1NIBA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
333
structure length
333
Chain Sequence
b'DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 87
structure length 333
sequence length 333
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA02
4TXVB 1WA1X 3PAZA 2BO0A 2IDTA 1A4BA 1BAWA 1URIA 1KCWA 4KO5A 3S8GB 4JHUA 3FSZA 2CUAA 4YSTA 4DPCX 3WNJA 2YAMA 1E5YA 3FSVA 2QT6A 3NSDA 4AZUA 1M57B 4P5SA 3WI9A 3FYIB 1NWPA 3CVBA 1A8ZA 2X87A 4UAHA 2FJSA 4F2EA 1W6WA 1BXAA 1ZV2A 2HXAA 1ET8A 2GC7C 3MX0B 5AZUA 2J57A 3BVDB 5I5MA 1XMEB 2XXGA 4GY4A 1AOZA 3CDZA 4BWTA 1WA2X 2DWSA 4DP2X 3UADA 1MZYA 1GS6X 1B3IA 3OMAB 4ENZA 6PAZA 3IBOA 3UABA 3NYKA 1ILSA 2N0MA 5B7EA 3BQVA 1GY1A 2XV3A 3QJRB 1TEGA 2PPEA 1JERA 4YSPA 2MTAA 2PP8A 5FC9A 4A67A 3UACA 2FTAA 1W8EA 3MBWB 1PLAA 1WA0X 2OV0A 1MZZA 2NRDA 1YLBB 2Q5BA 1EZLA 2EILB 2J5WA 2VW6A 4BXVA 1GYCA 5A7EA 3PAVA 3S3CB 1R1CA 3QPKA 4QLWA 2IWFA 3IN2A 7PCYA 2XV0A 1JVLA 3ABMB 1CC3A 2IH8A 2VSMB 3ASNB 1KDJA 1M56B 4DP7X 1AR1B 4M4RB 3T6VA 1HAUA 1X9UA 5F7AA 4E9SA 1QNIA 5I6OA 3NJHA 2BWIA 2HX7A 1NIBA 4KNSA 1EHKB 1RCYA 1GSKA 1DYZA 2W8CA 1PF3A 4X4KA 2A3TA 2Y1AA 4HALA 3DKHA 2HRGA 3NP3A 1J9TA 8PAZA 4AI7A 3TU6A 1OCRB 2CBPA 4HHGA 1NIDA 5LDUA 1SHXA 3TA4D 1GR7A 4HAKA 3S8FB 3WG7B 1IKOP 4AKPA 2YAFA 3CDZB 4A2GA 3WKPA 3FQ1A 4YVUA 3ABLB 4CSPA 1SFHA 2H3XC 4P5RA 1XB3A 1HAWA 4E9YA 1JXFA 1L9SA 2XVBA 2YXWA 2WO3B 4L0PB 1ASQA 4A2HA 3EHBB 3L45A 3X2QB 1V54B 4RH4A 2DWTA 4AKQA 4A66A 3N55A 4G72B 4YSUA 1OV8A 3H56A 4GP5B 3FU8A 2W88A 2X88A 1W6LA 3KW8A 1HFUA 5I6LA 1AZBA 1NIAA 3H4FA 3FU7B 3OQRA 3SQRA 5I5IA 3UGEA 4MFHA 1KBWA 2TSAA 4GP4B 3ZDWA 1N70A 4G70B 4HIPA 2PCYA 1CYXA 2BW4A 3X1GA 2GSMB 4E9TA 1KDIA 1JXGA 1OF0A 3PAUA 3QJTB 1XB6A 4NAJA 2AZAA 3JTBA 4KOBA 3FPXA 1BQ5A 3HEIB 4N4YB 1RZPA 3CVDA 4DP6X 3T9WA 1KCBA 2PPAA 4DP1X 4DP9X 2BW5A 3TBCA 3UAAA 4BWWA 2Q9OA 1PY0A 1RZQA 2YAHA 3V9CA 1J5CA 3EH3B 2UXGA 2IWKA 5I6MA 4PCYA 3NJIA 4G7QB 5IY5B 2EIMB 1OCCB 4W1TA 3IE9A 3ASOB 3WNIA 4WTQA 1QHQA 4A68A 4YSDA 2FT6A 2DYRB 4DPAX 2FQFA 1N68A 2AFNA 1TU2A 2BHFA 1ET7A 3FQ2A 4F2FA 1GS8A 1T5KA 1NIEA 2UX7A 4Q8BA 2UXFA 4KO9A 2ZWNA 2XX1A 2YAOA 2DYSB 3AG2B 3AW5A 1BEXA 4F7KA 1IBZA 3GXUB 3JT2A 1AZCA 4JHVA 4BDVB 3OM3B 1BYPA 4GXFA 4BXSV 3TBBA 1PNDA 3NJNA 4HHWA 3AG4B 5ANHA 3RYMA 2VW4A 3ABKB 2VMJA 3NSFA 3ZX1A 1KGYE 2CAKA 2XYBA 1XB8A 3EH4B 3V9EA 1DZ0A 1PZCA 2QDVA 2GI0A 3FU7A 2GBAA 2VN3A 2HRHA 3AG1B 2Y69B 4YSRA 2FT8A 1M9WA 4K9JA 1JZFA 2DY2A 1L9QA 2PP7A 3ABGA 3T6ZA 1SDDA 2BP8B 4G71B 2XWZA 5TK4A 3ZIYA 4YSQA 2AVFA 2PLTA 3IEAA 3QJVB 5F7BA 1AQ8A 2XV2A 1AZUA 1CYWA 1PZAA 7PAZA 2XX0A 2CJ3A 4CSZA 2QPEB 4HZ1A 1IC0A 4KOCA 2YAPA 1J9SA 1GS7A 4DP5X 4YSCA 2BWDA 1I53A 3X1NA 3D12B 1VLXA 4NB7A 3DTUB 1NINA 5AKRA 2CCWA 3HB3B 3N2JA 1AACA 2B08A 3C75A 3T71A 3NSYA 5I6KA 3PXLA 4PAZA 1KV7A 4E9WA 1JOIA 3OMNB 2I85A 3FT0A 1MG2C 1WS8A 4YSAA 1CUOA 2OCCB 1ETJA 2PP9A 1NTDA 2CALA 3AZUA 4BDVA 4E9RA 4M3HA 2YARA 1OE2A 5E9NA 3GYRA 1NWOA 3CVCA 5B1JA 1PMYA 1A4CA 5PCYA 1L9OA 2PPDA 2UX6A 2YXVA 3NT0A 2PPCA 2P80A 3QJUB 2OJ1A 3NJMA 4A2FA 1PLCA 3X1EA 5B7MA 1GW0A 1ET5A 1ZIBA 1ADWA 2BP8A 2GB2A 5D4IA 4AX3A 3NJFA 3T6XA 1AS6A 1V55B 2PPFA 2FT7A 5I5JA 4DP0X 1ID2A 1SDDB 3FU9A 4E9VA 5D4JA 2IWEA 1A65A 1BXVA 1SJMA 4QKTA 2H47C 4JKNA 1E65A 4AKOA 1JXDA 2IAAC 1AZRA 2YAEA 2P80D 2LLNA 5B1KA 3PPSA 1V10A 2IDSA 2VSKB 2BP0A 1NPJA 2J56A 1E67A 1OOWA 1OCOB 1PCSA 1ZIAA 2UXVA 4NERA 1ZPUA 2JXMA 2EINB 1ASPA 4GP8B 1X9RA 1WAEA 3FS9A 4DP4X 4N8UA 3FSAA 3S3DB 1L9PA 4HCFA 4HCIA 1FWXA 3WKQA 3WIAA 1CURA 1ZDQA 3PLYA 5B3SB 5I26A 4FA7B 3NP4A 2HZHA 2VM3A 1OCZB 2MRYA 3QJQB 3KW7A 9PCYA 3DIVA 5B7FA 2RACA 1SHWA 3AY2A 4KO6A 1L9TA 1E5ZA 1A3ZA 1E30A 1PAZA 2JKWA 1MDAA 4KO7A 2VM4A 3S3BB 1WS7A 2HX8A 3G5WA 2IDUA 2XLLA 4E9QA 2H5UA 2I7SA 1ASOA 4YSOA 1NICA 2BZ7A 4BK5C 1AS8A 1A4AA 1AAJA 4YSSA 2PCFA 1KYAA 2ZXWB 3ZBMA 1BXUA 1ZDSA 3CG8A 3FYEB 1SNRA 2JFCA 3AG3B 1BQKA 2BZCA 1FA4A 1FFTB 2WO2B 3H4HA 1J9QA 1OE3A 3X1BA 2B3IA 3OMIB 2GHZA 1PZBA 2FNWA 1ILUA 4Q89A 4BWUA 1JZIA 2VW7A 1GY2A 1IUZA 3FSWA 5I28A 1BQRA 2BP0B 1NZRA 2GIMA 2R7EB 1QLEB 1TEFA 2XXFA 1JZJA 2ZONA 3SBRA 4DP8X 1AG0A 2HX9A 4HCGA 2IDQA 2E86A 1JVOA 5AFAA 1NIFA 4FAAB 1AZNA 1NPNA 2UXTA 3NJGA 4KNUA 6PCYA 5B1AB 2FQGA 2FWLB 1IBYA 1OE1A 3U25A 3UAEA 2AZUA 1PLBA 1SF3A 4YL4A 5B1BB 1AS7A 4A2DA 5PAZA 3FPYA 1SFDA 5D4HA 3EH5B 3ERXA 4G7RB 5B1JC 3T6WA 3NJJA 2IDFA 4UF7C 1PNCA 3NJKA 3CZUB 3PCYA 4ZK8A 5TK2A 3X1FA 2YAQA 1AG6A 1KBVA 2AANA 4DPBX 1AIZA 1NDTA 1BYOA 4WKXA 4W9ZA 3OD3A 4UANA 2EIKB 1JZHA 4YSEA 1F56A 1J9RA 1SF5A 2ZOOA 2FQEA 1JZEA 1L9RA 4KNTA 3EF4A 1MG3C 2FQDA 5EHFA 3NSCA 5I6PA 4EF3A 3SBPA 3GDCA 4A2EA 2J55A 1JZGA 2IH9A 3IN0A 3SBQA 1AANA 3QQXA 2DV6A 1RKRA 3TASA 3QJSB 4E9XA 4YVNA 4GYBA 2EIJB 2TSBA 1J5DA 2XUWA 2I7OA 2QPDB 2QDWA 3NJLA 1TKWA 1UATA 2R7EA 2HLEB 2XU9A 2YQBA 2WSDA 3FQYA 2GC4C 5I6NA 4G7SB
chains in the Genus database with same CATH superfamily
