1NIBA

The structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
333
structure length
333
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title The structure of copper-nitrite reductase from Achromobacter cycloclastes at five pH values, with NO2- bound and with type II copper depleted.
pubmed doi rcsb
molecule tags Oxidoreductase (nitric oxide(a))
total genus 87
structure length 333
sequence length 333
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1nibA02
2VW7A 3NP3A 4DPBX 4DP0X 4AX3A 1RCYA 1TEFA 4YSEA 2J55A 5TK2A 1NTDA 2ZOOA 2HZHA 4DP1X 2IAAC 2HRHA 2IWKA 5F7BA 3TA4D 4M4RB 4A2HA 1PY0A 1ZPUA 4YSDA 3TU6A 3TBCA 1GY2A 2GBAA 2YAFA 3FPYA 3HB3B 3EF4A 1ILSA 4HCFA 1PLCA 1PLAA 3FYEB 3QJTB 2J57A 1NIDA 4KO6A 2AZAA 3T9WA 5B3SB 7PAZA 1URIA 3L45A 5I6OA 3HEIB 2YAOA 1AAJA 5I28A 4E9YA 4CSZA 4KO5A 3WNJA 1XMEB 4QLWA 4BK5C 3QJRB 5PCYA 3BQVA 3GXUB 1JXFA 2XVBA 1SF5A 3X1GA 3GYRA 4HIPA 2FQFA 2BZ7A 3H4FA 1GYCA 4G7SB 1B3IA 1W6WA 2BO0A 3UACA 4F2FA 3JTBA 4DP7X 1ET7A 2XV2A 1NWPA 5AZUA 4WTQA 5AFAA 4E9QA 2I7OA 2YXWA 3NJJA 2UXVA 4HAKA 1GR7A 2FNWA 3TASA 2XX0A 2YXVA 2JFCA 2PP8A 2H3XC 3FT0A 1EHKB 1MG2C 3PAVA 1WS7A 1UATA 3NSFA 2FT6A 4DP6X 3RYMA 2MRYA 3EH4B 5TK4A 2R7EA 4EF3A 2BZCA 2AVFA 1E5YA 4AKOA 1BQKA 2UXTA 3SBRA 3OMAB 2UX6A 3DTUB 2QDWA 1E30A 3ASNB 2EILB 3AG2B 1IUZA 3FU7B 2FQGA 1MG3C 4L0PB 5D4IA 3OMNB 1CC3A 1KDJA 3AG4B 2NRDA 4UANA 1SJMA 4GY4A 3X2QB 2HX8A 3EHBB 4YSPA 4AKQA 1KCWA 5I6NA 2VW4A 1YLBB 4G7QB 1J9TA 1ZV2A 1BXUA 3CZUB 4YL4A 1XB3A 1GS6X 1CYXA 5E9NA 3AG3B 1NIAA 4N4YB 3H4HA 3UGEA 3WI9A 2DV6A 2VN3A 1JZEA 1JZIA 2GB2A 1SHWA 2I85A 3KW8A 1OV8A 2TSAA 3S3CB 1ET5A 2CBPA 2QPDB 4E9WA 3IEAA 2Y1AA 1ID2A 5B7FA 3MX0B 2YARA 3EH3B 5I6MA 1QNIA 5I6PA 1CURA 4HHWA 4AZUA 6PAZA 1M56B 2XV0A 2PPAA 3FPXA 1ZDQA 2XLLA 3CVCA 1MZZA 5B1JA 1J5CA 2UXGA 5AKRA 1W8EA 2IWEA 1L9SA 3SBPA 5I6KA 2Q5BA 1AOZA 2BP8A 1AG6A 4RH4A 2CAKA 8PAZA 1SFDA 3C75A 1JOIA 2PP7A 3FU8A 3QJQB 5PAZA 2BWDA 2EINB 3NJKA 4NB7A 5B7MA 1JXDA 4GP8B 4PCYA 2XYBA 1OCOB 4Q8BA 3S3BB 3QJSB 1GY1A 1A8ZA 1IKOP 1AS7A 2OV0A 4A67A 4E9RA 4HZ1A 4A2FA 1XB8A 2OCCB 2FWLB 3EH5B 4BWWA 1PZCA 2AZUA 4KNSA 4W1TA 2J5WA 2H47C 3PAZA 3FQYA 1SHXA 1OCZB 4GXFA 9PCYA 2JKWA 2YAQA 1WA1X 3NJHA 4KOCA 1VLXA 4YSRA 3FSVA 1AS8A 1AZCA 3NSCA 4DPCX 1AS6A 1AIZA 2X87A 3S8GB 3UAAA 1KGYE 1E67A 4DP5X 4FA7B 4Q89A 1KBVA 1PF3A 2EIKB 2B08A 1NDTA 3X1EA 2WSDA 1AR1B 2X88A 2J56A 2FJSA 4A2GA 4A2DA 4KNUA 4E9VA 2Q9OA 3ASOB 4FAAB 3IN2A 1AZBA 3IN0A 1HAWA 4BDVA 4G70B 1ILUA 3KW7A 1ZDSA 3ZBMA 2BP0A 3ZDWA 3S8FB 