1NIBA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
total genus 87
structure length 333
sequence length 333
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA02
3FU7B 4F2EA 1JVLA 1DZ0A 1IKOP 2XXGA 1NDTA 4MFHA 2I7SA 1AOZA 1UATA 3HB3B 2YARA 4P5RA 1AG0A 4M3HA 5D4JA 1QLEB 3NJLA 5B7MA 3CVBA 1FWXA 1KDJA 3HEIB 3GYRA 3L45A 4GP5B 1GS6X 1AS8A 3T9WA 1NINA 3UAAA 5I6OA 2IWFA 1BQRA 2FQFA 1ZIBA 2IDUA 1ADWA 2WSDA 3NJMA 2ZXWB 1HAUA 3IEAA 1SHXA 3NSFA 3CVDA 1E67A 3PCYA 1M56B 3FPYA 5E9NA 1CC3A 2R7EB 1J9TA 2W88A 3BQVA 1KYAA 1ZPUA 3NJHA 4G70B 3PAVA 2I85A 2HRGA 3FSZA 1E5YA 2BP0B 1IUZA 3NYKA 4KO9A 2IDQA 3GDCA 2EILB 4UANA 2EIJB 4DP2X 2XV0A 2HLEB 2PLTA 4HCIA 2HRHA 2UXFA 1J5CA 2JFCA 2XV3A 1RZPA 3FU9A 4KNSA 3QJSB 4K9JA 1WA0X 4E9SA 1KBWA 1NICA 4KOCA 1L9PA 4N8UA 1A4CA 1BYOA 2BWIA 1DYZA 1W8EA 3H4FA 4KOBA 4BWUA 2OCCB 2PPEA 4YSAA 4WKXA 3G5WA 3KW7A 3BVDB 5IY5B 1PCSA 2AFNA 2FQEA 1V10A 2IWKA 4M4RB 4NB7A 4G7RB 3GXUB 4GXFA 3S3DB 3SBRA 2FT7A 3X1FA 5I5MA 3S8FB 5B1KA 2MRYA 3CDZB 1KV7A 2X88A 4DP9X 5B1JA 1NPNA 1N68A 3WNJA 2GSMB 7PAZA 1BAWA 4GP8B 2ZONA 4A2HA 4Q89A 2OJ1A 2DYRB 2BHFA 2N0MA 4ZK8A 1WA2X 3X1BA 2YAFA 3S3BB 1WS8A 4YSSA 4AKPA 3WI9A 2VSKB 2FT8A 1ET7A 4DPCX 2QDVA 3NSYA 2YXVA 4TXVB 3WNIA 1NIEA 4DP8X 1T5KA 1AZBA 4YSDA 4P5SA 2UXTA 2VSMB 4AKOA 3AG1B 2CALA 4GP4B 3DKHA 1JXFA 2XXFA 3AG2B 1PNCA 2PP8A 2UXGA 3OD3A 5PAZA 1PY0A 3ASNB 3T6ZA 5I6MA 2BP8B 3AW5A 2BZCA 3C75A 3OM3B 3SBPA 1SDDB 2H47C 2ZWNA 1AQ8A 2WO2B 1X9UA 4E9QA 1B3IA 1JVOA 4DPBX 3DTUB 2YXWA 3MBWB 4BDVA 2CBPA 2GHZA 3PAZA 2A3TA 4HIPA 1KCWA 1NPJA 2X87A 2XYBA 1JXGA 1GW0A 3UACA 5AZUA 1JZFA 2FQDA 3X1NA 2QT6A 5I6NA 1AZNA 3D12B 2JKWA 1OCOB 3FS9A 3NSDA 4HHGA 4YSTA 5AFAA 1AG6A 1AIZA 2HXAA 3QJVB 1AZCA 1URIA 3TBBA 1ZIAA 5LDUA 1GSKA 1EZLA 2GI0A 8PAZA 1SF3A 1SJMA 2GBAA 2XX0A 1PF3A 2W8CA 1BXAA 1XB8A 1TEFA 2VM3A 5ANHA 2YAPA 4CSZA 3FSVA 1YLBB 1AAJA 1OE1A 2UX6A 1RCYA 1ILUA 3PAUA 4FA7B 5A7EA 2Q9OA 2DY2A 5PCYA 2XVBA 1OE3A 3NSCA 3NJIA 2DV6A 3DIVA 3FQ2A 4G7QB 1SFHA 2FWLB 3ZDWA 3IN2A 2I7OA 3MX0B 1PLBA 4HAKA 3FU7A 1L9OA 2AANA 4YVNA 3FSWA 4QKTA 2B3IA 1PLAA 1SFDA 2Y1AA 4A2FA 1L9QA 4DPAX 3ABMB 3OMIB 4DP5X 2CAKA 1NIBA 1AZRA 4DP1X 2UX7A 1F56A 3N2JA 3AY2A 4HZ1A 4HALA 3U25A 5B1BB 2FTAA 2IDFA 2YQBA 1AZUA 2RACA 3X1EA 4KO5A 2YAOA 1CYWA 2YAEA 3QJQB 3S3CB 1MZYA 1ET5A 1OCRB 2CUAA 3AG3B 4L0PB 4E9YA 4YSCA 4G71B 4UF7C 1E5ZA 1JERA 1SNRA 2J5WA 3UABA 2EINB 3FYIB 1IBZA 1MDAA 2BP0A 4E9VA 4E9WA 3FT0A 2HX7A 1AANA 2AZUA 4UAHA 4YSQA 1TKWA 3QPKA 4YSPA 1I53A 3NJKA 2ZOOA 3CG8A 1VLXA 1A4AA 3ASOB 3NJNA 4BWTA 4DP0X 5B7EA 1SHWA 1NIDA 1AACA 4Q8BA 5B1AB 1JZHA 3QJRB 1MZZA 3H4HA 4PAZA 3OQRA 5B7FA 1J9QA 3RYMA 1ZDQA 3ZIYA 2BZ7A 2PP7A 1HFUA 3NP4A 2PPAA 1GY2A 1NTDA 1WS7A 2GC4C 2EIMB 2H3XC 1MG3C 2MTAA 3CZUB 3ZBMA 1SF5A 1PZBA 4YSOA 2QDWA 1OV8A 1AR1B 1WAEA 7PCYA 3CDZA 1L9RA 3FPXA 4JHVA 2DWSA 2BW4A 3IBOA 1J9SA 5FC9A 4KO6A 2IH9A 4HCFA 5D4HA 2XU9A 3V9EA 2GIMA 3OMNB 1NWOA 4YSEA 4DP7X 4X4KA 2HZHA 3QQXA 3NT0A 3ABKB 3PPSA 3FQYA 4E9TA 4A2EA 2UXVA 1KCBA 2BWDA 3JT2A 4AX3A 1HAWA 1QNIA 1XB6A 3AG4B 2J57A 2GC7C 4F2FA 5I5IA 5B1JC 1XMEB 2HX8A 2PP9A 1PZAA 2Y69B 2XUWA 4G7SB 5I28A 2PPCA 4BXSV 5F7AA 1W6WA 1L9SA 4KO7A 3AZUA 2VW4A 2BP8A 2FNWA 4AZUA 1SDDA 1M9WA 1EHKB 1FFTB 1GS8A 2BW5A 3ABLB 1IBYA 5I5JA 1ET8A 1PMYA 3T71A 1FA4A 1ASOA 3OMAB 1L9TA 1TU2A 1E65A 5I6PA 1OOWA 3NJFA 4BWWA 1J9RA 4W1TA 1OCCB 4EF3A 1CUOA 2YAHA 3X2QB 4FAAB 3NP3A 4KNTA 1NIAA 2PCYA 4AKQA 4YL4A 1QHQA 2R7EA 2CCWA 5D4IA 2IH8A 2PPFA 2XWZA 2J56A 3IE9A 4GYBA 3X1GA 1A65A 2BO0A 1NWPA 2J55A 2FJSA 4DP4X 3QJUB 9PCYA 4PCYA 3WKQA 1RKRA 4CSPA 1GR7A 4QLWA 3PXLA 1JOIA 3FU8A 2WO3B 4N4YB 3H56A 3SBQA 4A2GA 3IN0A 6PAZA 2TSAA 2IDSA 1CYXA 3PLYA 1GY1A 2CJ3A 3EH4B 2QPEB 1JZGA 1NZRA 4JKNA 1BYPA 4A66A 4RH4A 2HX9A 2OV0A 3S8GB 1R1CA 1MG2C 4F7KA 1AS6A 4E9RA 1BXVA 1W6LA 1TEGA 1V54B 3T6VA 4NERA 5B3SB 1JZJA 2Q5BA 1J5DA 2PPDA 1KBVA 1RZQA 3NJJA 3T6XA 3FYEB 2TSBA 5AKRA 4ENZA 3V9CA 1WA1X 1ETJA 1KDIA 1KGYE 3EH5B 4BK5C 2YAQA 4YSUA 1ZDSA 3FQ1A 1NIFA 2XV2A 2LLNA 1JZIA 2AVFA 2XLLA 3UAEA 3TASA 3TA4D 1ID2A 2FQGA 3FSAA 4DP6X 2YAMA 3TU6A 1ASPA 2IAAC 2VW6A 4NAJA 5I6LA 2FT6A 1A8ZA 3WKPA 3UADA 1BQ5A 1IC0A 2DWTA 5F7BA 1BXUA 2B08A 1OCZB 4GY4A 1ZV2A 2P80A 2AZAA 2VN3A 3QJTB 1JXDA 1E30A 1GS7A 1ASQA 1M57B 1PZCA 1XB3A 4G72B 1JZEA 3WG7B 3EHBB 2VW7A 3EF4A 3T6WA 5I6KA 1PAZA 2NRDA 3NJGA 2JXMA 1X9RA 1PLCA 4A2DA 3CVCA 6PCYA 4BDVB 5TK2A 2GB2A 4KNUA 3ZX1A 4YSRA 2E86A 2VMJA 4A68A 3ABGA 2EIKB 3ERXA 1OE2A 1AS7A 3TBCA 3EH3B 1BQKA 4E9XA 3SQRA 1PNDA 4HHWA 2H5UA 1A3ZA 1BEXA 2QPDB 3KW8A 1A4BA 5I26A 4A67A 1GYCA 3JTBA 1N70A 2PCFA 4W9ZA 3UGEA 2DYSB 2XX1A 4WTQA 4AI7A 4BXVA 5EHFA 1ILSA 3N55A 4HCGA 2VM4A 4JHUA 3WIAA 2IDTA 1V55B 1CURA 1OF0A 4YVUA 2P80D 5TK4A 2IWEA
chains in the Genus database with same CATH superfamily