4XRCB 3PAZA 5K1JA 1D2OA 2BO0A 2ITEA 5KN5A 4BE5A 2Y6TE 3LSOB 3CU7A 1F00I 5FOBB 4GRLA 1WWAX 2Y2YA 3MRQA 1ULVA 2F8OA 4O9HL 4Y9GA 3K2UH 3QPQD 4UNVA 5CCKH 4E42A 1LP9B 4J4PD 5EO9A 3HC4H 5EZLB 1YMHA 1HH9B 5EEYA 2VJ8A 5DWUH 4NN5B 2R4SH 5CFHA 2ZKYA 3MX0B 3TO4A 3VFGL 3KR3L 3LKNA 1TQCC 4QRQA 1S6NA 1I82A 3IMUA 4XWOD 1X5GA 2DWSA 5L2KD 4UMGA 1T3FB 1CZ8L 1NM9A 2J8UE 3R0MA 5A7BA 4G5ZH 4Z5RB 3RPIA 2XA3A 4MQ7A 2VITA 3IJHA 5I24A 1II4E 4ZUWB 5J9PB 3MREB 2CIKB 4U1MB 2PUQT 4H8WL 5ENWB 4EI5A 2IPUG 5H37A 5E08L 5HHPA 1W8EA 4Q6IC 1EHLH 3VXSE 2OSXA 1IV8A 3B9EA 1QEXA 3Q0HA 2YD0A 3EOYG 4ZMNA 1Z5YD 2K45A 2H26A 3UO1H 1MZZA 2XN2A 1U92A 3WO4B 4MXQD 4NT6A 4U2ZA 2UV3A 1ACYL 4PJ9B 3CV5A 1OSYA 1UJ3C 2IWFA 3DOSB 2X4RB 1CLVA 3W81A 2WUCL 3QYMA 3WBDA 4JL2A 1A1NB 1OAXH 3FONA 3R7QA 4AYID 3V6FB 3DV6A 3UYOD 4JRLA 2DW5A 2XJKA 2XSKA 4KC3B 2NY7L 4KY2A 3UP1A 4JFQA 1GCFA 1C16B 1I1CA 2XA8L 3DARA 4O2FA 4HJ1A 1X9UA 1U3ZA 4F8PA 2HT3D 3DX9A 3TBVB 2KERA 3VD9A 4TQIA 3PPEA 1T1ZA 2WLLB 1R75A 4G42B 2L3BA 2OR9H 5IROC 1VKXA 4CDGC 5F1SA 4LU5L 1Y1UA 1EHKB 3DURB 3D4ZA 3W0WA 1IEAA 2W5PA 1TXKA 1DTUA 2J21A 1Z9LA 3B5TA 2VUYA 3NOIA 3QXUA 1LJMA 3N3EA 2H3KA 3HNVL 2UUDK 5JUEL 2ADFH 2WOYA 4DK5A 5I71C 4ODTH 3IKCA 1NFAA 4YUEL 3MLRL 5HDRA 4LSPL 2YAFA 2QGBA 2QSCH 4LGRB 4TNVF 4YO0A 1CFTA 2BMKB 3GK8H 3T1FB 2FLRT 1OAQH 3CVIL 3JV4B 5B39B 4Y16A 3EJYC 4X9IA 4QYOA 3VQLA 1W0VA 2DLFH 2XWXA 4P57B 2CJUL 2WO3B 2J20A 3WJJC 4FKEA 1OGTA 2VERA 3QUGA 2ZUTA 4EQ3A 1MIMH 3X2QB 3R06B 5B3JE 5BXFB 1SM3H 4DVBA 1F3JA 4XP9L 1W0WA 3FU8A 3OLEA 4EI6A 5I1HH 5I6LA 1A14H 4FTVE 4NHCH 4K4KA 2WIMA 4HJGA 5DI8B 3IF1B 4KKCC 1EAPB 4M8UA 3WFZA 2CKBA 3ZKNC 2V17L 3LNGA 2Z1PA 2IAMA 1WAPA 1RP8A 2OXHB 4EQ2A 1NMAL 5F7EL 2XVGA 3BD5A 1G9NC 4ZFOB 4LHUD 1Q90A 3MV11 1G1YA 2RCSL 1KDIA 4MMZC 1G9MH 1XX9C 4FJ6A 3JWNG 3ALPA 4PR5A 5L2KA 1JYXA 2BC4B 3O6FD 2BSEA 5J1TC 4JFEE 3I6LE 1ZV5A 3Q8BA 1EO8L 3L08A 3MJGX 5D5MB 2V8LA 4YEEA 4Q9BA 4PJXB 4DP6X 5IVNA 3T2PA 3GS0A 5CSGA 3LXCA 3UAAA 1FJ1A 1BVLB 1NQBA 1PZSA 4PJDF 5I75B 2DMKA 1QBLL 1SLVA 3KM1A 1S3KH 2EDEA 5G4NA 4LKCA 4GQZA 3MMEA 4JN1L 5TE6L 4PRID 1EANA 2IWKA 3VU1A 4MJIB 1D5XA 4Q7DA 4F9LC 5DXWA 1MFAL 1OOAA 4JANA 2J1YA 3FB7B 2ADGB 5IT2L 1FZKA 4K0OA 5INCB 2EXWD 4HZAA 4HK0A 1KEMH 4HKJB 1T21A 3MXVL 1TU2A 4ZX5A 4ANWA 1ET7A 3WN5A 4C83B 3GNMH 4Z8FL 5JTWA 1U95A 1MSPA 2A1WL 1UENA 1XH0A 2PW2A 1U4EA 3I85A 4TSAL 5L0QB 1C5CL 1TSRA 3QIUD 3D0VA 2QQKL 1G7QA 4H8PA 1AD0B 1Q94B 2WLIA 4KQ4H 3STLA 1A7PH 1VAHA 5IMKB 3FT9A 4X6BA 4JO3L 4IEFB 4IRSD 3IPEA 4UQ9A 1DBKL 1M9WA 3K8MA 3U36B 4JKKA 4OUOA 4N22A 4X6CE 4OUUB 5TDNB 4DAGH 3ABGA 1O9VA 2VM9A 2ZJSH 3DOHA 5CJQH 5F7NC 3KLHC 3T3MF 5E6SB 2D7MA 1CBVH 2V2WB 4PWFA 4EAEA 4OGAD 1UD2A 2J5LB 1KPRA 3LRMA 2ZUWA 5AYTA 5BV7L 1JPSL 1A6ZA 1LNUB 5TDOA 1W91A 4Y9BA 5LGJA 3VI4B 2Q8BH 3VW3L 1I3GL 2R2HB 3FSOA 4OJDH 3BWUF 3OHXB 1OM9A 2W9EH 3AADB 3FTZA 4R9HA 3WKYA 1J9SA 4BZ1L 1GPOH 3D12B 4JY5H 3QORD 1P9MA 5LHDA 4P5TB 1BEYH 1FL5B 1OD9A 1RIVL 3RHWK 3F84A 1OKEA 2EDRA 5BS0B 5EPMA 4FNRA 4S1RL 2Y5TA 4Y1TA 5SV4A 2C3WA 1F41A 4BKTC 2GJJA 3CHRA 2O6DA 3OB0K 2VDPB 3ENEA 5KSAC 1FL6B 4NRXB 2DDQH 4P4RA 2YUZA 5J13C 3L3OB 3FTYA 4LHUA 4HHAB 5GGVY 1PFCA 3DSNA 4QHKI 3SE3C 4EIUA 3QNZA 4XPFH 4MLSA 2UVEA 4NKOA 3O6FA 2NSQA 4KKLD 1F58H 3ZQWA 3N40P 4IOSD 5SWZD 4ZDHA 4ETYA 4QHKJ 4POUB 5D1XB 1K8DA 4J3OD 5KYYA 1U91A 1D7CA 5MENE 4L1BA 4H88L 2BY3A 4JM4L 4RSVA 5BVPH 2YRZA 4RISH 3T1WA 4H1LB 4J8QA 4JFSA 1JHKH 3ZHKA 1IBHA 4PRIA 2AXFB 3BAEL 1WH0A 4PFEA 1ZIBA 2H6PA 3AY4A 5AL8A 4XNMB 5DURD 1Y6KR 1MJUH 2BNRE 4DO5A 2JKRM 1LO2H 4UOZA 1CFMA 1H3WM 2NSXA 2FUQA 4BA8A 1A47A 1VPOH 5DYOA 2NUTB 1MFBH 4NQDD 5BOZG 3N43F 5GS1C 4U33A 4RMRA 3IGAA 2DQIL 1FV1B 2OI9C 3VFNA 4MNQD 5D9SB 4LLVA 5DO8A 1IMHC 2YC1A 3C8DA 3VA6A 5FHAL 5FYJD 3UGXA 5IFAH 2HFGH 3EJRA 3ILQD 3QIUA 4NX0A 4X7CC 2P80D 2UWEE 4IDLA 3PPSA 4XXCA 3RWFA 4YHIB 4KJQC 1BP3B 3Q6FA 2BP0A 5BJTA 3GM8A 1N2RB 2V5MA 3BVUA 3QG6B 3KVDD 4IS6A 1OM3H 3SDYH 1VFUA 4F57H 3OPZL 2P24A 4OD3H 4I8DA 2WP3T 3UIZA 1JMXA 4IRSA 4JPKL 3CFBA 5I1EL 4LVHC 4N8UA 2D4FA 2DLIA 3T8XA 4LNRA 3S3DB 4HCFA 3S3PA 1O75A 1RPUA 3BZ5A 4FP8L 1WGVA 1ZWIB 1BQLL 3TS8A 2X4PB 1DQDH 4DEUA 4NM4L 1GH7A 3CC5B 3CJJA 3PNWA 4DQAA 3PE9A 5KJRL 5JHLA 4F8NA 3FTGB 2CR6A 6TAAA 4MS6A 5D7HA 3IDYC 5HI3C 3V55A 3HI5H 2XRAL 4DW2L 3TTYA 1MHEA 1ZVSA 3O6LL 1A1MA 4RWYH 1AQMA 2PXYB 4P2RB 3S3BB 3AMLA 3CIAA 3MRHA 2V9RA 4I0PB 3CU1A 2F54B 4PY7A 5EWIL 2GITB 2IDUA 3IS0X 3WHXB 3LOWA 2H1XA 3NIDB 1ZTXL 2W65A 4JDEA 3RX8A 4LCIL 3ZE2F 1W0YT 2IOMA 1AXSB 1BIIA 3L9RA 3VXSD 4HBCH 3QRLA 1UWFA 1IT9L 2C3GA 2WXLA 2OMWA 1IZJA 4AL8C 1A6AB 2WVVA 1AGBA 4KI5E 3QR0A 3MRPA 1NCAH 3ZVVA 2RFXA 4HV8B 3UCRA 3PQYB 1PKQB 3JBG7 1FO0A 4U1JA 1NEPA 4JO4H 5KVDH 3IDMA 4OLYH 1JNHB 2BH0A 5IV2A 1UJTA 4M61A 4JFOA 5I1CL 1A2YA 3QEQB 1YJDC 4UDTB 5AOIA 3RIFK 3VFPB 4UTAH 4XBEH 1TLMA 3GMMA 3FSWA 5D7IE 3TA3C 1XH1A 4WSJA 1Q0XH 2XWJA 4XMVA 2DKUA 5D2NB 1IC5L 3IS1X 3U4AA 3IETA 3MBXL 4PU2A 2H9GA 2QQNL 1BVKA 4CILA 5C7XL 4K3EL 4UILH 5GGTL 3EG9A 4QTIL 4Z7IA 4X42A 1EXUA 1QLFA 1S9XB 1RIUH 2WXMA 1NMCC 3HNTH 3QZWB 3JWOH 4TNFA 4NO2B 3BH4A 3NJGA 5D1QB 3EYQC 2IBGA 1ZT7A 4TVPH 5ABDE 2XTLA 3JYBA 4OLZH 2E7MA 1G6RA 4NJ9L 5GJTH 4FNQA 4JFUA 3TH4T 3FU3A 4UQ2A 1D6VH 4F92B 1MCWW 