1KV7A 1BYPA 1A4BA 4TXVB 1NIEA 4P5SA 2QPEB 1W6LA 2GIMA 1GS7A 4KO7A 4HCGA 1V55B 4BXSV 4PAZA 1A3ZA 1NPJA 5EHFA 3OD3A 2BHFA 2DYSB 3AZUA 1R1CA 1RKRA 1TU2A 5ANHA 1QHQA 1A4CA 1KDIA 5F7AA 2CALA 3CDZA 1IBYA 4E9SA 4W9ZA 1HFUA 1JZFA 3AG1B 1N70A 4E9TA 1NIFA 1NICA 1OE3A 1X9RA 3T6XA 2I7SA 1DYZA 3T6ZA 1JZGA 2CUAA 2VM4A 3FU9A 3MBWB 2HX9A 2Y69B 4G7RB 2DWSA 4BXVA 2XU9A 4YVUA 2R7EB 1PNDA 1A4AA 3QJUB 3QPKA 2HRGA 3D12B 1JZHA 1L9QA 3PLYA 1OF0A 1QLEB 3FQ1A 4KO9A 1AANA 2IDQA 3QQXA 3JT2A 4G71B 1BXAA 1OE1A 2WO2B 2GHZA 1PZBA 3OMIB 1CUOA 4ZK8A 5I6LA 2VM3A 3DIVA 2HX7A 1TKWA 4ENZA 1SDDA 5B1AB 1FFTB 1NPNA 2GI0A 3UAEA 1BXVA 1PNCA 5D4HA 1L9TA 2OJ1A 1OE2A 3SQRA 3UABA 3TBBA 1L9PA 3S3DB 3WKQA 2W8CA 1WA2X 3T71A 2QT6A 4YSAA 2IDSA 5B1JC 1JZJA 1X9UA 3FSZA 1FA4A 1ZIBA 1RZPA 2XWZA 3OQRA 1NIBA 2GC4C 3BVDB 1V10A 3SBQA 1ZIAA 5I5IA 1OCCB 2PP9A 3G5WA 4JKNA 1MZYA 2UX7A 3WIAA 2FT8A 3NJGA 4YSQA 4KOBA 4P5RA 1MDAA 3IBOA 1IBZA 3OM3B 2XUWA 5IY5B 4YSOA 1GSKA 5B7EA 2BP8B 3FSWA 2PPDA 2IDTA 2CJ3A 1T5KA 3NT0A 3PAUA 4DPAX 2H5UA 2XX1A 2BW5A 1GW0A 3WG7B 3X1NA 4DP4X 3NSDA 2IDFA 2WO3B 3AY2A 2HXAA 1KBWA 1ASOA 2VMJA 4G72B 1XB6A 7PCYA 1GS8A 1DZ0A 2ZWNA 1V54B 3NJLA 1BQ5A 1AZNA 1NZRA 1BYOA 1ETJA 2PLTA 2XXFA 1N68A 1L9OA 2PCFA 6PCYA 2IH9A 4M3HA 4HALA 2EIMB 2XV3A 1AG0A 4UAHA 4N8UA 2A3TA 1E65A 1SNRA 3FYIB 3CVBA 3X1BA 4DP2X 1KYAA 3ERXA 4DP8X 4HCIA 3PCYA 1PCSA 4A2EA 2LLNA 4YVNA 3IE9A 2UXFA 3PXLA 3FSAA 2BW4A 1M57B 4YSUA 5B1BB 1AACA 3V9CA 1L9RA 4BDVB 2PCYA 1E5ZA 3CVDA 1JVLA 1CYWA 4NAJA 1AQ8A 2PPFA 4AKPA 3AW5A 1F56A 1WAEA 2W88A 4GYBA 4GP4B 2MTAA 2DWTA 5B1KA 2BP0B 3PPSA 3WNIA 2PPEA 3H56A 4MFHA 3NSYA 2IH8A 4K9JA 3NJNA 1AZRA 2FT7A 3N55A 4UF7C 2VW6A 4HHGA 4YSTA 4BWTA 4X4KA 1J9RA 3NYKA 4JHUA 5I26A 2DYRB 3FU7A 2TSBA 4QKTA 3ZX1A 2IWFA 4WKXA 1M9WA 1NWOA 2AFNA 3U25A 4A66A 2ZXWB 1JXGA 1HAUA 2DY2A 2FTAA 3ABGA 1NINA 3NJIA 4JHVA 2HLEB 3CDZB 3ZIYA 1JERA 4AI7A 1BQRA 4KNTA 3X1FA 2YAPA 3ABMB 2FQDA 5FC9A 2GC7C 2YAHA 4NERA 2AANA 2B3IA 2FQEA 5D4JA 2YAEA 2ZONA 1WA0X 3CG8A 3FS9A 3N2JA 2QDVA 3T6WA 4F2EA 3ABKB 3T6VA 1OOWA 3FQ2A 2P80A 2GSMB 1ET8A 2YQBA 1PAZA 3NJFA 1ASQA 1OCRB 2VSMB 1FWXA 1J9QA 3DKHA 1PLBA 2JXMA 1KCBA 3GDCA 3NP4A 1TEGA 4CSPA 5A7EA 1WS8A 2EIJB 2N0MA 4YSCA 1J9SA 4E9XA 3ABLB 4A68A 1SDDB 1A65A 3UADA 4DP9X 1JVOA 1PZAA 1IC0A 2VSKB 1BAWA 1EZLA 2PPCA 3QJVB 3WKPA 5LDUA 4GP5B 2RACA 1RZQA 5I5MA 1AZUA 5I5JA 2CCWA 1SF3A 2BWIA 2E86A 4YSSA 1J5DA 1SFHA 1I53A 3V9EA 1ADWA 2XXGA 4BWUA 1BEXA 2P80D 4F7KA 3NJMA 1PMYA 2YAMA 1ASPA 2IDUA
chains in the Genus database with same CATH superfamily