3BKMH 2MQ3A 4X8JB 1JSYA 1LLAA 1AXTL 4ZRGA 3TGXA 4BZ1A 1S9VB 1N18A 1T1ZA 2R69L 5J13C 2DMKA 4G8FB 4Y5VB 5C09B 5KVDH 2X5PA 3WV0A 3B56A 2D7TH 4QO1A 3AQXA 4BFOA 2CHDA 4NUJB 1YPZB 3SCMD 4ZW5A 5CGYD 1I1CA 4H1LG 5AYUL 1JK9B 2JIXA 3GRGA 3EJTA 4J8QA 1AXTH 3APFA 4JN2A 1AS8A 3VMOA 1YNTA 5C9JA 2DQCH 4LZKA 2IWFA 3G04A 2FQFA 2JJWA 1S7VA 4PJXE 3BI9X 1FGVL 2XFXA 3AMKA 3GMRB 1N7MH 1HSAA 1U93B 1RLBA 2EDMA 3GJFK 4XCNB 1H3WM 2YC1B 1FH5L 3SGEI 1LWJA 4OD2A 1GHFL 4KY2A 2EZ0D 4G70B 3IMRA 4LRIC 1ZOXA 5AB0A 1IAOA 3D39D 5EIIA 3NYKA 4OJFL 4UUJA 4X4XA 3W11C 5FPIA 2CGYA 2J71A 3CVHB 5C9KA 1S8DB 2EKSA 1V3MA 2YPKA 1YEFL 2WK2A 3L13A 3ZTJG 4HK0A 3DHUA 4V33A 4R7VA 3T08A 3CDGA 3L54A 5EWIH 2Z6FA 3PJSA 3ZHNA 5B3NA 1IX2A 4AIZB 2C9VA 1T2XA 4Y4FA 1HNYA 1UA3A 1CQYA 1UVQB 4HWNA 5EG6C 3WJLC 1SLWA 2P44B 1DYZA 4NKDA 5ISZB 1EUTA 2XHNA 2ZPKL 2BC4A 2YPLA 2ZUQC 1HEZA 4JANB 1JWMA 5IW6B 3HFML 1PCSA 2AFNA 3ARBA 3CUPA 4DTGL 2E4TA 2JKLA 3MFGB 5GJTH 3GXUB 3QUXC 5I74B 3ILPA 3HTLX 5I8OL 5L7XH 2M1KA 4FXTA 2JCCA 4P59L 4ABQA 4ZMZA 1YN6A 1OAUL 4H40A 3RUGB 1NFDA 4G11A 2KMWA 4JPIB 3CFCL 3HBPA 1E28B 4P2RE 3BVVA 5LQBH 2EADA 2Y4SA 1NQBA 3LHAA 4DF9A 3G5YB 5J1AB 1QSVA 1VCBC 5J13B 3K6DA 4NBYB 1PJWA 1BAFL 2ENPA 3U83A 1MFEL 4UINL 3BD5A 4PW3A 3U9UB 3SPCA 3FTYA 3QCTL 4G5ZH 4YX2L 4NZFA 1P4UA 2ZCZA 1YUHB 3UBXG 4O2FA 3D07A 2DBJA 5AD0A 2M83A 4UQBA 2IXQB 1T04A 2OSLA 1LTXA 3HN3A 2DI9A 5HGDB 3JV5A 3GKZA 1EEZA 1S7TA 1UD8A 3CFKB 5HDOA 4B95C 1EQWA 3WFCH 1XF3A 8CGTA 4FYQA 1NFAA 1ED3B 3IDIA 4NC1E 4PYHA 2OTWA 4KKLC 2KC0A 2P8PB 3N44B 3NCXA 4QRRB 4FQJL 2YD5A 4GUOA 4MASA 5ESAA 5F70A 3EUUA 4JFZH 2FK9A 4PGEB 1IB5A 1ADQA 1YPZE 2APWA 2YXWA 3DTUB 3LD8C 4ZMQA 5HDBB 2ADYA 1SJEB 4IGBA 4IU2A 4D8OA 4XP9H 2DLIA 1KCWA 3SKNA 2DM4A 1ZA3B 4YQXL 5C8JA 2DWDB 2A4EA 3IGFA 1N5AB 1Z2KA 3LQZA 2J1ZA 3QDAA 3X1NA 1AGFB 4LLAA 1N4XH 3KG5A 3L95B 5C0EB 1NSNH 4KI5F 1O7DE 1HSBB 2Y9RT 3VXSE 3IJEA 3BEWB 1EZLA 4NXSA 3HUJE 1U58A 4RAHA 1BMZA 2I9TB 4ODSL 3O6MH 1FFPB 3WO3B 4AL8L 3RDTD 4KVNL 3FSVA 4AYEC 5GRUL 4AQEB 1RCYA 1T1YB 1ILUA 1P6AB 3HHSA 3PAUA 1R3HA 1FCCA 2F5BH 2J3SA 4X5RA 4BUHA 4A04A 4WU7A 2KYIA 1EAPB 3G6AB 2F8VA 2XVBA 4RIRA 1GKOA 3ZMRA 3QHTC 3WHXB 1IJNA 3GSRA 3OXRB 2NY6C 2IDCA 5ECJE 5E6ZA 3FTXA 5FHAL 4L3EA 4FRWA 1DLHB 5E00B 5C0RH 2ZXQA 4HEPG 3QW9A 1GC1C 4PG2C 2WTRA 1E2ZA 3F6LA 1ZT1A 1E2WA 3V0VA 1LMKA 2AKRB 3OSKA 4Y5VA 3ABMB 4QNPF 5C09A 2R2BA 2VRKA 2JI1A 1T22A 3AUVA 4RDQF 3HE7A 2XWBA 4PJ5A 4F2MB 4OVVA 4X7FC 5JHMA 3MRLA 1VDGA 2COQA 4FC3E 5DEGA 4HALA 3OWRA 5D7IE 3IFNH 2J1XA 1TSRA 5F2FA 2YQBA 2JJTA 4D9LL 3ALXA 1F90L 3EOBA 4GAGH 1Q9KB 5E94A 3MV7B 2ZE0A 3CK0H 3K6IA 4XCNA 4QWWC 5LGHH 7FABH 1QO3A 3SPVA 4L0ZA 4OD2B 3D2UD 2V17H 4N5EC 4E9YA 3VFNA 1MQKH 1DEEB 1IAOB 4PRDA 3SZKC 3W2DH 3OAWA 3MQIA 4KY1L 1ZA6B 2FEEL 4E9VA 5K59F 5HVFB 5HPMB 1YEGH 4UAHA 3CVHA 1WCBA 3LD8B 3U1SH 3FRPB 3CDGB 4A7QA 1KULA 3CBJB 4FG2A 1QPKA 1G9NC 1SLUA 1NIDA 4MQSB 3SSGA 4HAFA 4PLOB 1FZOA 4YDKL 4H8WH 4UQDA 4J27A 2VLKD 1T5WB 2AV1B 1F18A 1HEZB 4NN7C 1Z1WA 4JANA 4P5TD 3DMMD 2PP7A 3DK2A 4RMSA 4FFVD 2J8UF 4X0KA 4UV4H 4DO6A 2IVFC 4OF6A 3MCG1 3NDZE 4PJFF 4HKBB 3A23A 1PZBA 3AWGA 3ILPB 4M7KH 1TYEB 4PJAB 2AQ2A 4G6AC 1IV8A 1T6VN 1M9SA 2VYRE 1X5JA 4UTCA 4LCVA 1WD9A 2OYPA 4CAGA 4NUGL 2F7RA 3MLSL 1PJ9A 3O3AA 4M48L 4EZKA 4GT7A 5CSZB 4PJXA 2PR4L 4FCAA 4PBXA 3HI1A 1B6UA 2QHLA 3ALPA 3U9UA 4JNXA 5LXVA 3VD9A 1BGXH 3AU0A 1XR8B 1D9KD 4E42A 4N1EA 2NXYB 1C5BL 3MHZA 1TPXB 1CXLA 4O2FB 1MCEA 4L4JA 4M48H 3WFEH 1ZTXL 2YS4A 2A7BA 4PUBL 1S5IL 1OPGH 4UM8A 3F6IA 2VDQL 3QZWB 1LE5B 4ZUSB 3GSWB 4M7LH 4KHTH 3CMOH 1YMMB 4TNWK 2XZCH 2WYIA 1A3QA 3WEBA 2PNDA 5HBBA 2ZTBA 4N2FA 1T21B 1X5LA 1ED3A 3IDIB 4W6WB 4JFZL 1L9SA 2BK8A 1JRHH 1C1EH 5AW3B 2OTWB 3A21A 2XYCA 1INEH 4Z7OE 3VVWA 4PREA 1Q4NX 2OP4H 3O2DA 5FGBC 5JZ7D 3QH3A 2DZEA 4YQXH 2BW5A 4XR8C 1J0ZA 2WWOA 4ODTL 1TCMA 3ZL4H 2GCYB 3C2AH 4J2QA 4ZPTA 5E6IB 4J3XA 1SJEA 4IGBB 3QXDB 4EOWL 4ERSH 2DWDA 3D25B 3WLBA 1LP9F 2VDNB 1N5AA 3LQZB 2AGJL 2OMWB 2XN9A 3KPRD 3LVTA 3ET9F 2XBDA 3ZE2E 3TURA 1QSFD 3L95A 4NZUL 3J07A 4TL5A 1BBJA 3JV0A 1Y0LA 4NBXB 1XSJA 4EIGB 2X4TB 2WBJC 5D6DA 3IJEB 4PGDB 5IB2B 2XWZA 4N0CD 5FYKE 5IWLC 4H88L 1K5WA 5JW4N 4DP4X 3QZLA 2OMYA 3HHSB 4PV8A 1R3HB 1TR7A 2P8LA 4GQQA 5I0DA 1EAPA 1R3IH 4NXKA 4OIFA 4RIRB 1A6ZB 1W15A 3KDPB 3D34A 2RA1A 1H8LA 2VM9A 4S10A 5E1AB 2BHUA 5T5FA 2WXMA 1KNOB 4L8BA 2GJRA 2XIDA 4Y4HC 1YEFH 3JV6B 5JUEH 2QPEB 3Q6GH 2G60L 2NNFA 5IKCA 2WTRB 4MS6A 2MCAA 3CFIC 4W4NA 3V0VB 5EIVA 4M5ZH 3KXFD 2YPLE 2WNXA 3C08L 4RQQA 1R1CA 1OAZH 1T22B 3L9BA 2NY1D 2XWBB 3LRSB 3LS5L 4WW2F 5CCHE 5KW9L 3ETBF 3SDYH 2ZPKH 3IAPA 4MNQB 5DEGB 1R3JB 4UQ2B 5LWYH 5D7EA 1KXVC 4ANWA 3ZLQC 1I3GH 4M03A 3QZOA 1FO0A 4NFDA 1N64H 3P3SA 4A6YB 1YQVH 3BSGA 4J12A 1R3KB 4NQQA 2Y6TE 1KBVA 2KHAA 1DVFB 4HUUB 4KRPD 3CE1A 4UWQB 3WJMB 4XN9A 2XXCB 4X9IA 3NZSA 5DD1L 4X7EC 1QO3B 3SPVB 4YJZL 2D8KA 1KCKA 2R0KL 5E0FA 4HOZA 3VFNB 3WFCL 5HYFA 3JWOL 1DEEA 1J0HA 3FQ1A 5KS9E 4DOHB 1ZA6A 3IRCA 5MHSD 3MRDA 2D2OA 4L2LA 5EC2A 4XCCL 2FQGA 3FSAA 1RD6A 3FRPA 4IGBC 1BVKA 2CK2A 4PR5B 3MV9B 2IAAC 3STBA 4RCAA 1NCBL 4HIEB 2DMGA 3WIHH 2CDEB 2HT4D 5DK0A 2HVBA 3DJRA 1BP3B 1FZOB 1UXWB 1YMME 1X4YA 2AJZB 3AS0A 5C0CA 3S8WA 2RQEA 3MJ9H 1K5NA 4HDIB 1AFVH 3GXMA 4UCFA 3WTSA 5EH1A 3ESOA 5BZDA 4KK6C 4WAFA 3IFOA 3T3PB 3BRGC 3UAFA 