1CXEA 3MV7A 4NQDA 1MAMH 4RQQB 2B20A 1NCDL 4BA0A 3RURA 3FPYA 4OQTL 1M6UA 1E9PB 3F00A 4MD0B 4EKJA 3BZEB 1KGCD 3HE6B 3QWNA 1T6BX 4Y1AB 5AKTA 1XD1A 3E8UL 1AG6A 1KBVA 3SE6A 5JA8B 2DEYX 3AU1A 3MLYL 3UERA 1X7QB 1UXLA 4Z3HA 4I4WA 4IRJD 4LEXH 5AUMA 4C4UA 1JZHA 1ZA6A 2OTUB 1J9RA 3KYKH 4F7PB 4XXWC 2FSEB 3N91A 2GW5A 4PRDB 1MG3C 3AWGA 4L3EB 1KV3A 3MZGB 1JF5A 2FJHA 3IJYB 5LJYH 2EIZA 3BFWA 1BMZA 1FNGB 1KC5H 2A6DA 2WCGA 3DV4B 4U05A 3QQXA 3H3PL 4HUWA 5I0WA 1T89C 5BQDA 4MNHB 3K4AA 4TYUA 2QGEA 2ED9A 5FKPA 2TSBA 5C92A 2XUWA 4N1HB 1T66D 4JFED 1UJ3B 2J8UA 1IVLA 1MFDL 2YQBA 1YC8A 4XCNA 3QQ9C 5T3ZH 3ET9F 4ELME 2G60L 2V5TA 5T1LD 5KVGL 4PG2C 3QULB 4Z95L 3BXNA 1YYLL 4HKXB 1B2WH 3DDFA 5T3ZE 5IQ7L 4YBQD 2XXCB 1WD8A 2Y7QB 5CINH 5JPNA 5EZIH 3RL1A 4UV7H 1QSEE 5TDPB 3VXSA 3QWQB 1VA9A 3OKNA 4NZRL 4PEEA 1FNSH 3CVBA 4LSUL 5I28A 2NZ1A 4MWFB 4UAHA 4U1HA 4YDIH 5I8EB 1MWAL 3UZQA 3HTLX 4JO2H 4HJ0D 1FAIL 2J57A 4WFHE 3RZCC 4XMKL 1MQKH 4G6ML 1AOZA 2W94A 3KLLA 5HGBA 3CDGA 2C4FT 1S9WB 1R33A 5DUJA 2IH1A 3NDYE 5KANG 4X5QA 5H2BB 3NYKA 3UABA 5C0DB 2ZPKL 3UG5A 5DUBB 3O6MH 3UG3A 3D25B 4AJVA 1RY7B 2PP8A 2I9LA 2VMDA 3KPPB 3LMJL 4NZDA 4K5MA 4B50A 5IB4B 3NRFA 1ZGLA 5KW9L 4OLEA 1T4KB 4K3DL 3LVTA 4PV9B 3EDFA 1XGPB 1NEZB 3GINA 1V3JA 5AAPA 4JJ5B 1J1OH 3MFFA 3GEFA 3F2LA 4H7VA 1IM9B 3DETC 4WGVB 1CQYA 1EQWA 4Z7VB 3CZGA 3S3CB 4XVJH 3GMQA 4IBVA 4FYTA 2QPSA 2WANA 4UNUA 4NQQA 2WXNA 4I9WE 1KJVB 4MMZB 3DO4A 1T0OA 1V3KA 3WY1A 4LRIA 3SBWC 4IRJA 1M6OA 2G3XA 4JRFA 1R5WA 1P1ZB 4KPHL 3BLPX 1A8JH 2ARJB 2CM5A 5CMAB 2EDTA 1NIBA 3ARGB 3EF7A 1PIGA 1MDTA 5CGMA 1DYZA 2PTUA 4JQIH 3MLTB 4Q56A 2PKDA 4FEIA 5JHDE 4OF5A 3BD3A 3GSXA 4HHGA 5ISZB 1U58B 5LDUA 4PLJC 3QIWC 1HWGB 2VDNL 4TPRL 2ZX8A 2WZ5A 4A2GA 1F1GA 4L05A 5FHBH 3DO3A 4XPBL 2X6BA 3LHAA 3IRZA 4H5SA 3V0GA 1XB3A 1YMME 4JFEA 1ZE3C 4E9YA 1Q9LB 2Y1YA 4JPIA 1H0DB 5SWSE 5JLZB 1N12A 3Q43A 1CG9B 4JFZH 4NN6C 4DT2A 5T1LA 4K8RH 1A9EB 3B83A 5AW5B 2X53A 2Z91A 3MBWA 1CGSL 2D4DA 3GJEA 5EN2B 3FZUD 1CCZA 5KSAD 2JB5H 1XSJA 1TJHH 6CGTA 1BQHB 4TLKA 1YEFL 3U6XS 3HRZA 3QDJE 4HUVB 4J4PC 1AZBA 4ZXBD 4DVRL 2ZCZA 4HS6B 4OQ1A 1GIGH 3UGEA 5I0VA 4P06A 5EIQA 1E4KA 5CKGA 3RWGA 5KSBB 1DEEA 4LQ1A 1RMFH 2GSMB 2X7LA 4S0TD 4WENB 5HI4D 1RU9L 5J8OA 1U6AH 5LAPA 3MYZA 1OB0A 4M4RA 1ZJAA 4IU2A 5AZ2L 1BQ5A 3DWTA 4I77L 1CF1A 4J3OF 3T9WA 1M4KA 3D52A 3OKEA 4RX4D 4G5AA 5HHNB 3CHQA 5GGRA 1MHPL 3BHBB 4KXDA 2O5YL 1TYRA 2B7DT 5ID1A 3BP6A 4DETA 2IPTL 2UXGA 4NOFA 1E3ZA 2YD5A 3D0LA 1CGWA 3RDTA 1RUQL 4KVCH 4JX0A 3O45A 5HDOA 3DROA 4ZUVA 2WTRB 4FFYH 4IBWA 4BFBD 2GAZB 1RL1A 2PMZA 1QHQA 4ZQKB 4MXQC 3US9A 2AQSA 1TQBB 2YD9A 4CVWA 3CVHH 3H0TB 4RNRB 5C6WH 1HCVA 3TYFA 4IOIA 2JJSA 1RUKL 4IKLA 3V5HA 5J13B 2YPLD 5DDHB 5F7MC 3BO8A 5HJGA 1QTSA 4DZ8B 3AW5A 3ZT5A 5IJVA 1CL7L 4U3CA 1KYOK 3D05A 4KKRA 2NLJA 3QWOB 2HT3C 1QWHA 2WVUA 4Q6YA 5I8KL 3CZFB 5A2JH 2DD8L 3QUML 5I15L 1VB9A 4E36A 2ZAGA 2OJEA 4P9HL 1UACH 2QDVA 5DJCB 2GBAA 1XCQB 3F7KA 5EU6E 1ID5I 1D3CA 1JPGA 3BEWA 1TZIB 5JW4N 2OMBA 3BAIA 2JV6A 4C4KO 2Q8AL 5IG7B 1SDDA 2BP8B 2ICWJ 2XWZA 2ZG3A 3KPQB 3ZIYA 2FH8A 1H3UA 3GKZA 1PKOA 1AQ8A 1NLBH 1PZAA 1NGZA 2J8UF 1I1YB 2P5EE 2XTJE 4WDIB 1AGCB 2Q2LA 4OCYH 2YAPA 4ETQB 4M5YH 4AGOA 2AS5M 5GSRB 1DBBH 5C97A 1CDHA 1KELH 3PFQA 3RY6C 1B9ZA 4GAJH 1VLXA 1NINA 2CCWA 2AJYH 3FCSB 1FH5H 4M1GL 4P3WA 2L7QA 5KSAA 3CN3A 4JM2A 2B08A 4XNBA 5DLML 5IMMB 5ANMB 2HAZA 3LKPA 4PJFB 4ZXBA 1F4YH 3UBXI 1YZZA 1UZ6E 4WI0A 3KLAB 1Z32X 1JK8B 1RUPL 2Y9RT 1BZOA 1G7JA 3AREB 4R5VA 4TVPD 1R46A 1VJSA 2VXVL 1HXYB 1XGTA 1P7KB 1XCWA 2B2XH 3SDCD 5T1JA 2XV6B 3S37L 2VIRB 2Z1KA 2ZWZA 4GBXD 4FQ2H 4U6TA 4L1TA 5DJZA 3S97C 1PVHA 1UQSB 1ZLEA 2UVFA 2AK4E 2UWEA 4RX4A 1GGIL 3CVCA 2ICES 3ZR5A 4I85A 4APQB 2XG5A 5EC1B 4HEME 1DSFH 2VLKE 5LNEA 3MO1A 3D06A 4FFWC 4HGKC 3QRFM 3VXRB 4KZDH 3AY4C 1RD6A 3GMRB 4AX3A 1AS6A 5CJOH 2XY2A 4PP1D 5FYLH 3MLWH 3JWNH 3M8OH 2J1XA 2KLSA 2MEJB 2VXUH 4RGMB 4E9VA 3P77B 1H15A 1P84J 5F6HI 5D8JH 4R83A 1RSFA 2FWSA 4ABQA 3JWNE 4L23A 4YLBA 1L7IH 1JXDA 1Y6NR 2EABA 2YPLA 4L8SA 3QRBA 5F6HJ 4U1IB 5F0PB 3TJEL 1HVXA 2YOAA 3IWUA 3UEQA 3WU1A 2J56A 5B3JF 1CU4L 1E67A 5KVFE 2CLVB 1EMTL 2UXVA 1KPUA 2HPTA 3TA3B 3PABB 5T3ZD 1FZOA 2AABH 2JXMA 2ZKHL 4EKXA 5F1KC 1I7RA 1P5VB 5GGRY 5GGUB 4JR9L 1XGQA 1Q0YL 4OSUL 4PJDB 4LSQH 3RJDA 4GOSA 3UJIH 3TPUA 1RIHH 4JZJA 1W72B 1NMCB 1W80A 1WTGT 4ZMLA 1BAFL 2E7BA 3EJJX 4WFHD 4AXWA 2MIZA 4JRXB 5I1AA 5FO8A 1MXDA 3RPKA 3VI3E 4EBQH 3HA0A 4Y4KA 4JQXA 3KG5A 5DK0A 3BJ91 3D48R 4MMYA 4O4YL 1U8MB 2YLHA 3FQNA 4FS0A 1JXJA 1M05A 5K5YA 3WSQL 2EVJA 5D7IA 5GRVK 4DGVH 2E7HA 3GMOB 3Q8AA 4UTAA 2HX8A 3K8LA 3KPMB 3VGGA 4M5ZL 3QORC 3SQBB 2B1AH 3V0IA 2DF3A 4NPKA 1J0KA 3EOTH 2WUBL 1MFCH 1X5ZA 3HCVA 1LQBC 1AJ7L 5SX5H 2GSGA 3MRNB 3DYMA 3I2CH 1NC2D 2VQUA 3C6EA 3QNXA 3SKOA 2JKXA 3DVGA 4K3HA 2BZCA 2CRZA 4MJ6A 1NANH 3QYCA 3ZT7A 1WITA 4U2YA 4MD5B 5JIHA 1KLGB 4K55A 3QBTB 1A66A 4G1EB 3MRCA 4GI6A 4GBXA 1MCIA 4KKLC 3MODH 3T3MB 4C56D 4TRPH 4ZQTA 5LQBL 3QAQA 2ZF8A 4I9WD 3VNZA 2AV7A 3NZ8A 3QUKA 5DJYB 1BQRA 1RZFH 2HVJA 3KYNB 3UZVB 5HHME 3O2WL 1S8DB 4HF5L 