2QMJA 5FK9A 4G3YL 1EZVY 1FFOA 2YZ8A 2F5AL 1SEQL 2D73A 3IFOB 1P7BA 5GHWL 3P30L 4MD5B 1E9OA 2FDBP 3PGFH 5I8CA 4W68A 1MDTA 5LJYH 1QWNA 2BRQA 2GUYA 3FUKA 4YSDA 5DK0B 3FRPG 2OI9B 1YEIL 1DVFD 4U1LA 3DURB 1E43A 5E2TH 1IBGL 1Y0LB 2F53E 4UYPA 3DSNB 2FWUA 3K71B 3KBFA 1DUYB 2FH8A 4CU6A 4OFIA 3ZMEA 3U83A 3JYBA 3RFRA 4JG1L 1TO4A 1LTXA 4LLDB 1UFUA 3AU1B 4FHJA 4LHJB 4E9YA 3HHMA 5IB4A 3CVHH 4LLAA 2ETWA 3VU1A 3LPWA 2ZWKA 3AQDA 4OY9A 3CSBA 3ZQXA 1WIPA 3D39B 1LILA 2PCFB 1U58A 4APQD 1RFDH 1ZS8B 4XNQA 3GZKA 2HKAA 5HD8C 3S97C 1JZ4A 3S37X 2DMKA 3PDOA 4FX5A 1J8HE 4Q2ZA 5D7IE 1X4XA 5AD0A 1B0WA 2DTML 1QTYT 3R18A 3RKPA 2W9EH 4DVRH 1QLFA 3U0TA 3U36A 2DM3A 5DFVC 4M43H 5I1AA 4Z7UB 1JNHB 2BHYA 3BIAX 2JIXB 5IW6A 1OD9A 1LP9B 3D0LB 1OAXL 1BJ1H 2IAND 2Z8SA 5AZUA 1FZOB 3L7FA 3SDCB 4C47A 4OW6A 4AV4A 4ICXA 3HPLA 3MUGA 5JHBA 3S88L 2W65B 3CFTA 2DKUA 2F68X 3MSPA 2BVQB 5FW8A 2CHZA 1TVBA 2J1WA 4H8PA 2BINA 3T0EC 1N3NA 3MBWA 4XVOA 1M1SA 2LFGA 1M53A 4P57A 2XBTA 3VA2C 3Q44A 4UIKH 2L3BA 4QHLB 2Z91A 2BZCA 4RMTA 1TZGH 4JS7A 3H7BB 4Q9QL 5DUMH 4BEIA 3KBEA 2VE6B 2XY2A 3KH3A 1YECL 1II4E 2EILB 2Y7MA 4HAGA 4FQ1L 1MG3C 4NQDA 3L1OH 1DHKA 3T3MF 4O2FA 1T7ZA 1A4KB 2Z31D 3R0MA 5E7FA 1J1OH 2OR8A 5ERWA 3LNDA 2NTFB 4CADB 3VSTA 4HQQH 4U1SB 1E4KC 3U46B 2ODHA 4P2QA 3VD2A 1J9TA 1FYTD 4R7NB 3IMBA 4N0UE 1OAQH 1XH1A 1BECA 1E27A 4YR6B 5D70L 3N6YA 5CN2A 2F54D 3OG6B 2OPCA 1A66A 1RUAL 4TSCL 2B1HH 3QO0A 1JWUB 4MZ2A 1LVEA 4D9LH 5ISZD 4X7EC 1U8NA 2Y1AA 1QKZL 1V3LA 2EAEA 3EH3B 3G5YA 4WEUD 1KLUB 1CE6A 4XN2A 4OGAC 4AZUA 1G6RB 3DVNA 2WCSA 5I5RA 3CPLB 4JBSA 1JF6A 3OZ9H 1H8OA 4I48B 3VFNA 3OL2A 2WQAA 2LVEA 3BO8B 3VI4B 4S1QL 4KDVA 4ICWA 3KD4A 5D96B 4JB9L 1HKLH 4R9HA 1UJ3C 5E8DH 2OMXB 1QSFE 5B7MA 1F11A 1NCCH 3SYAA 4PEEA 1FH5H 1Z5YD 4HUXA 3RVVC 4C54A 5JXEA 1DJYA 1SEBA 5IHZA 1JN6A 3O8XC 1K4DB 2JKSA 4DN3L 4MMYB 3POHA 2E4FA 4JFUA 3K74B 3S36X 1XF3B 4LLVA 5FGCE 4WFHD 4GRWE 4I9XA 3GXDA 5D2NE 2A9DA 2OCCB 1UB6A 1PBYA 4LQ1A 1M7IB 3BEWA 1K4CB 2AXGA 3HR6A 5IQ7L 2QADB 3E2HB 3QAZB 3PUUA 5SWSB 2J43A 2XTJB 1ZLUK 5DA4A 4YC2C 4XO4A 3VD5A 5ITFB 1LE5B 4GXFA 1NCHA 1HDMB 1MFEH 1OGSA 4WWKC 3NTCH 1FO0L 1N0LB 4HLEA 4WNJA 3QIBC 4OF6A 2XKNB 4GQZA 2DEYX 4NZJA 1HOCA 3WBDA 5C08E 4DW2H 1LHZA 2NX5E 5KVGL 3E0GA 1RZ7L 4UT9A 1W0VB 1X5MA 1AXTL 4HUUB 5FYLE 4NO0B 3X1EA 1FNAA 3QNXB 4OM0L 4DGYH 1D7DA 3HW7A 4A2GA 3V0JA 5HVFB 5DS2A 4YPGA 5E6YA 4IS6B 3WD5H 5BV7L 4KY1H 3HE7C 1T0MA 4IRJC 5IG7A 1G84A 2DWDB 1S7WA 4KUZH 3KW7A 3IGFA 5CINH 3C5ZC 3LS5L 2HB0A 3KXFB 1YEHH 2BSRA 3WEXA 