3S4SB 1CG9B 2PN5A 3SE9L 1OM9A 4X0KB 3RBSA 4AGLA 1B4JH 1QZNA 2GJZA 1MCOH 2IPTH 3CDCA 4EO5A 2EABA 3BESR 5CSBA 2BINA 3MBWA 5C07B 4B9CA 1CE1L 2QELA 4L4TA 3WSQL 2XJKA 4PJAA 2VMJA 1GXEA 2ZCHH 1L7TL 3QUKA 1BIIA 2CGRL 5A40E 5DURB 2Y07L 3O3AB 3P4NB 1HCYA 3V0GA 5CSZA 4HHWA 4F58H 4U2ZA 3F7PC 4U6HB 5C0RL 1A3ZA 3L3JB 3GZKA 4UQCA 2AQ3A 3L3KA 4W68A 3HE7C 3V4PA 4YHYB 1N70A 1R33A 4Y4KA 2EDNA 4DK5A 5CJXC 3UGEA 4HA1A 5F6IC 3GF8A 4JRXD 4LCCA 5EUKA 4G1MA 1SXBA 2KPWA 3N91A 4NOFA 4PJ7E 4Q4EA 4R5TA 4R97C 1KPUA 3CSPA 5D1ZB 5CKAA 4W6YB 3MRKA 4ZDHA 4MQTB 4F2EA 3M86A 1I9JL 2BSSA 1A7QH 1UXMA 1RIHH 2XPGA 3QIBB 2LU3A 4YIQA 4JDVB 2C3HA 4MNGB 3WY4A 4WU5B 2NY1B 3HB3B 4PSRA 4MMYB 1N7ML 2Q8BL 5I17A 3E38A 1L0QA 4O58L 3UG3A 4LEXH 1UB5A 2CDGA 2GCYA 1Q9WB 5T1MB 2X6MA 5CZKA 1PY4A 2FL5B 1KDJA 3NCYP 1L7IH 1GS6X 4K71C 3T1WA 3KYMB 1J5HA 4LDLB 3WLBB 1BQRA 2IDUA 4Z95L 3MGTA 3UXFA 2OMWA 2XN9B 3KPPA 4PRIE 4BFIB 4DZ8A 5KVEE 5F0LB 3KE0A 4JB9L 4PP1D 2J4WL 4WUUA 4LEOB 4Z0XA 3R18A 4KHXH 4PGDA 5IB2A 1A7PH 3LEVH 2XVKA 3VFUA 5T1LB 3APNA 2K9UA 4XC1H 4FHKA 5GHWH 2I27N 2OMYB 3S35H 4YXHH 5I1JL 4WO4A 2EIJB 1Z3RA 4DGYH 3DJTA 1A6ZA 1P2CB 4LARL 1EEUA 5AOJA 1J5CA 1X5XA 4YHKL 1NCTA 3MJ9A 4NUMA 4APXB 4DKAA 2PABA 3SIKA 5E1AA 4JJOA 4QJ4B 5D2NE 1KNOA 3P0YL 4JFFE 1WO2A 3GSQB 3JV6A 2DL9A 3SPGA 4X6EA 5FO9A 1I8MA 5DHYA 5IJKA 5F72S 1ZHLB 2ICWA 4BWUA 1O6TA 4PN6A 3QCVL 5JDSA 4ESKA 4DKFL 3RWHA 1NL0H 3QJXA 3EGSA 4RQQB 1T5XB 1D9KC 4K3JL 4N3UA 3QYMA 3N6YA 1SXSA 2YUXA 4HS3B 4UTBL 2XOTA 2GTZA 3HG1D 2R39A 4RWHA 1CMOA 1LJMA 2DQTL 3IJ7A 4A6YA 1I1AC 3NRPA 1AHKA 3VB8A 4DGVH 1RZJC 2HVJB 5D1ZC 1DVFA 4DP9X 3CFJA 5DURD 2WBWB 3WNJA 4W9EC 4NSKB 1CFSB 3BLPX 2BVEA 3BPCA 2ZOLB 3QIBC 5B39A 1FO0H 3QHZH 4BRVA 1IRAY 2FX9H 3GXTA 2VZSA 2DYRB 3UX9B 5DR5L 3WKMH 3RNKB 4FG0A 4X99B 1WFJA 3MRDB 4NZRL 4N8PA 3NN8A 4JPKL 3G7TA 4OD1H 3LXAA 4TSCL 3WI9A 1ET7A 1RZKC 2OJEB 3MV9A 3AUWB 1OP5H 2AJVH 4ANUA 2EVFA 1NIEA 5HHVL 4XWOD 3ATDA 4ALAC 1NCDL 3IPEA 2NDFA 3MCYA 4BCZA 5AWNL 3CFBB 3O11A 4PJFA 4WTZA 1KJMA 2FE0A 4FQQA 3PDOA 5EPMA 2WP3O 4OD1L 3DKHA 1E4WH 4YXLL 2YUVA 2PP8A 5F7DB 3TEUA 5EUOA 1QTYT 3T3PF 3NZ8B 4OQTH 1FNHA 4MNGE 1REIA 1W72B 2LLGA 2NY5H 2ZUYA 5BRPA 2ITCA 3FTZA 4JVPA 1SEQL 1YNLH 2GJZB 3RG1C 4DPBX 3D3VA 2MQ0A 2IPKB 5IBUB 3MBWB 4BHUA 5H4ZA 4BUGA 4L4TB 3DVNB 3L6FB 1FVCA 5D2LB 3VXSD 4ZJ9A 4HUWB 3EFOB 3QUKB 2QT6A 1BIIB 1UZ8B 1OCOB 5I73B 2ZYSA 3T2NL 3MOQA 5G4NA 4N20A 5EU7E 3BSZL 1O7VA 2DLFL 5D5ME 3CFQA 4DGUA 3T8XB 1MREH 2GI0A 1RZKH 3PL6D 4K23L 3L3JA 1FL6B 2FECL 3V4PB 2WCGA 2Z31B 5DZJA 3R1GL 1KGIA 2M26A 2HT2C 3P54A 5FUOL 3NBNA 2H3KA 2IAND 2XQYA 3G6JA 3F3HA 5GJTL 4LCCB 5EUKB 2CLZB 5KW9H 4AJWA 4OR1A 5KTEH 1C8PA 3DIFB 3LHPH 1UZGA 3IN2A 4XMUA 5DZVA 1U8CB 3MRKB 5J6SA 1G4MA 1YQVL 5GRXG 3JXAA 3O9WA 2BSSB 3N1PC 2DQEL 1PLAA 5HJBA 5ISZD 2VWEE 4JDVA 4OLUH 4OLZH 4JM2F 2A5UA 4MMYA 5F9OH 2M2DA 3BZEA 2NTFB 1IGML 4PB0L 1NIBA 1AZRA 2XG5A 4ZUTB 4EZMA 4NRYA 1UB5B 2CDGB 4ICXA 1MLCB 1Q9WA 5T1MA 1RURH 4G8AC 4A7GA 2DQEH 3EKCA 4MXQC 3D9AL 4XXWA 1TQBB 2F8IA 5BS0D 1AZUA 1GZQA 1HK6A 1QSFB 3P2TA 5J6HA 3DX0A 1XGUB 2AP2A 1CYWA 2WNKA 4A2MA 2HUHA 4KJWD 2DIAA 2B39A 4XE5B 2D9QB 4EBQH 1MVYA 1PZ5B 3H9SB 5E9DA 1A1MA 1AQMA 2CUAA 4YXHL 4Z0XB 3FB5A 3GJEA 1CFNA 3VFUB 1KXTA 1MOEA 4N8CH 1FLRL 1WICA 2EINB 5LBGA 4Q6IB 4JM2B 3QPKA 1FORL 5KYNA 5I18H 3AITA 3EADA 3VJ6A 2PUQT 3WN5B 3BXNA 1HWWA 1TQUA 1DVZA 3KCWA 3GSNH 4JLRB 1I8MB 4RLDA 2WXKA 3TT3H 1IBGL 1ZHLA 4PAZA 1BF2A 4U1LB 3TN0A 3TBWB 3QXTA 3J8F7 2HT3C 4LESA 4KGJA 4ZFGH 2BRRH 1MFDL 5J12B 2PPAA 4PIRF 5C7XL 2G30A 4Y4KC 4AGOA 2XT1B 4HS3A 4KRNA 2EDYA 2BX5A 3EGDA 5FK9B 4OLWH 3O3DB 5GS1C 4NWTL 4W9JC 4WNSA 2HVKA 3U9PH 4O51A 5DJ8A 5F9AC 4PD4K 1HHKB 3M1OA 4Z7WA 3EYFA 4L4TE 3ZDZE 1IC7H 4BUQA 1CTOA 1A6TA 3CFJB 1CFSA 1I8IA 4Q9QH 1ZTXH 4K5NA 1GOHA 5DEZA 3BAXA 3HPJA 1D2PA 5I1IL 4PRHA 2YN3A 3O8XA 4FABL 4I85A 1NWOA 1AJ7L 4N8VA 4Z7QE 3P9WB 2BPBA 2CIIB 2VIRA 3ABKB 4NKIH 2A4CA 3SGKA 4I5BA 1BMWA 2CMRH 3MMEB 4LCWD 3QXWA 3IJ9A 1KCBA 2BWDA 4XMPL 5K39B 2ZCLL 3OLDA 4JRXB 3OG6B 3RL2B 4F2FA 3SD5A 4R84A 3FFCD 3ETBJ 2PXYC 3CFBA 3O11B 3FO0H 4PJFB 4D0CA 1SUHA 2PP9A 2QFRA 1NCCH 3OZ9H 4FQQB 1HESA 2EH8H 3JWOC 3OLEA 4YDJA 4OZIB 1MEXL 4XPTL 1S7UA 1JNNL 5DC4B 1XAKA 2CJUH 5EUOB 2NY7L 4G8GA 5FF6A 1MWAL 3ZE2F 5I1GH 5E2UH 4FQXC 3ABLB 2OYKA 3SKJH 1PLGL 4RAUB 4ZX3A 1OIOA 3C60C 5LGJA 1NCCL 3OZ9L 3VNYA 1ASOA 4ZAKA 5J8OA 3EGXA 1JF5A 3DVNA 1SGKA 3L6FA 3FL7A 2OULB 3JSSA 3WN5C 2VH5H 3EFOA 1J9RA 4F8TA 3KHOA 3QHFL 1C8QA 3N85H 1QRND 1XMWA 4FLQA 4FAAB 2FNBA 3ULUL 4KNTA 4LARH 3MV7D 4PRNB 4F3FB 2PCYA 3QR2A 3WFDH 5E8EB 4P9MH 3T8XA 3ZIMA 5D4IA 2IH8A 1L3NA 3F83A 3N1FC 1GOGA 4NJ9L 4Q7DA 3VXNB 1FL6A 4HEPA 2EDTA 1AY1H 3GI8H 2Z31A 3DGCR 3D0VA 3QUHA 3OKYA 4Y9GA 1W0YT 3R7QA 3JWNE 1RSYA 2EDFA 3L4VA 2CLZA 3RKPA 4N4YB 3H56A 1AR1C 3ES6A 4FG6D 4HU2A 1UWXH 3ZKMD 3DIFA 1KEGL 1CYXA 1AKJA 3LXUX 4IQHA 5CEYB 4ZG1A 2Q7NA 2CO4A 1X5KA 3TIEA 5D7IF 5LWYL 1E8ZA 1NZRA 4OF0A 3OC5A 4A66A 1FJ1A 5DJCB 4TN9A 2VXQL 2AK4B 2YK1L 3Q2CA 4O02H 4L0YA 2UY7A 4OTXL 1UXSB 3ZGHA 3SDXE 