1NI2A

Structure of the active ferm domain of ezrin
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
296
structure length
296
Chain Sequence
PKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ezrin
publication title Structure of the Active N-terminal Domain of Ezrin. CONFORMATIONAL AND MOBILITY CHANGES IDENTIFY KEYSTONE INTERACTIONS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 80
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1ni2A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1ni2A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1ni2A01
3UIPB 3PHXB 2KFKB 2KDEB 5KHQA 3ECIA 3X23A 3ENEA 5EDSA 1MG8A 2JRIB 2V76A 3APFA 1FAOA 2LVPA 2CQUA 4AUQC 3R3MA 2BKRB 1S3SG 5HE0A 4KDLB 3IG3A 4W9LA 1WMHA 1YX5B 2AL6A 2FIDA 2ZVNA 2RVBB 5CX3A 5FR6A 1WRDB 3JW0X 2IO3B 1R4NI 4MY6A 2M17A 4W9IA 1FHXA 3CMMB 2M4NA 5IJMA 1LFDA 3NHEB 2JPHA 4CO7A 4URKA 1HB8A 5LONB 2KD0A 4X57B 4IWOA 2KHWB 1JRUA 3GOEA 4IWPA 4L6EA 5L83A 2D9XA 3UGBB 1OEYJ 2ZZPB 4W9DA 2K39A 2GCJA 4NQKE 3RYTA 5JHBA 1ZVRA 5DCNA 4K7WA 3VOQA 3VDZA 5FI0A 1UNQA 4KSLC 2BPSA 4ANXA 1V5MA 2YS1A 2K00A 3LDZE 4ZRKA 2KJ6A 2X18A 5EFXA 4KHAA 1NTIA 4DWFA 2I5FA 3M3JA 1OEYA 4ANVA 2D9ZA 3NOBA 1OMWA 3PV1A 5C23A 3KW5B 5JH5C 3L13A 2XBBC 5CTRC 4A5KA 1V89A 4M0WB 2KWUB 2GS0A 1Y5OA 1WX9A 2C60A 2PPHA 2NR2A 1U4AA 2FIFA 5D3XA 4A3PA 2E2XA 2DHKA 3WA0A 3A9JB 3PLVA 3TIXA 2CS4A 2IY1B 3AXCA 2Q13A 1IPGA 2UWQA 2WH5A 3DDCB 4EZJA 1Y19B 4K81A 3QQ8B 1H4RA 1NVLA 1AARA 1HB6A 3PSEB 1U5DA 1HE8A 2HJ8A 1D3ZA 2LZ6A 2MBBB 3ZNHB 1WXSA 1E7VA 4KZCA 2YS3A 3PVUA 4C0AA 2B3AA 1WE6A 3N7CA 1WI1A 1P5TA 2D10A 1SHCA 1Q5WB 2MP2B 3ML4A 3JVZX 4PS3A 2COFA 1KM7A 2LVOA 1X1FA 2A5UA 2LRWA 2KCJA 2XQNM 4MT7A 4D0NB 2BYEA 5J2RA 3OJ4B 1DDWA 1WJMA 3R7RA 1FHOA 2D2QA 1WXMA 3QHTA 2BKFA 1KOTA 4A3OA 1M7RA 3M63B 1WF9A 4W9EA 2FCSA 4WQOB 3JSVA 1PFJA 2JWZA 3TMPB 4IFSA 2YT1A 3ODWA 4JL9A 2ZPYA 3N3KB 2MFQA 2JRHA 3KZ1A 4KZ0A 1ZC4B 2HTHB 1ZW7A 2I1JA 1L2NA 2KMAA 4KAXB 1WGGA 3QBVB 3PSCA 2JY6A 5LLIA 3DQVA 2REXA 2COCA 2DAFA 5CHVC 4GDKB 1V5PA 3A8PA 1J8CA 2Z59B 2K6DB 2KANA 2L7RA 4Y94A 1LQBA 1GUAB 1W1GA 1MK7B 2KJHB 3SV1A 3M62B 1TTNA 3PRMB 3PLUA 1YIWA 3ZRFA 1ZSQA 1ZGUB 3UZTA 4W9GA 1P1AA 2K2UA 2W2XD 1UZXB 2DHZA 1WR6E 4KV2A 3V6EB 2GJYA 5D27A 2R2OA 1E8ZA 1IP9A 4I6PA 3SUZA 3PREA 3A98B 2DKPA 1L7YA 3O65B 4G0NB 1T0YA 2M8SA 4M8MA 2AL3A 2M0XA 3V5WA 1WR1A 5JP4A 1WJ4A 1UPQA 2KFKA 1SIFA 3ZDMC 2K25A 4FHKA 4I6NB 4I6LB 2N9EB 4HCNB 4NY0A 2PJHA 3P2BA 4AOFA 3GZNI 2ZCCA 1NTVA 2KC1A 4NJ7A 4HPMB 4ZYNA 2FCQA 4TUUA 3LJUX 1GJZA 4B6HA 2AWTA 2L00B 2W2WA 1PLSA 2JT4B 2LXAA 3CSTA 1XCGA 2MWNB 3VUXA 2EJ8A 3HIZA 1XX0A 2KFJA 1TBEA 2LD9A 4MSMB 1P6SA 4Z2MB 2DYNA 2LI5A 2RSUA 3DBSA 1DYNA 4WWPA 3PRZA 2NS5A 4HAXB 5HKHA 3KUCB 1U5GA 4AJWA 4LJPB 4K7SA 3MJWA 1EO6A 3IFWB 4M8NA 1I35A 5AZGA 4HCPB 2M1MA 2G3QB 1WYWB 1X11A 4AWJA 1WG7A 3L08A 1WZ0A 1W1DA 3UINB 2LXCA 1WGQA 4A6FA 4WJ7A 1GNUA 3A9KB 4CHJA 1M94A 2ABDA 3VH3B 2DYQA 2VRRB 2GBNA 2JVCA 2RQ1A 2EKEC 2N4FA 4TYZA 2MW5A 4HB3B 3SO6A 2CKHB 2PEAA 1KZ7A 3ZNID 1UGMA 2D9VA 3APDA 3DXCA 2Z0PA 2QHOA 1DDMA 2NCNA 3IBEA 5CLQB 1FGZA 3F5RA 2MBOA 1V49A 3QARA 2K8BA 5D2MB 2NZ8B 3ML8A 5J3TA 1Z5SB 3VQIA 4FADA 1J19A 1BTKA 1GC6A 2DZJA 4TQ0A 5D3WA 4II3B 2MBEA 2N9XA 1OQNA 2YS5A 1YX6B 3D8FA 4ZRIA 1DDVA 3WAPA 1A5RA 5D6JB 5C5BA 1WX7A 2ROVA 2C7NB 2O2VB 1AQCA 4EZLA 3V6CB 4WSFA 3PTFC 3W1YA 2ZJDA 5C1ZA 1WM2A 4K1RB 2JF5A 2P0DA 2RNRB 2MWSB 3MDBC 2MSED 2NMBA 1U2BA 3L10B 1RJ2A 4IM3A 3DCGA 2MP2A 3ZRCA 2LVQA 1P9DU 1V5OA 5FI1A 2KLCA 1EVHA 3H7SA 2KGXB 2MCNB 4DHZB 3M1IB 2YVCA 3BINA 1N3HA 3MTNB 2LGXA 2K8CA 1RRPB 1ST7A 2NBWB 1KJTA 1DROA 5D7GA 3VUWA 3D32A 4EKUA 2OQBA 4DHJB 4B95A 4BBNC 2PZ1A 3EFUA 5JHAA 4HB2B 1WIAA 1QQGA 4DBBA 4KVGB 1WGHA 3PGEA 4MELA 4HK2A 4KIKB 2DLWA 3H1UA 1W1HA 3NS8A 1E90A 1WJ6A 4GXBA 2M38A 1Q1OA 2VKIA 2KWCA 2RGFA 1X1MA 5CHFA 3HQCA 1XR0B 5DH9B 4W9HA 1I2HA 3P6AA 2HTHA 3EHVA 5BO4B 1WH3A 2IBIB 5G2NA 3VIAA 1X05A 4GDKA 2C7MB 3AU5A 3ZTDA 2UZSA 4A6FB 4BKTA 4KHOA 3KUZA 4DBGA 2YRYA 4FJZA 1I42A 4MM3A 4HAWB 5IAAC 1WE7A 2N7DA 3WALA 2MLBA 2XK5B 3WAOA 2LRUA 2FAZA 3PVWA 2ZNVC 4H8SA 2J0JA 4NAWB 3VFKA 4FA6A 2NBUA 4MGZE 2L3ZA 3ULCA 3EPYA 1WM3A 2G35A 4E3CA 5LXIB 4GIVA 1Q0WB 5JZEB 3SHQA 2MRPA 4IW0A 3SYXA 2JZ3B 4FULA 1GG3A 4JGHB 3NSUA 5E6PA 4W9FA 2KDFB 1WFYA 4RM9A 3FM8C 1C3TA 4GB9A 2HE7A 3FEHA 3G9WA 3EECA 3A4SC 2YT0A 1TGZB 5C6RA 2BYVE 2DN6A 4BVUC 1TQZA 4GMVA 4RMAA 1XKEA 2OJRA 2R2QA 2MDXA 5C5BB 2N1WA 4F7GA 2BCJA 3A8QA 4ZRJA 2J7QB 2A4ZA 3PPAA 3L17A 1DBHA 3VTWA 1E8YA 4FBJB 1WGDA 2G45B 3DBLI 2GBJA 1V88A 4KHBB 3KVFB 4G50A 1WX8A 2YF0A 5HE2A 2D4QA 3ZLZA 3X0WA 4HDQA 1NTYA 3DVGY 5J17A 4XZ4A 1P98A 1OTRB 3QJZA 1J0GA 2GBMA 5CLLB 2KDIA 2WWZA 5LOPB 4F7HA 3U30A 1S1QB 1WXAA 1X1GA 1WGRA 2ELBA 2LULA 2DYMA 1MKEA 1P3RA 4E74A 3A9KA 4F7ZA 4DX90 2YLMA 2N1VA 5DHAB 4LDTB 2J0MA 4RM8A 1LB1A 2WYQA 2ADZA 3OANA 2I1KA 3DXEA 5DPSA 3NZUA 1UNPA 3UIOB 1OGWA 1V80A 1WGUA 3ZNZB 3H9DA 4WJOA 2DKQA 3TCAA 4XC2A 3HK0A 1OQYA 2M14A 2P0HA 4LJOB 2KUPA 2C7HA 4YONA 2DYBA 2QKLA 3RZWC 2DZMA 4DHJD 2MBQA 1K5GB 2H7EA 5HE1A 4PYZA 2CB8A 4WJQA 1UEFA 3BY4B 4Z2NA 2LGYA 3TBLD 4NNJB 1WZ3A 2VSZA 2ZVOA 2CHWA 2O2VA 3DOWA 1FGYA 5D94A 5TR5A 3ML9A 2DX5B 4HAZB 2BF8B 3SNHA 3V61A 4GDLB 4IG7B 3DXDA 3ZKJC 2HRJA 3JYUA 2KC2A 3VHTC 2R0DA 2LUEA 4KDIC 2RGNB 4GZUA 3KUDB 4PS8A 3EC8A 1J0WA 2KTRA 1Z2MA 1E7UA 4GMXB 1V2YA 3QAQA 4EUTA 2N23A 4EJNA 1B55A 4IAPA 3Q3FA 4HXDA 1E8WA 2DFKA 3KYDD 4FN2A 1VCBA 4BKGA 2ZNVB 4DHZE 1YQBA 3DVNV 2KLGA 1SE9A 3QWMA 3N30A 4F1SA 1FXTB 4KIKA 4CYEA 2P8VA 4GPTB 5DPTA 3VTUA 1ACAA 1MAIA 3UQAA 4IM2A 1UBIA 3HM6X 3PEGA 4P7IA 1LXDA 2OTXA 2LOZA 4HJKA 3HW2B 2I5CA 3RCPA 2N9PC 1XT9B 4A20A 4DX8A 5AEKB 3ZDTA 1XQQA 3W1SC 4MGIE 3KSYA 4WWNA 2BYFA 2XK5A 2LWPA 1EUVB 4BKSD 3LJ3A 3PG7A 2BWFA 2FUHB 3TW1A 2FCMA 2K1FA 2CHZA 4BFRA 4NAWA 3QA8A 3R7QA 2LKOA 4LCDE 3GYPA 3PZDA 5JHHA 4BOSC 5GMVA 2D11A 4HAYB 5KHOA 1V5UA 2DZIA 3S2AA 2O6VB 3MPXA 2Y7BA 2DENB 1ZM0A 4HPLB 3IVFA 1ZC3B 2IZVB 2DHIA 2MQJA 5JLJB 2VRWB 3KY9A 2WX1A 2WDTB 3PP2A 4HHVA 3D8EA 1LM8B 4F8CB 1EF5A 1UELA 1WI0A 3OLMD 4GU2A 1IRSA 2J59M 2GMIC 3SDLC 1Q67A 1V81A 4TV3A 5C79A 1UPRA 3BJIA 2GOWA 2GCLA 1G6JA 4N9F4 4J6IA 3NY5A 3W1SA 4BKSA 1U5EA 5J3YA 2OOBB 3ODOA 4WWOA 2FJLA 4IWQA 4LDTD 2Y8GA 2CU1A 4IM0A 3DVNU 3WANA 3ZTCA 3A1QB 4EFOA 4JLCA 2W9NA 2KTRB 3U8ZA 3VAWA 3D8DA 1SGHA 3ULBA 4A6HA 1TZ1A 2ZPNA 4HAVB 4MEMA 4YL8A 1CMXB 1EGXA 2Z0DB 1V6EA 1U29A 3RD2A 1MIXA 2DX1A 5KQ4A 1WJ1A 3WYFB 5DHFB 4FJVB 3T9LA 5KCVA 5E6OA 3TVVA 3FSSA 3K9PB 3WAMA 2L05A 2LGDA 3AI5A 4WJPA 2C9WB 3HM3A 1XD3B 4CHKA 4MGKE 1RRBA 1RAXA 3L0WB 4F7UP 4MDKE 2K2JA 3R66C 3L54A 2V3SA 1EF1A 2Z0EB 3CSFA 3H6NA 2MBHA 2R09A 3VVWB 4KSKC 5JHGA 1NI2A 3V60A 2D9WA 3NZSA 3PHWB 1KLVA 4GSWA 2JUOA 4EEWA 4NQLB 2FDQA 1U27A 2WX0A 2IYDB 2G4DB 1RLFA 3FLVA 2L0TA 2RLOA 2YSZA 3TL5A 1KI1B 1AWEA 2Z0QA 4XX5A 5KQ1A 3ZUNA 4MSQB 3HHMA 3QWZB 4MH0E 3ZW3A 5L81A 1VD2A 5C16A 2H7DA 3OJ3A 3CIKA 2KWVB 3KRXA 3AJ4A 4K2PA 3ZVRA 1TJ6A 3H7PB 2IO2B 4W9KA 4K17A 2V4LA 3VTVA 2CHXA 3VXWA 1MIZB 1K8RB 3VH4B 3RZFA 5D3YA 2RD0A 3Q3JA 2DX5A 1WGYA 4GDLA 4GOCA 4NJ6A 2L2IA 1EAZA 2RR9A 1YJ1A 2ZCBA 2AYOB 1NDDA 2NPTB 3TFMA 1V86A 4II2B 3PVLA 4MJSB 5E6NA 5AZHA 2DA0A 4PS7A 3ZIMA 2RUKB 2DYOA 2LBBA 1QC6A 4WJNA 1H10A 2LJ5A 2COPA 1M7EA 2CY5A 4PQ0A 1ZKHA 2O6VD 1WVHA 2COAA 2L1CA 2DHJA 3QX1A 2V1YA 2D9YA 2KQ7A 3VUYA 4B6WA 1ISNA 4EMOA 3B08A 4DXAB 2MX2A 4EOYA 1WXVA 3MHSD 5L95C 5HE3A 1YD8U 4E71A 3PT2B 2KOXA 3T8MA 1WMHB 2CY4A 1FHWA 4BOZB 2FJ9A 3PRPB 2KDBA 2KN5A 2JP2A 2PE6B 4WVFB 1C1YB 1GC7A 2J0KA 2N0YA 4PYUA 1V9JA 4TQ1A 3U7DA 3ZVVA 1TXDA 4XWXA 2Z0OA 2CAYA 4G11A 2ROZB 3I3TB 1UNRA 2DAJA 2KX3A 1Z87A 3L16A 2QKMA 3ALBA 2IYBA 1IYFA 4MK0A 4HLEA 2O6VA 3UQBA 2IY0B 4GN1A 2EMSA 2UVMA 4K7UA 1X86A 4DDID 4NPNA 4DDGD 4PNKA 4HB0B 4W9JA 3IHPC 1UBQA 4JIOU 1E8XA 4BBKA 5D3VA 2FCNA 4MGYE 3PS6A 4K2OA 3K9OB 3AU4A 1V61A 1U5FA 2NVUI 4IC7B 1Y8RC 3A33B 1XODA 2P0FA 2HD5B 2RSGA 3QIJA 2JZZA 2LASA 3B0AA 1P3QU 3OAWA 4ANUA 2W2XC 1I7AA 1P0RA 2C5LC 2BWES 1XD4A 3V62A 4CHMA 3TJPA 4BBNF 3RUIB 3N32A 5J18A 1PQSA 3O96A 3GYOA 5AZFA 1WY8A 2KK8A 4AJYB 4ASWC 2EMTA 1BWNA 4FLHA 3A1QA 4ICVA 2G4SA 2JXXA 1WJNA 3TO1A 2XEWA 3RCZA 4JQWC 2L8JA 4OVUA 4IUMB 1MPHA 4HDOA 4OVVA 5CHWA 1F9JA 4ZDVA 3ZNGC 4HAUB 1QZEA 3RT3B 3SD5A 2CR5A 2DTCA 4IOYX 4FJYA 2KXJA 2UZRA 2K6QA 5IA7A 3KYCD 3WIMA 1FOEA 5G55A 1UH6A 2GBRA 5DI9B 1K5DB 2D07B 3M95A 2Y8FA 4G3XB 4WAAA 2KNBA 2ELAA 2NBVB 1BT0A 2L0FA 2ZEQA 1BAKA 2MA9B 2UYZB 2KZRA 3C0RB 3SU8X 3DVGX 4A6KA 2KO3A 4ICUA 5DIFB 2D3GA 2MKRA 1BTNA 2ASQA 3ONSA 3JSVB 3QCAA 5DPRA 4DK5A 4AP4C 3DBHI 2KX0A 2LG1A 2PE9A 1KZGA 3AULA 1PMSA 3QC8B 4EZKA 5GOWB 1V5TA 3DPDA 4HB4B 3H7PA 2CODA 2GBKA 4W9CA 3A4RA 2N7EA 2AEHA 3T06A 2EC1A 4FHJA 1LW3A 2DZKA 1RFAA 5J3QA 1NBFC 2K8HA 4ANWA 1WJUA 1NU2A 3APCA 3FP5A 2KKCA 3UF8A 3CF6E 2BGFA 2KTFA 2CRFA 3P7ZA 5LXHA 2IO0B 2IO1B 1OY2A 1HBKA 1MK9B 3RULA 1H8CA 2RPQA 4GGQA 2LYDA 4B9KA 1UD7A 4HATB 2KJRA 2NPTA 2KMCA 3DBRI 3A9JA 4TKNA 4MJSA 1R4MI 3B1LX 2Y5BB 2IFSA 1FB8A 3KRWA 4HVBA 2KQSA 2LOXA 3CXBB 3QK0A 3ZO5B 3KH0A 4HWIB 4NSWA 2L76A 5DPWA 3F0WA 2FNJB 1E5WA 2KVRA 3ODXA
chains in the Genus database with same CATH superfamily