4IBUA 2XXFA 5CWSB 3HRPA 3LAFA 4FEMA 3E2HC 3SOBH 5KN5B 3W82A 3RVWD 3RZWA 5JQ6L 1EHXA 2NR6D 1L5GB 5MI0C 2UXTA 4GRLB 5L6YH 2RHEA 3MRQB 3RU8L 1CFBA 1O7SA 1DSWA 2CO1A 4KQ0A 4BJLA 2HA1A 5JHDD 1BZ7B 1DCLA 1XIWD 4E42B 5EO9B 4A2LA 4G6KL 1I9IH 4JFTA 1UEMA 1YMHB 4RMSA 4K3GA 4OIFA 4A04A 1UM5H 3QNFA 4YLCA 3RZCB 2OMZB 4Y2DA 1T83C 1PNCA 3COOA 4TNWK 3LPPA 4MNGA 4UNTA 5SWSD 1HESA 4ELMA 1L7TL 3K81A 3UJJL 1UM4L 1WBXA 4LDLB 3RPIB 3LNFA 4HUUA 3MYJA 4PI0A 5LGHH 2ZOOA 3PWUA 1FE8H 1QSEA 2YQGA 1N6VA 3KD4A 1QTYT 2BP5M 3FAXA 4EI5B 3A67L 3KJ6L 5HHPB 2H2SD 3ARWA 4LARH 3A47A 2VRAA 3SKNA 2R69H 2H26B 1RKRA 2EZ0C 2Y7OA 4N2BA 2NXYC 1U92B 2BY2A 1UH3A 1A3LH 2ZYRA 3DECA 4NT6B 1DVXA 1KLFA 2H0EA 1YEEH 1EA9C 5CEZL 1OAJA 3P2DA 1G4RA 3FT2A 3SB3A 4X6FA 1FLTX 1TKWA 1FVDA 2UYLB 2O6PA 1JYWA 1IGJB 1OAYL 4W9KC 3DV6B 2XKNA 5DFWH 3X11A 1QPPA 3O6KL 4M43H 4JFQB 3A24A 4YWGL 2CWRA 4O2FB 3L1OL 4JM2F 1G5GA 4L3AA 3DX9B 5KOMC 3S36H 4MMXC 4UINL 5JIPA 3FSVA 2X38A 1T1ZB 2IXQB 4K23L 4F27A 5DQJA 1H3PL 1NC2A 5F7HA 4F2EA 4CVUA 3HZYA 4ZUSA 3W0WB 4BRJA 1IEAB 4TLSA 2J12B 1AGEA 3WL9B 4FA8A 2CK2A 3T4YA 4ZMVA 2LABA 4BFKA 4OZFG 4P0DA 5DYFA 3UADA 2EDQA 3PGCA 4WNSA 2EYTA 3T09A 1JZ2A 2D03L 3B34A 3E1F1 3N06B 4YO0B 2UWEF 1CFTB 4FERA 3TL5A 5T8IA 4IJ3C 2UZXB 2JKSA 3WD5L 4KXCA 4J23A 1OSZA 4QXUL 3L4YA 1HU8A 4QYOB 4KITB 1W0VB 4OU3A 1TZOA 4ZFOL 2WQVA 1KJ2H 4YSPA 4NN6B 4B5ZA 4PY8I 1OGTB 2E9IA 4NC1E 2G2RA 5ECJE 3VM7A 4NHUA 2DLGA 2NR6A 3B7YA 3WFBH 4AC2A 1PLAA 4DVBB 3X14A 4PY8J 4UM8A 1F3JB 1W0WB 1NH6A 1MWOA 4L5FL 1WBYB 4QHMA 3LQZA 5FO9A 3ZE2B 5JHDA 1XIWA 2VZTA 4HJGB 1BSIA 1HHKA 5IREA 1U8CB 1YNKL 2B0SL 2CKBB 3AB0C 3QFJD 2AEIT 1RURH 4K7FA 5ERWA 4MCYA 5KG9B 3BPLC 1YMMA 4WFED 4WI7A 2XTJD 4GXVL 4NDMA 4PR5B 5L2KB 5LDSA 2J8OA 1ND0B 5SWSA 2OMUA 3B2UD 4KNQA 3T6VA 2XZQL 4HOMA 2CM6A 4B97A 4IRJC 4YEFA 1UUSA 5DUPL 3D8MA 4ZO6A 1CZ8H 1M71A 1C5BH 3BEVA 3C09C 1FJ1B 3D4GA 5I6XB 1HS6A 4ANVA 5K9JL 1PF3A 2BIHA 3QDJA 2Y1AA 4LKCB 4BKLA 3MMEB 5C0CE 2EO7A 4AV4A 1AC0A 4KZCA 1ZLSH 5DEJA 5C3LD 4GG8A 4H26A 4KI5F 4JANB 1E40A 2YUWA 3TA4D 2DQJL 1FZKB 3VRLE 3FUJA 2VLJE 5EF1A 3NEEA 4HK0B 5MEOA 4PRNA 3ABLB 1FFOA 4RAVA 2MKLC 1CFNA 1EJ6A 1T21B 3DUUA 3PV6B 1TU2B 4JPWL 5EOQL 1NAKL 4MXVE 5D7IF 4IHOA 1G9MC 4PJCA 5ETUA 4B7IA 1LILA 3MRRA 2PW2B 1E2ZA 4XXDA 2XHNA 3ZE0B 4D94A 1S9VA 5ICZA 1MCCA 5E1IA 4P2AA 3SDAA 2P8LA 1INDL 2WZAA 1JTPA 3D0VB 4P46D 4ORGA 1DN2A 1G7QB 4E5XG 2WLIB 4G72B 4GP5B 5T1MB 1CIDA 2R2CA 3STLB 3KW8A 1HFUA 2XA8H 5E1GA 4MA7L 3NA9H 1SOKA 2YHGA 4XOBA 3TOPA 4X6BB 3K6FA 1IKNA 3PHQA 3ARRA 1T22A 4MSWA 1OZUA 3ELQA 4NZUH 4DZBA 4E9TA 3DJRA 3QQ4B 5AYQA 3RG1C 2DMGA 4YHKL 1OF0A 2GUOA 2M8XA 5FYLD 1KGJA 2BLFA 3CVHA 1T6VN 1KPRB 5JUEH 2EXSA 5CIPH 1A6ZB 4ZFQA 3LKOA 1ACCA 4LVOC 4N5UA 4YUEH 2R1YA 2MCPH 2VDPL 2XCMC 2OM5A 3IDGB 3KAAA 1PY0A 4NWTH 2DL2A 4CW1A 4Q9QH 4PB9H 1AD9A 4Y19E 1SDYA 1N67A 15C8H 3QRGL 1L6PA 4X0KB 5TF1L 2P48B 3BMWA 2Y4SA 1F02I 1KTLA 1J5OH 3MLSL 1XF2B 3FCGA 2ZOLA 2YGPA 2Y5TB 4WFFD 5I1IL 2EDHA 2X2YA 2IGFH 3P4OA 4EVNB 3B7RL 5F7LB 2CRIA 1GS8A 1B6UA 5J6GA 3NIGF 1T1YB 2BVUA 3MNWA 4LL1A 4P4RB 4NQUA 3MOBL 4Q8BA 2UXFA 4KO9A 4LHUB 3KNBB 2P5EA 3DSNB 1BFVL 5CJ8A 4ELMF 2JQZA 3QNZB 5KZCD 1NMAH 1E5BA 3BKCL 3O6FB 1CLYH 1NKGA 2RCSH 4PB0H 4ZDHB 1QOKA 4WTWA 2Y72A 1NC4D 1BX2B 4N0FA 1ZANH 3AROA 3S98A 4AEIH 1K8DB 2WK2A 3EH4B 1U91B 2GI0A 3OB8A 4YZWA 3GSWA 2PWGA 3MQIA 3AG1B 2NNFA 3BIKA 1F1AA 3VTTA 3IAPA 3LRSA 3S96A 4PRIB 4AEHL 5KWYC 1GAFH 1T0MB 4M6OH 4BK5A 1EBPA 1RZ8B 3BOVA 3CNKA 1LE9B 3QAZB 4KTEL 3ZKXC 4XTRD 3ULUL 3D39E 2WV3A 3QJVB 4JPVH 1QUPA 5F7BA 5F7KC 2WC7A 1NBZB 4BFOA 3H6JA 5DYOB 2EDYA 3VNYA 4BUQA 3IGAB 1QNZH 2AK4A 5GGSA 3VFNB 4LLVB 2I5YL 3D3VE 1D7BA 3QA3A 4Z8FH 5HHMD 5JOEA 5C2UB 5GRVL 3QIUB 3P11L 2PO6C 1D9KC 4HEMA 4P46A 3QO1B 3FZUC 4O51A 3Q6FB 3KLQA 4FADA 3A4FA 5BUAA 5HI5D 2NY4D 4IS6B 3WN6A 2GHWB 3DRQA 1E6JL 1QYGH 5IJCC 1I7UA 3HMXH 4L2YA 4PLOB 3SCMD 1ETB1 4IRSB 2C9UA 3TBYB 1U8HB 3G5YA 3PP4L 4LNRB 3B3IB 5HVHB 3CXDL 4K94H 3F7VA 4HPYL 3V9FA 1J1PH 1FVCA 3LZOA 4S1DD 4A7UA 1UZ8B 1DBKH 1R3LA 1ODAA 3RRQA 1USQA 1ETZA 3PNWB 4I87A 5D7JC 5FXCH 5FYKL 4E9LA 2COQA 4K07A 4YHZL 1KXTA 4LOUD 4AJ0A 2JJTA 4HT1H 5GRJL 5BV7H 1MHEB 1ZVSB 5E6RB 1IB5A 4F7CA 1A1MB 3QJUB 1N5YL 3HOGA 1TQTA 4N0UA 1K8IA 3KYOA 2JVUA 4PY7B 1J8KA 4NPJA 3QORB 2A74A 2W65B 1GW0A 1QFWH 4JDEB 4HWBL 4TNVK 3TEUA 4YMPA 3QHZL 3NJFA 4JCMA 2CLRA 4M8QA 1BIIB 3L9RB 4DJMA 4UT7L 2VT0A 1HQRA 3QGVA 1BBDL 2OMWB 3MLPA 1A0QL 1WG3A 2V3DA 8PAZA 2YD4A 3HZMB 4LLDB 5T1DH 4RFOH 4C47A 3VI3A 2WVVB 4P2OD 4XMPH 2F19H 3MRPB 3BUIA 4FXKA 1F90L 3TCLA 3C5ZC 2RFXB 4BSVA 1QRNB 2XVLA 2JKTM 4O58L 1FO0B 3FJTA 1GA2A 4U1JB 3IDMB 2FCBA 3HS0A 4M61B 4JFOB 3SDXE 1A2YB 2YKLL 4FFTA 4IK6A 2DJUA 5SWZB 3GMMB 2GIYA 1OCOB 2FEJA 3ASWA 1NC4A 1J0IA 4BH8A 4F24A 2XWJB 4G8GE 1ZK5A 3HZKA 3O8XA 3GJFH 4X0NA 3BFOA 2H9GB 5CO1A 3V4VL 2WTPA 3WFDL 1F8TL 2NT0A 2OX5B 3E2HB 3FN0L 4D9LH 1L9PA 1QLFB 3GB7B 5DURB 3C6LD 3LZFL 3TC9A 3VWJD 5B3SB 1ZT7B 5LG6A 2W91A 2QMKA 1G6RB 1EEZA 2WINA 3CD4A 2FZ3A 4UQ2B 4ZNEA 4NQDB 35C8H 3R4DA 5D1ZI 2RAMA 2N1TE 