1S46A 5IHZB 3LQAC 4ZUTA 4NRYB 1RK1B 1EO5A 1MLCA 2OXHA 1VAHA 4ZO7A 2Q7YB 1E4XL 4WFHE 1YEIL 3FT3B 4QRQA 3H9YA 4OCRL 5DLMH 4ZMYA 1GZQB 1AQKH 4PJIA 1JGEA 4WQOA 5DJDB 5BRZD 4ZI8A 5MP6L 4M6AA 1BWWA 4R8WH 3RVTC 3DO7A 3H9SA 3S48A 5JXEA 4XI5C 3GXPA 4JGJA 3PGFH 3GJEB 1TJGH 3DA0A 1T2QH 1WH0A 2V8MA 3GLAA 5IUCA 4LO9A 5AAWC 3ZZQA 4JY4A 3UG5A 3HPLB 4BZ2A 4DUWA 2XLLA 4Z7NB 4P4KC 1A14H 2OK0L 3S88H 4P46D 1RFDH 3I6LD 3MV11 2WWMD 3TJHD 1KC5H 2WXHA 4IRSC 4CL7A 1CGYA 1PYWB 1D7BA 1T7YA 2ZX6A 4FQ2L 2ILLA 2WLNA 2VN3A 5DD3H 4PJFE 4ETQA 5CUSH 5CEZL 4FLOA 1A14L 4I3GA 2A38A 5DUPH 1L0PA 4MB5A 1XB3A 4CADA 4I88A 3BMWA 5EUOE 3U6XS 4V1DE 3EF4A 4JJ5A 1KTLB 4S1RH 1X4ZA 4G6KL 4A2DA 5ABZA 4N2KA 2R8SL 3ZJAA 3O3DA 5KBPA 2HVKB 2P7TB 5T33H 5E08L 3DROA 3Q44A 5GRUH 3T0WA 1R3LB 1W8OA 1HHKA 4Z7WB 2GJ6E 1RU9H 4JW3A 2WN3A 1QRNB 3CLEL 1A6TB 2BVTA 3BX7C 3ARED 4FABH 3TBCA 4WVRA 4Z3GA 3O9WC 2R8SH 2BY1A 4GRWB 3CXDH 3HPJB 4KK6D 5TQ2L 3X14B 4PRHB 3BH8A 3T4YA 3VI4B 4XB7A 3CZEA 3RZWA 4NCDA 1J8KA 4S1SH 4ZUUB 3TVMB 3RILA 3TIDA 4N2AA 1N0XL 3ZMEA 4I5BB 4XAKE 4QHLB 2VLKE 2YD6A 4JRXA 1Z5LB 3RL2A 1RUPH 1V55B 5F7LB 4ZW8A 2YD9A 2DWXA 3D52A 3QNYB 5AZEH 1CURA 1OF0A 4GXVL 1VJSA 3GSNA 1MWAH 2XY1A 4G2AA 3GQFA 4D0CB 5HPOA 2XTJB 2X4SB 3GFUA 1PX4A 3A6OA 2X2YA 1IKOP 5H37G 4LFHG 4MFHA 4XNDA 1S7UB 1E7VA 5KJRL 4PY8J 1IJ9A 1EBAA 1MFEH 1QI3A 4OZFG 4UINH 5FF6B 3WNMA 2WJ5A 3LRMA 2YARA 1P1VA 1AG0A 2NTSP 3ARDC 2AK4E 4PJGA 3RY6C 5B7MA 2WTOA 4RAUA 4WI5A 3S5YA 3V55A 2ZUXA 4OGYH 5LGJB 3QDME 2QTEA 1ZAGA 5D70H 4F9PC 4ZMNA 4KKRA 3VXMB 1CFTA 3EYVB 1QUPA 3P3RA 4FXGA 3NEOA 2Z7WA 4BEIA 2YPVA 2FX8H 4XP1L 5JOPD 1VRSA 1BZDA 3B8YA 1R6VA 1XIWB 1SHXA 4UT6A 5LB1A 3ARFC 5B8CC 1TYRA 3IMBA 1QQDA 2BCKA 4LSPL 5E8EA 1BEYL 3OAYH 2W88A 3TJEH 3VXNA 4PU2A 3TN0C 4I87A 4IKLA 3QRGL 1KJ2B 5LAXA 2NX5D 1PS3A 3D0VB 4DUVA 5BO0D 2LT9A 1I7UA 4XP9L 3IDNB 5DMIH 3HZYA 2Z0UA 3VG0H 2VMFA 1HI6B 1LD9A 2DYPB 4F57L 3RIFK 1HZKA 3US1A 1AKJB 1D5BB 4HPYH 4MD5B 2VXQH 5CEYA 4BYHA 3HZMA 2OMBA 1F11A 3QJZA 2ZOUA 4U3HA 4Z7UA 3TIEB 3QUYC 4TQEL 3AWEA 2F18A 3Q8FA 1XWVA 4HBQA 1PTZA 3V0AC 4GUPA 3HG3A 4BQ9A 2NNCA 4ZX6A 1EHNA 4KVNH 2D4FA 1G5AA 3HUJA 5DLML 4V1DB 5I1IH 1JXJA 1RK1A 1UA7A 3SGKC 4UT9A 4M8UA 1EGJH 3KWUA 3FUEA 3KLQA 3WKML 4M43L 2X88A 4Q0XL 1D5IH 1JGEB 3GC3A 5AVSB 3RHWF 5JR1H 43CAA 3K71A 3DO7B 2P1YA 1MAJA 3BH9A 5ID0B 1LEIB 1JS4A 1MNNA 4I3SH 4HXBL 4IOSA 4A2HA 2XQ0A 5EA0L 2BVPB 4WHDA 4PRHE 4KWUA 4D3CL 3V6FB 1KGWA 4JY4B 1FYTB 2PW2A 3H85A 3HPLA 3W37A 1WA2X 3K6NA 3RWJB 1TQTA 1EEQA 3MA7B 3QQ4A 1JWUB 3DXAA 4OI8A 5JNYB 3BGAA 1IM3A 5LVEA 3VD1A 1N6QL 1U8JA 4GKZB 4GAGL 2ORBL 4OQTL 3X11B 3O4OC 4Q56A 3GPEA 4YN3A 4N26A 4YSDA 2BSCA 1E42A 1XIWC 3NA9H 3ARFB 2CJTA 4ETQB 3SOTA 1E4HA 2QMJA 3HIZA 3TYGL 4MJ5B 2UXGA 1U4EA 3HVDA 3UC0H 3I6SA 2C3GA 2OR8A 1ORQA 1JFHA 3P1VA 5IROC 1FVDA 3EBAA 1F6FB 3EBIA 4Z0BH 4XVTH 4Y9FA 2IADB 4TUKL 3KPRE 5CCGE 4HJ0C 2OAAA 4X80H 2X2HA 5AW9B 3BYYA 5T1DH 2XYBA 1R3LA 1M3IA 5HHQB 3EAKA 4AYSA 4GG6B 3MRQB 4LKCB 2C26A 4YHKH 2OZNA 1X5HA 2OSYA 2YIHA 3VGAC 4YC2B 5ILTH 2Y36L 1M42A 1U8MA 5GS3A 4LCWE 3L9RB 1OTTC 1PSKL 3TX4A 3X14A 4QCIB 4X4ZA 3VI4A 3NEXA 2XX0A 4ZO9A 2H1PL 5IHHA 3TVMA 2K45A 1MJJB 3SKMB 4K5MA 1MCPL 1QATA 4UTBH 4C4KO 5FYLE 1WF5A 1KB5A 5E8DL 3FTUA 1YSOA 2CO1A 2WAHA 3ZTNL 1Z5LA 3FQ2A 3PE9A 2OR9L 3UEQA 1UT1A 2L7EA 5FIEA 5G2NA 2P47B 1L9OA 1SVZA 2AANA 2YR3A 2X3AA 3NCJH 4PCTA 1TZGH 3T3MF 3IJ8A 3P9LB 4PJHE 1XXFC 4NO0D 4Z18A 4PJGB 4KH9A 4P2OB 4QUOA 4GINA 5JMOC 4L18A 3VD0A 1BLIA 3DECA 3NCJL 4X6BA 3KYOB 3W9DB 2OCJA 1CFTB 3EYVA 2DW5A 5HGHA 3UZQA 4CMHC 2IFFL 1QASA 4ZW3A 1QFPA 1J8HE 3BUBA 1OXYA 5ITBL 3ML9A 2CZNA 1CVRA 1IC5H 1BHGA 5BRZB 4BKLB 1I4FA 3D2UA 3H2QA 3QG7H 1QQDB 2BCKB 3GD1C 4I77L 4NAQA 1AE6L 2IBGA 1ZHNB 3C9NA 3GSOA 1A9VA 2HA1A 4WHYH 1K6QL 4HWUA 5LAXB 1B2WL 3QXAA 4ELKA 4QRRE 4LNRB 2NY0D 3BDYL 1DSFL 3IDNA 2VGLM 3NJKA 3D0AA 3BP5A 4FA8A 1U2CA 3VYNA 4LBEB 4W9DC 2DYPA 1VFOA 3KYKL 5I0VA 4LVHB 5JA9A 1A4AA 3KPMB 2VISA 3OR7B 5EO9B 5BW7C 1CB4A 4UDUB 3MO1A 1SHWA 2YGOA 2ZUSA 3NIGB 4PBVC 5IJDC 3WEAA 2A9AA 4L8SB 2AEOA 2B4CL 1ZLWK 3T0EC 2GY5A 2VLKA 3W0WE 4ATWA 1MZZA 2K8MA 5HHPA 1E3XA 4M1CD 4RAVA 4F8NA 5B7FA 4JKKA 1J9QA 3D18A 4PJEB 1WTLA 3ZIYA 4DGWC 2BZ7A 2ICWJ 1T66C 4KI1A 4OV5B 4AZ8A 1ZRUA 3KL3A 4F58L 1RPKA 1KCRL 2VDPH 3FQTA 4OFVA 5GISL 3UYRH 3V4PH 3IMSA 3QWRD 4HSQA 1SF5A 3PNWB 4YSOA 5T5NG 2QDWA 2CCLA 4KMTH 4C56D 4MWFB 2H2SD 1CBJA 5SV3A 1C7SA 5H8DA 2GJ6A 2O93L 1XCXA 4Y2NA 3GBNL 1N8ZA 3BH9B 4XNQA 5ID0A 1LEIA 5IGXH 4YWGL 4GXVH 3WXVL 3CPUA 3LQAL 2GIMA 4GSRA 1MCKA 1WT5C 3HS0C 3B7YA 3WTVA 4C8XA 3VFVB 5I6XB 2VLLA 4KAQL 1FYTA 3MOBH 4X7SH 3MLWH 3RWJA 3ULUF 3L1FA 2A83A 5EU4A 3LN5B 3RPBA 3AXLA 2DQMA 2CHNA 4G82A 2B4CC 2I32A 5JNYA 5D7IB 3ROOB 4CMHB 1XB6A 2WSPA 4K2UL 3X11A 4Q9RH 2CLRA 2J57A 3HR5A 1CD9B 5FYJU 1UD3A 3GHBH 5I8EB 3KJ4C 1H5BC 5GGRA 3MBEC 3NAAL 1KTCA 2VXSH 3WTWA 4Y9CA 3WENA 3B2VH 4XVTL 3IDUA 4IEFB 3CZGA 4PJ8D 5GRVL 4AZUA 2FNWA 3IJSB 1MF2L 3VGFA 3QDGE 5FKPB 3G6DH 2Z7YA 4IMKC 4Z7UE 4WW2C 3MUHL 1VSCA 5CBEB 4HH8A 4I1RA 1EO8L 2IADA 4U1JB 