3VVVA 1Q9KA 4JRYB 2KH2B 5JHDA 3W56A 2EYSA 3Q8CA 4HHAA 4ABQA 2P8PA 4OJYA 3DX8B 4M62L 1IGFH 3ZKSD 4BXSV 4FYRA 1OCWL 1S7VA 5DK2A 2DYSB 2ZCLL 2KMWA 4TVPD 1ZLVK 4F2ME 5JO5B 1PDKB 3R4DA 5FYKU 3E6FA 4LESA 1AGCA 2CHWA 4OGXH 4JR9H 3MUJA 3L8QA 3REVA 3BD4A 4YAQB 4G6KH 4WK0B 1G7HB 3MI6A 1U8PB 3FRPA 4IIQA 4W9KC 3T6XA 3TBWA 1I8AA 2VM4A 3UIZA 4OSUH 3EDJA 4XCFH 4JJ5B 3HTLX 1TQUA 3O4LD 3N41B 3QI9B 2FSDA 2VDPB 4MAUH 3MXVL 1A4AA 3HMXL 5T1JA 3LKOA 3QJUB 3L9BA 3PE9A 1QTPA 1RZJH 1SJVA 1ZAGA 1XZWA 2BVYA 3CZJA 1RK1A 5L2JA 4U1IB 3H9YA 2OJZH 4M6MH 4N0RA 1IM9D 2WO4A 1H3GA 3C08H 2M8XA 2IH1B 2E74C 4UTAH 4CDHA 4TUOA 3G08B 3DGDA 5DA0B 2C4FU 1OE1A 4LASH 1G9ML 3ZYZA 2VXUL 2P1YA 3QUXC 1WITA 1MIEH 2VN6A 1PZBA 1ORQA 4LOFA 4OV5B 2CLRA 1KGWA 1SLUA 3SKNA 2VLJB 1YYMH 2BFGA 4TNGA 3RUGB 3BUPA 3GKWH 5HTSA 5KBKA 1SDDA 4WUKH 4L4TB 3T2QA 1U8QB 4M1CD 2LTQC 2V5MA 1KJ3H 1X9QA 4YNYA 3FO1A 1H0DB 5HDQL 3N1FC 3JVGC 3QG6A 4FULA 3M8OH 3FB7A 5DJAA 3SBQA 4M5YL 3FF7A 1MREH 2ITFA 4UV7L 1J0YA 2XTLA 1ZE3C 4YO0B 4NKIH 1USQA 5TGBA 3GSOA 2QSTA 4KROC 1WDAA 3LNEA 4CSSA 2PYEB 3MYZA 2EIZA 4NZRH 3EOBB 3HC2A 2AJSH 2X0WA 2NR6A 1HNGA 2HTKC 3ARDA 1MCIA 2NY2D 1NA8A 1ICTA 1MHPL 1T5WA 2PPDA 4KDTA 4PP2A 4N90D 3SDAA 1T5KA 2XG4A 1T20A 4HISA 4KDWA 2C34A 2Q2EB 1MI5A 3W9EB 1CLYL 2DPKA 4DP4X 4D0CA 1YEGH 2NY4D 1DVYA 3FRUB 2P7TA 2Y1ZA 1OSEA 1ES0A 3C09B 1RJZA 2NOYA 3AY2A 3OV6A 3TN0C 3IU4L 3WDIA 2VMJA 2XIIA 1GSMA 1V54B 3KYOA 4RBPK 5EUOE 2EXYC 5FGBC 4DHLA 5DFWH 4YS4A 2IAMC 3BSZH 2GJ6D 5F1NA 4M7JL 5FLUA 4GG6B 4DOHE 4KKRA 3JV5A 3WFBH 1T2XA 2WMPA 5KANI 3ARED 1MCHA 3IJSA 1DBKH 4QIRA 4WFGD 3BFWA 3F7KA 4LO9A 4BINA 3V52L 4L3ED 4HCIA 5A2CA 1EEYA 1NJ9A 2RQ8A 5D7SH 2BVOA 1EVTC 4X4YB 5AOMA 1I8LA 3TFKC 5AAWC 1J5HA 2ZCHH 3VRLF 3EJJX 4QRRA 4N9GA 4UV4L 1VSCA 4WEEA 4YXLH 2PWEA 3ULUH 1GGCH 1T4KA 2DMGA 2Y0SA 4M48H 1I1AD 3MO1B 4XO8A 3BH9B 2W88A 4S1SL 4E42A 4ZUVB 3OHMB 3QDGA 1TF4A 4KK9D 2C26A 4ODBD 4F5CA 4HEPG 5C70A 5GS1A 4Q9RH 4N2DA 3WY4A 3ZKND 5E5MA 5KZCD 1AHMA 1AZRA 4FQHA 4X5PA 5EOCH 1YEDB 4KTDL 4IKIA 3GK8L 5DI8A 1CLZH 1S9YA 4UOQA 5IJKA 4MLIA 2C9RA 4TOYL 1K5NB 4I85A 4QKTA 1TQBB 1NWOA 3U25A 5SX4I 4JDTL 5IB2A 1VGKB 1C5BL 3O6FD 5FYJH 1S9VB 2O6DA 1G1YA 3FB8A 5CSZB 4BFBD 3C6LD 5B39A 1NUGA 4ZD3L 3K2IA 4IBSA 4TQEL 4P5TD 4LP5A 3F5WA 1TSHA 5EIVA 1UXSB 3KE0A 2VMCA 3UBFA 3G6AA 1Z9MA 5I15H 1WEJH 2FHBA 1ZA3B 5ADPL 4L4VE 4AEIH 2X5PA 3M1BB 2Y5TB 2UY7A 3X11A 5G55A 2QDVA 4AUYA 1U91B 4NLAA 4Z7OB 4NBYB 1AKPA 1RUQH 3O0LA 1ZVSB 2D03L 5GSVA 5GRXG 5LB1A 1MFUA 1WLHA 2BNQD 4AQEB 4YHKL 1OT1A 