3FUKA 4MNQB 4GG6E 1DBJL 2A77L 2OJZL 3DX6A 4N8VA 2DQIH 2AV1B 1XT5A 4YSOA 3AU1B 4JN2A 4CN1A 2VDKL 3GHBL 3HG1D 2CDGA 4AC4A 5AUMB 1LGVA 3RWHA 1OQOA 4KJPD 5M94B 1EZVY 4RETB 3ARDD 4ZTPH 3Q01A 3RI5F 4WUUD 2YPKA 2PTTB 3CZEA 1FVEA 3SZ6A 3OSKA 1FFPA 2D7OA 4WEBH 3IDXH 3Q1SH 4WO0A 4MBOA 5F97E 2EIZB 2A6DB 3SDCC 2ZP8A 2A6IB 2ZWYA 2GHZA 1SY6L 1AOHA 2X9ZA 3QUZD 1FNEB 1GY2A 4GMSL 3ARBD 2ICWA 5FKPB 4NM4H 4O02H 1G7IA 5KTEL 3OAYH 2J8UB 4XCNB 1H3GA 1F97A 5FCUL 4DP8X 1JE6A 1N5AA 1I1AC 3W11D 3S34H 4WNQA 4JRYE 2HWZL 5JXAH 5IBLD 5AFAA 3BXNB 5DD3L 1Z9SA 2OMTA 2EEBA 4LLYA 2VAJA 5E8PA 1MN4A 5JO5A 3CGTA 5EWIH 2JIXA 4OJEH 5JPNB 3RL1B 3AGVA 4M48H 1ZTXH 4UT6L 1T5XB 2EH7H 3QCTL 3LH2H 1EERB 1OSPL 4HA1A 3VXSB 4QOKD 4AQAB 3NTCH 5H35A 1AMXA 4U1HB 2WIIA 2P47B 4LCUA 2VLJD 1FHGA 1ZTXE 3E6HA 4MAYD 3UZQB 4DUXA 3ARTA 4P2OA 1JPEA 4R26L 2R69A 5ES4B 3W5MA 2JLPA 3CZUB 4M93B 5HGBB 4KDTC 4ZK8A 5TK2A 2LU7A 2E5EA 2C7UB 1TZHA 2O30A 2IH1B 3MGOA 3T0ED 4AMWA 4IJ3B 3WEXB 4NI3A 3LN4A 2XC8A 3SO5A 3U48A 3V4UH 3T65A 3L1GA 1L9RA 2I9LB 5D7LD 2DIAA 5I1GL 1UZ6F 1ZGLB 2VQ4A 4BH7A 4DUWA 4XC1H 3MDJA 4W9JC 4HDIB 3GRWH 3PWPE 4ZPTA 3BP4A 1JPFB 3VWJA 2SEBA 2O5XL 3KYMA 2PR9A 5TFSH 2DMHA 3EXJA 1FYHB 4HK3J 3PXJA 3STZB 4ZTOL 1JYNA 4FYSA 4AMKL 1HEZA 4OKDA 1G9EA 1IRAY 1AHWA 2BHZA 2R7EA 4C8XA 4TV3A 1BJ8A 1OCWL 1HC1A 1OANA 4GXUM 3B2VH 4P3DA 4XN5A 2VDMH 3N1GC 5GRXG 2APXA 3UTQA 1A4BA 1KJ3L 5HY9A 1PX8A 4M8VA 4OCSL 2F61A 3FSZA 4Y19D 2VLRE 2X4OB 5CGYD 1QVOA 1RZKL 4IRJB 5I19H 1GJUA 1FGVL 2IFFH 1M6OB 3HG1A 1EO5A 2IO5A 4KX8A 4N2GA 4PJ8A 4RAHA 3V0FA 4AZUA 3V4LA 1GTFA 3OG6B 1R19A 1Q0EA 4R0LC 3MUGA 2A2QT 5EEVA 5EEWA 1TJGL 4RGNC 4JFHD 2ZNXA 5FO2A 4LLAA 1F4XH 4PJ5E 3GSXB 5AVRB 1AY1L 2OW7A 3O4LE 2K3HA 3D18A 2PYFA 1XF4A 4A7TA 2H2PD 5ILTH 1MZYA 2W1NA 2XKSA 4AUYA 1CL7I 2CA4A 1LK3H 4HC1H 5TE4L 4LPCA 4CVXA 3IBOA 4GO9A 3RKDD 4JFEB 5F21B 4EZMA 1C1EL 4OB5L 3U2SB 2NNRA 2BRQA 5T1LB 5EOTA 4A67A 4MA3A 4RA3A 3RWCB 1JNNH 4XH2A 2Z91B 1EH9A 3MBWB 5ICXA 5C0AD 2G60H 2P42B 3GUTA 5KVGE 4QOKA 1FQ9C 2Z8VC 4PV1C 3VI3F 2VLJA 3LRKA 4L4VE 3IKKA 1GGCL 3LRGA 3RWGB 4DTGL 1BOGB 1CC3A 2X0UA 2X6AA 4B0MB 4P23C 2QFPA 1FAIH 4M4RB 4JDTL 4IU2B 4LCWD 3D3VD 1HL9A 4YDKL 3T0EA 2EC9U 4AYGA 1CWVA 3VD4A 3LN5A 3OKEB 2YRBA 2WN3A 1QUNA 4K8RC 4OCLC 5J11C 2DM4A 3B1UA 5GGRB 3LY6A 2PR4L 2BSTA 1W8NA 5I8CA 5EU3A 4HKZB 3STBA 4NPYB 3BP6B 3CFEB 1VEMA 3TIDA 2APFA 2F1AA 4U1GC 1MF2H 1MFMA 2F5BL 1IEBB 2H2SC 3PGFH 5E0QA 3P4MA 4QTFA 3H9ZA 3DROB 4ZUVB 3LZQA 2YD2A 1KN2H 1PFOA 1COBA 5D7EA 1HHJA 1D5ZB 3G5VB 2AHIA 1SJVA 2X4UA 4AGNA 2AJSH 3WTYA 5DD0H 1KBGH 2CUHA 4PUBL 4XP6L 2YXWA 2RH0A 4XMZA 3TYFB 4BV1A 4HLZG 3V5HB 5DS8A 3VXPA 1I8KA 1YEJH 1OARL 3N9GH 4FG6C 4D0CA 4H20H 4MHHG 1O6SA 5IJVB 5CIPA 3VQ1C 2I07A 1BYNA 1B0GA 4P2QE 4Y19A 3KYAA 2NLJB 4JHZA 4EDWL 4Z78A 2W88A 2DQGH 3NCFB 2L8AA 4F7EA 5J4MA 2MPVA 2BXYA 3GRBA 4Z7QE 1YPZA 2HH0H 1J9CT 2ICCA 4Y5YC 1UADC 4U3SB 3MZTA 5GZND 1YEKL 1X4ZA 1JPGB 4M1DL 1FFNA 4XMWA 5T5FL 2V8MA 4NXKA 3UO8B 3OGCB 2ZKXA 1YDPA 3HPLA 4FCAA 5HGGS 3ZKXB 4OZHE 4O5LL 5DUML 3FPXA 4GKSB 4NZTH 4F93B 1ZS8B 5GS0H 4JK0D 3UDWA 2X3AA 2AEPL 3O4OC 4R3SB 5C8JA 3FL7A 4GINA 5J3HD 4L8CB 5D7SH 4HU8A 3BN9C 4QRUA 3NCCB 4A38A 3OLGA 5DZNA 4NUMA 3SE8H 2CUMA 1HEHC 1S7SA 1PG7L 3GMLA 4GRWH 4PGZA 3VVWA 1D9KB 3FQXA 5C0AA 5ALBL 3PDDA 5KSAB 2CKNA 3C8HA 5HVGB 2FB4L 3CBJB 3LKSA 2H32H 3LKPB 1R34A 3FQWA 2DYRB 2ZYHA 2OYPA 2FX8H 5JORA 4J39A 1N68A 1JS4A 2BHFA 4WI0B 1YEFH 1XGZA 5IMOA 1G7JB 3GKWL 1I3VA 1QX1A 2BP3A 2BVPB 3L4WA 5JNYA 3PF2A 2WCPA 2OS7A 3UL4A 1QKZL 4NO0D 4U7SA 4AGLA 3DSFL 2YR3A 3AC0A 4LGPB 1JG9A 2OK0H 1H9DA 2JB6A 3DMMD 3SGKA 1PG7W 4LCWA 3D3VA 5DJZB 4FXGC 4FQ1L 1DFXA 4PBWD 1PL3A 2APTA 1KGYE 2WQSA 4ABWA 5FIEA 4AL8L 5GZOD 4WW1B 3ARFD 2EACA 4XNZB 3H9SB 2XG5B 3DXAE 2B4CL 3IWVA 3MO1B 1I8LA 4NKMB 1JZFA 5GQBA 4YXLH 1N6UA 3IDJA 1MVFA 2NY2D 2O5YH 1YJDL 3CN2A 1M1XA 4LVNB 1EO7A 3TWCL 3N42B 3TFKD 2EICA 5EORL 5EEZA 1T6WA 1S9YA 1TEYA 1H15B 2HFEB 2XN9E 2ZX5A 1EZUA 1XHHA 4JREC 3NFSH 2YPLB 3C5ZB 2XPZA 3BZDA 4JS7A 4DP5X 4JDVA 4EUPG 1IGML 2DM3A 3TV3H 2WKOA 4P46C 4PGBA 2NY5H 4QRTA 3O11B 4QGYA 1AO7E 43CAA 4KXZI 1J0YA 3MCLL 2DQUH 3WCYA 1KPUB 3NSYA 1FZOB 2ZSWA 1VENA 2J71A 2JXMB 4RLDA 5I8KH 4ZFGH 5GZNA 1DE4A 3B1TA 2EEFA 3MRLA 4FZEH 1BPVA 3RB7A 5H94A 3AZUA 2J43A 1AGDA 5G55A 2WKGA 3RLSA 3S35X 5I1AB 2P8MA 2YBGA 1U0QA 4JLRA 4G6FD 2OL3H 3SDXA 5DK2A 4I9XA 1M05B 3OG4B 4FC3E 3MAWA 3SJVB 3RGVD 2FATL 5E8NA 3NG5A 3WUWG 3HMWH 4R84A 4YQXH 5IJBC 1ET5A 3OF6A 3CQQA 1KCSL 1CFVL 2Z65C 3HCVB 4KZEH 2CZNA 3INUH 1TO4A 1GYUA 2GSGB 3FU9A 3NEXA 2J6EH 3BW9A 3DO7B 3VYNA 3QNXB 3SKOB 1DANT 1P6AB 3DVGB 1KIPA 1SJMA 4MXVF 3NK3A 4MA1B 2QZ5A 4ODVL 5BO1L 2ERJC 4NO0A 3O3AA 4PS3A 5AOLA 3SDCB 2ED7A 2LLNA 1WFUA 3DMMA 4GG6A 5IFHL 3H6AA 4ODBD 1NPJA 4Q0XL 4LF3B 3FULA 2AV7B 3NZ8B 5CZVL 2GY7B 2BY1A 5I18H 2ID5A 5E4IA 2H1PH 1U42A 2ZCKL 2WGXA 4GP8B 3RKPA 3ORJA 1R3IL 3L5IA 4JKPL 2V9TA 1XR9A 3CN4A 3WKQA 1U8PA 2Y07H 2YA0A 2BFVH 4HXBL 3EDDA 4XHJC 5EA0L 5BRZE 4DCQB 3P0VH 1AQDA 2X9YA 4XTRC 4B0MM 2K78A 3II2A 4PJ5D 1ZVHA 3TEZA 1F3DH 