2DM2A 3P30H 3K3QA 1SYSA 4FFZA 1S7SA 1G9MC 4QTFA 5F71A 3GRWA 3TEXA 1L9TA 3VVVA 3ULVC 1E65A 3QORC 4I0PC 4GG6A 3SJVE 3WIHL 2F19H 3MRQA 4LKCA 5BS0B 4MA3A 2G9KA 3TZVC 1BBDH 1EDQA 1ZK9A 1OCCB 2X9WA 1A7NL 4OM0L 1R75A 2JLLA 5EBLA 1KT2A 4MAYD 2A77L 3TPUA 3BVTA 3L3DB 1HHJB 3L9RA 4F9PA 3JUZA 4QCIA 3MUZ1 5HYJA 1J12A 1ZANH 3QNXA 4H25B 1MFAH 2BXZA 4GO9A 4WGKA 2VC2B 4ISVA 3NCCB 3N3EA 4KJQD 4LQFL 3GMLA 1CE1H 1JYXA 2FJFA 1P7QA 3R4RA 1KB5B 3BZFA 1GVIA 4AG4H 1MKFA 1O6SB 2CGRH 1XSKA 3WS3A 4HWBL 1G7QA 1SXZA 3PLYA 3IFPB 4HLEA 4K0OA 1S3KL 3ASWA 1EGJL 4POYA 5HGBA 1JZGA 4XXCC 1UH4A 4RH4A 3KLLA 4BFKA 2HX9A 3U0TA 5FECA 2MNUA 3HG1E 4J3SA 3TESA 1AQKL 2LV4A 5I6XC 4XX1E 4P2OA 3OAYK 3UO1L 1ZT7A 2ZF8A 2Y7QA 3HMWL 3K2MC 1JVKA 4HS8L 2AXFB 3KYOA 1ZLVK 3H3KA 3W9DA 3MACH 5CU5A 4Z6AT 5I1CL 5L2JB 4RSVA 1O5PA 4C4BA 2WNWA 4Y8DC 3UZQB 3VWJB 2X4PA 3QUZC 3R06B 4FHBD 2LFGA 1CICD 3MBEB 3VFOA 3CJJA 2HT4C 1I4FB 2R1WB 3D2UB 2WWNA 5JHDB 4F27A 4B9PA 1MI5A 4XX5A 3GSOB 1NLBL 2D3JA 4J4PA 2LLNA 2E75C 1JJUA 4ELKB 1W2KT 3M17B 4HXBH 1RV6X 1OP3H 2D7NA 2BHYA 3VXOA 4DPRA 5E4OA 3TU6A 4FFTA 3NEEA 4LBEA 4AIXA 4Z0BL 3DXAE 5EO9A 1KLFA 1XGYH 5DVOA 3GRWL 2NPLX 3MO1B 2KBGA 4UDUA 2DWTA 1H6TA 2O72A 2CIKB 3OR6B 2A1WH 3S3PA 1I8AA 4J3TA 3GMMA 2VLKB 4PRIA 3T3ME 1VPOL 1M1SA 4LOEA 1RIUH 3TNNB 3D18B 4PJEA 3VRIA 3UCQA 5HJDA 1B0RA 1P5UB 3BZ4A 4L1HA 4C4KT 3ECWA 3CLEH 3KH4A 5GSVA 4AZ8B 3H9ZA 4Z7VF 3NIDE 3QDGB 3FDWA 2VAAB 5FUCE 2NCEA 3FQTB 3MOAH 2ATKA 4LPTA 4M9PA 2WLJA 4XBPB 1ZHBB 5JOFB 4ETYA 1A6PA 3ARZA 3TF4A 2EH7L 1S9XA 5I16A 1JPSH 1NAMA 3C5JB 3K81A 4HUNB 4XPHH 3CFNA 4KTDH 4YSRA 2O6CA 2HMIC 4IOFD 4XT1C 1EFXB 2VMEA 4PWGA 5G4MA 3ZQWA 2B8OT 5CEXB 2CNYA 4HGWA 4HJUA 1OE2A 2F74B 2ZOKB 4G9FA 1CK0L 1G84A 4I18B 4IKIA 1ANUA 2HG5A 4E9XA 1YPZF 1HWHB 1PNDA 4GXUN 4K8RC 4YFLI 3Q43A 3ILQD 3ZT7A 2VABA 3BOVA 3KW8A 5JPMA 3D09A 2VLLB 5FYJE 1GYCA 2YK1H 3C8KB 2W91A 3POCA 3SQBA 1RHHA 2E59A 1BCIA 4IRJA 2XX1A 5EU4B 3BUIA 3AXLB 4U1IB 1XH3B 2CCVA 4X4ME 3HZVB 1U3JA 4LLVB 5EO0B 3UJTL 2R0WL 2WYTA 2QKIB 3EOAB 1H0DB 2HFFA 2MQCA 4H8QA 5CCKL 3KGRA 4N8VG 4BH7B 4XHJD 1PG7W 5F7EL 1X6LA 2R56H 1XTLA 4NQUA 3THML 5A43C 4L4VD 3IJSA 4XAWL 3V0EA 4GQRA 2FEEI 2RR3A 3ECUA 3EG9A 2XWTA 2GY7B 3GKWH 3KDMA 2H9GA 1R5WB 2NY0C 2TAAA 4R96A 1ZHKB 3BGFC 2BOCA 2SODB 1FWXA 3P40A 4U1JA 4DOHE 1KJ3L 1SYSB 2GW5A 3AMLA 3EYOB 4YAQB 5IQLA 3LSOB 5JIPA 1ZK5A 1HHHB 2VZUA 5A3ID 4XAWH 1TYJA 3MV9E 3CH1B 2ZXWB 5IFAL 3UMNA 4Y16B 5D2LF 3NSFA 2EEBA 1J1OL 3TPUB 3PCYA 1MELA 4ZNEA 1DEDA 3BGMA 5CUSL 5E6YA 4KNQA 4Z7QF 5HYJB 1BF8A 3QNXB 2YZ8A 3S36X 3G5XB 4ISVB 4KROB 2R27A 3HI6L 3O6LH 4LB8A 3TO4C 3C09B 4ERSL 3EO1A 3FTWA 3O2WH 1BFTA 4GSDH 4LLMA 3GGWA 3ZGIA 2ATPB 1P7QB 5KSBE 3L2MA 2PLTA 3BZFB 2H2SC 3VFPB 1EXHA 3RJDA 4G6JH 2O6DA 1O6SA 3KPOB 4A63A 4ZQKB 5E7FA 3FU9A 4ICWA 4K9JA 5KOVC 3VXRD 4EDWL 5GGTH 3HLAA 1L9PA 3PJLA 1AXSA 1U92B 4WSKA 5GS2H 2YPVL 4NJAH 5DUMH 4OZGB 4AIOA 3U0TB 1J10A 3BVDB 5F7FA 3RGVC 2UZIL 1I1FA 1YEWA 3EFDL 3MRFB 1Q8MA 2BDNL 3BIAX 4FGMA 1A6AA 3NIDB 4PBDA 2X4OB 3V79C 2ZXEB 3DWTA 2AXFA 3T1FB 4F5CE 4GXFA 2K8QA 2I69A 5CHNB 3X1FA 5SX4H 4H0LC 2BCMA 2W60A 3KLKA 3DGDA 3VWJA 3OV6A 3RIKA 3V0IA 3LN9A 3KGUA 2YGQA 3HFMH 4H5SB 4GSXA 4OGAC 4OIIL 1EK3A 4M1DL 3MBEA 2HKFH 2DQFB 5AAPA 1N26A 5JHDA 1G6VK 1DVSA 1B0GB 3MXWH 2ESVE 4P59H 1ADQH 4OKDA 2J5LC 4XCEA 4OLVL 3T0XA 3D85A 3KAAA 4H20H 3S37L 3IFNL 4N2GA 4L9LB 4JM0A 4MNHB 3SDCA 1ULVA 2NXZD 3A6CH 3MRGB 1J5OH 2YXVA 2QVIA 4DUXA 5BVJB 4ZTPH 3IAQA 5F1OB 1WBXA 1RUAL 3QUZD 3QIUC 5LGHL 4K15A 3GMMB 4PRIB 3LKSA 4M6OL 1WZ1H 3IMUA 3MRJB 3QDJA 5I15H 5IESL 3D69B 3TNNA 1QSEB 2OL3A 5J56B 5HI4C 3QEHA 3BZ4B 1X7SA 5DD0L 4BQ8A 3P73B 2Y1VA 4KJQC 1KYFA 1B0WA 4KROC 4KTDL 3ROLB 1J0KA 4P9ML 1MSPA 4HJGB 4LLWB 5C70A 5CD3A 1JPFA 2ZP0T 4UV7H 1ZHBA 4RBPK 5JOFA 1KBGL 4R5XA 1U3YA 2HT2D 3GJFH 1K8IB 1MIEH 1WFIA 2IQ9L 4N68A 3U36A 1NPJA 1KELL 1NAMB 1TU2B 1AY1L 1JXGA 4JUSA 1TLKA 4LQFH 2BMKB 2LAGB 2N59A 2F5AH 3PQYE 4HGWB 1DQTA 2F74A 2ZOKA 4G9FB 4YSTA 5FM4A 3UBHA 1GCFA 3I6KB 3QJVB 4PG9B 3FFDB 1GSKA 2FBRA 4JY5H 5TE7L 2I24N 2VXVH 2Y24A 5KSAB 1AP2B 1T6BX 3SQBB 1NLDH 1LXMA 3BYTA 1QR1B 1OTSC 1AD9A 3MI6A 5HVHB 1DBAH 4OI9A 4U1IA 1XH3A 5IVXA 5CGTA 2XWDA 5EO0A 5KSBB 1M2VB 2QKIA 1H0DA 2HFFB 3FOLB 4ILDA 2I7OA 3C5ZA 3QJFA 1ZLUK 3KYNB 3WIIL 4BH7A 1OZTG 2BSRA 1ZV9A 1HNGA 3BP6B 3OGCA 2ALWA 4HEME 5HHMD 1B9ZA 4XGZB 3LTVA 1SYVB 4CVWA 3G5ZA 2MOQA 2XBTA 2XWTB 3ARBD 4R0LC 1A6VH 2FX9L 3QUMA 4U6YA 1R5WA 4B60A 1JMZA 2WXPA 1SVBA 1YECL 5FEBA 1UYWL 2BOCB 1F41A 4GRLD 3PIQA 1JPST 3EYOA 3GLDA 4L9LC 5ICYB 2O61A 4J1UB 1BVLB 1UD5A 4M8VA 4XCFL 4KO5A 3CFEA 1DCLA 3FF8A 1INDH 5KVDL 1U8PB 3NCEB 4BK8A 4FF9A 4ALAH 4N90E 3NZHL 4R26L 5TDNB 3CXFA 5C1MB 4LEXL 3V2AR 1CE6A 2CBQA 3C6LD 1OAQH 1CDGA 4KQ4L 1HS6A 4M29A 5F7NC 1E5ZA 3G5XA 5BV7C 4XP5L 4E9WA 5TE4H 4JFED 3EO1B 4LLMB 2HX7A 1YY8B 3RU8H 2ZSWB 3GGWB 1YEKL 2QVKA 5T3XE 1CXKA 5IEHA 2Y1ZA 1KIPA 2HKHH 4EN3C 5HD8D 2FZ3B 4BSWB 2XQYG 3ARGC 2Q86B 3IDJB 4XPHL 2WMPB 1OL0A 3DDGA 5HHOD 4HULB 3BSZH 4OZGA 1E9OB 1U36A 1SY6L 5GHWL 2W1NA 2J2ZA 