3FT4B 3HNSL 4XGZA 2IBBA 2AVGA 4L3CB 4JPIB 5HVWA 4YE0A 2WWKT 3SHSA 3D5OF 5KBNC 3BT0A 1Y6MR 3MJ6A 2EIJB 2OULB 4OVUA 2PR4H 2FL5A 3EAKA 1RZFH 3QDAA 4NNPL 3GI8H 5J56B 1DBJH 1HX0A 2EO1A 3DGGB 4W6XB 3TFBA 1H15B 1PZAA 2XWJB 3O3BB 4PYGA 2C4XA 3S4SA 1I85C 4NRXA 5FHAL 2AJUL 1AZUA 4Z76A 2EDBA 2DWEA 4RZCA 3TESA 4E5XB 2F53A 2Y2WA 1KB5H 2Z8RA 3NDYE 4IGBD 4KTEH 4L1LA 3W11C 4I13B 3LNHA 1MPAH 1CFVL 3PV6A 5TFSL 1J88A 4F37K 2FD6L 1GYAA 4M7ZC 3QRLA 3N85H 5D5MB 3OAZH 4JUSA 3BP4A 1OTUD 2OSXA 1TEFA 2X70A 3L7EA 2J55A 4XBEH 2VXSL 3ARBA 3MODL 4KXZI 4ETQB 2V3FA 3ZTJG 1E90A 4IEFB 4HKZB 3RQ3A 3HPJA 2ZF9A 1QSVA 4MXVF 5H8DA 2WTPA 1YQVH 2YUXA 3GPSA 3NCYS 1DBBH 4R90H 4ANUA 5IBTH 1QTSA 5IHHA 1R5IA 3V0HA 3ZHDA 3K2MC 2HVJA 4YQXH 3AAZA 2AQ1A 5GIRB 3A6OA 4EDWH 2C9UA 5G4MA 1IV8A 4NQCA 4PGEA 2GBVA 4OGQC 3KLAA 4QGTA 1MJJA 1QATA 4UTBL 3NZSA 1JPFA 3H9HA 1SBSH 4JKPL 2YPLA 3WL9B 4Z78B 4NKDB 2OK0H 1YMMB 5AAMA 2KC0A 2QZ5A 3SKOA 4WI4A 2F7OA 3QA3B 1U8OA 3SDCC 2A1WL 5CWSA 4Q4EA 2EH7L 4XHQA 3RGVA 5IGXH 4YGAB 1W6WA 5C0EA 2CUHA 3VXNB 3WXWH 4HWBA 1U95B 1UWFA 3GMMA 4XPAL 1CFNA 2WUBL 3C6EA 4FN0A 4PJ8D 3NJJA 4M1DL 3V5HA 1IM3A 4G42B 5DTFA 1S5IH 4WHCA 4AQOA 5I17B 5C0CB 3CLEH 3QZOA 3CIQA 3O6KH 2EEFA 5A7BA 4TUKH 5C0JB 4HULB 4Z3EA 1JK9A 4XPTL 2XZZA 3BP6B 3I84A 4PJXB 5CXPA 4K3EL 3ME0A 4R3SB 4N0UA 5I18H 2Z7WA 1FVDB 1RIHL 3BWZA 1E2WA 3SBRA 2QQQA 4CGUB 3BKCH 4PB0H 2Y06H 4N8CH 4UT7L 4NUGL 1MJ8H 5F9JA 4JO5A 4LXFA 2XN1A 1NKOA 1E3XA 4O5LH 4HWEH 4E41E 1YQ2A 4L2YA 4ONHB 3BVNB 1Z5HA 2NYZA 5GJTH 1QA9A 1X3DA 2QMKA 2BNRB 1G9HA 2YA1A 3I74A 1UM5H 4WO4B 4ONFH 4FZ8L 2X12A 1A7RH 2K45A 3FOLA 4PJ7B 3VGDA 3JTSA 2P49B 4NKOB 5IEKA 4K5NA 2EP6A 5EN2B 3RY4A 1FZJB 3WY2A 3UTQB 5A2JH 1P9MA 4G8FA 4X98A 1ZSDA 3PGFL 3OX8A 2AQTA 4P46B 2H3KA 4X4ZA 3EXJA 1R33A 3W3BA 4EO5A 2X42A 4GAYB 3ARTA 5HPMB 3RX8A 3SJVD 4WI9A 4H1LB 6PAZA 5CEZE 4LOVA 4JN2A 4NKMB 4XP4H 1KPRA 1ZDQA 5E2TL 2XLLA 4NC2B 4ZFZB 1MZZA 4NQED 5IQ9A 1TTBA 5D93B 5AVRB 2MCAA 5DJYB 5CR8A 4QYOA 4P4KD 4Z7WF 3TA3A 4Y1AE 4FP8H 1UQSA 3DJSA 5FDWA 2H32H 3CZSA 1JGVH 4U6XB 3B9KB 3MV7D 4NB7A 3CVHL 4MDIB 4MB1A 4X6DF 2KZ1B 4CN6A 2Y36H 4GRWH 5DQ9B 1QWHA 4HJGB 3VXQB 3X12A 4G82A 3GSVB 2EDDA 4XTRD 1UEYA 2G5BA 1AOHA 1RFDL 3SE3A 3FCBA 4MMXB 3PWPB 1MHCA 1ZCRA 3HAEB 2LU5A 2XYCA 5EU4A 3GSUA 4JFOA 4GRLA 3VU2A 1T89A 3VMNA 3WTXA 1BVKA 2J6WA 2EADA 5E2JA 2W9EL 4DVRL 3JXAA 2VN7A 5C0BD 3QNFA 3NIDE 2CDFA 4M43L 4HOZA 2WXFA 5DMGD 1UXWB 3MNVA 5HDBF 1HQ4A 1DQDH 4FG6C 3T2OA 4OD1H 2JNZA 4ZMQA 3T8VA 3AS1A 2YHGA 3VQLA 3MGOB 1GXEA 4KKZA 4J4PD 