00 B;  2J59 M;  1V6E A;  2LZ6 A;  1QC6 A;  4LJP B;  1I35 A;  4BOZ B;  2QKM A;  2YS5 A;  1GNU A;  2ADZ A;  5LON B;  4CHM A;  5HE2 A;  2HE7 A;  3PRP B;  1IPG A;  4AWJ A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...