3UIPB 3PHXB 2ICIA 2KFKB 2KDEB 1L4ZB 5KHQA 2LJIA 3ECIA 3X23A 3ENEA 5EE3A 5EDSA 1YJJA 2V9HA 1MG8A 1N6ZA 2JRIB 2V76A 1ACCA 3APFA 1SJED 2WXKA 1FAOA 2LVPA 4RNAA 2CQUA 4AUQC 3R3MA 1FCLA 2BKRB 1S3SG 5HE0A 4KDLB 3IG3A 4W9LA 4AS1A 1WMHA 1YX5B 2AL6A 2FIDA 2WXGA 2ZVNA 1C79A 2RVBB 5CX3A 5FR6A 1WRDB 3JW0X 2IO3B 1R4NI 4JK7A 2OJWA 4MY6A 2M17A 4W9IA 1FHXA 3CMMB 2M4NA 5FK9C 1FNWA 5IJMA 1LFDA 1YOVB 2KQ4X 3NHEB 4N59A 2JPHA 4A9AA 2WXPA 2QILA 2JWUA 4CO7A 4URKA 1HB8A 5LONB 4KKJA 4MT5A 2KD0A 4X57B 4QJ5B 4IWOA 2KHWB 1I4GA 1JRUA 3GOEA 4IWPA 4L6EA 5L83A 2D9XA 1SBBB 3UGBB 1OEYJ 2ZZPB 4W9DA 4A6QA 4B0MA 2K39A 1FM0D 2GCJA 4NQKE 3RYTA 1E0ZA 3T3OA 5JHBA 1PGBA 2I2YA 1ZVRA 5DCNA 4K7WA 3VOQA 3VDZA 5FI0A 1KLUD 2K3UA 1UNQA 4KSLC 2BPSA 2J53A 3P63A 4ANXA 1V5MA 1D5XC 2YS1A 2K00A 1KH0A 3LDZE 4ZRKA 2KJ6A 4ILHA 2WHIA 4ILGB 2BW2A 5I2SA 1Y56A 2KAJA 4LNNA 2CJOA 5EE1A 3HUIA 4RGMA 2X18A 5EFXA 4KHAA 1NTIA 3LB8C 1AWDA 4DWFA 2I5FA 5FKAC 1MHHE 3M3JA 3Q8EA 2W3RA 4HROA 4REZA 1OEYA 1VZ8A 4ANVA 4XE0A 2D9ZA 3NOBA 2V0GA 4ILJA 1OMWA 3AECB 3PV1A 5C23A 2LUMA 3KW5B 5JH5C 3ZJUA 3L13A 2XBBC 5CTRC 1PUTA 4A5KA 4OT1A 1L0XB 1QF6A 1V89A 4M0WB 2KWUB 5IN7A 2GS0A 2ZW1A 3RPFC 4JWUC 3NWDA 3PZ7A 1Y5OA 1WX9A 4JK8A 1VJKA 2C60A 1ESFA 2PPHA 2NR2A 1U4AA 2FIFA 5D3XA 4A3PA 2E2XA 4KGRA 2DHKA 3AE3B 3WA0A 5C3JB 3A9JB 3AE4B 3PLVA 3TIXA 2CS4A 2IY1B 3AXCA 2Q13A 1IPGA 1FXAA 2UWQA 1N5XA 2WH5A 1WYGA 3DDCB 4EZJA 1Y19B 4K81A 3QQ8B 1H4RA 1NVLA 1AARA 2BS3B 2KWDA 1HB6A 3PSEB 1U5DA 1HE8A 1YMHE 2HJ8A 1D3ZA 2LZ6A 3W9CB 2MBBB 3ZNHB 1ZDXA 1ZUD2 5IKCM 1WXSA 1NVID 1E7VA 2WXRA 3AEFB 2RMMA 4KZCA 1N63A 2YS3A 3PVUA 2FBWB 4C0AA 2B3AA 4JKBA 1MJDA 1WE6A 3N7CA 1WI1A 1P5TA 4RGNA 2D10A 1SHCA 2ON8A 1Q5WB 2MP2B 3BWUD 3ML4A 2LFIA 3JVZX 4PS3A 2COFA 1KM7A 1YN5A 4P1CC 2LVOA 1KC7A 1X1FA 4HJGE 1UWXA 2A5UA 2PLPA 4ZOHC 2LRWA 5H8YE 4P1BC 3URYA 2KCJA 4OHJA 2XQNM 4MT7A 4D0NB 1JW9D 2BYEA 2NMQA 2AQ2B 3B9JA 5J2RA 3OJ4B 1DDWA 1WJMA 3R7RA 1FHOA 3Q6BA 1TIFA 2D2QA 3IT4B 2K8EA 1WXMA 1E10A 3QHTA 1BUIC 2BKFA 1KOTA 4A3OA 1M7RA 2B76B 4OW0A 3M63B 1WF9A 4W9EA 2FCSA 1OFFA 4WQOB 2JX5A 3JSVA 1PFJA 2JWZA 3TMPB 4IFSA 2YT1A 3OHMB 3HVDA 1JCKB 2Z13A 2INCC 3ODWA 4JL9A 3EUB2 2ZPYA 3N3KB 2MFQA 2JRHA 4C4VA 3ZJTA 3KZ1A 1SSNA 3Q8AA 1DOXA 3ABVB 4KZ0A 1JROA 1TYGB 2LHEA 1ZC4B 2HTHB 1ZW7A 2I1JA 4YSZB 2AX5A 1L2NA 2KMAA 4KAXB 1WGGA 3QBVB 3PSCA 3V3XA 4RFBA 2JY6A 5LLIA 4L23A 3DQVA 2REXA 1UWMA 1XF5L 2COCA 2DAFA 5CHVC 3NWFA 1L4DB 2DWQA 4GDKB 1GOZA 1V5PA 3A8PA 3E9PA 1J8CA 2Z59B 2WGSA 4MM3B 2K6DB 2KT7A 2KANA 2L7RA 1TT5B 4Y94A 1LQBA 1GUAB 1W1GA 1MK7B 2KJHB 3SV1A 1HZ6A 3M62B 1TTNA 3PRMB 2MJEA 3PLUA 1YIWA 4JKFA 1ZOYB 2LHDA 3ZRFA 1ZSQA 1ZGUB 3UZTA 4ARIA 4W9GA 1P1AA 2K2UA 2JXTA 2PKOA 2W2XD 1UZXB 2WDRB 4C7ZA 2DHZA 1JRPA 1YN4A 1WR6E 1RYJA 2X38A 4YSXB 2RDBC 4KV2A 3V6EB 2GJYA 5D27A 2R2OA 3RNCC 1E8ZA 1IP9A 4I6PA 3SUZA 3PREA 3W5VB 3A98B 1FNUA 1KFYB 2DKPA 1L7YA 3O65B 4G0NB 1T0YA 3BK2A 2PMVA 1MI1A 2M8SA 4M8MA 2AL3A 2M0XA 3V5WA 1WR1A 5JP4A 1WGKA 1WJ4A 1UPQA 2KFKA 1SIFA 3ZDMC 2J4XA 2K25A 4FHKA 4I6NB 4I6LB 2N9EB 4RCOA 3WCQA 4HCNB 4ACFA 4NY0A 2PJHA 3P2BA 4M01A 2X8XX 4AOFA 3GZNI 4XWWA 1C77A 3EA6A 2ZCCA 1NTVA 2KC1A 4NJ7A 4HPMB 1FD6A 1SXTA 4ZYNA 1LGRA 1FNVA 2FCQA 3C8YA 3FILB 1N61A 3RNEC 4TUUA 3LJUX 1GJZA 4B6HA 2AWTA 2L00B 2W2WA 1NYQA 1PLSA 1JQ4A 2JT4B 2KVZA 2LXAA 3CSTA 1XCGA 2MWNB 3VUXA 2EJ8A 3HIZA 1XX0A 2KFJA 2BVCA 1TBEA 1SE2A 2LD9A 4MSMB 1P6SA 4Z2MB 2DYNA 4JPSA 2LI5A 3IAM1 2BB6A 4RF1A 2RSUA 3DBSA 1DYNA 4WWPA 3PRZA 1T6BX 2NS5A 4HAXB 5HKHA 3KUCB 1B9RA 3OWEB 4QJ4B 1U5GA 2BT6A 2CJNA 4AJWA 1VZ6A 4RF0A 4LJPB 4K7SA 3MJWA 1EO6A 3IFWB 4M8NA 2K0PA 1I35A 1JALA 3TEZA 5BYQA 5AZGA 2ZW0A 4JKEA 2N9LA 3MJ5A 4HCPB 2M1MA 4UDUC 2G3QB 1WYWB 1BXTA 1X11A 4AWJA 1WG7A 1C4CA 3L08A 1WZ0A 1W1DA 3UINB 2LXCA 2IDYA 1RWSA 1WGQA 4IOIE 5IP4D 4A6FA 1SB3C 1ET6A 4WJ7A 1GNUA 1T0RC 2GB1A 3A9KB 4CHJA 1M94A 2Q5WD 1NI3A 1NYRA 3MC9A 4C4VB 2ABDA 2W54A 2Z14A 3VH3B 3IT6B 2DYQA 2VRRB 2GBNA 2JVCA 3P4RB 2RQ1A 2EKEC 2N4FA 2D3AA 4TYZA 2MW5A 1DIKA 1E9MA 4LNIA 4HB3B 3SO6A 2CKHB 2PEAA 3O13A 1KZ7A 2KIGA 1T77A 3ZNID 1UGMA 1ZPSA 3MC0B 4JKGB 2D9VA 3APDA 4M0WA 3DXCA 2Z0PA 4HRSA 1FRRA 2QHOA 1DDMA 2NCNA 3ZXVA 2MJDA 1JWSD 2DBYA 1L6UA 3IBEA 5CLQB 1FGZA 3I5JC 3LXFA 3F5RA 2MBOA 3AB5A 3N1YC 1V49A 1J7CA 3QARA 1L5PA 2K8BA 3BYTB 1ZYIA 4GLSC 5D2MB 2NZ8B 1P7FA 3ML8A 1C4AA 5J3TA 2R61A 1Z5SB 3VQIA 3KLSX 4FADA 1J19A 1BTKA 1GC6A 2DZJA 4TQ0A 5D3WA 4J3OD 4II3B 2QCZA 2G1EA 2MBEA 2N9XA 1OQNA 2YS5A 3W2DA 1YX6B 3D8FA 3SBGA 4ZRIA 1DDVA 3WAPA 2ONQA 3V05A 1A5RA 5D6JB 5C5BA 3DWMA 1WX7A 2ROVA 1QQRA 2BB5A 5TSSA 2C7NB 2O2VB 1TY0A 1AQCA 4EZLA 1QOGA 1SIJA 4IDIA 3V6CB 4WSFA 3PTFC 3W1YA 3HVZA 2ZJDA 4S17A 1NENB 5C1ZA 1WM2A 2D3BA 4K1RB 2JF5A 1MVKA 2P0DA 2RNRB 2MWSB 3MDBC 5LNK1 1D6EC 2L52A 2MSED 1TS3A 2WXMA 1FCCC 2NMBA 1U2BA 4KGSA 2QDFA 3L10B 3Q3MC 2V3NA 2JYEA 4YT0B 1RJ2A 4KHBA 4IM3A 3DCGA 2MP2A 2WS3B 3ZRCA 3NUHB 2LVQA 1P9DU 1T0SC 1HXYD 1V5OA 1WSPA 5FI1A 2KLCA 4L1RA 1EVHA 2K5PA 3H7SA 2KGXB 2MCNB 1MG4A 4DHZB 3M1IB 2YVCA 3BINA 1N3HA 3MTNB 2FUG1 2LGXA 2K8CA 4DIXA 1RRPB 1ST7A 3DCXA 1A70A 2MH7A 4JKDA 1KJTA 1DROA 2NBWB 5G5HA 5D7GA 3VUWA 3D32A 4EKUA 2OQBA 4DHJB 1PGAA 3FKYA 4B95A 4BBNC 3VR9B 2PZ1A 3NVZA 3AE7B 3EFUA 5EE0A 5JHAA 1R7SA 4HB2B 1WWTA 3AN1A 3GP7A 1WIAA 1I4XA 2BQQA 1QQGA 3R2TA 4DBBA 4KVGB 1C76A 1J7BA 1VDVA 1WGHA 4RGOS 3PGEA 4MELA 4HK2A 4KIKB 2DLWA 2CU3A 1CQVA 1FFVA 2HDEA 3H1UA 1W1HA 3NS8A 1E90A 1WJ6A 4GXBA 1F1HA 2M38A 1Q1OA 2VKIA 2KWCA 2RGFA 1X1MA 5CHFA 3FC4A 3AEDB 3HQCA 1SE3A 1XR0B 5DH9B 5AUIA 4W9HA 1I2HA 5HFYA 3P6AA 3ZGZA 1AYFA 2HTHA 3EHVA 2IGGA 2W3SA 3DHHC 3P4SB 4A90A 5BO4B 1WH3A 2IBIB 2WXHA 5G2NA 2Y3AA 1L0YB 1D5ZC 4IKGA 3VIAA 1X05A 4GDKA 2C7MB 3AU5A 3ZTDA 2UZSA 1YNTE 4A6FB 4BKTA 4KHOA 3KUZA 2JYTA 4DBGA 2YRYA 4FJZA 1I42A 1K50A 2Z59A 4MM3A 4HAWB 5IAAC 1WE7A 2N7DA 3WALA 1E7PB 2H88B 2MLBA 4XDDA 2XK5B 1D5MC 3WAOA 2LRUA 2FAZA 2V3PA 3SEBA 3PVWA 3AE8B 2VH1A 2ZNVC 2M56B 3TSSA 4H8SA 2J0JA 4NAWB 3VFKA 4FA6A 3TEYA 2NBUA 4D2KA 4MGZE 2L3ZA 3ULCA 3EPYA 1WM3A 4GNKB 3ENBA 2G35A 4E3CA 5LXIB 2WU5B 4GIVA 2KMMA 4FXCA 1Q0WB 5JZEB 2OHFA 1VBHA 3SHQA 2MRPA 3MFGA 4IW0A 3SYXA 2JZ3B 4FULA 1GG3A 4C00A 4JGHB 3NSUA 5E6PA 4US9A 3AH7A 5E6JA 4W9FA 2KDFB 1V1OA 1WFYA 4RM9A 3FM8C 1CK1A 1C3TA 4GB9A 2HE7A 3FEHA 3G9WA 3EECA 3DWGC 3A4SC 2HTME 2M19A 2YT0A 1TGZB 1XO3A 3RN9C 4TMAB 2JZPA 5C6RA 2BYVE 4N58A 2WXFA 2DN6A 3Q69A 4BVUC 1TQZA 4GMVA 4RMAA 1XKEA 2OJRA 2R2QA 2MDXA 1F77A 4RGTA 5C5BB 1TZOA 2N1WA 2SAKA 4F7GA 3HIEA 2BCJA 3FILA 3A8QA 3E9OA 2INPE 4ZRJA 2J7QB 2A4ZA 3PPAA 3L17A 3H8HA 1N60A 4YXDB 2PVOD 2GI9A 1PFDA 2BS2B 3Q3NC 4WWMA 1DBHA 4USAA 3VTWA 1E8YA 4FBJB 1WGDA 2VH2A 2G45B 3DBLI 2GBJA 1V88A 4KHBB 3KVFB 4OZAA 4G50A 4ITKA 1WX8A 3N9YC 2YF0A 5HE2A 2D4QA 3ZLZA 1RM6C 3X0WA 4HDQA 1NTYA 1KLGD 2Z8LA 3DVGY 4M02A 3DHGC 5J17A 4DXGA 4XZ4A 1P98A 1OTRB 3QJZA 1J0GA 3P42A 2GBMA 2H89B 5CLLB 2KDIA 2WWZA 5LOPB 5LG4B 1TKYA 4F7HA 2Y5CA 4YTPB 3U30A 2WXLA 4OSNA 1S1QB 4P6VF 5BYSA 1WXAA 2W55A 3AMZA 4MH8A 1KRHA 3U2SC 1X1GA 1WGRA 2ELBA 2LULA 2DYMA 1MKEA 1I4RA 1P3RA 4E74A 3A9KA 4F7ZA 4DX90 2YLMA 3BYYB 4L1BA 5GXGB 2Z4DA 2N1VA 2WXJA 3BVMA 5HHDG 3NVVA 1LO5D 5DHAB 4QAYA 4LDTB 3GS2A 2J0MA 4RM8A 1LB1A 2WYQA 2ADZA 3OANA 5AUKA 2I1KA 3DXEA 5DPSA 2LGIA 3NZUA 3ZYYX 1UNPA 3B77A 3UIOB 1OGWA 4JKGA 1V80A 1TJEA 1WGUA 1GB4A 1RFKA 3ZNZB 3H9DA 2IPKD 4WJOA 2DKQA 3TCAA 4XC2A 3U4EG 3HK0A 1XEEA 1OQYA 3SR6A 2M14A 2X0SA 2P0HA 4LJOB 4KGTA 4NZLB 2KUPA 2C7HA 2E3TA 3AV8A 4OZBA 4YONA 2DYBA 2PIAA 2QKLA 3AE1B 3RZWC 4PT5A 2DZMA 4DHJD 4KX6B 4S0RA 1EWYC 4WURA 1FIQA 2MBQA 1K5GB 2H7EA 5HE1A 4PYZA 2CB8A 4WJQA 1UEFA 3BY4B 2WXOA 2XN9C 4Z2NA 1V8CA 2FJUB 3AEBB 2LGYA 2W82A 3TBLD 1UNSA 4NNJB 3HSAA 2KUQA 1WZ3A 4CSQA 1B1ZA 2VSZA 1ZXHA 5BMIA 1XCQL 2ZVOA 2CHWA 2O2VA 3E66A 1ET9A 3DOWA 1FGYA 5D94A 5TR5A 3ML9A 2DX5B 2G9HD 4HAZB 2BF8B 3SNHA 4QXAB 3V61A 4GDLB 3BZDB 4IG7B 3RNBC 4ZHOA 3DXDA 1D4BA 3ZKJC 5JXVA 2HRJA 3JYUA 3NW8A 1HTOA 2KC2A 4P16A 3VHTC 2R0DA 4WAFA 2LUEA 4KDIC 2RGNB 4GZUA 2L83A 3KUDB 4PS8A 3EC8A 1J0WA 3DHIC 1QOBA 3RNFC 2KTRA 1QLBB 1SJHD 1Z2MA 2KIEA 1E7UA 4GMXB 1V2YA 3QAQA 3U7ZA 3Q8CA 4EUTA 2N23A 3ZQ4A 4DXFA 4EJNA 1B55A 1YN3A 4IAPA 3VR8B 3Q3FA 4HXDA 1E8WA 2DFKA 3KYDD 4FN2A 1VCBA 4BKGA 2ZNVB 2UU7A 4DHZE 1YQBA 2WLBA 3DVNV 4JE3B 2GLSA 2KLGA 4WH4A 5HI1A 1SE9A 4H2AA 4WIPA 3QWMA 3N30A 1FFUA 2JSVX 2SEBD 2QEJC 1ZP0B 1I4PA 2D5GA 2TSSA 4YSYB 4F1SA 2AQ1B 1VRAB 1FXTB 4KIKA 4CYEA 2P8VA 4GPTB 5DPTA 4ZRQA 3VTUA 1ACAA 4C7YA 1MAIA 1OQRA 3GZNB 3UQAA 2ZKMX 2WXIA 4IM2A 3NWAA 1K52A 3RNAC 1UBIA 2BS4B 3HM6X 3PEGA 4XDCA 1GB1A 4P7IA 1LXDA 3BVGA 2OTXA 4HEA1 2LOZA 4HJKA 1PDXA 3HW2B 1MHXA 3P1MA 2RDHA 2I5CA 3RCPA 2WDQB 3NG0A 2NTSA 3AM9A 4DQOC 1ENFA 2N9PC 1MFWA 1XT9B 4A20A 4DX8A 3FVCA 5AEKB 3ZDTA 2GUMA 1XQQA 2BBCA 3W1SC 4JKHA 4MGIE 2YEPB 4OVZA 1TS2A 3KSYA 5BMGA 4WWNA 2BYFA 2XK5A 2LWPA 4R3DA 1EUVB 4BKSD 3LJ3A 3PG7A 2BWFA 2FUHB 3TW1A 5D3IB 2FCMA 1FMAD 4LNFA 2K1FA 2CHZA 4BFRA 4NAWA 3QA8A 1V97A 3SBTA 3R7QA 2LKOA 1XLNA 3GYPA 1VLBA 4LCDE 4C80A 3PZDA 5JHHA 5IOIA 4BOSC 5GMVA 2D11A 4HAYB 1F2RI 5KHOA 1V5UA 2DZIA 1AW7A 3S2AA 2O6VB 3MPXA 2Y7BA 2DENB 1ZM0A 4HPLB 3IVFA 1ZC3B 2IZVB 2DHIA 2MQJA 3VRAB 5JLJB 3Q8FA 2VRWB 2WXNA 3KY9A 2WX1A 2WDTB 4WQMA 3PP2A 3AE5B 2YEPF 2EELA 4HHVA 3DBHB 3D8EA 1LM8B 2KN4A 4LTUA 1EF5A 3SFEB 1UELA 1MPEA 1WI0A 3OLMD 4F8CB 4GU2A 2N0SB 3R2IA 1CJEA 4M00A 1IRSA 1HTQA 2J59M 1VZ7A 2GMIC 4ARCA 3SDLC 3Q8BA 1TKEA 1Q67A 1V81A 4TV3A 3AEGB 4K3CA 4ZHPA 5C79A 1UPRA 3BJIA 1E6EB 2GOWA 2GCLA 4MACA 4XWTA 1G6JA 4N9F4 4EE2A 4J6IA 1DYQA 3NY5A 5T8IA 3Q14C 3W1SA 3MHZA 3KWLA 4HKZE 2IJ0A 4A8XC 4BKSA 1U5EA 5J3YA 2OOBB 3ODOA 4WWOA 2FJLA 5H92C 4IWQA 2M0AA 4LDTD 4L2YA 2Y8GA 1L0VB 2QMTA 4QJ3B 2CU1A 4IM0A 2WQYB 3DVNU 3N1XC 4RH6A 3WANA 3DBRB 3ZTCA 3TEXA 3A1QB 1R4MB 3LYYA 4JLCA 4EFOA 2W9NA 2KTRB 3U8ZA 1QKZA 3VAWA 3D8DA 1SGHA 3ULBA 4A6HA 1TZ1A 2ZPNA 4HAVB 4MEMA 4YL8A 5IO9A 1CMXB 1EGXA 2Z0DB 3RNGC 1V6EA 1U29A 1UUPA 1MIXA 3RD2A 3AE2B 2DX1A 1CZPA 1J7AA 4XYCA 5KQ4A 1WJ1A 3WYFB 4JWSC 5DHFB 1IGCA 4FJVB 3T9LA 5KCVA 2WNMA 3TVVA 3FSSA 3K9PB 5E6OA 3WAMA 2L05A 3PZ8A 2KR0A 2LGDA 3AI5A 3MP9A 4WJPA 2C9WB 3HM3A 1XD3B 4CHKA 1VR9A 1P7EA 1SE4A 2INDC 4MGKE 1RRBA 1RAXA 2L32A 4ZYSA 3L0WB 1XLQA 4F7UP 4MDKE 2K2JA 3R66C 3L54A 2V3SA 3KQ4A 1EF1A 3E56A 5EE9A 2Z0EB 3CSFA 3H6NA 2MBHA 2R09A 3VVWB 1N62A 5BYRA 4KSKC 4BZAA 5JHGA 1IUEA 1NI2A 3V60A 2D9WA 3NZSA 3PHWB 1KLVA 4GSWA 1AN8A 2JUOA 4EEWA 4NQLB 2FDQA 1U27A 2WX0A 2IYDB 2G4DB 1R4NB 1RLFA 2PW9A 1N5WA 3FLVA 2L0TA 2RLOA 2YSZA 5D3DA 3TL5A 4YTMB 1KI1B 1UGJA 3CIRB 1AWEA 1EU3A 2Z0QA 4XX5A 5KQ1A 1IGDA 3ZUNA 2N7JA 4MSQB 1ZE3D 3HHMA 1EU4A 3QWZB 1C9FA 4MH0E 3ZW3A 1JWMD 2BTEA 1NEKB 5L81A 1VD2A 5C16A 5MPOA 1EWCA 2H7DA 3BK1A 3OJ3A 4ZRPA 3CIKA 2KWVB 3KRXA 3AJ4A 4K2PA 2LGSA 2IGDA 3ZVRA 1TJ6A 2HJ1A 3H7PB 2IO2B 4W9KA 3ZXRA 4K17A 4AQ7A 