4Y19B 3Q01A 5FYLH 5HYQA 2XN9E 2ZWLT 4LLYA 4EUPH 4NCC1 1EEZB 2CH8A 1SY6H 4UIKL 3L2LA 3QUMB 2OX5A 5AW1B 5EEXA 2CO6A 1CDHA 1TZGL 5I75B 5I74B 5DUML 4O2EA 4AIOA 1MVUA 2XHNA 3F05A 2ICEA 1AD9A 1FSKC 2YSSA 3KH4A 1GYUA 2ZXCA 3L1OL 3SQBA 4HEMA 1U3JA 1VADB 1J1OL 3EO1B 3S8FB 4U1JB 4EN3A 1XD0A 4HQQL 4NUMA 5FKAB 5SWQB 3OF6A 4QO1A 1NLDH 1NC2B 2WXKA 3H3PH 1OAQL 3G3LA 3ZZLA 4N6RA 5CJXC 2ZNXA 3MXWH 3I85A 2FGWH 1E2VA 4MA1C 3TIDA 1HT6A 2HFTA 4L8BA 2O5ZH 4D9LL 4AQ8A 3BGFC 4R8WH 3EUDA 4PP1D 4W9ZA 5EZPA 3QI9C 1U8JA 1DE4B 1X9RA 1T80A 2AAAA 2PXYB 3ARGA 3T6ZA 3EJCA 2HMIC 4PJ5B 1GW6A 1NFDE 3OZ9L 5HVGB 4EN2A 3EFDH 5AVVB 2QGEA 4Z7WA 5FEBA 3VRIA 1CVSC 1ZK5A 3WNPA 3ZTNH 2CCVA 3D12B 4HGWB 4QDGA 1WT5C 5EBWA 1HKLL 4OZGF 4X6DA 5E8DL 1OF0A 4YDIH 1RPQA 1NCCL 3TNMA 1FH5L 2OJEA 1PTZA 1PLGH 2X2HA 5DC0A 1I82A 3K6OA 1N5AA 5F0PB 1JI1A 2FIKB 4HS3B 1CDJA 4HH9A 1CUOA 4YHNA 4B50A 3ES6B 3P9LB 4PRIB 4PJ9D 4ENZA 2OMZB 1FFTB 3D09A 2BSBA 3EJYD 4GH7B 3NTCL 4RAUA 3SQRA 1NANH 5JORB 3TBBA 4KJWC 3DPBB 1FP5A 3QEQD 1HYRC 4MJ6A 1DVFC 1T6BX 3VAEA 2DQTH 1M4KA 3LKSA 4G1EA 1R3HB 4DW2L 4V1DB 1B9KA 5E5RB 2YXMA 2L0DA 5JW4M 5EPMA 2R56H 4DGYL 4YSQA 4KNQA 2N0KA 3OM3B 4MJIA 4MNHA 5D1ZB 1FNFA 3VWJD 3ARUA 3WD5L 3TOPA 4L8SB 4KY1L 1E4XH 2Z92A 5EUOA 4AGOA 4XCCH 4APQC 2HG5A 4LLWB 1MQKH 1AP2A 4LPWA 2AGJH 4KH2A 4KUZL 1J86A 1U4EA 3HG3A 1TENA 3F04A 3C09C 3K80A 5CINL 2XPGB 3V4VH 5H4ZA 1YVLA 3CFKB 1YEHL 3QR2A 4LMQE 5AB1A 4JRXE 2NW2B 4KVCH 2IOIA 2A99A 2X0UA 3KPRE 2LGNA 4PJAB 1B0IA 1IGFL 3ZDZB 1M1XA 1Z1WA 3QIUD 3DV6A 1NBZA 2ED9A 2FJFB 3VFVA 3D1MC 3ARWA 5I9QB 4JFFE 3VXMB 3CIAA 1ETJA 5AZEH 3CSPA 2YLHA 3T08A 1JXJA 4OI9A 4OGXL 4JR9L 3KNBA 4AMKH 1KTLA 5IW1B 4WV1C 4PPTA 2EIMB 4A7SA 4ZMYA 4G6KL 1I1FB 4OI7A 4N8UA 5D1QB 4C83B 4OSUL 5EFIB 4ZOCA 3BP7A 4EI5D 3TBTA 2MQ0A 4IJ3B 4XCFL 1KPVB 3TCTA 1JUFB 2AV1A 1PCSA 2W81C 4MAUL 4MZIA 2ESVA 5T5NG 4RMRA 3SB3A 1RZJL 1JNLH 3FUEA 4OZGA 1LE9B 1XBRA 2AXFA 1S7QA 2OJZL 2Z31C 4PJBF 4M6ML 5C86A 1AACA 1J10A 2OW6A 3V9CA 4JFTA 3B56A 3C08L 4JO4H 2VSDA 3ZQWA 2H2SC 4JDEA 1KBPA 2JQAA 4UTAL 2KZKA 4JE4B 4UIMA 3WFHA 3K5RA 3BVUA 5D1XD 4GP4B 2MTAA 2DQDH 4LASL 5EOTA 5E2WH 4R2GD 3T0EA 1MIEL 4ABWA 4CVXA 1TQBC 3MNMA 4KJQD 4NP9A 4Y4KD 1EO7A 1YYML 2H8PA 2KUTA 3A6CH 1LP9E 4I18C 3GKWL 4BWTA 4WUKL 3GBEA 1G1OA 4QRTB 3RNQA 1LNUB 1TJHH 4TV3A 4ATTA 2CO3A 1KJ3L 3BQUA 2VZOA 4J3OF 4XB8A 5C07E 4UQ2A 3TLRA 2CUMA 4JZNB 5E5LA 5E2VH 2DY2A 3BAIA 3DXAE 1SVBA 1F5WA 3M8OL 3WLWD 2GG1A 5JOPD 2W0FA 1MREL 1KGIA 3HJEA 3OVUB 3QPXH 1QP1A 4YUEH 4AGMA 4NKIL 4PRHB 1DL7H 