3V6OE 3O4LD 1IBDA 1KYUA 5C07E 3UYRL 3PNRB 2Y3AA 1KLUA 1JHLH 4G8FA 3FQRA 4WWKC 1JNLL 1LO4L 1ZK9A 3NIGB 4KMQA 3WTUA 5AYUH 4ZMZA 1XF3A 2GBVA 3EO0B 5A1AA 5IVXE 3GXTA 4MNGB 1PS3A 1X5LA 4I48A 3H9HA 3AXLB 4JRYA 1WBXB 3U9WA 1YPZF 2FJUB 2N59A 1HX0A 4OT1L 4HUUB 5LAXA 2FBJL 3R19A 3O0RH 3BSGA 2EYSB 2NY3C 4QAWA 3MYJB 1T7WA 3SCMC 2NX5E 4ZSOE 3PWUB 4LLWA 3OMZA 1W8OA 4JFYB 3CMGA 1NFIB 4M3JA 2ITCA 5TJWK 1Z9PA 2WO2B 3LHPL 4OSUH 2EUXA 5D6DC 4S1DC 4L4VD 5DZJA 2PWEA 5IESL 1T7XA 1QBML 1FORH 4OF0A 1IAMA 4M4PA 1RJZA 2HSIA 3KLDA 4ISVA 3CDFA 1IUZA 1KLFB 1L0QA 3TVMA 1QW8A 4ONGL 5IWLC 2VUKA 3FT2B 3F5WA 4OZGE 4J2XA 4RVBA 4X6FB 4MB5A 1TKWB 4HIJA 5HDBB 3WJLA 5AB9A 5GGVL 3RGVA 4PTUA 1IBGH 2AQ2A 5IEHA 2XKNB 4QHPA 4R96A 2XZCH 3X11B 1ZLDA 3WTTA 1JSYA 3EKCA 3SZKC 1TJMA 3FBQA 2NNAA 2WJ7A 5IJKA 3WIFA 1J0HA 1D5MA 3IMVA 4Q6KA 4ZUTA 1J0JA 3PWPA 5I76A 2W07B 2Z8RA 1PLBA 5DQJB 3RIKA 1JN6A 1NC2B 3ZYZA 1SBSH 4R0LB 4JFXA 3HZYB 1RAMA 5JR1L 5GGTA 3EUDA 4P2OC 4WK0B 4LSVL 5CJXC 3V0WH 5JPMC 4ZMXA 2AJXL 2FECL 4UQIM 1O6VA 3T4YB 4B9PA 3T6WA 5IMLB 1JGEB 3X3FH 4UF7C 1KZYA 2V2XA 1IIKA 3PCYA 4OI9A 3ZTNL 1BM7A 3PGCB 3BAXA 4APXB 3E0GA 4C56B 1G7HB 4X9GA 2R56H 2CKBL 4RZKA 1WZLA 1OSZB 4NNXA 1F56A 2X2UA 4N8PA 1BGXL 3GI9H 4OQTA 4HCRH 4AYMC 1KXVA 3EF4A 1LEGA 1BAGA 4DGWC 1LP9E 2G2RB 3O2WH 4NHUB 4E41D 4EF3A 1XGRA 4MCNA 3KJ4C 3VRIA 2XNAA 2D3NA 2QADD 3VSQA 3C6LC 5AL0A 3SGDH 3X14B 2W0KA 2VDQH 3HFMH 3V2AR 4QHMB 2JKIS 5C0RL 2DLHA 3LQZB 4TUKH 5JHDB 4PJ5A 1XIWB 4IIQA 5IB2A 1CD0A 1ZV9A 1Y6MR 2EIJB 1N0LA 2R29H 1V7ML 3O4LA 1A7OL 2QPDB 1JFQH 4XO9A 3MRMB 5TE7H 4FN0A 4HAFA 5ERWB 2NYYD 4MCYB 4G6KH 4Y9EA 5DRNB 2NY1C 2WKOF 5CEXA 1I8MA 2BX5A 4EIGB 3S8GB 5GS0D 4LASH 2BSSA 3OKLB 2FSDA 4N0RA 3ZW3A 1W2KT 2X6CA 5ESQA 4FKHA 3BEVB 4TSBL 4WI3A 2DTMH 3ARDC 1NWPA 3BD4A 3FUIA 5J11B 25C8L 3C60A 2IALB 1N19A 3PIQB 3ULVH 2LR4A 1NKOA 5F72S 3JXAA 3MRGA 3W2DH 3BE1L 4GG8B 3OKMB 4HLJA 4KH9A 4L4VA 4O2CA 1PW3A 1KMGA 5T3XH 1TT6A 1IJ9A 5A3IC 1A6WL 3CQFA 3QUZC 3NABH 4WJ5A 5MEOB 3HZVA 1CD1B 4GW1A 4NFDA 1E27B 1DQIA 1FFOB 3ARBC 4PRNB 3SDXF 4RAVB 4W68A 5T3XE 1CFNB 3DUUB 1MVUB 3HR5A 5B7EA 1ZT1A 1MWAA 2NZ9D 1SJHA 4PJCB 5ETUB 3MRRB 3VWKD 3MJ9H 3TYGL 1S9VB 5FGBC 3OL2A 4ESKA 5ICZB 5IBLC 3IRPX 2IGLA 1XH3A 2WNXA 2P8LB 3QB7C 4ORGB 4PVLA 4I18C 4CJ0A 2OV0A 2W60A 1ANUA 5DJDA 3VSVA 1U21A 2HKHL 4BELD 1V27A 4KUCF 5D1ZA 1YEGL 5E99L 3RILA 4BD4A 3H2WA 1I8UA 4Y5YB 1T22B 3VFSA 2DQEL 1MRFL 4MSWB 5TQ2L 4MAYC 7PCYA 2FUTA 2QTEA 1F3RB 2XDHA 3PY9A 4NQTA 3UFIA 4F8LA 5FW7A 4UAOB 1BM3H 3GIZH 3ILPB 3LTVA 4DZBB 4NUJB 4OFPA 1QEWA 4GG6F 3QH3A 4OF7A 2P45B 3CVHB 4JE4B 3D5OF 3EJUA 4FQJL 3LKOB 5I23A 1NOLA 3NJHA 4Q58C 1TCMA 4NM8H 1PX4A 4Z18A 4AIZA 3I74A 3P3UA 5E94A 5MP6H 3PHAA 4KNSA 5E2VH 3U30C 3TNNA 3JVFC 1KBBA 1KGUA 3DKHA 3EFFA 5DEFA 1KGIA 4LEBA 1FIGL 5GRUH 3RJOA 1CK0H 2BDNH 1OCRB 2LTQB 1MXGA 1KTLB 5IBTL 4XN7A 5CD3A 3CDZB 3FO9B 1WD9A 3L1FA 4XPTH 4YVUA 5E6IA 5D2LB 3P4OB 4WKZA 4P5RA 5GXBB 4OZHA 1DEDA 4IM8A 3P4LA 3QFJB 3H7BA 5D5ME 3F83A 5F89A 5J6GB 1JXFA 3CSBA 3MNWB 2R2BA 2XQ0A 4KQ3L 4L5FE 2AI0H 4HQQH 1X4XA 2VZUA 2CHNA 1Y07A 2YD7A 4KKQA 5E2TL 5LBVA 3EH2A 5I5RA 2VLLA 3K6NA 4AKQA 4C58B 1AYOA 4M02A 4PSPA 2KLRA 5GISL 4FXGB 1OV8A 3FXIC 2X88A 1VF5C 2E27L 4MJIE 4N0FB 4GSDL 4YHLL 3TONA 2ZD0A 3MACL 4HJJH 5J89A 3GSWB 4YAQA 3BIKB 3RQ3A 3LRSB 2BINA 4G70B 5ADOH 5DGRA 1B2YA 2DQTL 4YS4A 2H32A 1VHPA 3EDEA 2QQQA 1JXGA 4OLUH 1U3HD 4OZFA 4AGQA 2CLZA 5K39A 3JZYA 5F93C 4BFFA 2ZT9C 1TQUA 3FH7A 4LCCA 4PWKA 3VXQA 1J5IA 5GHWL 3MJWA 5AOKA 2DH2A 4AM0A 1NMBH 3VWKA 4JREB 3Q5YA 1MCFA 5EZOH 1OPGH 3OKYA 5EFIA 3H54A 3DX3A 5ALCL 4P46B 5KBLA 1XTMA 2IGTA 3MGAA 1N8ZA 1F2QA 3FUFA 4O51B 5JHLL 1GJWA 1YN6A 2N7SA 4W9CC 4LVEA 3ASOB 3WGVB 4JDZB 2C1PA 5B4MD 1J8HD 5DJ8A 4NQXA 1I7UB 1KB3A 1NIEA 4ZOAA 5J0BA 2W9LA 3MN8A 3GMPA 1GSMA 2MPAH 2X10A 4QYAA 5C07D 4HJEA 3QUXA 4GSQA 1FVCB 2XN9A 2DYSB 3K4ZA 4AEEA 2Z92A 5GPRA 1DBAL 4FFZL 1R3LB 3SYQA 3J7HA 3VFUB 4QJ4B 1FZJB 1AGFB 43C9B 4CKQA 2VO8A 2BS8A 3T4AC 4CC1A 1ETZB 4LIQL 1KTKE 2NY0D 3VFMB 1YEHH 4Y4HC 2R23A 5FK9B 3L6FB 1KXTB 5KYXA 4CSSA 1AO7A 2C9SA 4WI4A 5BS0E 3BVTA 4F7CB 5JXED 1FO0L 4N0UB 1K8IB 3KYOB 3QXAA 1IAIM 5FUCC 2HN7B 3TWYA 4EXKA 4HPOL 4JG0L 4AQZA 1UHVA 5JW4M 5AOZA 3HG3A 3I6GA 1DR9A 1DVZA 1MRDH 4HWEH 2CLRB 2VUOA 3QUMA 4LLQB 4GKOA 5GRYA 3TZVD 3LS4L 3US0A 3N40F 2XV2A 1AZUA 3BC9A 3KL5A 3IJSA 1UC6A 1HQRB 2XWBB 4TLUA 5EBLA 3CE1A 3AM8C 1E2WA 3TBTA 3MA9L 2JJVA 3VI3B 4XGZA 2EUVA 4CNIA 4LPYA 3PL6D 1BZ9B 1M7XA 4FXKB 3TCLB 5BO0D 1I4FB 5D1XE 2QVFB 1GS7A 4EZJA 2ERJB 3I75B 2AW2A 2X1PA 3CZKA 5AB1A 3FUHA 2CK0L 5HHXH 5KZCB 4XODA 3SYCA 1ADQL 1TPXC 3SDDA 5CUSL 2CMRH 4G6JH 2VXQH 3O3UN 4E5XA 2WQUA 3QPXL 1NC4B 1QSVA 5E4EB 1VCAA 4BH8B 5GJSH 3HZKB 2TAAA 1ONQA 2Z4QB 2KC0A 3BAYA 5FYJL 3BGMA 2AKRB 4CGTA 3ZIMA 3K6SA 2DWEA 1KCKA 2Q7AA 2YEVB 4UBDD 4N26A 3VFVA 5CD5C 5IQLA 1F6LL 4GLRI 2ATKA 2J6EA 4BZ2L 4W9LC 2OR8A 5KBDA 3JTSB 1J1XH 4ECNA 1MRCH 1MY7A 2WINB 4B9KC 5K93A 5B1JA 1BJMA 3QZPA 3BZ4B 1C8PA 3K2MC 5EF0A 3NZUA 4ABVA 3M1CA 3K2UL 5CCKL 3HC3H 3NBNA 5HHMB 3U9PH 3V6ZA 3DX6B 