5E1GA 1MCWW 1EZVX 2VDLH 1I1FB 2NUPA 5TQ0H 5EZIL 4XNAA 4FNRA 1WRFA 4QHKJ 4QMEA 3VUAA 3WTYA 4KKQA 3P0YH 3D8MA 5CHNA 4XNMA 4L05A 2AQRA 2GSGB 3ECQA 5D72L 1I75A 7PCYA 3VDCA 1GZHA 2ZKWA 2BIMA 3V6OA 4FYTA 4MXWL 5AOLA 2DQFA 4H2CA 4P23B 4NT6B 2EUWA 1THAA 1PZ2A 4AITA 1EZVY 1JGDA 1LE9A 1T66D 2ADJA 4YZWA 3MLRL 3GPSA 5D72H 2GSIA 4OLZL 3GHBL 4OLUL 1YMHB 1BQLH 1NMCC 4XCEB 5FYKU 2MOGA 1ZSHA 2H0FA 5I8OH 3PUUA 2G4GA 4LBAA 4MA8L 4Y5YC 2C8NA 3WD5L 4WO4D 3VG9B 1PIGA 3MLUL 1D7FA 2GVYA 1AC6A 3VWKC 5L0QB 5TTRA 1WBXB 2GC7C 3MLVL 4QXWA 3TZVD 1KENL 4XPAH 4OB5H 3HI5H 4BXSV 4A7UA 4BE6A 2VTFA 1QSEA 4Y1SA 2DM7A 2G3NA 5I19L 4ZFQA 4Z77B 3P73A 3CN3A 3TO4A 1BDYA 4LLWA 5CD3B 2ED8A 1JPFB 3UBXI 1ZSDA 5LKNA 5D7SH 3OB0H 4DQAA 5JO5B 1NCBH 1XAUA 1YRKA 1PZSA 3RHWK 4OZHF 2JJSC 5E8OA 3OVUB 4DIXA 5J11B 4QHUA 1NCAL 5FYJL 4UI2A 4X4YA 4KTYA 4FD0A 4IIQA 3FFDA 4ZNEE 2XFGB 2GJPA 3DX8B 1X6NA 2BIQA 3ARUA 4LP5A 3Q05A 3IETB 5JPNA 2EUZA 3DPBB 1M7DB 2APBA 4CSSA 2R4SH 4XPFH 5KSAA 3UAJC 3C5XA 2NY2B 2DQJL 4UTAL 1QR1A 4GKSA 5GISH 2H2PC 3V4PL 1GJUA 2ESVA 3SE8L 5IVXB 3T2NH 4A2GA 1GKEA 3IJHA 1M2VA 4ES8A 3DOHA 4DO5A 1V27A 2VOTA 5E2VL 3ZDZB 5EULV 5AB9A 2P5PA 5SWQA 2RFXA 4P23C 4X7TB 5ECGA 3WNOA 1F58L 2GI7A 1NCGA 3HG5A 1UYWH 4PCSA 5JR1L 1JD9A 3L3GA 3IDXH 3UBXA 4U6YB 4FKHA 4QHPA 5ANME 3TBTA 1TO4A 1HDMB 4NQVA 3Q6GL 1YEJH 3PIQB 3SDCC 3R0MA 3ZR6A 5ICYA 4J1UA 1LO3H 3T6VA 5B3SB 4UB0L 1USZA 2J8UE 3IDMB 2Y22A 1MXGA 1UM4L 2WWMC 2PPDA 3VWKB 5L0QC 3RIAK 4B9KC 4Q9RL 1JNLH 3V5HA 1CQKA 1H8SA 5AVUB 1NUFA 4AXWB 2PYED 4JN1H 4AQ1C 2R4RH 5FO7B 1TIUA 2CGZA 3HNVH 2C9SA 4Z7NF 1ZDSA 1SQ2N 1HC1A 4WK2B 1NCWL 1P7KA 4UNVA 4HKZB 4ZUVA 3UAEA 1VENA 1YY8A 2ZSWA 1AQHA 2QGCA 4NQCD 1D5MA 3VTMA 5DC2A 3HHRB 2R1YB 3FFCB 4AENA 3CSBA 3ZZLA 1GGCH 4LP4A 2QR0B 2QQNH 2Q86A 1KELH 1QACA 3IDJA 4LSPH 4HSAC 4MJ6A 2H26B 4RFEA 2DQGH 4XVJH 1RUAH 4R5VA 2J2ZB 3KLAA 2J8OA 3IDGA 4WWID 3IU4H 1EJOH 1WDAA 1WITA 1PAZA 4Q9BA 3QWRA 1X9RA 3L2NA 2NY2C 4DGYL 1PLCA 3VG0L 4JKLA 4BDVB 3MJ9L 3GO1L 2H7WA 1J48A 5IW3A 4XNMB 3X3GL 4RRPA 3LKNB 2VDPB 4Q97A 1MIEL 4RSYA 1Q9OA 4JVUA 3MRIA 4NT6A 1UD2A 3BP7B 5DQJA 1JGDB 1LE9B 3U4EA 2F5AL 4PHXA 3ARWA 1OK8A 2GSIB 1OTUC 1E40A 5BZXA 1IL1B 1CF1A 1OPGL 1YMHA 3EO0B 3JTBA 4M1GL 3WUZA 5K9JH 4E41A 4A6YL 2NZ1A 2Y07H 4BXVA 3N55A 1KJ2L 3X17A 3TBSA 4P46B 1D5IL 1G0DA 2KERA 3ARPA 1WZAA 2ARJB 1JVLA 1JZ6A 1Q0YL 4PLKD 3FN9A 4WDIA 2J88H 2ICEA 3E1F1 1BV8A 2LU4A 4K3HA 4DEPB 4Z77A 3TN0D 3S98A 4XMPH 4JFFD 3ZE2B 4ZODA 1J1OH 3SDDB 1HNFA 5TGBB 2X4NB 4MZ3A 1A6UL 4HK3J 1NINA 3RU8L 5I0XA 3NQKA 3MRRA 2AJYL 4ORZC 4MX7B 3L1OL 5CINL 5GIRB 4QHUB 3FW6A 4QXTB 3TT1L 1LNUB 5EBWA 4X4YB 4HUVA 2D0FA 2X44D 4IIQB 3KPSA 3L4UA 5ITFA 2CM5A 3NJHA 5A16A 5H4YA 1S5HB 4EIBA 1M7DA 1IZJA 4UQEA 1EHAA 2BP0B 2E9BA 3FU3A 5ALBH 3HC0A 5F0MB 5F97E 5HDLA 1JYNA 3D08A 4FEMA 4ELDA 4GKSB 2AV7B 1E0OB 2ESVB 4O4YH 3SO3B 1CS6A 4H44C 1KFGA 2BNQB 3WXWL 2BSTA 3US9A 2W95A 1UTDA 3J27A 4MD4A 4MXVF 3MXVH 2MCPH 1DBML 1G6RA 5E8PB 4ZFOA 1ETA1 2Q0ZX 2RFXB 3J7HA 4N8UA 1A4CA 3H4FA 1KPRA 5C0IA 4ATTA 3AJ7A 2XA8L 1DBJL 3POHA 2WB7A 4FFZL 3TO4D 3UBXB 4E0RA 1MJ7H 3WOVA 3PV6A 4AVJA 12E8H 1Z9OA 2HJFA 4NQVB 4AUYA 4D0BA 2DJMA 5HI3C 2OXGB 5T3ZH 3GMPB 4FS0A 4HKJB 4CNIA 2H2PD 1EANA 3FQXB 1IFHL 2NXZC 2XN0A 3VWKA 4QF1B 1NKOA 4FFZH 4WGWB 2PYFA 4JMNA 4W9FC 5DF0A 3WDIA 2R2EA 1A7RL 1PEWA 3V6OE 4FQIL 4H0HB 2CUHA 4AXWA 4P23D 4RVBA 2H6PB 2WVVA 3NABH 4KTEH 2JKTM 4JR9H 5GGRY 1FHNA 4AH2A 4PJDA 2R23B 1DE4A 1Y6KR 2HTKD 5DZNA 5JHAA 1JHKL 3B83A 3V4VL 4UT7L 2X2UA 5IB5B 3RPIA 1OSYA 2Q3ZA 1D5MB 2AQQA 2B77A 2GEEA 3CX5J 5DLLA 3TP4A 2B2XH 4OZIF 1BD2A 5EO1B 3FFCA 5KVEL 3C8DA 2VUYA 1DJHA 3WO4C 4PJIF 1CGSH 3PFUA 4JFQA 1AZBA 4JFEE 5C6PB 4OF7A 3EFFB 2VSMB 1NM4A 3NJXA 5HYSA 3L3HB 1GJWA 5DZLA 4MJ6B 3D3VE 2H26A 4FL4C 3ZSSA 5F3BB 1PY0A 2TRHA 3QI9C 1NC2A 3PP4H 3DGGB 3IDYB 4PJ8A 4PI2A 1Y7VA 1AOHA 5JDJA 2XZZA 2EIZA 4GRMB 1HOEA 1NBQA 4NLAA 3VXTA 4FQ2H 2Q76A 5AZUA 2FQDA 1GC1H 2G9HB 3DHJA 1S7RA 2YBRA 4OFQA 3RFZB 5GGTL 2ZUQB 2B5IC 3NPZB 4S1RL 8PAZA 4ZFGL 3RTQB 3SEPA 5F96H 1BG9A 3Q8AA 5H37A 5KS9F 4U0RC 2AMUA 3V7AE 2UZIH 1IFGA 1MVUB 1QLRB 1PQZA 1LEGB 4OAWB 2CKBB 3BAYA 2EDQA 4WW1B 1PIFA 3AM8C 1TITA 2W0FB 3O6ML 4JE0A 4JUTA 4BA0A 3C5SB 2A74C 2X28A 2LGNA 5I8KH 5C2UB 1DQKA 3MRNA 3OAZK 1DDTA 1R3IL 3X12B 4F7EB 4MGXA 1OTTD 3N0PB 3DYOA 3TBVA 2NQ3A 4CVXA 3RDTC 1CL7L 4XPGH 3KXFB 3UTSD 4GW4B 2OMXB 1WWBX 3G9AB 1RIVL 5IMOA 4YDMA 3IM1A 2JKIS 4YHIB 3D87B 5BQDA 4LAJH 1GH7A 4BQCA 1DHKA 2CA4A 2NY6D 1ETZA 2CBOA 4JRFA 4JAMB 1UWEH 2WXNA 4HIQA 2RACA 3X1EA 3QRFM 3NIGF 1C5DB 3WO4B 2YAOA 2J8HA 3ARGD 1LNUA 4JO4H 4HUVB 3QEUB 4FJZA 1A8JH 2AJUH 1JCVA 3FCTA 4PBWD 6CGTA 2XNAA 1UJ3A 2MOVA 4XX1G 4FL4B 1W72L 2QQNL 4I2XE 5D1QA 1JTPA 3UO8B 3P4MB 3JQOB 1TZIB 2VDKB 4GLRH 3EJJX 1HH6A 2BP0A 4NO5A 4GRLC 5EU3A 3HC0B 3FT0A 2R4RL 3UDWC 4W4OA 5AYQA 1H15B 5IBTH 1DBMH 3EYSH 1S9WB 3VE0B 2BNQA 4WCYL 3QHFH 5T5NF 1G7HB 2X4QB 3NACH 1LQBC 4N6RA 4AE0A 1WAPA 3W2DL 4MD4B 1HOCB 4GG6E 3RWEB 4I4WB 5HY9B 2WLLB 4ZTOL 4IKNA 2Y3NA 4OCNC 3MR9A 1KPRB 3CAFA 5C0IB 3A24A 2N7SA 