1IVLA 4OLXH 2KDYA 1E4KA 4I0PA 3VG0H 4NZRL 5LBGA 2AJSL 3N2JA 4XZUB 1Z9SB 4LF3A 1DQVA 4XVTH 3UG5A 1ZT1B 3GSWB 4GKOA 4TNWK 2GEQA 3HG1A 4A7VA 1OOWA 2DS4A 3GZQA 1UD3A 4I1RA 4NFDA 5KSUB 4PJEA 4JAMB 3FFCE 1AY1H 4QRUB 2AK4E 3CFCH 1TQSA 3VNYA 2FEEI 2CKBB 2F8VA 1PZUB 1YEGL 2XQYA 1PLBA 1P5VB 5GZOD 4QWWD 4EQ3A 1NGXB 3PWUB 2WIIA 4H44C 3SBWC 1DQQA 2XZCH 1USZA 3DUHA 3GMOB 3NESA 2JWYA 3KPMA 3E9UA 3QHTC 4FS0A 2W5PA 3UADA 3OBAA 3FUHA 2PW1A 1FYHB 3BSZL 5LLIC 3P40A 3KEDA 2PUQT 4NSKA 1D6EB 5AYTA 3CFDA 2IMNA 3GFUA 3WFBL 4OFDA 3EYFB 4JFQB 4FA8A 5KYXB 5FO9B 4LKCA 1DBKL 5BZWB 1B90A 1SUJA 4J2QA 4KTYA 1AMYA 2BMKA 1RLWA 3FH8A 2WP3O 1GIGH 3PQYB 2PCXA 3EBIA 3V6OE 3R06B 1ASPA 2R0ZH 5E9DD 5D7SL 4MQ7A 3I50H 4N2GA 1AD0B 4RFNB 1IAKA 1OWWA 4AL8C 3OJVC 2ZCHL 4PJBA 1T03H 1TUPA 2BIPA 2VDNH 3K0WA 3AADB 3CN1A 4G9FE 5GGVH 1LK2A 4UCFA 4WWOA 3MJ9H 4YXLL 5JIHA 3ULUL 5IV2A 5EV7A 1GGCL 2JTYA 5HI5C 5TDOA 1DQJB 4M48L 1N0XH 3MLTB 3QIBA 4BH7A 2E7MA 2VMEA 3BUBA 4MNQE 4AXWB 5M94B 5DHVH 3T9WA 1C1EH 2HA1A 4Q9RL 1A0QH 5EF0A 5IM7A 2VDRH 5EOCL 3FT2A 3UTTD 2VR8A 3PP3K 1CLZL 2IALB 2BY3A 2C5DC 1UZGA 4G8GB 1GRWA 4J7RA 3PPEA 4X6CE 3HE7A 1BSIA 4YJZL 2RIKA 4IRJA 3U2SA 3NIFF 5FYJL 1C16A 2HJKA 3VXRD 8FABB 2VZVA 4LT7A 4MJ4A 4K5MA 1FUNA 2BHUA 3C5ZA 2FBOJ 5MHSE 3UP1A 1T1XB 4H5SA 4FQXD 3SCMD 2GK2A 4CGTA 3MR9B 2VXQH 15C8H 1XF2B 4K94C 3GHPA 4HGMA 5I15L 3TGXA 1WEJL 2A9CA 1AC6A 1UENA 4AEIL 2UZIH 4M5TA 1GJWA 4UBDD 2CGRH 4BKLA 4XH2A 5M95B 2LU7A 4Y4HA 4E41A 2ZX9A 5JHMA 1RUQL 3NGBB 3CXFA 2PP8A 5DVNA 3N91A 1MG2C 5FV2A 1IQWH 1IFHH 2Q6WA 3RKDC 3H3BC 5IFAH 4NJAH 1S6NA 1AO7D 4M1CC 1GKOA 2AVFA 2UV3A 2YGVA 3ZUNC 1ZWIA 1BQKA 2PR4L 3WS3A 5BVJA 2W94A 5ELIA 2GJPA 1RZFL 1MLBA 4QNPF 3GI8L 3CDFA 1DBJL 3O11B 3C8DA 1AR2A 5IWLC 4WO4C 5B3NA 3DYOA 1CC3A 3AG4B 1XGYH 2Q7NA 4X5WA 3NFNB 3D69B 1XIWA 3WE1A 2D7NA 1KB5L 1HJBC 4KTEL 4D9QE 3EGXB 5C0AD 1MPAL 4W9GC 4IOSD 4WW1B 1XB3A 4P46C 1IKFH 3N85L 1ZHBB 3GBMH 3QUXA 2NY2C 4JVPA 3A4FA 3PWNA 4A7GF 5AW3B 1JZIA 3DBXA 4B9YA 6CGTA 2PCPA 1FBIH 4DEPB 3PDDA 1UZ6F 1VFOA 4XBEL 5CEZH 3WDJA 1WD9A 3CH1B 4AENB 1UKQA 1Z3GH 5ES4B 5J1AA 3HRZB 3MLXH 3O45B 2V2WB 1YQVL 4R90L 1DBBL 5IBTL 3BHBA 1PZ3A 3VXSE 3AROA 4YQXL 3UTSE 1A3QA 4PH8A 4BUHA 2JXMB 1AGEB 3V5KB 4X4XA 2Q3XA 4EDWL 5A2KH 1R46A 2YGPA 3GJEA 1EIBA 4HJ1A 4XOEA 1AH1A 2B59B 4PG9A 1MUJA 4H2AA 4MMXC 1JOIA 2PF6A 2R2HB 3FU8A 4BV1A 3SO5A 2YPVA 3DRTA 1XGTB 4G8IA 5EZLA 4NUJB 3MV8A 1SBSL 3AREC 2OK0L 1IKOP 3NCXA 1PJ9A 4XN9A 5FO2A 5GS0H 3OSKA 3KYMB 3FQXB 1F3JB 3OXRB 5ABDE 2ZG1A 4A2FA 2Z8WC 4OCRH 