3HC4L 3CHOA 1I7TB 5BRPA 5DWUL 4L9LC 3CH8A 2GB2A 3PJSA 5D4IA 3VAEA 4JN2B 2G9HA 1ORQB 2PPFA 3QI9A 4OY9A 2CDGB 4DOHE 2NY4B 5AVWB 3G5XA 3RWHB 1WEJH 3Q2NA 3HI6L 3OSVA 5BRZA 2NY3B 5L8LB 2WWOA 2QELA 4YDVA 2YPKB 3SCMB 1SYSA 1FVEB 3TESA 3V6OA 3LZPA 1T2QH 3DX0A 3AMKA 4G5ZL 5C07A 1IO4C 1UH2A 4GUOA 5HYQA 2YAEA 1NGWA 1RZIA 1GC1C 2Q2EB 4FI8A 5FLUA 3OKKB 3CFMA 1GRWA 1OOWA 1WYJA 1D5IH 1ZSDA 1AXTH 2F54E 2RD0A 3GBNH 2C3VA 3GMNB 3CZLA 4S1SH 5IVXA 2ICWB 4N2CA 3T6QC 5CBAA 5GZOC 3K7UA 1G7IB 3NIDE 4G3YH 1TJIH 3ARFC 3FCUB 5DHDA 4UDUA 5FYKH 1YAZA 2EDKA 4Z7QF 1N5AB 3UO1L 4CL7A 1JGUH 1BD2D 3MNZB 5J5EA 4WNQB 1X6NA 1TVHA 5FYKE 4PBDA 4Q52A 4DGIH 1Z9SB 2NX5A 4ZSOA 1R0AH 1CURA 1IL1A 2YZ1A 2APWA 3DC0A 3QQ3A 3DVIA 5JO5B 1JWMA 3WKNA 1OAXL 3PQYE 3TZVA 3TFKC 3VGFA 1PKQE 1QATA 2RACA 6FABH 4OZHF 1Z5HA 5F9JA 4U4BA 4DK3A 4HH9B 2WIIB 4ZO9A 4EN3D 3QEQE 3E6HB 2QGDA 4P2OB 5T3XD 1CXFA 2P9RA 4OFKA 1J87A 3FT3A 5DEZA 2AC0A 4OZGA 3VGEA 3WIIH 4AQEA 1WS7A 2OR9L 3U6RB 5D2NE 2Z93A 3L5JA 2I9TB 3QJFA 4M7ZC 4BCXA 4KKNA 4X8GA 2NXZC 1TZHB 1AZVA 3MGOB 1AS8A 2K0RA 2XG4A 4KRPC 4A6YL 2R1XA 1FPTH 2ZXWB 3LN4B 3QS2A 2NYKA 4AVKA 4GRWF 1V5JA 2ADFL 4E68A 3I3EA 4ODTL 4BQ9A 1OO2A 4CC0A 1LEIB 2VABA 3WO3B 2QSCL 4BH7B 2VSDA 3GK8L 3Q8EA 1OAQL 5CSBA 5L4MA 3BPOB 1QWUA 3KJ4B 3S9DB 1IKFH 4ZPTB 3BP4B 2FJGA 3C6LB 3VWJB 1E3XA 2DLFL 4U6HB 4KU1A 1WE5A 3RHWF 1PZBA 2FNWA 3GXPA 4UYQA 5FUOH 2VW7A 4EUPH 3LZFH 4OTXH 1WVZA 4ZS7H 1MIML 2J1KA 5I73C 4X4ZA 1SM3L 1AHWB 2R7EB 4XP4H 1R5VB 3DRTB 4M56A 2PWHA 2GSIB 4WSKA 1HK6A 1JGLH 5I1HL 4P3DB 1A14L 5FOBA 5J57B 2IDQA 4J3SA 2NY1B 5EOCH 1QO3A 3SY6A 3UTQB 1LWHA 1B0WA 5HY9B 1BA9A 1PDKB 4OGZA 6PCYA 4HYTB 4L3EE 3SE4C 1LP9A 4RMWA 1QVOB 4MGXA 3HG1B 5EZLA 1KJ2B 1OE1A 4HCRA 5EZPA 3OXSA 4OKVA 3UTPD 2AZUA 1JL8A 1G9ML 3UTSE 3ARDB 1K9TA 1SF3A 2VDKH 4IHBA 1OGPA 4B41A 4WUUB 1DJWA 3OX8B 3TN0C 4UCFA 1C7SA 1GOFA 1UB5A 4ENEC 3BP5A 3S88H 4J6IA 1YEIH 3EOBA 4XPAH 5BUPA 5F96H 3WDIA 3K1KC 3D18B 4Z5RA 2PYFB 1XF4B 1JPST 3PYCA 3QUZB 4ZOEA 1N64H 2ZAIA 1G7PA 2DBJA 4W9ZA 1DQLH 3ARBB 4CVXB 4ZUWA 3E6FA 3O2DL 2CIKA 5IZ7A 5ENWA 4HWUA 2FQEA 2XZZA 5DC4B 3CFDB 4X4XB 4MA3B 1KEML 3ILDA 2V5YA 1MCBA 3H9YA 5ICXB 4YXHH 3GNML 4P8QA 2WXGA 1QHOA 2YRPA 1KB5H 3GSOB 1TTUA 3GUTB 5F2FA 3DOSA 2DBLH 4QOKB 3WKMH 2X4RA 5MEQA 4HG4J 1A6VH 1N7MH 4EN3A 2VLJB 5HHVH 1EV2E 4MAYB 1OSPH 3NZHH 4KQ4L 1A7PL 7CGTA 3RFRA 3RP1A 4DEPC 4W6XB 2PNDA 4XX1G 2WXRA 2L7UA 4ACTA 2V5RA 4F8TA 1EAQA 4MB4A 3T0EB 5AVTB 2J1ZA 4QDGA 2B59B 3LN5B 5D70H 2ZTBA 1QUNB 4F1SA 4DAGL 3FYIB 5CJQL 1YQ2A 2ZG2A 3LXAA 2K7PA 3H8NA 1CBVL 2BSTB 4JKLA 2P5WD 3KCWA 5D7LB 3ESMA 4ZUUA 3KWXA 1G9NH 4Z7VE 1JWUA 1B0RB 3DGCR 4PWHA 3P4MB 1HCFX 1QLEH 2Q8BL 5I8OH 4ZMPA 3QO0A 1QD0A 3OPUA 12E8H 2I69A 3JV4A 3T1FA 2W9EL 5B39A 2WO4A 2NTFA 3MGTB 4U0RC 1B3IA 1XV8A 1HHJB 2GVYA 3REVB 4P57A 2UY6A 3L4VA 1GPOL 2H0PA 4JY5L 3U79A 2X4UB 3T2NH 4XP1H 2XV3A 1I9JH 4FLSA 2OYLA 2V2TB 2QEJA 4L4JA 4AMKH 2MTAA 1PQZA 5DS8B 1TETH 2WLJA 4P5TD 3I6KA 5DRZB 5LWYH 4D0CB 2FTAA 5LGKA 5CIPB 5AAWC 5HD8D 1XGUA 4CC4C 4Y19B 3F7PC 2M2DA 1RXLA 1G7LB 3QVAA 3RIFF 2DDQL 2G3NA 4IKIA 4F7EB 2O61B 5J6HA 4HIHB 3C5SB 2VOTA 1YPZB 3QISA 5LXGH 2EDLA 2OXHA 5A43C 2XWEA 5ISZE 4XPFL 1NAMH 1KWGA 1J86A 4TVSa 1FGVH 4K3JH 4R7XA 2YMTA 2Z31C 1F58L 2VLME 3H53A 2FRGP 3MCKB 3ABMB 3M17A 2DL9A 4KFZC 2BC4A 2DQCH 4F1ZA 5HGHA 2ZNWA 1AE6H 4LAQH 5D5MA 5BVPL 1HIML 1YDPB 3HPLB 4RISL 4I1RA 1P5UA 4MZ2A 5TF0A 5HPOA 5IVXF 1JHKL 3WY2A 2Z0BA 3II1A 1BVLA 3FDWA 1ZHNA 5LBSH 5K69A 4N1EA 1OZTG 3KPOB 1FDLL 4QHUA 3MFGB 5E9DB 2OYKA 3GFUA 5C8JB 2ZYIA 1ZY9A 3EJZC 2QLVB 3MXWH 3NJVA 1LO2L 2AAAA 3P3TA 4XVUD 3V0JA 3QT2A 3A22A 4JVPA 2DM7A 1S7XA 1S7SB 1SN0A 4DKEH 1VPOL 2QADC 4QI3A 5C0AB 1MFBL 3MA7B 1XSOA 4HKJA 4KMLB 1MFEH 3FB8B 3LKSB 3B7TA 4JBSA 2XN1A 3S5ZA 3KWVA 1TNMA 2QFRA 3NQIA 4X9YA 5IFAL 2HFGL 3QC5X 1NM4A 5EBGA 1XZ0A 4HUXB 3SN6N 2IPUK 2NYYC 4WWPA 1R9FA 4U1KB 5FCSH 4OZGF 1VESA 1I75A 3D33A 1RHFA 1C12B 1OM3L 1U2HA 3SDYL 2WXIA 4KKAD 3WS3B 1Q94A 3KPLA 4J7RA 4OD3L 1OP5H 5GS0C 4RH4A 1GZHC 2JB6B 2BVYA 4C57C 4UU9A 2XWCA 1OLZA 3D3VB 4LCWB 2MJWA 1A3RH 3KDMA 4XHQA 1NBQA 1NIAA 2CBTA 2VR8A 3H4FA 2EEAA 3RA7H 1DQDL 4O00A 1DUZA 4WHYG 1T1XB 2BM3A 1KBWA 2FK9A 5CILH 3UJTH 5TQ0H 4HIPA 4ZS6D 4Z7NB 3IDJB 1ED3B 1XF5A 4M00A 3HI5L 5HYSG 3GXDA 5GS2H 3AXIA 3TBWB 2AZAA 3ZYOA 4EJ1C 4RWYL 2CA3A 4N4YB 4OLWH 4YDLB 1P7QD 2W0LA 1FNAA 1EJ8A 1RK7A 4MVBD 4PV8B 2C9VA 2Q9OA 3ZYIA 3B8SA 4YFEA 5I0YA 3B7UX 2OMXB 4KI5C 2X70A 4P5TA 4ZMOA 4PUBH 1FL5A 4NP9A 3BRDA 2LE9A 5EO1B 3L3HA 1LDPH 5BS0A 4P07A 4PGBB 1LWRA 1LP9F 4QRTB 1TPXB 2EIMB 3FCBA 3WTXA 4ZO7A 43CAB 5BV7B 4W1TA 5FYKD 3TH2T 1NCAL 3Q1EA 1GZPA 4XAKE 3PWNA 4NUGH 2ZSWB 4AQ1A 3O2VH 5KVDL 1YN7A 4JO4L 1QR4A 4DPAX 4OLYL 4NRXA 3ROOA 3BT0A 1DE4B 1M7DB 3LJ3A 1T5KA 1SOQA 3KDPB 4XBEL 4KGLA 1RK1A 1YEKH 3WGUB 3OVUB 1Q0XL 1A9BB 4YLQT 1M1SA 2W92A 1CN4A 1AGDB 3F6IA 3OM3B 5CLZA 3VH8B 4XN4A 4UILL 5D1XA 2P8MB 4OCMC 5DHMC 3SD5A 3RYMA 3FQTA 4JLRB 1VGEH 1RIUL 3HNTL 2CAKA 4O5LH 4H1LA 5DK2B 4OLXH 3BZFA 1KTDA 3TLRA 3V9EA 4JGNA 4G80B 4TVPL 5ANME 4OLZL 4PJFE 