1HZ5A 2V4LA 3VTVA 2CHXA 3R8BA 3VXWA 1MIZB 2AQ3B 2PTLA 1K8RB 1V1PB 3VH4B 3RZFA 2DLBA 4YTNB 2PVGC 1QOAA 5D3YA 2NTTA 1FPYA 4O1NA 2RD0A 3Q3JA 2DX5A 2MEKA 1KTKA 1DOYA 1WGYA 3HRDD 3TEWA 3IXSA 4GDLA 3NJTA 4GOCA 1UF0A 1C4PA 4NJ6A 2L2IA 1EAZA 2RR9A 1YJ1A 2QJLA 2ZCBA 1MI0A 2AYOB 3C19A 1JWBD 1T3QA 1NDDA 3SFDB 2NPTB 3TFMA 5IRSA 1V86A 4II2B 3PVLA 4PK1A 2QIEB 1BMLC 4MJSB 3B2GA 5E6NA 1JWUD 2QSDA 5AZHA 1HA5A 3PO0A 2DA0A 1XLPA 3B2FA 4PS7A 3ZIMA 2RUKB 1T0QC 5I2MA 2VZKB 2DYOA 2LBBA 1QC6A 1FEHA 2FE8A 1JMLA 1IBXA 4JKCA 4WJNA 1YJIA 2WU2B 1H10A 1QOFA 2K9XA 2LJ5A 2COPA 1F52A 2LMCA 1FRDA 1M7EA 2CY5A 2JU6X 4PQ0A 2DNFA 1ZKHA 2O6VD 1WVHA 2COAA 2L1CA 2DHJA 3QX1A 2V1YA 3A58A 2D9YA 2KQ7A 3VUYA 4B6WA 1FXIA 1ISNA 3NVYA 4EMOA 3B08A 4DXAB 2MX2A 4EOYA 1WXVA 4LNKA 5BMHA 3E9LA 3MHSD 5HE3A 1YD8U 2J52A 5L95C 4E71A 3PT2B 2KOXA 4NAMA 3T8MA 1WMHB 2CY4A 2R82A 2NBVA 1FHWA 4BOZB 1I4HA 3AEEB 3TUOA 2FJ9A 3PRPB 3I63C 3MC8A 2KDBA 1SEBD 1JDEA 2KN5A 2JP2A 4HKQA 2PE6B 4WVFB 2OEDA 1T5XD 3AE9B 1K53A 2YT2A 1C1YB 1YQ3B 1SF0A 4N6EB 1GC7A 2J0KA 1F2RC 3DBLB 2N0YA 4PYUA 1V9JA 4TQ1A 3U7DA 3ZVVA 1DOIA 1TXDA 4XWXA 1JWAD 2Z0OA 2CAYA 4G11A 3NVWA 2ROZB 3I3TB 1UNRA 2DAJA 2KX3A 1Z87A 3L16A 3U52E 2QKMA 3ALBA 2IYBA 3GE3C 1IYFA 2INNE 4MK0A 3EGRA 1ZDVA 3U12A 3GE8C 4HLEA 2MJ3A 2O6VA 3UQBA 2IY0B 4GN1A 2EMSA 2UVMA 4K7UA 1TKGA 1X86A 1QT9A 4DDID 3NRZA 1DGJA 4NPNA 4HSIA 4DDGD 4PNKA 4HB0B 4W9JA 1PGXA 1Q10A 3IHPC 2V4IB 1QILA 1UBQA 4JIOU 1E8XA 4BBKA 5D3VA 2FCNA 4MGYE 1KF6B 3PS6A 4K2OA 2RPVA 3K9OB 3AU4A 1V61A 1U5FA 2NVUI 1K51A 4IC7B 2KACA 1YQ4B 3P4QB 1Y8RC 3A33B 1XODA 2P0FA 2HD5B 1F0ZA 4D6WA 2RSGA 3QIJA 2JZZA 3RFZB 2LASA 3B0AA 1P3QU 1HEZE 3OAWA 4ANUA 2W2XC 4JKAA 3ETRA 1I7AA 4OZCA 1P0RA 2C5LC 2I38A 2BWES 1XXGA 1WRIA 2KYWA 3RMKC 3P4PB 1XD4A 3V62A 1GAQB 4CHMA 4K3BA 3TJPA 4BBNF 3RUIB 4US8A 3N32A 5J18A 2WP9B 1PQSA 4LLGM 3O96A 1TS4A 3GYOA 5AZFA 4JK9A 1WY8A 2KK8A 4AJYB 3KWVA 4ASWC 2EMTA 1BWNA 3CWIA 4FLHA 3A1QA 4BAXA 4ICVA 2G4SA 2JXXA 1WJNA 3TO1A 2XEWA 3RCZA 4JQWC 2L8JA 4OVUA 4IUMB 1MPHA 1TY2A 4HDOA 1IBXB 4OVVA 2KDMA 3I9V1 1L6VA 5CHWA 1F9JA 2XNAC 4ZDVA 4CQNA 1XCTL 3ZNGC 4JX1C 1VBGA 1GGOA 4HAUB 1TS5A 1C78A 3N1ZC 3Q2AC 1QZEA 3RT3B 3SD5A 2CR5A 2DTCA 4IOYX 3L4PA 2LEKA 4FJYA 2KXJA 2UZRA 2K6QA 4C56C 3FAHA 1EM7A 5IA7A 3KYCD 5JVLA 4YWGG 2JQRB 3WIMA 2DIKA 3W5UB 1FOEA 4TSSA 2N9KA 5G55A 5C2TB 2EKIA 1UH6A 2GBRA 2WXQA 5DI9B 1K5DB 2D07B 3M95A 2Y8FA 4A55A 1HQRD 4G3XB 3E9SA 4NJCA 4WAAA 2KNBA 4LNOA 2K49A 2ELAA 2NBVB 1BT0A 1WXQA 3OG5A 4Q2JA 2L0FA 3N20C 2ZEQA 1BAKA 2MA9B 2UYZB 2KZRA 4XGAB 4B0EA 3C0RB 3BIID 3SU8X 3DVGX 4A6KA 4KKIA 3T3NA 2KO3A 4ICUA 5DIFB 2D3GA 3IAS1 2BYTA 2MKRA 2E6XA 1BTNA 2ASQA 2MHJA 3ONSA 1FO4A 1ZXIA 3JSVB 3QCAA 1I7HA 1ROEA 5DPRA 4DK5A 4AP4C 2VZKD 2KX0A 2WDVB 3DBHI 3I57A 2ACZB 2LG1A 2PE9A 1KZGA 3AULA 2GRIA 1PMSA 3AE6B 3NZ3A 3QC8B 4EZKA 4GOUA 2K22A 1STEA 5GOWB 1V5TA 3DPDA 4HB4B 3H7PA 2CODA 1OQQA 2GBKA 3A4RA 4W9CA 2QC8A 2N7EA 2AEHA 3VRBB 3RI7C 4HPPA 1PYWD 3T06A 2EC1A 1GPXA 4FHJA 1LW3A 2DZKA 1RFAA 3NS1A 5J3QA 1NBFC 1V1PA 2K8HA 4ANWA 3AEAB 3J9CA 1WJUA 2RRFA 1NU2A 3APCA 3FP5A 2KKCA 2Y5PA 3UF8A 2L1AA 3CF6E 5G5GA 5I4DA 2BGFA 4LK0M 2KTFA 2CRFA 3P7ZA 5LXHA 2IO0B 2IO1B 1OY2A 1HBKA 1MK9B 3RULA 1H8CA 2RPQA 4GGQA 2LYDA 4B9KA 2R2YA 1UD7A 3UI3A 3EFCA 4HATB 2KJRA 2NPTA 2KMCA 5HG2A 3DBRI 3BVZA 1XLOA 3A9JA 4TKNA 4MJSA 1R4MI 3B1LX 2Y5BB 2IFSA 1FB8A 3KRWA 3ZJVA 4HVBA 2KQSA 5FR3A 5M4YB 2D3CA 2LOXA 3CXBB 3QK0A 3GB1A 1M4VA 3ZO5B 3KH0A 1KBLA 4HWIB 4NSWA 2L76A 2J42A 5DPWA 3F0WA 1I4QA 2FNJB 2IGHA 2RDGA 3Q3OC 1E5WA 2KVRA 3ODXA
chains in the Genus database with same CATH topology
3UIPB 3PHXB 2KFKB 2KDEB 5KHQA 3ECIA 3X23A 3ENEA 5EDSA 1MG8A 2JRIB 2V76A 3APFA 1FAOA 2LVPA 2CQUA 4AUQC 3R3MA 2BKRB 1S3SG 5HE0A 4KDLB 3IG3A 4W9LA 1WMHA 1YX5B 2AL6A 2FIDA 2ZVNA 2RVBB 5CX3A 5FR6A 1WRDB 3JW0X 2IO3B 1R4NI 4JK7A 4MY6A 2M17A 4W9IA 1FHXA 3CMMB 2M4NA 5IJMA 1LFDA 3NHEB 2JPHA 4CO7A 4URKA 1HB8A 5LONB 2KD0A 4X57B 4IWOA 2KHWB 1JRUA 3GOEA 4IWPA 4L6EA 5L83A 2D9XA 3UGBB 1OEYJ 2ZZPB 4W9DA 2K39A 2GCJA 4NQKE 3RYTA 5JHBA 1ZVRA 5DCNA 4K7WA 3VOQA 3VDZA 5FI0A 1UNQA 4KSLC 2BPSA 4ANXA 1V5MA 2YS1A 2K00A 3LDZE 4ZRKA 2KJ6A 4ILHA 4ILGB 2X18A 5EFXA 4KHAA 1NTIA 4DWFA 2I5FA 3M3JA 1OEYA 4ANVA 2D9ZA 3NOBA 4ILJA 1OMWA 3PV1A 5C23A 3KW5B 5JH5C 3L13A 2XBBC 5CTRC 4A5KA 1V89A 4M0WB 2KWUB 2GS0A 1Y5OA 1WX9A 4JK8A 2C60A 2PPHA 2NR2A 1U4AA 2FIFA 5D3XA 4A3PA 2E2XA 2DHKA 3WA0A 3A9JB 3PLVA 3TIXA 2CS4A 2IY1B 3AXCA 2Q13A 1IPGA 2UWQA 2WH5A 3DDCB 4EZJA 1Y19B 4K81A 3QQ8B 1H4RA 1NVLA 1AARA 1HB6A 3PSEB 1U5DA 1HE8A 2HJ8A 1D3ZA 2LZ6A 2MBBB 3ZNHB 1WXSA 1E7VA 4KZCA 2YS3A 3PVUA 4C0AA 2B3AA 4JKBA 1WE6A 3N7CA 1WI1A 1P5TA 2D10A 1SHCA 1Q5WB 2MP2B 3ML4A 3JVZX 4PS3A 2COFA 1KM7A 2LVOA 1KC7A 1X1FA 2A5UA 2LRWA 2KCJA 2XQNM 4MT7A 4D0NB 2BYEA 5J2RA 3OJ4B 1DDWA 1WJMA 3R7RA 1FHOA 2D2QA 1WXMA 3QHTA 2BKFA 1KOTA 4A3OA 1M7RA 3M63B 1WF9A 4W9EA 2FCSA 4WQOB 3JSVA 1PFJA 2JWZA 3TMPB 4IFSA 2YT1A 3ODWA 4JL9A 2ZPYA 3N3KB 2MFQA 2JRHA 3KZ1A 4KZ0A 1ZC4B 2HTHB 1ZW7A 2I1JA 1L2NA 2KMAA 4KAXB 1WGGA 3QBVB 3PSCA 2JY6A 5LLIA 3DQVA 2REXA 2COCA 2DAFA 5CHVC 4GDKB 1V5PA 3A8PA 3E9PA 1J8CA 2Z59B 2K6DB 2KANA 2L7RA 4Y94A 1LQBA 1GUAB 1W1GA 1MK7B 2KJHB 3SV1A 3M62B 1TTNA 3PRMB 3PLUA 1YIWA 4JKFA 3ZRFA 1ZSQA 1ZGUB 3UZTA 4W9GA 1P1AA 2K2UA 2W2XD 1UZXB 2DHZA 1WR6E 4KV2A 3V6EB 2GJYA 5D27A 2R2OA 1E8ZA 1IP9A 4I6PA 3SUZA 3PREA 3A98B 2DKPA 1L7YA 3O65B 4G0NB 1T0YA 2M8SA 4M8MA 2AL3A 2M0XA 3V5WA 1WR1A 5JP4A 1WJ4A 1UPQA 2KFKA 1SIFA 3ZDMC 2K25A 4FHKA 4I6NB 4I6LB 2N9EB 4HCNB 4NY0A 2PJHA 3P2BA 4AOFA 3GZNI 2ZCCA 1NTVA 2KC1A 4NJ7A 4HPMB 4ZYNA 2FCQA 4TUUA 3LJUX 1GJZA 4B6HA 2AWTA 2L00B 2W2WA 1PLSA 2JT4B 2LXAA 3CSTA 1XCGA 2MWNB 3VUXA 2EJ8A 3HIZA 1XX0A 2KFJA 1TBEA 2LD9A 4MSMB 1P6SA 4Z2MB 2DYNA 2LI5A 2RSUA 3DBSA 1DYNA 4WWPA 3PRZA 2NS5A 4HAXB 5HKHA 3KUCB 1U5GA 4AJWA 4LJPB 4K7SA 3MJWA 1EO6A 3IFWB 4M8NA 1I35A 5AZGA 4JKEA 4HCPB 2M1MA 2G3QB 1WYWB 1X11A 4AWJA 1WG7A 3L08A 1WZ0A 1W1DA 3UINB 2LXCA 1WGQA 4A6FA 4WJ7A 1GNUA 3A9KB 4CHJA 1M94A 2ABDA 3VH3B 2DYQA 2VRRB 2GBNA 2JVCA 2RQ1A 2EKEC 2N4FA 4TYZA 2MW5A 1DIKA 4HB3B 3SO6A 2CKHB 2PEAA 1KZ7A 3ZNID 1UGMA 4JKGB 2D9VA 3APDA 3DXCA 2Z0PA 2QHOA 1DDMA 2NCNA 3IBEA 5CLQB 1FGZA 3F5RA 2MBOA 1V49A 3QARA 2K8BA 5D2MB 2NZ8B 3ML8A 5J3TA 1Z5SB 3VQIA 4FADA 1J19A 1BTKA 1GC6A 2DZJA 4TQ0A 5D3WA 4II3B 2MBEA 2N9XA 1OQNA 2YS5A 1YX6B 3D8FA 3SBGA 4ZRIA 1DDVA 3WAPA 1A5RA 5D6JB 5C5BA 1WX7A 2ROVA 2C7NB 2O2VB 1AQCA 4EZLA 3V6CB 4WSFA 3PTFC 3W1YA 2ZJDA 5C1ZA 1WM2A 4K1RB 2JF5A 2P0DA 2RNRB 2MWSB 3MDBC 2MSED 2NMBA 1U2BA 3L10B 1RJ2A 4IM3A 3DCGA 2MP2A 3ZRCA 2LVQA 1P9DU 1V5OA 5FI1A 2KLCA 1EVHA 3H7SA 2KGXB 2MCNB 4DHZB 3M1IB 2YVCA 3BINA 1N3HA 3MTNB 2LGXA 2K8CA 1RRPB 1ST7A 2NBWB 4JKDA 1KJTA 1DROA 5D7GA 3VUWA 3D32A 4EKUA 2OQBA 4DHJB 4B95A 4BBNC 2PZ1A 3EFUA 5JHAA 4HB2B 1WIAA 1QQGA 4DBBA 4KVGB 1WGHA 3PGEA 4MELA 4HK2A 4KIKB 2DLWA 3H1UA 1W1HA 3NS8A 1E90A 1WJ6A 4GXBA 2M38A 1Q1OA 2VKIA 2KWCA 2RGFA 1X1MA 5CHFA 3HQCA 1XR0B 5DH9B 4W9HA 1I2HA 3P6AA 2HTHA 3EHVA 5BO4B 1WH3A 2IBIB 5G2NA 3VIAA 1X05A 4GDKA 2C7MB 3AU5A 3ZTDA 2UZSA 4A6FB 4BKTA 4KHOA 3KUZA 4DBGA 2YRYA 4FJZA 1I42A 4MM3A 4HAWB 5IAAC 1WE7A 2N7DA 3WALA 2MLBA 2XK5B 3WAOA 2LRUA 2FAZA 3PVWA 2ZNVC 4H8SA 2J0JA 4NAWB 3VFKA 4FA6A 2NBUA 4MGZE 2L3ZA 3ULCA 3EPYA 1WM3A 3ENBA 2G35A 4E3CA 5LXIB 4GIVA 1Q0WB 5JZEB 1VBHA 3SHQA 2MRPA 4IW0A 3SYXA 2JZ3B 4FULA 1GG3A 4JGHB 3NSUA 5E6PA 4W9FA 2KDFB 1WFYA 4RM9A 3FM8C 1C3TA 4GB9A 2HE7A 3FEHA 3G9WA 3EECA 3A4SC 2YT0A 1TGZB 5C6RA 2BYVE 2DN6A 4BVUC 1TQZA 4GMVA 4RMAA 1XKEA 2OJRA 2R2QA 2MDXA 5C5BB 2N1WA 4F7GA 2BCJA 3A8QA 3E9OA 4ZRJA 2J7QB 2A4ZA 3PPAA 3L17A 1DBHA 3VTWA 1E8YA 4FBJB 1WGDA 2G45B 3DBLI 2GBJA 1V88A 4KHBB 3KVFB 4G50A 1WX8A 2YF0A 5HE2A 2D4QA 3ZLZA 3X0WA 4HDQA 1NTYA 3DVGY 5J17A 4XZ4A 1P98A 1OTRB 3QJZA 1J0GA 2GBMA 5CLLB 2KDIA 2WWZA 5LOPB 4F7HA 3U30A 1S1QB 1WXAA 1X1GA 1WGRA 2ELBA 2LULA 2DYMA 1MKEA 1P3RA 4E74A 3A9KA 4F7ZA 4DX90 2YLMA 2N1VA 5DHAB 4LDTB 2J0MA 4RM8A 1LB1A 2WYQA 2ADZA 3OANA 2I1KA 3DXEA 5DPSA 3NZUA 1UNPA 3UIOB 1OGWA 4JKGA 1V80A 1WGUA 3ZNZB 3H9DA 4WJOA 2DKQA 3TCAA 4XC2A 3HK0A 1OQYA 2M14A 2X0SA 2P0HA 4LJOB 2KUPA 2C7HA 4YONA 2DYBA 2QKLA 3RZWC 2DZMA 4DHJD 2MBQA 1K5GB 2H7EA 5HE1A 4PYZA 2CB8A 4WJQA 1UEFA 3BY4B 4Z2NA 2LGYA 3TBLD 4NNJB 1WZ3A 2VSZA 2ZVOA 2CHWA 2O2VA 3E66A 3DOWA 1FGYA 5D94A 5TR5A 3ML9A 2DX5B 4HAZB 2BF8B 3SNHA 3V61A 4GDLB 4IG7B 3DXDA 3ZKJC 2HRJA 3JYUA 2KC2A 3VHTC 2R0DA 2LUEA 4KDIC 2RGNB 4GZUA 3KUDB 4PS8A 3EC8A 1J0WA 2KTRA 1Z2MA 1E7UA 4GMXB 1V2YA 3QAQA 4EUTA 2N23A 4EJNA 1B55A 4IAPA 3Q3FA 4HXDA 1E8WA 2DFKA 3KYDD 4FN2A 1VCBA 4BKGA 2ZNVB 4DHZE 1YQBA 3DVNV 2KLGA 1SE9A 3QWMA 3N30A 4F1SA 1FXTB 4KIKA 4CYEA 2P8VA 4GPTB 5DPTA 3VTUA 1ACAA 1MAIA 3UQAA 4IM2A 1UBIA 3HM6X 3PEGA 4P7IA 1LXDA 2OTXA 2LOZA 4HJKA 3HW2B 2I5CA 3RCPA 2N9PC 1XT9B 4A20A 4DX8A 5AEKB 3ZDTA 1XQQA 3W1SC 4JKHA 4MGIE 3KSYA 4WWNA 2BYFA 2XK5A 2LWPA 1EUVB 4BKSD 3LJ3A 3PG7A 2BWFA 2FUHB 3TW1A 2FCMA 2K1FA 2CHZA 4BFRA 4NAWA 3QA8A 3SBTA 3R7QA 2LKOA 4LCDE 3GYPA 3PZDA 5JHHA 4BOSC 5GMVA 2D11A 4HAYB 5KHOA 1V5UA 2DZIA 3S2AA 2O6VB 3MPXA 2Y7BA 2DENB 1ZM0A 4HPLB 3IVFA 1ZC3B 2IZVB 2DHIA 2MQJA 5JLJB 2VRWB 3KY9A 2WX1A 2WDTB 3PP2A 4HHVA 3D8EA 1LM8B 4F8CB 1EF5A 1UELA 1WI0A 3OLMD 4GU2A 1IRSA 2J59M 2GMIC 3SDLC 1Q67A 1V81A 4TV3A 5C79A 1UPRA 3BJIA 2GOWA 2GCLA 1G6JA 4N9F4 4J6IA 3NY5A 3W1SA 4BKSA 1U5EA 5J3YA 2OOBB 3ODOA 4WWOA 2FJLA 4IWQA 4LDTD 2Y8GA 2CU1A 4IM0A 3DVNU 3WANA 3ZTCA 3A1QB 4EFOA 4JLCA 2W9NA 2KTRB 3U8ZA 3VAWA 3D8DA 1SGHA 3ULBA 4A6HA 1TZ1A 2ZPNA 4HAVB 4MEMA 4YL8A 1CMXB 1EGXA 2Z0DB 1V6EA 1U29A 3RD2A 1MIXA 2DX1A 5KQ4A 1WJ1A 3WYFB 5DHFB 4FJVB 3T9LA 5KCVA 5E6OA 3TVVA 3FSSA 3K9PB 3WAMA 2L05A 2LGDA 3AI5A 4WJPA 2C9WB 3HM3A 1XD3B 4CHKA 4MGKE 1RRBA 1RAXA 3L0WB 4F7UP 4MDKE 2K2JA 3R66C 3L54A 2V3SA 1EF1A 2Z0EB 3CSFA 3H6NA 2MBHA 2R09A 3VVWB 4KSKC 5JHGA 1NI2A 3V60A 2D9WA 3NZSA 3PHWB 1KLVA 4GSWA 2JUOA 4EEWA 4NQLB 2FDQA 1U27A 2WX0A 2IYDB 2G4DB 1RLFA 3FLVA 2L0TA 2RLOA 2YSZA 3TL5A 1KI1B 