3KMDA 3QQ9D 2R0ZH 2F1EA 1GGCL 3CSFA 5C08D 1I9EA 2FLMA 1UXLA 5EF3A 2KLTA 4NQXB 2K6YA 4JKWA 3G9VA 2A6DB 2OXGA 2MTAA 3N9GH 1G5GA 4Y1AB 4MDJA 4CNIB 5LQBL 5TDPB 2EXSA 1X5IA 2ZF9A 4QF1A 3LNIA 4RGOH 3V5DB 1P1ZA 4Y4HB 2A73B 2YOAA 3SKUD 4G7VL 3O3EB 3P02A 4PLKC 5FC9A 3S4SG 3V5KB 5BXFA 3BISA 3RVXD 5D6CB 4AH2B 5TPWL 1TDQA 2GK0B 4PJHB 4X4KA 3NT0A 1YYLH 1JNHA 1Q72H 3PV7A 3RPIB 1G9NL 2UZXA 1N8OE 1AGBB 2LFEA 3KPQA 3RWFB 3VRJA 4EUPB 1BD2B 1IZKA 1SHMA 2B7DT 2JJTC 5GGVH 1IE4A 5A2BA 3OKDB 3BQUB 4I0PD 4GPVA 3Q06A 1RERA 4U1KA 3ARFD 1P6WA 4AM0B 3A4DA 1P4IH 1Q38A 1XR9B 4XOAA 4J8RA 2V5RA 2DH2A 5FYJD 4NZRH 2XVGA 3MDJA 4JFVA 1JK8B 1E9QB 3BAEH 4BSJA 1SDDA 3DGGA 3QYCA 5HP5A 3ELQA 1AE6H 4P5TB 5J3HC 1EHKB 3QEQE 3QO1A 1NBZA 1CDJA 3FO9A 5D5MB 2YKLL 1WYJA 3CZLA 3WIFA 3WS6A 4YDVB 3FU0A 4AMWA 5JW4R 5GGQL 4KRPB 3FQWA 3MLZL 4XWOC 2XSKA 4FFYA 2YBRB 3I02B 1VPOH 2L0DA 2PCXA 4Q6KA 5EOQH 3SY6A 4HUKB 3LCYA 1N6VA 2WQSA 1FHGA 2Q3AA 3HHMA 4FADA 3DO3A 3P77A 3ILEA 1E3FA 1GCYA 2VDLL 3H7BB 1R5VA 1CO1A 1UOLA 4OF8A 5F93C 3RJQB 1GHFH 3MZGB 1PQZB 2QHRL 4F8QA 4O02A 1EVUA 5K9KA 3GXIA 4UYQA 4TNWF 4OAWA 3QUXA 4TMPA 3ULVD 2OMNA 1OARL 3EXLA 1FBIL 1F45A 2LHAA 3DXAD 5E99L 2B9AA 5D1ZD 1EHXA 2AF2A 3IDXL 4I48B 3UGUA 5E1HB 5IOPB 3C5SA 1J18A 3MRNB 5B3JF 1LP9B 1KCVL 4O4YL 1SXAA 2QHRH 4MS8D 4F7CA 4NUPA 4F8OA 4DAGL 1HHIB 3CFCH 2LLLA 2V2TA 3BLBA 3KXFA 5E8DH 5C0AB 4UT6H 4GW4A 2OZ4A 2YO3A 4YHIA 5ABAA 2R29L 4BKSC 1KB3A 3QJHA 4KUCF 4NDMA 3QCTH 4F7TB 3PWLA 3VFRB 3RGBA 3GZOA 4Y4HD 4M3KB 1NM9A 4XRCB 1HKFA 3HVNA 1D5XB 3I9GH 3VFSA 1DN2A 1MRCL 2XNAB 3CC5B 5INCA 3SOBH 2JVUA 4J3OC 4PMFA 3BN9C 4X42A 4WLCA 4J3OG 1OLZA 4LSQL 2NY1C 3P4MA 4M62L 1BW8A 3EYUL 1EMTL 5BUPA 4PJDE 5FX3A 5JIIA 5EU3B 4CGUB 3QXUA 2WYHA 3GXNA 3KLSA 3QK0A 3V6BR 1DQJA 3S7GA 2EO7A 4X9BA 1DQLH 3HMXA 5HYQB 1W0VB 3SBWA 2IH1A 1A8ZA 1X9LA 2ENSA 2I60L 3MC0A 2X4QA 1CICC 4LSQH 1BQ5A 4I77H 2XTJD 1XTMA 2B08A 3RWEA 3ZE0F 4YHPB 2WBJB 2A77H 4ZS6C 2W9DL 4P5MB 4K8RD 2EICA 5C08E 3WG7B 5IG7B 3QIWA 3EHBB 2PW1B 5TD4A 5IWLA 5IB1A 1KLGA 4I1NB 4NQXA 4A7VA 3VDBA 4ZAKD 3S5LB 4GKLA 1DSWA 1T7XA 3MKGA 4NOBA 4K5PA 4TSAH 3LQMA 4B3VA 1CZ8H 5L4JA 4NRXA 3V5DA 2WC7A 4JO8A 3ERXA 4MKTA 1P1ZB 4Y4HA 5B38A 2A73A 1QLEH 4U6XA 3QUMH 1EEYB 3SQRA 4U2YA 3KR3L 1M7IB 3LH9A 1ZWIA 5DQDH 3VGEA 3RNQB 4JZJB 1P84J 1RJZB 2V5MA 4AYMC 1BEXA 1VGKB 5I26A 2AVGA 1BZ9A 3AQDA 1T03H 4NQDA 2EIBA 5AG9A 4KMTL 4Y8AA 4RMQA 5GRWA 2JKJA 3KPQB 3RWFA 3HRZC 1ILSA 1W0WA 4UU9A 4XO9A 1UGNA 2V5TA 4D7PA 3HW7A 3BQUA 1T03L 4NO3B 5E5RB 3NIFE 2BSBA 4F8PA 5DK2A 1VEMA 4AM0A 3NZUA 1BG1A 3QDMA 5CCJA 3TCTA 1JV5A 4KKNA 1RUKH 1DJSA 1OTUD 5DC9B 5L2KE 1JK8A 4RGMB 1UQSB 1CGVA 3ATEA 3FT1A 2TRYA 2MKWA 1QLEB 3ORJA 3QO1B 4U3XA 1VACA 1K4CB 3UDWA 5EZJB 1XCTB 5L88H 3MRCB 2J4WH 4HGKC 5KVGH 2EYRB 2HFGH 5F89A 4XP5H 3T9WA 3H42L 3COOA 4JM4L 3KCPB 4YDVA 2RMNA 4N2CA 4WHYG 3HMXL 3LN4A 4XHJC 2G0LA 4TPRH 2X6UA 3WNLA 4WJKB 2XWEA 4NQEA 4OF5A 4MZ2A 3TA3C 2R7EB 1NAMH 1SN0A 4NYLA 2PYEB 5AUMA 5JORB 1ZPUA 3ECVA 3ZE1B 3FONA 4A7SA 3H7BA 1R5VB 2I85A 1A9BB 2IOOA 2V2WB 4AGMA 4YDZA 3U79A 1U6AH 2BVUA 5FDYA 3TEWA 1J86A 3HC3H 1RZJH 4KC3B 2HLEB 5HI3D 4CRPA 2PCPB 4UZUA 3E6FB 1QHOA 2OX5B 5K1VA 3U7WH 3VQMA 5JHLL 1E5UI 4I48A 4OVUA 3MKKA 1HKLH 5FO2A 2MMXA 4DAGH 5IOPA 3C08H 5C7ZA 5BUAA 3AU1A 5F1IB 3SDXB 4KOCA 3MREB 3PQYA 5AB2A 2EDHA 4AWJC 2FO8A 3AS2A 1EHLL 4H4NA 1U8QA 4GO6B 2FQEA 3LRKA 1CFMA 2Z91B 1XSOA 4RFNB 2O5YL 1T7ZA 2DN7A 4CMMB 2E9IA 2YRLA 4IBUA 4BM7A 4WFHD 1Q94A 3S8FB 5EORL 4F7TA 3FCUB 2ZNXA 1KV7A 5ADPL 2XKNA 2NY4D 5BPPA 2Z65C 3SODB 1OPOA 4E36A 4NPYB 4XRCA 3HNTL 3UOAB 5KYWA 2QVMA 1D5XA 2KI6A 4RBPH 2X1XR 3VFSB 4ANXA 5INCB 2DTMH 4Q89A 3B2UD 1B4LA 5KVEH 2NLJB 3HC4H 4UMGA 4M43H 4Q0XH 2N0MA 3U2JA 1JRHL 2CNZA 2A9ML 4IOIA 1FVEB 3S3BB 3L2LA 1OSEA 1I9RH 2VAJA 3DBXB 4AKPA 2HWZH 2ZAIA 2YJLA 4K71B 4LFHD 5MP6H 1K9TA 3RJOA 1W0VA 3WS6C 3BVNB 3CZKA 3ZTEA 3U6RA 4Y19A 2ED7A 4D3CH 1JHLH 5CP7A 1KEMH 4ADJA 5C86A 1T2QL 5GJSL 4P2QB 3P9MB 2CALA 4HPOH 2WBJA 3AG2B 1JV2A 3BAWA 3AW5A 4QRPD 3OM3B 3QIWB 5I75C 1HXMA 3WFBH 3X3FL 4WWNA 2WO2B 3F58L 1KLGB 2ZCHL 1N12A 1JVOA 1TQVA 4GW1B 1G1YA 3CZNA 3GUFA 4H0GA 4JM2C 4L3CA 4OKVA 4FEIA 2NY3B 4FFWC 4GSDL 4H0IA 1HL9A 1KIQB 1LK2A 3CN0A 4JO1H 2A9BA 1U3HC 1RIUL 1EDHA 3JTTB 2Y7SA 1DBBH 2E7MA 5DFVC 4DVBB 2FSEB 1QEXA 5B38B 4U6XB 1AIZA 1EEYA 3FULA 5IJKC 1DUYB 4KBPA 1ZWIB 5HI4D 4JZJA 2CDFB 3UFIA 1NCUA 2BFVH 4KROD 1XB8A 5KZCD 1D9KA 3ZE1E 1MUJA 1QBML 1KXVA 2LR4A 1QPPA 5PCYA 3QWNA 5IBLD 3RZCA 2J72A 2WXLA 1W0WB 4UU9B 4OI7A 3GI8L 3W82A 4AT6A 2FD6H 4NO3A 2H1PH 5DJYB 1SVCP 1JCKA 1M1XA 3ETSA 3QR1A 4XN5A 5DK2B 3ZDXE 3AREC 1J1XL 3V52L 4HV8A 3ZE0E 1PKOA 3ZQXA 2Y1AA 1A7RH 1I82A 1SFDA 5IW1A 1N9PA 3QDMB 1JV5B 1ITCA 4HQQL 1B90A 3U2IA 1UQSA 5CO1A 2VLJD 5DZOA 1OT2A 2FO4B 2CAKA 3EJYD 5JW4Q 1T83A 2ITFA 5EF1A 4RNRA 2CHXA 1A3RL 1K4CA 1QP1A 2F53D 1XCTA 5A6MA 3VI4F 2DQUH 1DJIA 3MRCA 4HMEA 4HZ1A 3QG6B 5A6LA 1WV7T 2EYRA 5F89B 5EDSA 3LS5H 1CICA 4LVNB 5HI5C 5J9PA 4X9YA 2EP6A 2HLFD 5KJRH 2PXYB 4I9XA 2FHFA 2AEQL 2P5WA 3BD3A 1FORH 5DHVH 4EVNB 