5E8NB 4M3KB 5E2JA 5GJTL 3VG0L 4K9JA 1HWWA 1G87A 2VXQA 5LCVH 1D6VL 4ODWA 3IPFA 3T6ZA 1MAML 4JNXA 4L9LB 2A7BA 3ZUCA 4IKJA 3GJFB 2NUTA 3VD3A 4OGQC 5KBNC 3VG9C 5HGAB 1FV1A 3BW9B 5A16A 5F0MB 1QFPA 3TT1H 1KIPB 4PQXA 4U1LB 4LEXL 1RZ7H 2JH2A 4NO0B 3KYKL 2R0LH 3O3AB 1QPXA 3LPFA 4RIRB 5A2FA 1N2RA 3DMMB 3EBHA 1RJCA 2D9QB 3QG6A 1CTOA 4Z3EA 4HFUH 4NZ8A 2HJFA 3EUUA 2VE6A 1H3XA 2MMXA 1S7QB 4YC2C 4AUJA 1KC5L 3ARFB 4L3ED 4GW5A 4UQBA 4EZLA 4LHQB 5G5DA 3BAKA 1YO4A 4AL8H 2DIJA 1WUNT 4X7TB 3UTSD 1XR9B 4CVZA 1CUOA 4UQAA 2NY2B 5F71A 2AXGA 1I85C 1U8PB 1MCRA 3Q13A 2FECI 4MZIA 1U3HC 3FTGA 3GSNH 5T3ZL 2DEWX 2IIJA 4MX7B 4JHBA 4FF9A 5E9NA 3H2PA 1BVZA 1D7FA 3CZSA 1B2WL 1P7QA 2IAND 5FWRA 3LS5H 2PXYA 1PMYA 1JD9A 2DWDA 4FOMA 5CINL 2WJ5A 2F54A 2PPDA 3HBZA 4G8FB 5EZIL 5SX5K 3FQRB 4OFQA 4UV7L 3DI2B 3P2BA 2AF2A 1OAUH 1FNSL 3E3QE 1CLZH 4NP4H 4M7ZB 4YDIL 4O02B 3H9HB 1MHHA 3K3QA 4JO2L 2GTZB 3NVQA 1JNJA 5IROD 4YHNB 4M7LH 2VMEA 2WN2A 5LAXB 1UOLA 1PPIA 4AZ8A 5IHHA 2O5ZH 4HV8A 4JRXE 5D4JA 4X6DA 1PKQA 2XWTA 3VFOB 4LP4A 3F01A 1E65A 1JNHA 4G59C 4GEIA 5D5MF 3N50A 4UDTA 4HWBA 5F44A 2E7LC 4ZW6A 4HBQA 1TOXA 3O6ML 2Q20A 3FAWA 1JHTB 3REWA 1DJSA 2F7OA 2DM2A 1CGYA 1RJZB 4ISVB 1PCSA 1X6LA 3D50A 2X4SA 4G6FB 3F5WB 2NPLX 3L81A 5EUOA 1PEZA 4HIJB 1E28A 5JXEC 1QR1A 3RGVB 3V7AG 4XNQB 4HPHA 1NL0H 1J1OL 1JRHL 4BYHA 4WIQA 4XVJL 2Z0UA 4HIEB 3P0YH 1CTNA 1EFXD 3B7SA 3EJQA 4KKCD 1D5MB 3ZKND 4ZUTB 4JUTA 5B7FA 2MOVA 2WNWA 2ODIA 2JKLA 4XOCA 1JN6B 4CADB 4JFXB 1CGVA 1G4MA 1QQDB 3SOTA 3T3ME 2G2PA 3V4VA 2LLLA 4MA8L 2F7IA 3PL6C 1HYRC 4ES9A 5ID0A 2WVTA 3U6XA 4EUPA 5DA0B 1X7QA 3TO2A 4GH7B 3TIEB 3V4PH 2I7SA 5IHLB 2OTUA 5E6UB 1HT6A 5FPIA 3HIZA 1CT8A 4JQIL 2YN3A 3MI6A 2WLHA 3ATDA 1T0NB 1OK0A 4YSSA 5DJ6B 4NNXB 4L3EA 3JUZA 2VDMB 4JAMA 5DD5H 2J73A 5B1CA 1IC4H 3Q2LA 4KHTL 4Q6IA 1LEGB 5TD4A 4TOYH 5FHBL 2WHVA 3UTSA 5T1KD 4AJYV 2MHAA 3VRIB 5FR3A 3X1BA 4OD1L 1WISA 2VLMD 1R3IH 3GXMA 1HEJC 1WFNA 4JFZL 3ZGHA 1FUNA 5IB2B 1UJ3A 3KBPA 4K8RL 3ZTCC 3O4LB 3VE0A 4M6ML 1ZEAH 2XWRA 2A4EA 3GO1H 1JWSB 2GIMA 4G9DA 2Y6SC 1RVFH 2JB5L 1TJHL 1MH5A 2LVEA 4HKXA 4S0HA 2DWXA 1LLAA 4DEPB 3WUWA 5CEXB 1NIFA 1I8MB 1GIGL 3FFDA 3N85H 1QAWA 5DJ0A 2BSSB 1HNYA 1ZRUA 3U7YH 5IROA 5BW7C 1DCEA 1RMFL 2NYZA 4ANKA 1U6AL 1P84K 4OT1H 5KAQG 3D07A 4WK2B 5EU5A 3ZTJG 2HLAB 3MRGB 4ALAH 1ML0A 4P9MH 2FHFA 3F7LA 4AIEA 4IMKC 4LRNH 1NGYB 1YYMH 4WY7H 1KB5A 1S9WA 1FZMA 4L4VB 2VL4A 4O2CB 4X5RA 3UTOA 5F9WC 2ZUXA 5HDQH 2MQGA 5H2BA 1E43A 4U0RB 1L9NA 4UT6A 3HZVB 2QL1A 4WJ5B 3IFPA 3D25A 3FFCD 1JDCA 3HR5B 4KVCL 4OFIA 4IIZA 2XFXB 1ZT1B 3WJJA 2A9BA 1SJHB 4FFYL 3BUBA 4GUCA 1T4KA 4W9FC 3U83A 1P1VA 1PJWA 2NTSP 3R1GL 5E5RB 1JD7A 1QFWM 2J55A 1JZGA 2J8HA 3CVHL 1GHFH 4JJ5A 3SPGA 2BVOA 5ELIA 2W60B 5DJDB 4LSSH 4QXVA 1UB6B 3TASA 4IBSA 3CFQA 4RBPK 1IFHH 1WBZA 3LQAH 3T0XA 3ULVC 1NCUA 3LIZH 2SODB 3VFSB 4PBXA 1S46A 4CU6A 3NCJH 2WSDA 4MMZA 4BZYA 1INEH 1WA1X 1CXHA 2Z64C 3L5XH 4HJIA 1SHSA 1UACL 2DWYA 4LSVH 2CNZA 3O41B 4KO5A 3RVUC 4ZTEA 2HB0A 3T08A 3OAZH 4MXWH 2V7NB 1P1ZA 3Q06A 5F8RC 1CDCA 1FIEA 4P2CG 3ZTNH 3GHEH 4L18A 4KZ0A 5L8JB 3Q5OA 4AIZB 1B9KA 4N2MA 3MLTA 4Q14A 1DVTA 4HS3A 4UIKH 3W39A 1O0VA 2RBLA 4XAKD 3RVXC 4F9LA 4Z7QB 5JW3L 2ESVD 3EFFB 3M86A 3W56A 1NLBL 1U58A 4E41B 5DEFB 5I5MA 3KPSE 2XXGA 4GT7A 2QADB 3E7JA 5D96C 1IARB 5DEGA 1WK0A 4UMSA 4LKXB 5CD3B 1URZA 2BSRA 4M5YL 3HN3A 1DBBL 2IG2H 4QGTA 1KELL 4GAJL 1H0DA 5JLZA 1ILSA 4OZHB 2AJYL 1FH5L 2Y2WA 5F89B 1A9EA 2R2BB 3NIDF 4M29A 5IW6A 3ECBA 5EN2A 3RUGE 1JF1A 4KJQD 1F4YL 5LBSA 3PWVB 5CP3H 1KT2B 3ECWA 4N68A 1A7QL 4HMCA 2ARWA 1T0PB 5L4FA 4BXVA 2B2XL 1HZLA 3PAVA 4JY6A 4X6DF 5HJBA 3ZL4H 5DHYA 4GRWB 4N2DA 4FQ2L 2O93L 1CDJA 1KTCA 4OD2A 4QD2E 1OAKH 3DHJA 3JWDH 1U30A 5ACLA 4KK6C 2H32B 3KL0A 3VQMA 3K4DA 5DZVA 4OH2A 4ZPVB 1DJHA 2CLZB 5IHUH 5K39B 1M42A 3ZE0E 3L7FA 1DSFL 5HHNA 5HI3D 5F7AA 4LCCB 4UB0H 3VXQB 4KZDL 3L1EA 5EUOF 4A39A 2QSVA 3AFLA 1URLA 4AM0B 2HX7A 4MJ5A 3RFZC 5HJ3A 5CJOL 1XQ4A 1E4XH 2WTRA 2CHXA 5FYLL 5EFIB 4U6VH 2AQ3A 3TYGH 3RNQB 4ZQKA 4ZO8A 3ZHFA 1N8ZB 2WXJA 5D8JL 4N1CA 1SHXA 1YN6B 1GR7A 4NGHH 1M2VA 1L7IL 2X44D 3U4KA 3H0TA 4RNRA 2AVGA 2C1PB 2Y36H 4XAWL 4NQXB 2HKHH 2H3XC 3EAKA 4FLQA 4N24A 4PWEA 4DZ8A 3NH7H 4L0PB 1JUFB 3SE3A 4GSRA 4R2GD 3GMPB 2AABL 3S37X 4KGJA 4ZX6A 2Z92B 4GNKB 4JUSA 1N18A 3ARSA 1WT5C 2DWTA 3CZFA 4Z9KB 2MOGA 3QNYB 2HFFB 2IDCA 4LSQL 5DJCA 5AVVB 2LAGB 3UJIL 1XCQA 1RIHL 5KYXB 2R51A 3OKDA 4XVOA 4GQRA 4UI2A 3ZU8A 3S5LG 1N70A 2BOBA 1OK8A 1VIWA 1XZWA 3WMSA 5IG7A 3EYQD 3KPQA 4EBQL 4OV6F 3C2AH 1MAKA 5DVPA 2BPBA 4R97C 4EEEA 3I6GB 3N0AA 5LN4A 2BERA 3HNSH 4X5LA 3ZDYB 4DGVL 3O0LA 1EZSA 1I1YA 4PVMA 4B3EA 5GS1A 3IJSB 3VG9B 5EBLB 3GBMH 2B1AL 4ETQA 3VX0A 4XGZB 5T5FA 4LE8A 4CNIB 3EOTL 4Z77A 1MFCL 2I24N 3HUJE 4TN9A 3JZ7A 3FCSA 5JW5A 2K6YA 2N4IA 4GQQA 5TPWH 4XNDA 4KQ3H 3I2CL 1WWBX 5IUSA 1HYSD 5ANMA 4K7PH 4PJFA 2GJ6D 3HS9A 4E5XB 5IHBA 4PRIE 1UGNA 2C9QA 1ROWA 3KLAA 1JK8A 3KPNA 4ZD3H 2TRHA 2K6ZA 3WMPA 3NEOA 4K2UH 3M45A 1VZIA 1RULH 5C0EA 3MODL 4TRPL 2H0FA 3BGMB 4BIKA 3MV8D 5EC2A 4AV0A 3DK0A 3QWRD 4RRPM 1RZFL 2DWEB