1AWEA 2Z0QA 4XX5A 5KQ1A 3ZUNA 4MSQB 3HHMA 3QWZB 4MH0E 3ZW3A 5L81A 1VD2A 5C16A 2H7DA 3OJ3A 3CIKA 2KWVB 3KRXA 3AJ4A 4K2PA 3ZVRA 1TJ6A 3H7PB 2IO2B 4W9KA 4K17A 2V4LA 3VTVA 2CHXA 3VXWA 1MIZB 1K8RB 3VH4B 3RZFA 5D3YA 2RD0A 3Q3JA 2DX5A 1WGYA 4GDLA 4GOCA 4NJ6A 2L2IA 1EAZA 2RR9A 1YJ1A 2ZCBA 2AYOB 1NDDA 2NPTB 3TFMA 1V86A 4II2B 3PVLA 4MJSB 5E6NA 5AZHA 2DA0A 4PS7A 3ZIMA 2RUKB 2DYOA 2LBBA 1QC6A 4JKCA 4WJNA 1H10A 2LJ5A 2COPA 1M7EA 2CY5A 4PQ0A 1ZKHA 2O6VD 1WVHA 2COAA 2L1CA 2DHJA 3QX1A 2V1YA 2D9YA 2KQ7A 3VUYA 4B6WA 1ISNA 4EMOA 3B08A 4DXAB 2MX2A 4EOYA 1WXVA 3E9LA 3MHSD 5HE3A 1YD8U 5L95C 4E71A 3PT2B 2KOXA 3T8MA 1WMHB 2CY4A 2R82A 1FHWA 4BOZB 2FJ9A 3PRPB 2KDBA 1JDEA 2KN5A 2JP2A 2PE6B 4WVFB 1C1YB 1GC7A 2J0KA 2N0YA 4PYUA 1V9JA 4TQ1A 3U7DA 3ZVVA 1TXDA 4XWXA 2Z0OA 2CAYA 4G11A 2ROZB 3I3TB 1UNRA 2DAJA 2KX3A 1Z87A 3L16A 2QKMA 3ALBA 2IYBA 1IYFA 4MK0A 4HLEA 2O6VA 3UQBA 2IY0B 4GN1A 2EMSA 2UVMA 4K7UA 1X86A 4DDID 4NPNA 4DDGD 4PNKA 4HB0B 4W9JA 3IHPC 1UBQA 4JIOU 1E8XA 4BBKA 5D3VA 2FCNA 4MGYE 3PS6A 4K2OA 3K9OB 3AU4A 1V61A 1U5FA 2NVUI 4IC7B 1Y8RC 3A33B 1XODA 2P0FA 2HD5B 2RSGA 3QIJA 2JZZA 2LASA 3B0AA 1P3QU 3OAWA 4ANUA 2W2XC 4JKAA 1I7AA 1P0RA 2C5LC 2BWES 1XD4A 3V62A 4CHMA 3TJPA 4BBNF 3RUIB 3N32A 5J18A 1PQSA 3O96A 3GYOA 5AZFA 4JK9A 1WY8A 2KK8A 4AJYB 4ASWC 2EMTA 1BWNA 4FLHA 3A1QA 4ICVA 2G4SA 2JXXA 1WJNA 3TO1A 2XEWA 3RCZA 4JQWC 2L8JA 4OVUA 4IUMB 1MPHA 4HDOA 4OVVA 5CHWA 1F9JA 4ZDVA 3ZNGC 1VBGA 1GGOA 4HAUB 1QZEA 3RT3B 3SD5A 2CR5A 2DTCA 4IOYX 4FJYA 2KXJA 2UZRA 2K6QA 5IA7A 3KYCD 5JVLA 3WIMA 2DIKA 1FOEA 5G55A 1UH6A 2GBRA 5DI9B 1K5DB 2D07B 3M95A 2Y8FA 4G3XB 4WAAA 2KNBA 2ELAA 2NBVB 1BT0A 2L0FA 2ZEQA 1BAKA 2MA9B 2UYZB 2KZRA 3C0RB 3SU8X 3DVGX 4A6KA 2KO3A 4ICUA 5DIFB 2D3GA 2MKRA 1BTNA 2ASQA 3ONSA 3JSVB 3QCAA 5DPRA 4DK5A 4AP4C 3DBHI 2KX0A 2LG1A 2PE9A 1KZGA 3AULA 1PMSA 3QC8B 4EZKA 5GOWB 1V5TA 3DPDA 4HB4B 3H7PA 2CODA 2GBKA 4W9CA 3A4RA 2N7EA 2AEHA 3T06A 2EC1A 4FHJA 1LW3A 2DZKA 1RFAA 5J3QA 1NBFC 2K8HA 4ANWA 1WJUA 1NU2A 3APCA 3FP5A 2KKCA 3UF8A 3CF6E 2BGFA 2KTFA 2CRFA 3P7ZA 5LXHA 2IO0B 2IO1B 1OY2A 1HBKA 1MK9B 3RULA 1H8CA 2RPQA 4GGQA 2LYDA 4B9KA 1UD7A 4HATB 2KJRA 2NPTA 2KMCA 3DBRI 3A9JA 4TKNA 4MJSA 1R4MI 3B1LX 2Y5BB 2IFSA 1FB8A 3KRWA 4HVBA 2KQSA 2LOXA 3CXBB 3QK0A 3ZO5B 3KH0A 1KBLA 4HWIB 4NSWA 2L76A 5DPWA 3F0WA 2FNJB 1E5WA 2KVRA 3ODXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP B;  3PHX B;  2KFK B;  2KDE B;  5KHQ A;  3ECI A;  3X23 A;  3ENE A;  5EDS A;  1MG8 A;  2JRI B;  2V76 A;  3APF A;  1FAO A;  2LVP A;  2CQU A;  4AUQ C;  3R3M A;  2BKR B;  1S3S G;  5HE0 A;  4KDL B;  3IG3 A;  4W9L A;  1WMH A;  1YX5 B;  2AL6 A;  2FID A;  2ZVN A;  2RVB B;  5CX3 A;  5FR6 A;  1WRD B;  3JW0 X;  2IO3 B;  1R4N I;  4MY6 A;  2M17 A;  4W9I A;  1FHX A;  3CMM B;  2M4N A;  5IJM A;  1LFD A;  3NHE B;  2JPH A;  4CO7 A;  4URK A;  1HB8 A;  5LON B;  2KD0 A;  4X57 B;  4IWO A;  2KHW B;  1JRU A;  3GOE A;  4IWP A;  4L6E A;  5L83 A;  2D9X A;  3UGB B;  1OEY J;  2ZZP B;  4W9D A;  2K39 A;  2GCJ A;  4NQK E;  3RYT A;  5JHB A;  1ZVR A;  5DCN A;  4K7W A;  3VOQ A;  3VDZ A;  5FI0 A;  1UNQ A;  4KSL C;  2BPS A;  4ANX A;  1V5M A;  2YS1 A;  2K00 A;  3LDZ E;  4ZRK A;  2KJ6 A;  2X18 A;  5EFX A;  4KHA A;  1NTI A;  4DWF A;  2I5F A;  3M3J A;  1OEY A;  4ANV A;  2D9Z A;  3NOB A;  1OMW A;  3PV1 A;  5C23 A;  3KW5 B;  5JH5 C;  3L13 A;  2XBB C;  5CTR C;  4A5K A;  1V89 A;  4M0W B;  2KWU B;  2GS0 A;  1Y5O A;  1WX9 A;  2C60 A;  2PPH A;  2NR2 A;  1U4A A;  2FIF A;  5D3X A;  4A3P A;  2E2X A;  2DHK A;  3WA0 A;  3A9J B;  3PLV A;  3TIX A;  2CS4 A;  2IY1 B;  3AXC A;  2Q13 A;  1IPG A;  2UWQ A;  2WH5 A;  3DDC B;  4EZJ A;  1Y19 B;  4K81 A;  3QQ8 B;  1H4R A;  1NVL A;  1AAR A;  1HB6 A;  3PSE B;  1U5D A;  1HE8 A;  2HJ8 A;  1D3Z A;  2LZ6 A;  2MBB B;  3ZNH B;  1WXS A;  1E7V A;  4KZC A;  2YS3 A;  3PVU A;  4C0A A;  2B3A A;  1WE6 A;  3N7C A;  1WI1 A;  1P5T A;  2D10 A;  1SHC A;  1Q5W B;  2MP2 B;  3ML4 A;  3JVZ X;  4PS3 A;  2COF A;  1KM7 A;  2LVO A;  1X1F A;  2A5U A;  2LRW A;  2KCJ A;  2XQN M;  4MT7 A;  4D0N B;  2BYE A;  5J2R A;  3OJ4 B;  1DDW A;  1WJM A;  3R7R A;  1FHO A;  2D2Q A;  1WXM A;  3QHT A;  2BKF A;  1KOT A;  4A3O A;  1M7R A;  3M63 B;  1WF9 A;  4W9E A;  2FCS A;  4WQO B;  3JSV A;  1PFJ A;  2JWZ A;  3TMP B;  4IFS A;  2YT1 A;  3ODW A;  4JL9 A;  2ZPY A;  3N3K B;  2MFQ A;  2JRH A;  3KZ1 A;  4KZ0 A;  1ZC4 B;  2HTH B;  1ZW7 A;  2I1J A;  1L2N A;  2KMA A;  4KAX B;  1WGG A;  3QBV B;  3PSC A;  2JY6 A;  5LLI A;  3DQV A;  2REX A;  2COC A;  2DAF A;  5CHV C;  4GDK B;  1V5P A;  3A8P A;  1J8C A;  2Z59 B;  2K6D B;  2KAN A;  2L7R A;  4Y94 A;  1LQB A;  1GUA B;  1W1G A;  1MK7 B;  2KJH B;  3SV1 A;  3M62 B;  1TTN A;  3PRM B;  3PLU A;  1YIW A;  3ZRF A;  1ZSQ A;  1ZGU B;  3UZT A;  4W9G A;  1P1A A;  2K2U A;  2W2X D;  1UZX B;  2DHZ A;  1WR6 E;  4KV2 A;  3V6E B;  2GJY A;  5D27 A;  2R2O A;  1E8Z A;  1IP9 A;  4I6P A;  3SUZ A;  3PRE A;  3A98 B;  2DKP A;  1L7Y A;  3O65 B;  4G0N B;  1T0Y A;  2M8S A;  4M8M A;  2AL3 A;  2M0X A;  3V5W A;  1WR1 A;  5JP4 A;  1WJ4 A;  1UPQ A;  2KFK A;  1SIF A;  3ZDM C;  2K25 A;  4FHK A;  4I6N B;  4I6L B;  2N9E B;  4HCN B;  4NY0 A;  2PJH A;  3P2B A;  4AOF A;  3GZN I;  2ZCC A;  1NTV A;  2KC1 A;  4NJ7 A;  4HPM B;  4ZYN A;  2FCQ A;  4TUU A;  3LJU X;  1GJZ A;  4B6H A;  2AWT A;  2L00 B;  2W2W A;  1PLS A;  2JT4 B;  2LXA A;  3CST A;  1XCG A;  2MWN B;  3VUX A;  2EJ8 A;  3HIZ A;  1XX0 A;  2KFJ A;  1TBE A;  2LD9 A;  4MSM B;  1P6S A;  4Z2M B;  2DYN A;  2LI5 A;  2RSU A;  3DBS A;  1DYN A;  4WWP A;  3PRZ A;  2NS5 A;  4HAX B;  5HKH A;  3KUC B;  1U5G A;  4AJW A;  4LJP B;  4K7S A;  3MJW A;  1EO6 A;  3IFW B;  4M8N A;  1I35 A;  5AZG A;  4HCP B;  2M1M A;  2G3Q B;  1WYW B;  1X11 A;  4AWJ A;  1WG7 A;  3L08 A;  1WZ0 A;  1W1D A;  3UIN B;  2LXC A;  1WGQ A;  4A6F A;  4WJ7 A;  1GNU A;  3A9K B;  4CHJ A;  1M94 A;  2ABD A;  3VH3 B;  2DYQ A;  2VRR B;  2GBN A;  2JVC A;  2RQ1 A;  2EKE C;  2N4F A;  4TYZ A;  2MW5 A;  4HB3 B;  3SO6 A;  2CKH B;  2PEA A;  1KZ7 A;  3ZNI D;  1UGM A;  2D9V A;  3APD A;  3DXC A;  2Z0P A;  2QHO A;  1DDM A;  2NCN A;  3IBE A;  5CLQ B;  1FGZ A;  3F5R A;  2MBO A;  1V49 A;  3QAR A;  2K8B A;  5D2M B;  2NZ8 B;  3ML8 A;  5J3T A;  1Z5S B;  3VQI A;  4FAD A;  1J19 A;  1BTK A;  1GC6 A;  2DZJ A;  4TQ0 A;  5D3W A;  4II3 B;  2MBE A;  2N9X A;  1OQN A;  2YS5 A;  1YX6 B;  3D8F A;  4ZRI A;  1DDV A;  3WAP A;  1A5R A;  5D6J B;  5C5B A;  1WX7 A;  2ROV A;  2C7N B;  2O2V B;  1AQC A;  4EZL A;  3V6C B;  4WSF A;  3PTF C;  3W1Y A;  2ZJD A;  5C1Z A;  1WM2 A;  4K1R B;  2JF5 A;  2P0D A;  2RNR B;  2MWS B;  3MDB C;  2MSE D;  2NMB A;  1U2B A;  3L10 B;  1RJ2 A;  4IM3 A;  3DCG A;  2MP2 A;  3ZRC A;  2LVQ A;  1P9D U;  1V5O A;  5FI1 A;  2KLC A;  1EVH A;  3H7S A;  2KGX B;  2MCN B;  4DHZ B;  3M1I B;  2YVC A;  3BIN A;  1N3H A;  3MTN B;  2LGX A;  2K8C A;  1RRP B;  1ST7 A;  2NBW B;  1KJT A;  1DRO A;  5D7G A;  3VUW A;  3D32 A;  4EKU A;  2OQB A;  4DHJ B;  4B95 A;  4BBN C;  2PZ1 A;  3EFU A;  5JHA A;  4HB2 B;  1WIA A;  1QQG A;  4DBB A;  4KVG B;  1WGH A;  3PGE A;  4MEL A;  4HK2 A;  4KIK B;  2DLW A;  3H1U A;  1W1H A;  3NS8 A;  1E90 A;  1WJ6 A;  4GXB A;  2M38 A;  1Q1O A;  2VKI A;  2KWC A;  2RGF A;  1X1M A;  5CHF A;  3HQC A;  1XR0 B;  5DH9 B;  4W9H A;  1I2H A;  3P6A A;  2HTH A;  3EHV A;  5BO4 B;  1WH3 A;  2IBI B;  5G2N A;  3VIA A;  1X05 A;  4GDK A;  2C7M B;  3AU5 A;  3ZTD A;  2UZS A;  4A6F B;  4BKT A;  4KHO A;  3KUZ A;  4DBG A;  2YRY A;  4FJZ A;  1I42 A;  4MM3 A;  4HAW B;  5IAA C;  1WE7 A;  2N7D A;  3WAL A;  2MLB A;  2XK5 B;  3WAO A;  2LRU A;  2FAZ A;  3PVW A;  2ZNV C;  4H8S A;  2J0J A;  4NAW B;  3VFK A;  4FA6 A;  2NBU A;  4MGZ E;  2L3Z A;  3ULC A;  3EPY A;  1WM3 A;  2G35 A;  4E3C A;  5LXI B;  4GIV A;  1Q0W B;  5JZE B;  3SHQ A;  2MRP A;  4IW0 A;  3SYX A;  2JZ3 B;  4FUL A;  1GG3 A;  4JGH B;  3NSU A;  5E6P A;  4W9F A;  2KDF B;  1WFY A;  4RM9 A;  3FM8 C;  1C3T A;  4GB9 A;  2HE7 A;  3FEH A;  3G9W A;  3EEC A;  3A4S C;  2YT0 A;  1TGZ B;  5C6R A;  2BYV E;  2DN6 A;  4BVU C;  1TQZ A;  4GMV A;  4RMA A;  1XKE A;  2OJR A;  2R2Q A;  2MDX A;  5C5B B;  2N1W A;  4F7G A;  2BCJ A;  3A8Q A;  4ZRJ A;  2J7Q B;  2A4Z A;  3PPA A;  3L17 A;  1DBH A;  3VTW A;  1E8Y A;  4FBJ B;  1WGD A;  2G45 B;  3DBL I;  2GBJ A;  1V88 A;  4KHB B;  3KVF B;  4G50 A;  1WX8 A;  2YF0 A;  5HE2 A;  2D4Q A;  3ZLZ A;  3X0W A;  4HDQ A;  1NTY A;  3DVG Y;  5J17 A;  4XZ4 A;  1P98 A;  1OTR B;  3QJZ A;  1J0G A;  2GBM A;  5CLL B;  2KDI A;  2WWZ A;  5LOP B;  4F7H A;  3U30 A;  1S1Q B;  1WXA A;  1X1G A;  1WGR A;  2ELB A;  2LUL A;  2DYM A;  1MKE A;  1P3R A;  4E74 A;  3A9K A;  4F7Z A;  4DX9 0;  2YLM A;  2N1V A;  5DHA B;  4LDT B;  2J0M A;  4RM8 A;  1LB1 A;  2WYQ A;  2ADZ A;  3OAN A;  2I1K A;  3DXE A;  5DPS A;  3NZU A;  1UNP A;  3UIO B;  1OGW A;  1V80 A;  1WGU A;  3ZNZ B;  3H9D A;  4WJO A;  2DKQ A;  3TCA A;  4XC2 A;  3HK0 A;  1OQY A;  2M14 A;  2P0H A;  4LJO B;  2KUP A;  2C7H A;  4YON A;  2DYB A;  2QKL A;  3RZW C;  2DZM A;  4DHJ D;  2MBQ A;  1K5G B;  2H7E A;  5HE1 A;  4PYZ A;  2CB8 A;  4WJQ A;  1UEF A;  3BY4 B;  4Z2N A;  2LGY A;  3TBL D;  4NNJ B;  1WZ3 A;  2VSZ A;  2ZVO A;  2CHW A;  2O2V A;  3DOW A;  1FGY A;  5D94 A;  5TR5 A;  3ML9 A;  2DX5 B;  4HAZ B;  2BF8 B;  3SNH A;  3V61 A;  4GDL B;  4IG7 B;  3DXD A;  3ZKJ C;  2HRJ A;  3JYU A;  2KC2 A;  3VHT C;  2R0D A;  2LUE A;  4KDI C;  2RGN B;  4GZU A;  3KUD B;  4PS8 A;  3EC8 A;  1J0W A;  2KTR A;  1Z2M A;  1E7U A;  4GMX B;  1V2Y A;  3QAQ A;  4EUT A;  2N23 A;  4EJN A;  1B55 A;  4IAP A;  3Q3F A;  4HXD A;  1E8W A;  2DFK A;  3KYD D;  4FN2 A;  1VCB A;  4BKG A;  2ZNV B;  4DHZ E;  1YQB A;  3DVN V;  2KLG A;  1SE9 A;  3QWM A;  3N30 A;  4F1S A;  1FXT B;  4KIK A;  4CYE A;  2P8V A;  4GPT B;  5DPT A;  3VTU A;  1ACA A;  1MAI A;  3UQA A;  4IM2 A;  1UBI A;  3HM6 X;  3PEG A;  4P7I A;  1LXD A;  2OTX A;  2LOZ A;  4HJK A;  3HW2 B;  2I5C A;  3RCP A;  2N9P C;  1XT9 B;  4A20 A;  4DX8 