2QQKH 1QFOA 1K4DB 2BNRB 5EEVA 1KJVB 2FGZA 2PYEA 2L3BA 4G71B 3GBMH 5I75B 2VN5A 3OZLA 1UKTA 5L4IA 4FQXB 1G1KA 2UWEE 4S1DC 1G4RA 4NHUA 4HCRA 1TKWA 2F54E 1LO4H 2NY3C 3UZVB 2QQKL 5L8LB 3GLZA 1IBBA 5GS0D 2ZOOA 2PCPA 4TL4A 2UY6B 5D71H 1Z66A 3PGDA 2H3NA 1U3HB 1PU0A 3FFOA 5D4QA 2HJKA 1TVBA 5B7EA 4N5UA 5CNHA 2IWGA 4ZD3H 5I1DB 5I73C 3D7PA 3WSQH 2J43A 3PQYB 3PXHA 1QA9B 1LO4L 3H4HA 5CS7A 1Q1PA 2O5YH 5H37H 2ZQKA 3KVDD 4AYFB 3DUUA 3QFJE 2EE3A 1PCXA 1WS7A 5LO7A 2E74C 3Q1SL 5L2KA 5D93C 1ZJBA 3CZUB 4ZMOA 1Z9LA 4PB9L 3WBDA 5JOPE 2KT6A 1VKXB 4UNIA 5AW6B 4LNVA 2XKNB 4S0SD 3FPXA 4PV9A 4P57B 1ZV5A 3AREB 4N25A 3Q1SH 1ZKAA 1VGEL 3L8QA 1G7MB 1ZE3C 5E9AA 1R4XA 4FQHA 3PHQA 5IR1A 5ACMA 4NQEE 2J88L 2DBLL 4IOIB 1FVEA 1RZFL 3NJVA 3ZYIA 2D2CC 1IKNA 2C3VA 3OX8B 2JCCE 3BDBA 4LHUB 1FNLA 5CJQL 2XA3A 5DYOB 4Z23A 2E6QA 4FJYA 4AX3A 2CKBH 1DTUA 2FJGA 3AAZA 4Y19B 3UGXA 5I5IA 5CP7B 4B9FA 2HX8A 4XMTA 5HXMA 4WI8A 4QXGH 4B41A 2GEQA 3G6JE 1PZAA 2YSTA 3CK0L 4DZBA 4MZIA 1W6WA 1HU8A 4JL2A 3LRHA 1JV2B 4PGZA 1UWYA 5AALA 4BK5A 1N6UA 2VL5A 2JKRM 3CFUA 4MAUH 4I9WE 4ENEC 5AZ2L 4AK2A 4YNYB 2KH2B 3RVUD 1ZGLM 3UTSB 5JW3H 1FH2A 2Z8RA 4OKVB 4WO4C 2DJSA 2YD4A 3OAUL 4KXAA 1DBBL 4ODUB 3STLB 1KIQA 1LK2B 4IRSB 4RA0C 3GRWH 1B2YA 3NJFA 1WTGT 2BVOB 3N04A 1IGIL 2BFVL 5HDBF 2WXOA 4G9DA 4M5SA 4HIXL 5I0WA 5A2KH 3A67L 1ZLVH 3O4LD 4QHNA 5J57B 1DUYA 4MS8C 4EI5A 3MXVL 2PPFA 1F4YH 1TJHH 3IE9A 2W92A 3X1GA 1EJOL 3NIDF 4JHWH 5ENWB 5KSAD 1MFCH 3EJSA 4P5KA 4LLUB 4RETB 4TLTA 1UC6A 3UERA 1XEDA 2XA8H 4M7LT 5LJYH 3FK3A 3VH8A 2UWEB 2BFGA 4NM4H 1Q1JL 5IVZB 3GWJA 3V52H 4MCYB 5E2JA 1FZKB 3SBQA 1YJDH 1N2RA 2EC9U 4HWEH 3U4KA 1GY1A 4GO8A 5AVRB 3EH4B 5D96C 2WBJD 5DEJA 2FJUB 3GBEA 2W59A 1A3RH 4TUUA 4U1GB 1R17A 3ZT5A 4HUMB 4FZ8L 2OV0A 1JHTB 3O8XC 4P4RB 2FO4A 4JFFB 1I8UA 1KEGH 4RNRB 4BJLA 2R9HD 2O5NA 2KLRA 4Y88A 4G6FD 1TEGA 2Z4TA 3DX1A 2OS7A 5BRZE 5IF0A 3GLEA 3O6FD 4WGVB 1LDSA 3PWPD 3MV01 4L3EE 4G5ZL 4YX2H 4AVKA 1MI5E 3I6GB 3TH2T 1J5DA 3FO1B 4O02L 5J9PB 3NJJA 4L37A 3KGTA 3K6OA 4M8QB 4UIMA 2CXKA 3VQLA 4LVOB 2X2JA 4XPAL 1K4DA 1T4KB 3V9CA 5CBAA 3S3JA 3EUDA 4F9LC 4IKKA 4FQXA 3ARDB 4LCYB 5DS8A 1JZIA 2K9FB 2VITA 2YD8A 4LCUB 5CN3A 4V11A 4G42B 3C60A 1KY7A 1B4RA 3PWUA 6FABH 4XNXH 1T1WA 2XZQH 2NY2D 3DYMA 1KSRA 3QZWG 1V3JA 3DSFH 2MCMA 4APQC 1IGYB 2OZ4L 5D1XA 3GS0A 2H3NB 4RISH 1U3HA 5JQ6H 1RL1A 2E27H 5LNGA 5CZXD 1I31A 4KKPA 2P80A 5B8CB 3EJCA 2NQDA 4XZUA 3VXRB 1AQDA 3B6SB 4UAOB 3UYRL 1M57B 4XNZB 2DI7A 4P9HL 5AWNH 3KPSE 2BVQB 3DETC 5DJAA 3AROA 4AYFA 1WK0A 3LNEA 2XWRA 4KUZL 1IQWH 4EI6A 4AYGA 3FQNA 1YDPB 2HYMA 5L2KB 1GIGH 3QNZA 4G8GE 5FM5M 4MLSA 4Q9QL 4Z7UF 4A68A 3F58H 5E4AA 1SY6H 5M7QA 3B9KC 3QARA 3LIUA 5I1EL 3AREA 3HS9A 1U9KA 1GMEA 3C2SA 2F61A 3L3OA 1IBHA 4U1GC 3LZRA 1G7MA 3BO8B 4M1CC 1LEKA 4JHAH 2QPDB 3VFWB 2F54D 5FHBL 3AABA 4B5ZA 3TWYA 5EMYA 5C3TA 4JZNB 4XN4A 4N87A 3IS1X 4FQCH 4QY8A 1UM5H 4AI7A 1ZLWH 4IHOB 4U7KA 5DYOA 3BSZA 2VDRB 4PJCE 1E8YA 3T8MA 2YMTA 1JPGA 2EDRA 2WOBA 3LQAH 4DN3H 3L16A 2YKKA 2ZX9A 3OWEA 3S36L 5C0BA 4ZMTA 3GZPA 3CN2A 4JFOB 2XXGA 4FQCL 4WY7H 3UMTA 4OCSH 4WFED 4N85A 1KFAH 1WHPA 5I66A 1PGRB 5I0YA 3FH7A 4NO0B 4U05A 2E8YA 4JO2H 4PJGF 5F6HI 2DS4A 4P4KA 2FJHB 3N41B 5IHWA 1OALA 3U82B 1OB1B 4OJDH 1ZS8A 2D03L 1YEHH 3NAAH 4IRSA 3VFTB 4APQB 2DMHA 4MMXC 3O3BA 1ADWA 3O4OB 4LXFA 1EAJA 3Q3GB 2HKAA 4G9DB 5KSUB 1MY7A 1KIUB 1Z32X 3JWDL 3BT2H 2ZOTA 3MRHA 4HBCH 4XOCA 4XNZC 5I1LA 4GMTH 3VGHA 3GSNL 3KLHC 4ODBD 2IANE 1HKLL 1UADC 3VXQA 2HRGA 1LO2L 1XF4A 5KSVB 2UWEA 3P0GB 3GDCA 4L1DA 5DUBB 3DRTB 4H8UA 4G43B 1F13A 3X13A 4DJMA 5ES4B 2WKLA 5DT1L 4MCYA 1FZKA 3UTZA 4XN8A 1N2RB 4KKZA 3RWGB 2K6WA 1I1AD 4OH2A 1ZMYA 3T6QC 1FSKC 1PG7H 4HJJL 4LL4A 3QJSB 5EBGA 1NICA 2G3ZA 3V0WL 4KXZI 4WWKA 2AQPA 1QLEL 1I7RB 1KXHA 4GBXD 4U1SB 2VXVL 3QWOA 4Z5RB 3HNSH 3ZXAC 4WNQB 4DQOL 4NQSB 5F7YC 5EU7C 4HG4J 3MODL 1CXEA 2HTKC 2C7FA 4HX1A 2OA9A 5BJTA 4KJYA 3W1ZA 4PEEA 1QAWA 1JPEA 5JHDE 1T0MB 4ZO6A 1E4JA 3TWCL 3C8HA 4NNPL 1HQ4A 4L37B 4QR7A 4M8QA 1SN2A 2F53E 4HAGA 4S2SA 3LB6C 4ABWA 2YQ2A 4J3UA 3LZQA 2CA3A 2OJ1A 1ES0A 3CXHK 5DMKB 2GQHA 1NCDH 3GUTB 2A6JA 5AW0B 4ZK8A 3UYPA 3GHEH 3LKPB 3QISA 3RY6A 1LO3L 2VITB 4LCUA 1H19A 2F7IA 2JK5A 2VXQA 3E6HA 3LPPA 4NQCB 2IPUK 2C9UA 3PWUB 5GGSY 1E4WL 4YXLH 4LLQA 1WIUA 2C1PB 3BJLA 4FFWD 4K8RH 4N3TA 4G6MH 4JRYE 1T5KA 1TVHA 1KCUH 4GQ9L 3FRUA 4S1QH 4ALAL 5B8CA 2FGWH 3NZHH 2E7CA 2Y2TA 1AQDB 3B6SA 4M9OA 3TS8A 5KS9A 2A0LD 4OCLC 5ACZA 4UTAA 1Z9MA 5IQ9A 2ORBH 1A7PL 3LEVL 3MNZA 2VZOA 1QD0A 5K93A 1PD1A 4TTGA 3ARXA 3SHSA 4PCKA 1WBZA 3FT4A 2OPCA 4V1DD 1RPQA 3DUHA 3SD2A 2X7LA 2AK1L 2HCZX 1BWMA 1HCVA 1QW8A 1KGJA 2AABL 3MA9L 2V2XA 4HC1A 2BNQE 3D12B 4JHAL 4NM4L 3NSJA 2EXWC 3B2PA 4YDIH 3P2BA 2OMZA 3GB7A 1PX8A 4TUKH 3QUYA 2HXAA 4XMWA 3L3OB 1N0XH 3B43A 4YLCA 4A7GF 1QVOB 4OJYA 1J8RA 5EZIH 4I7ZC 2WQRA 1TO5A 4H1LB 4NZTL 4F15C 4KK5C 4JZNA 3MTRA 3O6FC 5FW8A 4PJAE 5KWYC 1GAFH 2VDKL 4DESA 4IHOA 4DN3L 4GEIA 3D33A 4HEMA 3SDYL 3V4VA 4TVPE 3AT0A 4KI5C 4PY7A 3RTLA 2ZSVA 3CVHH 1IT9H 1KFAL 5BZZA 1G7IB 1CD1B 1N64L 2C9RA 1IAIL 3SDAB