A;  5AEK B;  3ZDT A;  1XQQ A;  3W1S C;  4MGI E;  3KSY A;  4WWN A;  2BYF A;  2XK5 A;  2LWP A;  1EUV B;  4BKS D;  3LJ3 A;  3PG7 A;  2BWF A;  2FUH B;  3TW1 A;  2FCM A;  2K1F A;  2CHZ A;  4BFR A;  4NAW A;  3QA8 A;  3R7Q A;  2LKO A;  4LCD E;  3GYP A;  3PZD A;  5JHH A;  4BOS C;  5GMV A;  2D11 A;  4HAY B;  5KHO A;  1V5U A;  2DZI A;  3S2A A;  2O6V B;  3MPX A;  2Y7B A;  2DEN B;  1ZM0 A;  4HPL B;  3IVF A;  1ZC3 B;  2IZV B;  2DHI A;  2MQJ A;  5JLJ B;  2VRW B;  3KY9 A;  2WX1 A;  2WDT B;  3PP2 A;  4HHV A;  3D8E A;  1LM8 B;  4F8C B;  1EF5 A;  1UEL A;  1WI0 A;  3OLM D;  4GU2 A;  1IRS A;  2J59 M;  2GMI C;  3SDL C;  1Q67 A;  1V81 A;  4TV3 A;  5C79 A;  1UPR A;  3BJI A;  2GOW A;  2GCL A;  1G6J A;  4N9F 4;  4J6I A;  3NY5 A;  3W1S A;  4BKS A;  1U5E A;  5J3Y A;  2OOB B;  3ODO A;  4WWO A;  2FJL A;  4IWQ A;  4LDT D;  2Y8G A;  2CU1 A;  4IM0 A;  3DVN U;  3WAN A;  3ZTC A;  3A1Q B;  4EFO A;  4JLC A;  2W9N A;  2KTR B;  3U8Z A;  3VAW A;  3D8D A;  1SGH A;  3ULB A;  4A6H A;  1TZ1 A;  2ZPN A;  4HAV B;  4MEM A;  4YL8 A;  1CMX B;  1EGX A;  2Z0D B;  1V6E A;  1U29 A;  3RD2 A;  1MIX A;  2DX1 A;  5KQ4 A;  1WJ1 A;  3WYF B;  5DHF B;  4FJV B;  3T9L A;  5KCV A;  5E6O A;  3TVV A;  3FSS A;  3K9P B;  3WAM A;  2L05 A;  2LGD A;  3AI5 A;  4WJP A;  2C9W B;  3HM3 A;  1XD3 B;  4CHK A;  4MGK E;  1RRB A;  1RAX A;  3L0W B;  4F7U P;  4MDK E;  2K2J A;  3R66 C;  3L54 A;  2V3S A;  1EF1 A;  2Z0E B;  3CSF A;  3H6N A;  2MBH A;  2R09 A;  3VVW B;  4KSK C;  5JHG A;  1NI2 A;  3V60 A;  2D9W A;  3NZS A;  3PHW B;  1KLV A;  4GSW A;  2JUO A;  4EEW A;  4NQL B;  2FDQ A;  1U27 A;  2WX0 A;  2IYD B;  2G4D B;  1RLF A;  3FLV A;  2L0T A;  2RLO A;  2YSZ A;  3TL5 A;  1KI1 B;  1AWE A;  2Z0Q A;  4XX5 A;  5KQ1 A;  3ZUN A;  4MSQ B;  3HHM A;  3QWZ B;  4MH0 E;  3ZW3 A;  5L81 A;  1VD2 A;  5C16 A;  2H7D A;  3OJ3 A;  3CIK A;  2KWV B;  3KRX A;  3AJ4 A;  4K2P A;  3ZVR A;  1TJ6 A;  3H7P B;  2IO2 B;  4W9K A;  4K17 A;  2V4L A;  3VTV A;  2CHX A;  3VXW A;  1MIZ B;  1K8R B;  3VH4 B;  3RZF A;  5D3Y A;  2RD0 A;  3Q3J A;  2DX5 A;  1WGY A;  4GDL A;  4GOC A;  4NJ6 A;  2L2I A;  1EAZ A;  2RR9 A;  1YJ1 A;  2ZCB A;  2AYO B;  1NDD A;  2NPT B;  3TFM A;  1V86 A;  4II2 B;  3PVL A;  4MJS B;  5E6N A;  5AZH A;  2DA0 A;  4PS7 A;  3ZIM A;  2RUK B;  2DYO A;  2LBB A;  1QC6 A;  4WJN A;  1H10 A;  2LJ5 A;  2COP A;  1M7E A;  2CY5 A;  4PQ0 A;  1ZKH A;  2O6V D;  1WVH A;  2COA A;  2L1C A;  2DHJ A;  3QX1 A;  2V1Y A;  2D9Y A;  2KQ7 A;  3VUY A;  4B6W A;  1ISN A;  4EMO A;  3B08 A;  4DXA B;  2MX2 A;  4EOY A;  1WXV A;  3MHS D;  5L95 C;  5HE3 A;  1YD8 U;  4E71 A;  3PT2 B;  2KOX A;  3T8M A;  1WMH B;  2CY4 A;  1FHW A;  4BOZ B;  2FJ9 A;  3PRP B;  2KDB A;  2KN5 A;  2JP2 A;  2PE6 B;  4WVF B;  1C1Y B;  1GC7 A;  2J0K A;  2N0Y A;  4PYU A;  1V9J A;  4TQ1 A;  3U7D A;  3ZVV A;  1TXD A;  4XWX A;  2Z0O A;  2CAY A;  4G11 A;  2ROZ B;  3I3T B;  1UNR A;  2DAJ A;  2KX3 A;  1Z87 A;  3L16 A;  2QKM A;  3ALB A;  2IYB A;  1IYF A;  4MK0 A;  4HLE A;  2O6V A;  3UQB A;  2IY0 B;  4GN1 A;  2EMS A;  2UVM A;  4K7U A;  1X86 A;  4DDI D;  4NPN A;  4DDG D;  4PNK A;  4HB0 B;  4W9J A;  3IHP C;  1UBQ A;  4JIO U;  1E8X A;  4BBK A;  5D3V A;  2FCN A;  4MGY E;  3PS6 A;  4K2O A;  3K9O B;  3AU4 A;  1V61 A;  1U5F A;  2NVU I;  4IC7 B;  1Y8R C;  3A33 B;  1XOD A;  2P0F A;  2HD5 B;  2RSG A;  3QIJ A;  2JZZ A;  2LAS A;  3B0A A;  1P3Q U;  3OAW A;  4ANU A;  2W2X C;  1I7A A;  1P0R A;  2C5L C;  2BWE S;  1XD4 A;  3V62 A;  4CHM A;  3TJP A;  4BBN F;  3RUI B;  3N32 A;  5J18 A;  1PQS A;  3O96 A;  3GYO A;  5AZF A;  1WY8 A;  2KK8 A;  4AJY B;  4ASW C;  2EMT A;  1BWN A;  4FLH A;  3A1Q A;  4ICV A;  2G4S A;  2JXX A;  1WJN A;  3TO1 A;  2XEW A;  3RCZ A;  4JQW C;  2L8J A;  4OVU A;  4IUM B;  1MPH A;  4HDO A;  4OVV A;  5CHW A;  1F9J A;  4ZDV A;  3ZNG C;  4HAU B;  1QZE A;  3RT3 B;  3SD5 A;  2CR5 A;  2DTC A;  4IOY X;  4FJY A;  2KXJ A;  2UZR A;  2K6Q A;  5IA7 A;  3KYC D;  3WIM A;  1FOE A;  5G55 A;  1UH6 A;  2GBR A;  5DI9 B;  1K5D B;  2D07 B;  3M95 A;  2Y8F A;  4G3X B;  4WAA A;  2KNB A;  2ELA A;  2NBV B;  1BT0 A;  2L0F A;  2ZEQ A;  1BAK A;  2MA9 B;  2UYZ B;  2KZR A;  3C0R B;  3SU8 X;  3DVG X;  4A6K A;  2KO3 A;  4ICU A;  5DIF B;  2D3G A;  2MKR A;  1BTN A;  2ASQ A;  3ONS A;  3JSV B;  3QCA A;  5DPR A;  4DK5 A;  4AP4 C;  3DBH I;  2KX0 A;  2LG1 A;  2PE9 A;  1KZG A;  3AUL A;  1PMS A;  3QC8 B;  4EZK A;  5GOW B;  1V5T A;  3DPD A;  4HB4 B;  3H7P A;  2COD A;  2GBK A;  4W9C A;  3A4R A;  2N7E A;  2AEH A;  3T06 A;  2EC1 A;  4FHJ A;  1LW3 A;  2DZK A;  1RFA A;  5J3Q A;  1NBF C;  2K8H A;  4ANW A;  1WJU A;  1NU2 A;  3APC A;  3FP5 A;  2KKC A;  3UF8 A;  3CF6 E;  2BGF A;  2KTF A;  2CRF A;  3P7Z A;  5LXH A;  2IO0 B;  2IO1 B;  1OY2 A;  1HBK A;  1MK9 B;  3RUL A;  1H8C A;  2RPQ A;  4GGQ A;  2LYD A;  4B9K A;  1UD7 A;  4HAT B;  2KJR A;  2NPT A;  2KMC A;  3DBR I;  3A9J A;  4TKN A;  4MJS A;  1R4M I;  3B1L X;  2Y5B B;  2IFS A;  1FB8 A;  3KRW A;  4HVB A;  2KQS A;  2LOX A;  3CXB B;  3QK0 A;  3ZO5 B;  3KH0 A;  4HWI B;  4NSW A;  2L76 A;  5DPW A;  3F0W A;  2FNJ B;  1E5W A;  2KVR A;  3ODX A; 
#chains in the Genus database with same CATH topology
 3UIP B;  3PHX B;  2ICI A;  2KFK B;  2KDE B;  1L4Z B;  5KHQ A;  2LJI A;  3ECI A;  3X23 A;  3ENE A;  5EE3 A;  5EDS A;  1YJJ A;  2V9H A;  1MG8 A;  1N6Z A;  2JRI B;  2V76 A;  1ACC A;  3APF A;  1SJE D;  2WXK A;  1FAO A;  2LVP A;  4RNA A;  2CQU A;  4AUQ C;  3R3M A;  1FCL A;  2BKR B;  1S3S G;  5HE0 A;  4KDL B;  3IG3 A;  4W9L A;  4AS1 A;  1WMH A;  1YX5 B;  2AL6 A;  2FID A;  2WXG A;  2ZVN A;  1C79 A;  2RVB B;  5CX3 A;  5FR6 A;  1WRD B;  3JW0 X;  2IO3 B;  1R4N I;  4JK7 A;  2OJW A;  4MY6 A;  2M17 A;  4W9I A;  1FHX A;  3CMM B;  2M4N A;  5FK9 C;  1FNW A;  5IJM A;  1LFD A;  1YOV B;  2KQ4 X;  3NHE B;  4N59 A;  2JPH A;  4A9A A;  2WXP A;  2QIL A;  2JWU A;  4CO7 A;  4URK A;  1HB8 A;  5LON B;  4KKJ A;  4MT5 A;  2KD0 A;  4X57 B;  4QJ5 B;  4IWO A;  2KHW B;  1I4G A;  1JRU A;  3GOE A;  4IWP A;  4L6E A;  5L83 A;  2D9X A;  1SBB B;  3UGB B;  1OEY J;  2ZZP B;  4W9D A;  4A6Q A;  4B0M A;  2K39 A;  1FM0 D;  2GCJ A;  4NQK E;  3RYT A;  1E0Z A;  3T3O A;  5JHB A;  1PGB A;  2I2Y A;  1ZVR A;  5DCN A;  4K7W A;  3VOQ A;  3VDZ A;  5FI0 A;  1KLU D;  2K3U A;  1UNQ A;  4KSL C;  2BPS A;  2J53 A;  3P63 A;  4ANX A;  1V5M A;  1D5X C;  2YS1 A;  2K00 A;  1KH0 A;  3LDZ E;  4ZRK A;  2KJ6 A;  4ILH A;  2WHI A;  4ILG B;  2BW2 A;  5I2S A;  1Y56 A;  2KAJ A;  4LNN A;  2CJO A;  5EE1 A;  3HUI A;  4RGM A;  2X18 A;  5EFX A;  4KHA A;  1NTI A;  3LB8 C;  1AWD A;  4DWF A;  2I5F A;  5FKA C;  1MHH E;  3M3J A;  3Q8E A;  2W3R A;  4HRO A;  4REZ A;  1OEY A;  1VZ8 A;  4ANV A;  4XE0 A;  2D9Z A;  3NOB A;  2V0G A;  4ILJ A;  1OMW A;  3AEC B;  3PV1 A;  5C23 A;  2LUM A;  3KW5 B;  5JH5 C;  3ZJU A;  3L13 A;  2XBB C;  5CTR C;  1PUT A;  4A5K A;  4OT1 A;  1L0X B;  1QF6 A;  1V89 A;  4M0W B;  2KWU B;  5IN7 A;  2GS0 A;  2ZW1 A;  3RPF C;  4JWU C;  3NWD A;  3PZ7 A;  1Y5O A;  1WX9 A;  4JK8 A;  1VJK A;  2C60 A;  1ESF A;  2PPH A;  2NR2 A;  1U4A A;  2FIF A;  5D3X A;  4A3P A;  2E2X A;  4KGR A;  2DHK A;  3AE3 B;  3WA0 A;  5C3J B;  3A9J B;  3AE4 B;  3PLV A;  3TIX A;  2CS4 A;  2IY1 B;  3AXC A;  2Q13 A;  1IPG A;  1FXA A;  2UWQ A;  1N5X A;  2WH5 A;  1WYG A;  3DDC B;  4EZJ A;  1Y19 B;  4K81 A;  3QQ8 B;  1H4R A;  1NVL A;  1AAR A;  2BS3 B;  2KWD A;  1HB6 A;  3PSE B;  1U5D A;  1HE8 A;  1YMH E;  2HJ8 A;  1D3Z A;  2LZ6 A;  3W9C B;  2MBB B;  3ZNH B;  1ZDX A;  1ZUD 2;  5IKC M;  1WXS A;  1NVI D;  1E7V A;  2WXR A;  3AEF B;  2RMM A;  4KZC A;  1N63 A;  2YS3 A;  3PVU A;  2FBW B;  4C0A A;  2B3A A;  4JKB A;  1MJD A;  1WE6 A;  3N7C A;  1WI1 A;  1P5T A;  4RGN A;  2D10 A;  1SHC A;  2ON8 A;  1Q5W B;  2MP2 B;  3BWU D;  3ML4 A;  2LFI A;  3JVZ X;  4PS3 A;  2COF A;  1KM7 A;  1YN5 A;  4P1C C;  2LVO A;  1KC7 A;  1X1F A;  4HJG E;  1UWX A;  2A5U A;  2PLP A;  4ZOH C;  2LRW A;  5H8Y E;  4P1B C;  3URY A;  2KCJ A;  4OHJ A;  2XQN M;  4MT7 A;  4D0N B;  1JW9 D;  2BYE A;  2NMQ A;  2AQ2 B;  3B9J A;  5J2R A;  3OJ4 B;  1DDW A;  1WJM A;  3R7R A;  1FHO A;  3Q6B A;  1TIF A;  2D2Q A;  3IT4 B;  2K8E A;  1WXM A;  1E10 A;  3QHT A;  1BUI C;  2BKF A;  1KOT A;  4A3O A;  1M7R A;  2B76 B;  4OW0 A;  3M63 B;  1WF9 A;  4W9E A;  2FCS A;  1OFF A;  4WQO B;  2JX5 A;  3JSV A;  1PFJ A;  2JWZ A;  3TMP B;  4IFS A;  2YT1 A;  3OHM B;  3HVD A;  1JCK B;  2Z13 A;  2INC C;  3ODW A;  4JL9 A;  3EUB 2;  2ZPY A;  3N3K B;  2MFQ A;  2JRH A;  4C4V A;  3ZJT A;  3KZ1 A;  1SSN A;  3Q8A A;  1DOX A;  3ABV B;  4KZ0 A;  1JRO A;  1TYG B;  2LHE A;  1ZC4 B;  2HTH B;  1ZW7 A;  2I1J A;  4YSZ B;  2AX5 A;  1L2N A;  2KMA A;  4KAX B;  1WGG A;  3QBV B;  3PSC A;  3V3X A;  4RFB A;  2JY6 A;  5LLI A;  4L23 A;  3DQV A;  2REX A;  1UWM A;  1XF5 L;  2COC A;  2DAF A;  5CHV C;  3NWF A;  1L4D B;  2DWQ A;  4GDK B;  1GOZ A;  1V5P A;  3A8P A;  3E9P A;  1J8C A;  2Z59 B;  2WGS A;  4MM3 B;  2K6D B;  2KT7 A;  2KAN A;  2L7R A;  1TT5 B;  4Y94 A;  1LQB A;  1GUA B;  1W1G A;  1MK7 B;  2KJH B;  3SV1 A;  1HZ6 A;  3M62 B;  1TTN A;  3PRM B;  2MJE A;  3PLU A;  1YIW A;  4JKF A;  1ZOY B;  2LHD A;  3ZRF A;  1ZSQ A;  1ZGU B;  3UZT A;  4ARI A;  4W9G A;  1P1A A;  2K2U A;  2JXT A;  2PKO A;  2W2X D;  1UZX B;  2WDR B;  4C7Z A;  2DHZ A;  1JRP A;  1YN4 A;  1WR6 E;  1RYJ A;  2X38 A;  4YSX B;  2RDB C;  4KV2 A;  3V6E B;  2GJY A;  5D27 A;  2R2O A;  3RNC C;  1E8Z A;  1IP9 A;  4I6P A;  3SUZ A;  3PRE A;  3W5V B;  3A98 B;  1FNU A;  1KFY B;  2DKP A;  1L7Y A;  3O65 B;  4G0N B;  1T0Y A;  3BK2 A;  2PMV A;  1MI1 A;  2M8S A;  4M8M A;  2AL3 A;  2M0X A;  3V5W A;  1WR1 A;  5JP4 A;  1WGK A;  1WJ4 A;  1UPQ A;  2KFK A;  1SIF A;  3ZDM C;  2J4X A;  2K25 A;  4FHK A;  4I6N B;  4I6L B;  2N9E B;  4RCO A;  3WCQ A;  4HCN B;  4ACF A;  4NY0 A;  2PJH A;  3P2B A;  4M01 A;  2X8X X;  4AOF A;  3GZN I;  4XWW A;  1C77 A;  3EA6 A;  2ZCC A;  1NTV A;  2KC1 A;  4NJ7 A;  4HPM B;  1FD6 A;  1SXT A;  4ZYN A;  1LGR A;  1FNV A;  2FCQ A;  3C8Y A;  3FIL B;  1N61 A;  3RNE C;  4TUU A;  3LJU X;  1GJZ A;  4B6H A;  2AWT A;  2L00 B;  2W2W A;  1NYQ A;  1PLS A;  1JQ4 A;  2JT4 B;  2KVZ A;  2LXA A;  3CST A;  1XCG A;  2MWN B;  3VUX A;  2EJ8 A;  3HIZ A;  1XX0 A;  2KFJ A;  2BVC A;  1TBE A;  1SE2 A;  2LD9 A;  4MSM B;  1P6S A;  4Z2M B;  2DYN A;  4JPS A;  2LI5 A;  3IAM 1;  2BB6 A;  4RF1 A;  2RSU A;  3DBS A;  1DYN A;  4WWP A;  3PRZ A;  1T6B X;  2NS5 A;  4HAX B;  5HKH A;  3KUC B;  1B9R A;  3OWE B;  4QJ4 B;  1U5G A;  2BT6 A;  2CJN A;  4AJW A;  1VZ6 A;  4RF0 A;  4LJP B;  4K7S A;  3MJW A;  1EO6 A;  3IFW B;  4M8N A;  2K0P A;  1I35 A;  1JAL A;  3TEZ A;  5BYQ A;  5AZG A;  2ZW0 A;  4JKE A;  2N9L A;  3MJ5 A;  4HCP B;  2M1M A;  4UDU C;  2G3Q B;  1WYW B;  1BXT A;  1X11 A;  4AWJ A;  1WG7 A;  1C4C A;  3L08 A;  1WZ0 A;  1W1D A;  3UIN B;  2LXC A;  2IDY A;  1RWS A;  1WGQ A;  4IOI E;  5IP4 D;  4A6F A;  1SB3 C;  1ET6 A;  4WJ7 A;  1GNU A;  1T0R C;  2GB1 A;  3A9K B;  4CHJ A;  1M94 A;  2Q5W D;  1NI3 A;  1NYR A;  3MC9 A;  4C4V B;  2ABD A;  2W54 A;  2Z14 A;  3VH3 B;  3IT6 B;  2DYQ A;  2VRR B;  2GBN A;  2JVC A;  3P4R B;  2RQ1 A;  2EKE C;  2N4F A;  2D3A A;  4TYZ A;  2MW5 A;  1DIK A;  1E9M A;  4LNI A;  4HB3 B;  3SO6 A;  2CKH B;  2PEA A;  3O13 A;  1KZ7 A;  2KIG A;  1T77 A;  3ZNI D;  1UGM A;  1ZPS A;  3MC0 B;  4JKG B;  2D9V A;  3APD A;  4M0W A;  3DXC A;  2Z0P A;  4HRS A;  1FRR A;  2QHO A;  1DDM A;  2NCN A;  3ZXV A;  2MJD A;  1JWS D;  2DBY A;  1L6U A;  3IBE A;  5CLQ B;  1FGZ A;  3I5J C;  3LXF A;  3F5R A;  2MBO A;  3AB5 A;  3N1Y C;  1V49 A;  1J7C A;  3QAR A;  1L5P A;  2K8B A;  3BYT B;  1ZYI A;  4GLS C;  5D2M B;  2NZ8 B;  1P7F A;  3ML8 A;  1C4A A;  5J3T A;  2R61 A;  1Z5S B;  3VQI A;  3KLS X;  4FAD A;  1J19 A;  1BTK A;  1GC6 A;  2DZJ A;  4TQ0 A;  5D3W A;  4J3O D;  4II3 B;  2QCZ A;  2G1E A;  2MBE A;  2N9X A;  1OQN A;  2YS5 A;  3W2D A;  1YX6 B;  3D8F A;  3SBG A;  4ZRI A;  1DDV A;  3WAP A;  2ONQ A;  3V05 A;  1A5R A;  5D6J B;  5C5B A;  3DWM A;  1WX7 A;  2ROV A;  1QQR A;  2BB5 A;  5TSS A;  2C7N B;  2O2V B;  1TY0 A;  1AQC A;  4EZL A;  1QOG A;  1SIJ A;  4IDI A;  3V6C B;  4WSF A;  3PTF C;  3W1Y A;  3HVZ A;  2ZJD A;  4S17 A;  1NEN B;  5C1Z A;  1WM2 A;  2D3B A;  4K1R B;  2JF5 A;  1MVK A;  2P0D A;  2RNR B;  2MWS B;  3MDB C;  5LNK 1;  1D6E C;  2L52 A;  2MSE D;  1TS3 A;  2WXM A;  1FCC C;  2NMB A;  1U2B A;  4KGS A;  2QDF A;  3L10 B;  3Q3M C;  2V3N A;  2JYE A;  4YT0 B;  1RJ2 A;  4KHB A;  4IM3 A;  3DCG A;  2MP2 A;  2WS3 B;  3ZRC A;  3NUH B;  2LVQ A;  1P9D U;  1T0S C;  1HXY D;  1V5O A;  1WSP A;  5FI1 A;  2KLC A;  4L1R A;  1EVH A;  2K5P A;  3H7S A;  2KGX B;  2MCN B;  1MG4 A;  4DHZ B;  3M1I B;  2YVC A;  3BIN A;  1N3H A;  3MTN B;  2FUG 1;  2LGX A;  2K8C A;  4DIX A;  1RRP B;  1ST7 A;  3DCX A;  1A70 A;  2MH7 A;  4JKD A;  1KJT A;  1DRO A;  2NBW B;  5G5H A;  5D7G A;  3VUW A;  3D32 A;  4EKU A;  2OQB A;  4DHJ B;  1PGA A;  3FKY A;  4B95 A;  4BBN C;  3VR9 B;  2PZ1 A;  3NVZ A;  3AE7 B;  3EFU A;  5EE0 A;  5JHA A;  1R7S A;  4HB2 B;  1WWT A;  3AN1 A;  3GP7 A;  1WIA A;  1I4X A;  2BQQ A;  1QQG A;  3R2T A;  4DBB A;  4KVG B;  1C76 A;  1J7B A;  1VDV A;  1WGH A;  4RGO S;  3PGE A;  4MEL A;  4HK2 A;  4KIK B;  2DLW A;  2CU3 A;  1CQV A;  1FFV A;  2HDE A;  3H1U A;  1W1H A;  3NS8 A;  1E90 A;  1WJ6 A;  4GXB A;  1F1H A;  2M38 A;  1Q1O A;  2VKI A;  2KWC A;  2RGF A;  1X1M A;  5CHF A;  3FC4 A;  3AED B;  3HQC A;  1SE3 A;  1XR0 B;  5DH9 B;  5AUI A;  4W9H A;  1I2H A;  5HFY A;  3P6A A;  3ZGZ A;  1AYF A;  2HTH A;  3EHV A;  2IGG A;  2W3S A;  3DHH C;  3P4S B;  4A90 A;  5BO4 B;  1WH3 A;  2IBI B;  2WXH A;  5G2N A;  2Y3A A;  1L0Y B;  1D5Z C;  4IKG A;  3VIA A;  1X05 A;  4GDK A;  2C7M B;  3AU5 A;  3ZTD A;  2UZS A;  1YNT E;  4A6F B;  4BKT A;  4KHO A;  3KUZ A;  2JYT A;  4DBG A;  2YRY A;  4FJZ A;  1I42 A;  1K50 A;  2Z59 A;  4MM3 A;  4HAW B;  5IAA C;  1WE7 A;  2N7D A;  3WAL A;  1E7P B;  2H88 B;  2MLB A;  4XDD A;  2XK5 B;  1D5M C;  3WAO A;  2LRU A;  2FAZ A;  2V3P A;  3SEB A;  3PVW A;  3AE8 B;  2VH1 A;  2ZNV C;  2M56 B;  3TSS A;  4H8S A;  2J0J A;  4NAW B;  3VFK A;  4FA6 A;  3TEY A;  2NBU A;  4D2K A;  4MGZ E;  2L3Z A;  3ULC A;  3EPY A;  1WM3 A;  4GNK B;  3ENB A;  2G35 A;  4E3C A;  5LXI B;  2WU5 B;  4GIV A;  2KMM A;  4FXC A;  1Q0W B;  5JZE B;  2OHF A;  1VBH A;  3SHQ A;  2MRP A;  3MFG A;  4IW0 A;  3SYX A;  2JZ3 B;  4FUL A;  1GG3 A;  4C00 A;  4JGH B;  3NSU A;  5E6P A;  4US9 A;  3AH7 A;  5E6J A;  4W9F A;  2KDF B;  1V1O A;  1WFY A;  4RM9 A;  3FM8 C;  1CK1 A;  1C3T A;  4GB9 A;  2HE7 A;  3FEH A;  3G9W A;  3EEC A;  3DWG C;  3A4S C;  2HTM E;  2M19 A;  2YT0 A;  1TGZ B;  1XO3 A;  3RN9 C;  4TMA B;  2JZP A;  5C6R A;  2BYV E;  4N58 A;  2WXF A;  2DN6 A;  3Q69 A;  4BVU C;  1TQZ A;  4GMV A;  4RMA A;  1XKE A;  2OJR A;  2R2Q A;  2MDX A;  1F77 A;  4RGT A;  5C5B B;  1TZO A;  2N1W A;  2SAK A;  4F7G A;  3HIE A;  2BCJ A;  3FIL A;  3A8Q A;  3E9O A;  2INP E;  4ZRJ A;  2J7Q B;  2A4Z A;  3PPA A;  3L17 A;  3H8H A;  1N60 A;  4YXD B;  2PVO D;  2GI9 A;  1PFD A;  2BS2 B;  3Q3N C;  4WWM A;  1DBH A;  4USA A;  3VTW A;  1E8Y A;  4FBJ B;  1WGD A;  2VH2 A;  2G45 B;  3DBL I;  2GBJ A;  1V88 A;  4KHB B;  3KVF B;  4OZA A;  4G50 A;  4ITK A;  1WX8 A;  3N9Y C;  2YF0 A;  5HE2 A;  2D4Q A;  3ZLZ A;  1RM6 C;  3X0W A;  4HDQ A;  1NTY A;  1KLG D;  2Z8L A;  3DVG Y;  4M02 A;  3DHG C;  5J17 A;  4DXG A;  4XZ4 A;  1P98 A;  1OTR B;  3QJZ A;  1J0G A;  3P42 A;  2GBM A;  2H89 B;  5CLL B;  2KDI A;  2WWZ A;  5LOP B;  5LG4 B;  1TKY A;  4F7H A;  2Y5C A;  4YTP B;  3U30 A;  2WXL A;  4OSN A;  1S1Q B;  4P6V F;  5BYS A;  1WXA A;  2W55 A;  3AMZ A;  4MH8 A;  1KRH A;  3U2S C;  1X1G A;  1WGR A;  2ELB A;  2LUL A;  2DYM A;  1MKE A;  1I4R A;  1P3R A;  4E74 A;  3A9K A;  4F7Z A;  4DX9 0;  2YLM A;  3BYY B;  4L1B A;  5GXG B;  2Z4D A;  2N1V A;  2WXJ A;  3BVM A;  5HHD G;  3NVV A;  1LO5 D;  5DHA B;  4QAY A;  4LDT B;  3GS2 A;  2J0M A;  4RM8 A;  1LB1 A;  2WYQ A;  2ADZ A;  3OAN A;  5AUK A;  2I1K A;  3DXE A;  5DPS A;  2LGI A;  3NZU A;  3ZYY X;  1UNP A;  3B77 A;  3UIO B;  1OGW A;  4JKG A;  1V80 A;  1TJE A;  1WGU A;  1GB4 A;  1RFK A;  3ZNZ B;  3H9D A;  2IPK D;  4WJO A;  2DKQ A;  3TCA A;  4XC2 A;  3U4E G;  3HK0 A;  1XEE A;  1OQY A;  3SR6 A;  2M14 A;  2X0S A;  2P0H A;  4LJO B;  4KGT A;  4NZL B;  2KUP A;  2C7H A;  2E3T A;  3AV8 A;  4OZB A;  4YON A;  2DYB A;  2PIA A;  2QKL A;  3AE1 B;  3RZW C;  4PT5 A;  2DZM A;  4DHJ D;  4KX6 B;  4S0R A;  1EWY C;  4WUR A;  1FIQ A;  2MBQ A;  1K5G B;  2H7E A;  5HE1 A;  4PYZ A;  2CB8 A;  4WJQ A;  1UEF A;  3BY4 B;  2WXO A;  2XN9 C;  4Z2N A;  1V8C A;  2FJU B;  3AEB B;  2LGY A;  2W82 A;  3TBL D;  1UNS A;  4NNJ B;  3HSA A;  2KUQ A;  1WZ3 A;  4CSQ A;  1B1Z A;  2VSZ A;  1ZXH A;  5BMI A;  1XCQ L;  2ZVO A;  2CHW A;  2O2V A;  3E66 A;  1ET9 A;  3DOW A;  1FGY A;  5D94 A;  5TR5 A;  3ML9 A;  2DX5 B;  2G9H D;  4HAZ B;  2BF8 B;  3SNH A;  4QXA B;  3V61 A;  4GDL B;  3BZD B;  4IG7 B;  3RNB C;  4ZHO A;  3DXD A;  1D4B A;  3ZKJ C;  5JXV A;  2HRJ A;  3JYU A;  3NW8 A;  1HTO A;  2KC2 A;  4P16 A;  3VHT C;  2R0D A;  4WAF A;  2LUE A;  4KDI C;  2RGN B;  4GZU A;  2L83 A;  3KUD B;  4PS8 A;  3EC8 A;  1J0W A;  3DHI C;  1QOB A;  3RNF C;  2KTR A;  1QLB B;  1SJH D;  1Z2M A;  2KIE A;  1E7U A;  4GMX B;  1V2Y A;  3QAQ A;  3U7Z A;  3Q8C A;  4EUT A;  2N23 A;  3ZQ4 A;  4DXF A;  4EJN A;  1B55 A;  1YN3 A;  4IAP A;  3VR8 B;  3Q3F A;  4HXD A;  1E8W A;  2DFK A;  3KYD D;  4FN2 A;  1VCB A;  4BKG A;  2ZNV B;  2UU7 A;  4DHZ E;  1YQB A;  2WLB A;  3DVN V;  4JE3 B;  2GLS A;  2KLG A;  4WH4 A;  5HI1 A;  1SE9 A;  4H2A A;  4WIP A;  3QWM A;  3N30 A;  1FFU A;  2JSV X;  2SEB D;  2QEJ C;  1ZP0 B;  1I4P A;  2D5G A;  2TSS A;  4YSY B;  4F1S A;  2AQ1 B;  1VRA B;  1FXT B;  4KIK A;  4CYE A;  2P8V A;  4GPT B;  5DPT A;  4ZRQ A;  3VTU A;  1ACA A;  4C7Y A;  1MAI A;  1OQR A;  3GZN B;  3UQA A;  2ZKM X;  2WXI A;  4IM2 A;  3NWA A;  1K52 A;  3RNA C;  1UBI A;  2BS4 B;  3HM6 X;  3PEG A;  4XDC A;  1GB1 A;  4P7I A;  1LXD A;  3BVG A;  2OTX A;  4HEA 1;  2LOZ A;  4HJK A;  1PDX A;  3HW2 B;  1MHX A;  3P1M A;  2RDH A;  2I5C A;  3RCP A;  2WDQ B;  3NG0 A;  2NTS A;  3AM9 A;  4DQO C;  1ENF A;  2N9P C;  1MFW A;  1XT9 B;  4A20 A;  4DX8 A;  3FVC A;  5AEK B;  3ZDT A;  2GUM A;  1XQQ A;  2BBC A;  3W1S C;  4JKH A;  4MGI E;  2YEP B;  4OVZ A;  1TS2 A;  3KSY A;  5BMG A;  4WWN A;  2BYF A;  2XK5 A;  2LWP A;  4R3D A;  1EUV B;  4BKS D;  3LJ3 A;  3PG7 A;  2BWF A;  2FUH B;  3TW1 A;  5D3I B;  2FCM A;  1FMA D;  4LNF A;  2K1F A;  2CHZ A;  4BFR A;  4NAW A;  3QA8 A;  1V97 A;  3SBT A;  3R7Q A;  2LKO A;  1XLN A;  3GYP A;  1VLB A;  4LCD E;  4C80 A;  3PZD A;  5JHH A;  5IOI A;  4BOS C;  5GMV A;  2D11 A;  4HAY B;  1F2R I;  5KHO A;  1V5U A;  2DZI A;  1AW7 A;  3S2A A;  2O6V B;  3MPX A;  2Y7B A;  2DEN B;  1ZM0 A;  4HPL B;  3IVF A;  1ZC3 B;  2IZV B;  2DHI A;  2MQJ A;  3VRA B;  5JLJ B;  3Q8F A;  2VRW B;  2WXN A;  3KY9 A;  2WX1 A;  2WDT B;  4WQM A;  3PP2 A;  3AE5 B;  2YEP F;  2EEL A;  4HHV A;  3DBH B;  3D8E A;  1LM8 B;  2KN4 A;  4LTU A;  1EF5 A;  3SFE B;  1UEL A;  1MPE A;  1WI0 A;  3OLM D;  4F8C B;  4GU2 A;  2N0S B;  3R2I A;  1CJE A;  4M00 A;  1IRS A;  1HTQ A;  2J59 M;  1VZ7 A;  2GMI C;  4ARC A;  3SDL C;  3Q8B A;  1TKE A;  1Q67 A;  1V81 A;  4TV3 A;  3AEG B;  4K3C A;  4ZHP A;  5C79 A;  1UPR A;  3BJI A;  1E6E B;  2GOW A;  2GCL A;  4MAC A;  4XWT A;  1G6J A;  4N9F 4;  4EE2 A;  4J6I A;  1DYQ A;  3NY5 A;  5T8I A;  3Q14 C;  3W1S A;  3MHZ A;  3KWL A;  4HKZ E;  2IJ0 A;  4A8X C;  4BKS A;  1U5E A;  5J3Y A;  2OOB B;  3ODO A;  4WWO A;  2FJL A;  5H92 C;  4IWQ A;  2M0A A;  4LDT D;  4L2Y A;  2Y8G A;  1L0V B;  2QMT A;  4QJ3 B;  2CU1 A;  4IM0 A;  2WQY B;  3DVN U;  3N1X C;  4RH6 A;  3WAN A;  3DBR B;  3ZTC A;  3TEX A;  3A1Q B;  1R4M B;  3LYY A;  4JLC A;  4EFO A;  2W9N A;  2KTR B;  3U8Z A;  1QKZ A;  3VAW A;  3D8D A;  1SGH A;  3ULB A;  4A6H A;  1TZ1 A;  2ZPN A;  4HAV B;  4MEM A;  4YL8 A;  5IO9 A;  1CMX B;  1EGX A;  2Z0D B;  3RNG C;  1V6E A;  1U29 A;  1UUP A;  1MIX A;  3RD2 A;  3AE2 B;  2DX1 A;  1CZP A;  1J7A A;  4XYC A;  5KQ4 A;  1WJ1 A;  3WYF B;  4JWS C;  5DHF B;  1IGC A;  4FJV B;  3T9L A;  5KCV A;  2WNM A;  3TVV A;  3FSS A;  3K9P B;  5E6O A;  3WAM A;  2L05 A;  3PZ8 A;  2KR0 A;  2LGD A;  3AI5 A;  3MP9 A;  4WJP A;  2C9W B;  3HM3 A;  1XD3 B;  4CHK A;  1VR9 A;  1P7E A;  1SE4 A;  2IND C;  4MGK E;  1RRB A;  1RAX A;  2L32 A;  4ZYS A;  3L0W B;  1XLQ A;  4F7U P;  4MDK E;  2K2J A;  3R66 C;  3L54 A;  2V3S A;  3KQ4 A;  1EF1 A;  3E56 A;  5EE9 A;  2Z0E B;  3CSF A;  3H6N A;  2MBH A;  2R09 A;  3VVW B;  1N62 A;  5BYR A;  4KSK C;  4BZA A;  5JHG A;  1IUE A;  1NI2 A;  3V60 A;  2D9W A;  3NZS A;  3PHW B;  1KLV A;  4GSW A;  1AN8 A;  2JUO A;  4EEW A;  4NQL B;  2FDQ A;  1U27 A;  2WX0 A;  2IYD B;  2G4D B;  1R4N B;  1RLF A;  2PW9 A;  1N5W A;  3FLV A;  2L0T A;  2RLO A;  2YSZ A;  5D3D A;  3TL5 A;  4YTM B;  1KI1 B;  1UGJ A;  3CIR B;  1AWE A;  1EU3 A;  2Z0Q A;  4XX5 A;  5KQ1 A;  1IGD A;  3ZUN A;  2N7J A;  4MSQ B;  1ZE3 D;  3HHM A;  1EU4 A;  3QWZ B;  1C9F A;  4MH0 E;  3ZW3 A;  1JWM D;  2BTE A;  1NEK B;  5L81 A;  1VD2 A;  5C16 A;  5MPO A;  1EWC A;  2H7D A;  3BK1 A;  3OJ3 A;  4ZRP A;  3CIK A;  2KWV B;  3KRX A;  3AJ4 A;  4K2P A;  2LGS A;  2IGD A;  3ZVR A;  1TJ6 A;  2HJ1 A;  3H7P B;  2IO2 B;  4W9K A;  3ZXR A;  4K17 A;  4AQ7 A;  1HZ5 A;  2V4L A;  3VTV A;  2CHX A;  3R8B A;  3VXW A;  1MIZ B;  2AQ3 B;  2PTL A;  1K8R B;  1V1P B;  3VH4 B;  3RZF A;  2DLB A;  4YTN B;  2PVG C;  1QOA A;  5D3Y A;  2NTT A;  1FPY A;  4O1N A;  2RD0 A;  3Q3J A;  2DX5 A;  2MEK A;  1KTK A;  1DOY A;  1WGY A;  3HRD D;  3TEW A;  3IXS A;  4GDL A;  3NJT A;  4GOC A;  1UF0 A;  1C4P A;  4NJ6 A;  2L2I A;  1EAZ A;  2RR9 A;  1YJ1 A;  2QJL A;  2ZCB A;  1MI0 A;  2AYO B;  3C19 A;  1JWB D;  1T3Q A;  1NDD A;  3SFD B;  2NPT B;  3TFM A;  5IRS A;  1V86 A;  4II2 B;  3PVL A;  4PK1 A;  2QIE B;  1BML C;  4MJS B;  3B2G A;  5E6N A;  1JWU D;  2QSD A;  5AZH A;  1HA5 A;  3PO0 A;  2DA0 A;  1XLP A;  3B2F A;  4PS7 A;  3ZIM A;  2RUK B;  1T0Q C;  5I2M A;  2VZK B;  2DYO A;  2LBB A;  1QC6 A;  1FEH A;  2FE8 A;  1JML A;  1IBX A;  4JKC A;  4WJN A;  1YJI A;  2WU2 B;  1H10 A;  1QOF A;  2K9X A;  2LJ5 A;  2COP A;  1F52 A;  2LMC A;  1FRD A;  1M7E A;  2CY5 A;  2JU6 X;  4PQ0 A;  2DNF A;  1ZKH A;  2O6V D;  1WVH A;  2COA A;  2L1C A;  2DHJ A;  3QX1 A;  2V1Y A;  3A58 A;  2D9Y A;  2KQ7 A;  3VUY A;  4B6W A;  1FXI A;  1ISN A;  3NVY A;  4EMO A;  3B08 A;  4DXA B;  2MX2 A;  4EOY A;  1WXV A;  4LNK A;  5BMH A;  3E9L A;  3MHS D;  5HE3 A;  1YD8 U;  2J52 A;  5L95 C;  4E71 A;  3PT2 B;  2KOX A;  4NAM A;  3T8M A;  1WMH B;  2CY4 A;  2R82 A;  2NBV A;  1FHW A;  4BOZ B;  1I4H A;  3AEE B;  3TUO A;  2FJ9 A;  3PRP B;  3I63 C;  3MC8 A;  2KDB A;  1SEB D;  1JDE A;  2KN5 A;  2JP2 A;  4HKQ A;  2PE6 B;  4WVF B;  2OED A;  1T5X D;  3AE9 B;  1K53 A;  2YT2 A;  1C1Y B;  1YQ3 B;  1SF0 A;  4N6E B;  1GC7 A;  2J0K A;  1F2R C;  3DBL B;  2N0Y A;  4PYU A;  1V9J A;  4TQ1 A;  3U7D A;  3ZVV A;  1DOI A;  1TXD A;  4XWX A;  1JWA D;  2Z0O A;  2CAY A;  4G11 A;  3NVW A;  2ROZ B;  3I3T B;  1UNR A;  2DAJ A;  2KX3 A;  1Z87 A;  3L16 A;  3U52 E;  2QKM A;  3ALB A;  2IYB A;  3GE3 C;  1IYF A;  2INN E;  4MK0 A;  3EGR A;  1ZDV A;  3U12 A;  3GE8 C;  4HLE A;  2MJ3 A;  2O6V A;  3UQB A;  2IY0 B;  4GN1 A;  2EMS A;  2UVM A;  4K7U A;  1TKG A;  1X86 A;  1QT9 A;  4DDI D;  3NRZ A;  1DGJ A;  4NPN A;  4HSI A;  4DDG D;  4PNK A;  4HB0 B;  4W9J A;  1PGX A;  1Q10 A;  3IHP C;  2V4I B;  1QIL A;  1UBQ A;  4JIO U;  1E8X A;  4BBK A;  5D3V A;  2FCN A;  4MGY E;  1KF6 B;  3PS6 A;  4K2O A;  2RPV A;  3K9O B;  3AU4 A;  1V61 A;  1U5F A;  2NVU I;  1K51 A;  4IC7 B;  2KAC A;  1YQ4 B;  3P4Q B;  1Y8R C;  3A33 B;  1XOD A;  2P0F A;  2HD5 B;  1F0Z A;  4D6W A;  2RSG A;  3QIJ A;  2JZZ A;  3RFZ B;  2LAS A;  3B0A A;  1P3Q U;  1HEZ E;  3OAW A;  4ANU A;  2W2X C;  4JKA A;  3ETR A;  1I7A A;  4OZC A;  1P0R A;  2C5L C;  2I38 A;  2BWE S;  1XXG A;  1WRI A;  2KYW A;  3RMK C;  3P4P B;  1XD4 A;  3V62 A;  1GAQ B;  4CHM A;  4K3B A;  3TJP A;  4BBN F;  3RUI B;  4US8 A;  3N32 A;  5J18 A;  2WP9 B;  1PQS A;  4LLG M;  3O96 A;  1TS4 A;  3GYO A;  5AZF A;  4JK9 A;  1WY8 A;  2KK8 A;  4AJY B;  3KWV A;  4ASW C;  2EMT A;  1BWN A;  3CWI A;  4FLH A;  3A1Q A;  4BAX A;  4ICV A;  2G4S A;  2JXX A;  1WJN A;  3TO1 A;  2XEW A;  3RCZ A;  4JQW C;  2L8J A;  4OVU A;  4IUM B;  1MPH A;  1TY2 A;  4HDO A;  1IBX B;  4OVV A;  2KDM A;  3I9V 1;  1L6V A;  5CHW A;  1F9J A;  2XNA C;  4ZDV A;  4CQN A;  1XCT L;  3ZNG C;  4JX1 C;  1VBG A;  1GGO A;  4HAU B;  1TS5 A;  1C78 A;  3N1Z C;  3Q2A C;  1QZE A;  3RT3 B;  3SD5 A;  2CR5 A;  2DTC A;  4IOY X;  3L4P A;  2LEK A;  4FJY A;  2KXJ A;  2UZR A;  2K6Q A;  4C56 C;  3FAH A;  1EM7 A;  5IA7 A;  3KYC D;  5JVL A;  4YWG G;  2JQR B;  3WIM A;  2DIK A;  3W5U B;  1FOE A;  4TSS A;  2N9K A;  5G55 A;  5C2T B;  2EKI A;  1UH6 A;  2GBR A;  2WXQ A;  5DI9 B;  1K5D B;  2D07 B;  3M95 A;  2Y8F A;  4A55 A;  1HQR D;  4G3X B;  3E9S A;  4NJC A;  4WAA A;  2KNB A;  4LNO A;  2K49 A;  2ELA A;  2NBV B;  1BT0 A;  1WXQ A;  3OG5 A;  4Q2J A;  2L0F A;  3N20 C;  2ZEQ A;  1BAK A;  2MA9 B;  2UYZ B;  2KZR A;  4XGA B;  4B0E A;  3C0R B;  3BII D;  3SU8 X;  3DVG X;  4A6K A;  4KKI A;  3T3N A;  2KO3 A;  4ICU A;  5DIF B;  2D3G A;  3IAS 1;  2BYT A;  2MKR A;  2E6X A;  1BTN A;  2ASQ A;  2MHJ A;  3ONS A;  1FO4 A;  1ZXI A;  3JSV B;  3QCA A;  1I7H A;  1ROE A;  5DPR A;  4DK5 A;  4AP4 C;  2VZK D;  2KX0 A;  2WDV B;  3DBH I;  3I57 A;  2ACZ B;  2LG1 A;  2PE9 A;  1KZG A;  3AUL A;  2GRI A;  1PMS A;  3AE6 B;  3NZ3 A;  3QC8 B;  4EZK A;  4GOU A;  2K22 A;  1STE A;  5GOW B;  1V5T A;  3DPD A;  4HB4 B;  3H7P A;  2COD A;  1OQQ A;  2GBK A;  3A4R A;  4W9C A;  2QC8 A;  2N7E A;  2AEH A;  3VRB B;  3RI7 C;  4HPP A;  1PYW D;  3T06 A;  2EC1 A;  1GPX A;  4FHJ A;  1LW3 A;  2DZK A;  1RFA A;  3NS1 A;  5J3Q A;  1NBF C;  1V1P A;  2K8H A;  4ANW A;  3AEA B;  3J9C A;  1WJU A;  2RRF A;  1NU2 A;  3APC A;  3FP5 A;  2KKC A;  2Y5P A;  3UF8 A;  2L1A A;  3CF6 E;  5G5G A;  5I4D A;  2BGF A;  4LK0 M;  2KTF A;  2CRF A;  3P7Z A;  5LXH A;  2IO0 B;  2IO1 B;  1OY2 A;  1HBK A;  1MK9 B;  3RUL A;  1H8C A;  2RPQ A;  4GGQ A;  2LYD A;  4B9K A;  2R2Y A;  1UD7 A;  3UI3 A;  3EFC A;  4HAT B;  2KJR A;  2NPT A;  2KMC A;  5HG2 A;  3DBR I;  3BVZ A;  1XLO A;  3A9J A;  4TKN A;  4MJS A;  1R4M I;  3B1L X;  2Y5B B;  2IFS A;  1FB8 A;  3KRW A;  3ZJV A;  4HVB A;  2KQS A;  5FR3 A;  5M4Y B;  2D3C A;  2LOX A;  3CXB B;  3QK0 A;  3GB1 A;  1M4V A;  3ZO5 B;  3KH0 A;  1KBL A;  4HWI B;  4NSW A;  2L76 A;  2J42 A;  5DPW A;  3F0W A;  1I4Q A;  2FNJ B;  2IGH A;  2RDG A;  3Q3O C;  1E5W A;  2KVR A;  3ODX A; 
#chains in the Genus database with same CATH homology
 3UIP B;  3PHX B;  2KFK B;  2KDE B;  5KHQ A;  3ECI A;  3X23 A;  3ENE A;  5EDS A;  1MG8 A;  2JRI B;  2V76 A;  3APF A;  1FAO A;  2LVP A;  2CQU A;  4AUQ C;  3R3M A;  2BKR B;  1S3S G;  5HE0 A;  4KDL B;  3IG3 A;  4W9L A;  1WMH A;  1YX5 B;  2AL6 A;  2FID A;  2ZVN A;  2RVB B;  5CX3 A;  5FR6 A;  1WRD B;  3JW0 X;  2IO3 B;  1R4N I;  4JK7 A;  4MY6 A;  2M17 A;  4W9I A;  1FHX A;  3CMM B;  2M4N A;  5IJM A;  1LFD A;  3NHE B;  2JPH A;  4CO7 A;  4URK A;  1HB8 A;  5LON B;  2KD0 A;  4X57 B;  4IWO A;  2KHW B;  1JRU A;  3GOE A;  4IWP A;  4L6E A;  5L83 A;  2D9X A;  3UGB B;  1OEY J;  2ZZP B;  4W9D A;  2K39 A;  2GCJ A;  4NQK E;  3RYT A;  5JHB A;  1ZVR A;  5DCN A;  4K7W A;  3VOQ A;  3VDZ A;  5FI0 A;  1UNQ A;  4KSL C;  2BPS A;  4ANX A;  1V5M A;  2YS1 A;  2K00 A;  3LDZ E;  4ZRK A;  2KJ6 A;  4ILH A;  4ILG B;  2X18 A;  5EFX A;  4KHA A;  1NTI A;  4DWF A;  2I5F A;  3M3J A;  1OEY A;  4ANV A;  2D9Z A;  3NOB A;  4ILJ A;  1OMW A;  3PV1 A;  5C23 A;  3KW5 B;  5JH5 C;  3L13 A;  2XBB C;  5CTR C;  4A5K A;  1V89 A;  4M0W B;  2KWU B;  2GS0 A;  1Y5O A;  1WX9 A;  4JK8 A;  2C60 A;  2PPH A;  2NR2 A;  1U4A A;  2FIF A;  5D3X A;  4A3P A;  2E2X A;  2DHK A;  3WA0 A;  3A9J B;  3PLV A;  3TIX A;  2CS4 A;  2IY1 B;  3AXC A;  2Q13 A;  1IPG A;  2UWQ A;  2WH5 A;  3DDC B;  4EZJ A;  1Y19 B;  4K81 A;  3QQ8 B;  1H4R A;  1NVL A;  1AAR A;  1HB6 A;  3PSE B;  1U5D A;  1HE8 A;  2HJ8 A;  1D3Z A;  2LZ6 A;  2MBB B;  3ZNH B;  1WXS A;  1E7V A;  4KZC A;  2YS3 A;  3PVU A;  4C0A A;  2B3A A;  4JKB A;  1WE6 A;  3N7C A;  1WI1 A;  1P5T A;  2D10 A;  1SHC A;  1Q5W B;  2MP2 B;  3ML4 A;  3JVZ X;  4PS3 A;  2COF A;  1KM7 A;  2LVO A;  1KC7 A;  1X1F A;  2A5U A;  2LRW A;  2KCJ A;  2XQN M;  4MT7 A;  4D0N B;  2BYE A;  5J2R A;  3OJ4 B;  1DDW A;  1WJM A;  3R7R A;  1FHO A;  2D2Q A;  1WXM A;  3QHT A;  2BKF A;  1KOT A;  4A3O A;  1M7R A;  3M63 B;  1WF9 A;  4W9E A;  2FCS A;  4WQO B;  3JSV A;  1PFJ A;  2JWZ A;  3TMP B;  4IFS A;  2YT1 A;  3ODW A;  4JL9 A;  2ZPY A;  3N3K B;  2MFQ A;  2JRH A;  3KZ1 A;  4KZ0 A;  1ZC4 B;  2HTH B;  1ZW7 A;  2I1J A;  1L2N A;  2KMA A;  4KAX B;  1WGG A;  3QBV B;  3PSC A;  2JY6 A;  5LLI A;  3DQV A;  2REX A;  2COC A;  2DAF A;  5CHV C;  4GDK B;  1V5P A;  3A8P A;  3E9P A;  1J8C A;  2Z59 B;  2K6D B;  2KAN A;  2L7R A;  4Y94 A;  1LQB A;  1GUA B;  1W1G A;  1MK7 B;  2KJH B;  3SV1 A;  3M62 B;  1TTN A;  3PRM B;  3PLU A;  1YIW A;  4JKF A;  3ZRF A;  1ZSQ A;  1ZGU B;  3UZT A;  4W9G A;  1P1A A;  2K2U A;  2W2X D;  1UZX B;  2DHZ A;  1WR6 E;  4KV2 A;  3V6E B;  2GJY A;  5D27 A;  2R2O A;  1E8Z A;  1IP9 A;  4I6P A;  3SUZ A;  3PRE A;  3A98 B;  2DKP A;  1L7Y A;  3O65 B;  4G0N B;  1T0Y A;  2M8S A;  4M8M A;  2AL3 A;  2M0X A;  3V5W A;  1WR1 A;  5JP4 A;  1WJ4 A;  1UPQ A;  2KFK A;  1SIF A;  3ZDM C;  2K25 A;  4FHK A;  4I6N B;  4I6L B;  2N9E B;  4HCN B;  4NY0 A;  2PJH A;  3P2B A;  4AOF A;  3GZN I;  2ZCC A;  1NTV A;  2KC1 A;  4NJ7 A;  4HPM B;  4ZYN A;  2FCQ A;  4TUU A;  3LJU X;  1GJZ A;  4B6H A;  2AWT A;  2L00 B;  2W2W A;  1PLS A;  2JT4 B;  2LXA A;  3CST A;  1XCG A;  2MWN B;  3VUX A;  2EJ8 A;  3HIZ A;  1XX0 A;  2KFJ A;  1TBE A;  2LD9 A;  4MSM B;  1P6S A;  4Z2M B;  2DYN A;  2LI5 A;  2RSU A;  3DBS A;  1DYN A;  4WWP A;  3PRZ A;  2NS5 A;  4HAX B;  5HKH A;  3KUC B;  1U5G A;  4AJW A;  4LJP B;  4K7S A;  3MJW A;  1EO6 A;  3IFW B;  4M8N A;  1I35 A;  5AZG A;  4JKE A;  4HCP B;  2M1M A;  2G3Q B;  1WYW B;  1X11 A;  4AWJ A;  1WG7 A;  3L08 A;  1WZ0 A;  1W1D A;  3UIN B;  2LXC A;  1WGQ A;  4A6F A;  4WJ7 A;  1GNU A;  3A9K B;  4CHJ A;  1M94 A;  2ABD A;  3VH3 B;  2DYQ A;  2VRR B;  2GBN A;  2JVC A;  2RQ1 A;  2EKE C;  2N4F A;  4TYZ A;  2MW5 A;  1DIK A;  4HB3 B;  3SO6 A;  2CKH B;  2PEA A;  1KZ7 A;  3ZNI D;  1UGM A;  4JKG B;  2D9V A;  3APD A;  3DXC A;  2Z0P A;  2QHO A;  1DDM A;  2NCN A;  3IBE A;  5CLQ B;  1FGZ A;  3F5R A;  2MBO A;  1V49 A;  3QAR A;  2K8B A;  5D2M B;  2NZ8 B;  3ML8 A;  5J3T A;  1Z5S B;  3VQI A;  4FAD A;  1J19 A;  1BTK A;  1GC6 A;  2DZJ A;  4TQ0 A;  5D3W A;  4II3 B;  2MBE A;  2N9X A;  1OQN A;  2YS5 A;  1YX6 B;  3D8F A;  3SBG A;  4ZRI A;  1DDV A;  3WAP A;  1A5R A;  5D6J B;  5C5B A;  1WX7 A;  2ROV A;  2C7N B;  2O2V B;  1AQC A;  4EZL A;  3V6C B;  4WSF A;  3PTF C;  3W1Y A;  2ZJD A;  5C1Z A;  1WM2 A;  4K1R B;  2JF5 A;  2P0D A;  2RNR B;  2MWS B;  3MDB C;  2MSE D;  2NMB A;  1U2B A;  3L10 B;  1RJ2 A;  4IM3 A;  3DCG A;  2MP2 A;  3ZRC A;  2LVQ A;  1P9D U;  1V5O A;  5FI1 A;  2KLC A;  1EVH A;  3H7S A;  2KGX B;  2MCN B;  4DHZ B;  3M1I B;  2YVC A;  3BIN A;  1N3H A;  3MTN B;  2LGX A;  2K8C A;  1RRP B;  1ST7 A;  2NBW B;  4JKD A;  1KJT A;  1DRO A;  5D7G A;  3VUW A;  3D32 A;  4EKU A;  2OQB A;  4DHJ B;  4B95 A;  4BBN C;  2PZ1 A;  3EFU A;  5JHA A;  4HB2 B;  1WIA A;  1QQG A;  4DBB A;  4KVG B;  1WGH A;  3PGE A;  4MEL A;  4HK2 A;  4KIK B;  2DLW A;  3H1U A;  1W1H A;  3NS8 A;  1E90 A;  1WJ6 A;  4GXB A;  2M38 A;  1Q1O A;  2VKI A;  2KWC A;  2RGF A;  1X1M A;  5CHF A;  3HQC A;  1XR0 B;  5DH9 B;  4W9H A;  1I2H A;  3P6A A;  2HTH A;  3EHV A;  5BO4 B;  1WH3 A;  2IBI B;  5G2N A;  3VIA A;  1X05 A;  4GDK A;  2C7M B;  3AU5 A;  3ZTD A;  2UZS A;  4A6F B;  4BKT A;  4KHO A;  3KUZ A;  4DBG A;  2YRY A;  4FJZ A;  1I42 A;  4MM3 A;  4HAW B;  5IAA C;  1WE7 A;  2N7D A;  3WAL A;  2MLB A;  2XK5 B;  3WAO A;  2LRU A;  2FAZ A;  3PVW A;  2ZNV C;  4H8S A;  2J0J A;  4NAW B;  3VFK A;  4FA6 A;  2NBU A;  4MGZ E;  2L3Z A;  3ULC A;  3EPY A;  1WM3 A;  3ENB A;  2G35 A;  4E3C A;  5LXI B;  4GIV A;  1Q0W B;  5JZE B;  1VBH A;  3SHQ A;  2MRP A;  4IW0 A;  3SYX A;  2JZ3 B;  4FUL A;  1GG3 A;  4JGH B;  3NSU A;  5E6P A;  4W9F A;  2KDF B;  1WFY A;  4RM9 A;  3FM8 C;  1C3T A;  4GB9 A;  2HE7 A;  3FEH A;  3G9W A;  3EEC A;  3A4S C;  2YT0 A;  1TGZ B;  5C6R A;  2BYV E;  2DN6 A;  4BVU C;  1TQZ A;  4GMV A;  4RMA A;  1XKE A;  2OJR A;  2R2Q A;  2MDX A;  5C5B B;  2N1W A;  4F7G A;  2BCJ A;  3A8Q A;  3E9O A;  4ZRJ A;  2J7Q B;  2A4Z A;  3PPA A;  3L17 A;  1DBH A;  3VTW A;  1E8Y A;  4FBJ B;  1WGD A;  2G45 B;  3DBL I;  2GBJ A;  1V88 A;  4KHB B;  3KVF B;  4G50 A;  1WX8 A;  2YF0 A;  5HE2 A;  2D4Q A;  3ZLZ A;  3X0W A;  4HDQ A;  1NTY A;  3DVG Y;  5J17 A;  4XZ4 A;  1P98 A;  1OTR B;  3QJZ A;  1J0G A;  2GBM A;  5CLL B;  2KDI A;  2WWZ A;  5LOP B;  4F7H A;  3U30 A;  1S1Q B;  1WXA A;  1X1G A;  1WGR A;  2ELB A;  2LUL A;  2DYM A;  1MKE A;  1P3R A;  4E74 A;  3A9K A;  4F7Z A;  4DX9 0;  2YLM A;  2N1V A;  5DHA B;  4LDT B;  2J0M A;  4RM8 A;  1LB1 A;  2WYQ A;  2ADZ A;  3OAN A;  2I1K A;  3DXE A;  5DPS A;  3NZU A;  1UNP A;  3UIO B;  1OGW A;  4JKG A;  1V80 A;  1WGU A;  3ZNZ B;  3H9D A;  4WJO A;  2DKQ A;  3TCA A;  4XC2 A;  3HK0 A;  1OQY A;  2M14 A;  2X0S A;  2P0H A;  4LJO B;  2KUP A;  2C7H A;  4YON A;  2DYB A;  2QKL A;  3RZW C;  2DZM A;  4DHJ D;  2MBQ A;  1K5G B;  2H7E A;  5HE1 A;  4PYZ A;  2CB8 A;  4WJQ A;  1UEF A;  3BY4 B;  4Z2N A;  2LGY A;  3TBL D;  4NNJ B;  1WZ3 A;  2VSZ A;  2ZVO A;  2CHW A;  2O2V A;  3E66 A;  3DOW A;  1FGY A;  5D94 A;  5TR5 A;  3ML9 A;  2DX5 B;  4HAZ B;  2BF8 B;  3SNH A;  3V61 A;  4GDL B;  4IG7 B;  3DXD A;  3ZKJ C;  2HRJ A;  3JYU A;  2KC2 A;  3VHT C;  2R0D A;  2LUE A;  4KDI C;  2RGN B;  4GZU A;  3KUD B;  4PS8 A;  3EC8 A;  1J0W A;  2KTR A;  1Z2M A;  1E7U A;  4GMX B;  1V2Y A;  3QAQ A;  4EUT A;  2N23 A;  4EJN A;  1B55 A;  4IAP A;  3Q3F A;  4HXD A;  1E8W A;  2DFK A;  3KYD D;  4FN2 A;  1VCB A;  4BKG A;  2ZNV B;  4DHZ E;  1YQB A;  3DVN V;  2KLG A;  1SE9 A;  3QWM A;  3N30 A;  4F1S A;  1FXT B;  4KIK A;  4CYE A;  2P8V A;  4GPT B;  5DPT A;  3VTU A;  1ACA A;  1MAI A;  3UQA A;  4IM2 A;  1UBI A;  3HM6 X;  3PEG A;  4P7I A;  1LXD A;  2OTX A;  2LOZ A;  4HJK A;  3HW2 B;  2I5C A;  3RCP A;  2N9P C;  1XT9 B;  4A20 A;  4DX8 A;  5AEK B;  3ZDT A;  1XQQ A;  3W1S C;  4JKH A;  4MGI E;  3KSY A;  4WWN A;  2BYF A;  2XK5 A;  2LWP A;  1EUV B;  4BKS D;  3LJ3 A;  3PG7 A;  2BWF A;  2FUH B;  3TW1 A;  2FCM A;  2K1F A;  2CHZ A;  4BFR A;  4NAW A;  3QA8 A;  3SBT A;  3R7Q A;  2LKO A;  4LCD E;  3GYP A;  3PZD A;  5JHH A;  4BOS C;  5GMV A;  2D11 A;  4HAY B;  5KHO A;  1V5U A;  2DZI A;  3S2A A;  2O6V B;  3MPX A;  2Y7B A;  2DEN B;  1ZM0 A;  4HPL B;  3IVF A;  1ZC3 B;  2IZV B;  2DHI A;  2MQJ A;  5JLJ B;  2VRW B;  3KY9 A;  2WX1 A;  2WDT B;  3PP2 A;  4HHV A;  3D8E A;  1LM8 B;  4F8C B;  1EF5 A;  1UEL A;  1WI0 A;  3OLM D;  4GU2 A;  1IRS A;  2J59 M;  2GMI C;  3SDL C;  1Q67 A;  1V81 A;  4TV3 A;  5C79 A;  1UPR A;  3BJI A;  2GOW A;  2GCL A;  1G6J A;  4N9F 4;  4J6I A;  3NY5 A;  3W1S A;  4BKS A;  1U5E A;  5J3Y A;  2OOB B;  3ODO A;  4WWO A;  2FJL A;  4IWQ A;  4LDT D;  2Y8G A;  2CU1 A;  4IM0 A;  3DVN U;  3WAN A;  3ZTC A;  3A1Q B;  4EFO A;  4JLC A;  2W9N A;  2KTR B;  3U8Z A;  3VAW A;  3D8D A;  1SGH A;  3ULB A;  4A6H A;  1TZ1 A;  2ZPN A;  4HAV B;  4MEM A;  4YL8 A;  1CMX B;  1EGX A;  2Z0D B;  1V6E A;  1U29 A;  3RD2 A;  1MIX A;  2DX1 A;  5KQ4 A;  1WJ1 A;  3WYF B;  5DHF B;  4FJV B;  3T9L A;  5KCV A;  5E6O A;  3TVV A;  3FSS A;  3K9P B;  3WAM A;  2L05 A;  2LGD A;  3AI5 A;  4WJP A;  2C9W B;  3HM3 A;  1XD3 B;  4CHK A;  4MGK E;  1RRB A;  1RAX A;  3L0W B;  4F7U P;  4MDK E;  2K2J A;  3R66 C;  3L54 A;  2V3S A;  1EF1 A;  2Z0E B;  3CSF A;  3H6N A;  2MBH A;  2R09 A;  3VVW B;  4KSK C;  5JHG A;  1NI2 A;  3V60 A;  2D9W A;  3NZS A;  3PHW B;  1KLV A;  4GSW A;  2JUO A;  4EEW A;  4NQL B;  2FDQ A;  1U27 A;  2WX0 A;  2IYD B;  2G4D B;  1RLF A;  3FLV A;  2L0T A;  2RLO A;  2YSZ A;  3TL5 A;  1KI1 B;  1AWE A;  2Z0Q A;  4XX5 A;  5KQ1 A;  3ZUN A;  4MSQ B;  3HHM A;  3QWZ B;  4MH0 E;  3ZW3 A;  5L81 A;  1VD2 A;  5C16 A;  2H7D A;  3OJ3 A;  3CIK A;  2KWV B;  3KRX A;  3AJ4 A;  4K2P A;  3ZVR A;  1TJ6 A;  3H7P B;  2IO2 B;  4W9K A;  4K17 A;  2V4L A;  3VTV A;  2CHX A;  3VXW A;  1MIZ B;  1K8R B;  3VH4 B;  3RZF A;  5D3Y A;  2RD0 A;  3Q3J A;  2DX5 A;  1WGY A;  4GDL A;  4GOC A;  4NJ6 A;  2L2I A;  1EAZ A;  2RR9 A;  1YJ1 A;  2ZCB A;  2AYO B;  1NDD A;  2NPT B;  3TFM A;  1V86 A;  4II2 B;  3PVL A;  4MJS B;  5E6N A;  5AZH A;  2DA0 A;  4PS7 A;  3ZIM A;  2RUK B;  2DYO A;  2LBB A;  1QC6 A;  4JKC A;  4WJN A;  1H10 A;  2LJ5 A;  2COP A;  1M7E A;  2CY5 A;  4PQ0 A;  1ZKH A;  2O6V D;  1WVH A;  2COA A;  2L1C A;  2DHJ A;  3QX1 A;  2V1Y A;  2D9Y A;  2KQ7 A;  3VUY A;  4B6W A;  1ISN A;  4EMO A;  3B08 A;  4DXA B;  2MX2 A;  4EOY A;  1WXV A;  3E9L A;  3MHS D;  5HE3 A;  1YD8 U;  5L95 C;  4E71 A;  3PT2 B;  2KOX A;  3T8M A;  1WMH B;  2CY4 A;  2R82 A;  1FHW A;  4BOZ B;  2FJ9 A;  3PRP B;  2KDB A;  1JDE A;  2KN5 A;  2JP2 A;  2PE6 B;  4WVF B;  1C1Y B;  1GC7 A;  2J0K A;  2N0Y A;  4PYU A;  1V9J A;  4TQ1 A;  3U7D A;  3ZVV A;  1TXD A;  4XWX A;  2Z0O A;  2CAY A;  4G11 A;  2ROZ B;  3I3T B;  1UNR A;  2DAJ A;  2KX3 A;  1Z87 A;  3L16 A;  2QKM A;  3ALB A;  2IYB A;  1IYF A;  4MK0 A;  4HLE A;  2O6V A;  3UQB A;  2IY0 B;  4GN1 A;  2EMS A;  2UVM A;  4K7U A;  1X86 A;  4DDI D;  4NPN A;  4DDG D;  4PNK A;  4HB0 B;  4W9J A;  3IHP C;  1UBQ A;  4JIO U;  1E8X A;  4BBK A;  5D3V A;  2FCN A;  4MGY E;  3PS6 A;  4K2O A;  3K9O B;  3AU4 A;  1V61 A;  1U5F A;  2NVU I;  4IC7 B;  1Y8R C;  3A33 B;  1XOD A;  2P0F A;  2HD5 B;  2RSG A;  3QIJ A;  2JZZ A;  2LAS A;  3B0A A;  1P3Q U;  3OAW A;  4ANU A;  2W2X C;  4JKA A;  1I7A A;  1P0R A;  2C5L C;  2BWE S;  1XD4 A;  3V62 A;  4CHM A;  3TJP A;  4BBN F;  3RUI B;  3N32 A;  5J18 A;  1PQS A;  3O96 A;  3GYO A;  5AZF A;  4JK9 A;  1WY8 A;  2KK8 A;  4AJY B;  4ASW C;  2EMT A;  1BWN A;  4FLH A;  3A1Q A;  4ICV A;  2G4S A;  2JXX A;  1WJN A;  3TO1 A;  2XEW A;  3RCZ A;  4JQW C;  2L8J A;  4OVU A;  4IUM B;  1MPH A;  4HDO A;  4OVV A;  5CHW A;  1F9J A;  4ZDV A;  3ZNG C;  1VBG A;  1GGO A;  4HAU B;  1QZE A;  3RT3 B;  3SD5 A;  2CR5 A;  2DTC A;  4IOY X;  4FJY A;  2KXJ A;  2UZR A;  2K6Q A;  5IA7 A;  3KYC D;  5JVL A;  3WIM A;  2DIK A;  1FOE A;  5G55 A;  1UH6 A;  2GBR A;  5DI9 B;  1K5D B;  2D07 B;  3M95 A;  2Y8F A;  4G3X B;  4WAA A;  2KNB A;  2ELA A;  2NBV B;  1BT0 A;  2L0F A;  2ZEQ A;  1BAK A;  2MA9 B;  2UYZ B;  2KZR A;  3C0R B;  3SU8 X;  3DVG X;  4A6K A;  2KO3 A;  4ICU A;  5DIF B;  2D3G A;  2MKR A;  1BTN A;  2ASQ A;  3ONS A;  3JSV B;  3QCA A;  5DPR A;  4DK5 A;  4AP4 C;  3DBH I;  2KX0 A;  2LG1 A;  2PE9 A;  1KZG A;  3AUL A;  1PMS A;  3QC8 B;  4EZK A;  5GOW B;  1V5T A;  3DPD A;  4HB4 B;  3H7P A;  2COD A;  2GBK A;  4W9C A;  3A4R A;  2N7E A;  2AEH A;  3T06 A;  2EC1 A;  4FHJ A;  1LW3 A;  2DZK A;  1RFA A;  5J3Q A;  1NBF C;  2K8H A;  4ANW A;  1WJU A;  1NU2 A;  3APC A;  3FP5 A;  2KKC A;  3UF8 A;  3CF6 E;  2BGF A;  2KTF A;  2CRF A;  3P7Z A;  5LXH A;  2IO0 B;  2IO1 B;  1OY2 A;  1HBK A;  1MK9 B;  3RUL A;  1H8C A;  2RPQ A;  4GGQ A;  2LYD A;  4B9K A;  1UD7 A;  4HAT B;  2KJR A;  2NPT A;  2KMC A;  3DBR I;  3A9J A;  4TKN A;  4MJS A;  1R4M I;  3B1L X;  2Y5B B;  2IFS A;  1FB8 A;  3KRW A;  4HVB A;  2KQS A;  2LOX A;  3CXB B;  3QK0 A;  3ZO5 B;  3KH0 A;  1KBL A;  4HWI B;  4NSW A;  2L76 A;  5DPW A;  3F0W A;  2FNJ B;  1E5W A;  2KVR A;  3ODX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...