1JWSA 4WI0A 2YD1A 3QW9A 3ZE0F 3F7QA 3MRHB 4MNGA 4U1MB 5IGXL 3IDMA 4M9OA 1EBAA 3VXPB 3WXWL 2WVVA 2Y1VA 2P5ED 1J8RA 4ABUA 3DHJA 3EIFA 2IIJA 2DZEA 2HT2D 2QL1A 1AZCA 3BWUC 3OMZA 3TN0A 4NO5B 3GSNA 3V2AR 1I1AC 1FZKA 1QASA 1XSJA 3ZOAA 5JUEH 1S5IL 1E67A 3BT2H 1O7VA 3CLEL 3HJ0A 5K39B 2WINB 3O6KL 4HPOH 4GKSA 4P3DB 4WQOA 2R0WH 4TUKL 5FGBA 3ZKNC 2IAMA 3FO2B 2EKJA 3RZCA 1M6OB 2WLZA 2K7QA 3TV8A 4WWNA 3LRLA 5ICZA 3QUYA 5GRYA 1YC7A 3EO0B 1TIUA 4JZJB 3IDGB 5I18L 5E24E 2I9TB 5D7HA 1MVYA 1P2CA 1ZS2A 2BOCB 2YBRA 3BKCL 4PB0L 2Y06L 3FHQA 4N8CL 4B60A 3O6FC 1MJ8L 2IANE 3LVEA 3C5JA 5EU3B 3C6LC 3QUGA 4O5LL 4HWEL 4NIYE 4KKCD 1AGDB 1KN4H 4RAVB 5AAWA 4P5TC 3HHSB 3NN8B 3MRJA 2WLLA 2VDKB 4UOW0 3GLAA 1A4BA 5GJTL 4P5SA 2EEAA 1XFPA 3II3A 1H3UA 3EYVB 3VO0A 1BF5A 4R0LB 4PTUB 1UM5L 3VFUA 4AK1A 3VGEA 3ML8A 1CFBA 3NPZB 4ONFL 2AABH 4W9CC 3WTWA 1A7RL 3PJSA 2COQA 4A7GA 5KBPA 2D3NA 2IGLA 3P3UA 3SYCA 4XBGA 5ANHA 3LKRA 2C3VA 1QR1A 1T1YA 4I2XE 3IGAA 5JMRA 1VFMA 2KLTA 3RX7A 3FAXA 4XP4L 3DI2B 2FBRA 3L6FA 5ESAB 2DWSA 2GEEA 1DQTA 4N2EA 4Z7UF 2X6UA 1Q94B 4GSDH 5E8NB 3S96B 5KYWA 3F7YA 1IAIH 2RD0A 4FP8L 4FCHA 4Y2DB 3LRKA 1JGVL 4Y2NA 3QYMA 4MS8D 1YMHA 2GUOA 2CLVB 4MB4A 5ISZE 2Y36L 2Z7ZA 4XN5A 2W9DH 4IGBC 3SPVA 4BBWA 2Z1KA 2TRHA 4HGKC 1RQ5A 1A4JB 4N28A 5IJCC 3TURA 3ARYA 3RB5A 2UUDK 3V0IA 1Z32X 1D9KB 5K9OB 4FD0A 2WKLA 4XXCA 3UAEA 4ZTPH 1KYFA 4ABVA 1DQDL 2UVFA 4OD1L 2XNAB 1JSYA 4WU5B 4JO1H 2NY1D 3WKQA 4P5KA 3NG5A 4A6YA 3Q1EA 5DZVA 5AUMA 1N18A 4B97A 5FYLL 1NBYA 1DCLA 4YSAA 4XWOC 5B1JC 3OKKA 4X0NA 5AVTB 1RZPA 3CSYB 4J8QA 4A39A 4PW9A 4C4KO 4JRXA 4CRPA 1T6WA 4UM8B 4AMWA 4WFHE 2ZG3A 4LCUA 2OSLA 1SY6L 4XCNA 1KJ2A 4N5ED 2H0FA 4CILA 3NA9H 4XMUA 1NUFA 1D2OA 4G6FB 2VL5B 3IFOA 3VXUB 5B7EA 5E4EB 1ZEAH 2OR7A 2VR6A 4YZFE 1KNOB 5JA9A 2LAAA 5H37A 1FG2B 5DK0A 4L18A 4LE8A 3DURA 4HUVB 1Y0LA 4XP1H 3K71A 3LHAA 1DUYA 3X1NA 1NOFA 3QEHB 4PI0A 3ZY7A 4XN8A 2AMGA 3VJ6A 2G5RA 2WO3B 1NLDL 4LLDA 1NEZG 3AU1A 1NFAA 4FLHA 3FL7A 2HAZA 3H3PL 4LSSH 4PJ8C 1KBWA 2YGOA 3MXWL 2FGWL 4QCIB 1GS8A 1I8KB 4AOFA 1BQ5A 5JHLA 4PI2A 4MAZA 5D1QC 2O5ZL 3MOQA 4ZI8A 4YDLC 1CFTB 3D39A 3UX9B 2CIKB 2PCFA 4R8WL 1ZS8A 5F44A 3ZE2B 4XXWC 2K4AA 3CAFA 4J1UB 2BSCA 3RTQD 3FYIB 2Q7AA 4HH8A 1JNHA 1X7SA 4NPJA 1CICD 2JIXA 2VUYA 3EFDL 3PHOB 4Z7UA 1LP9A 5FCSH 2NDFA 3D0LA 3SDCA 5I1LA 5EC2B 1FZOA 2WV3A 1A02N 2RGSA 4JY4B 4UQCA 4YVNA 3ZTNL 4BUQA 4FNRA 4XHJD 1KUMA 1BZ8A 3L2NA 2RJMA 4TVPE 2BVQA 5HYJD 4YDIL 1OWRM 4EIZC 1PLGL 1G0DA 3SDXB 2A6KA 1EWHA 4OZ4B 1I7TB 3RDTD 3X3GH 5AW6B 4QHLA 2NZ1A 1X7TA 3F7PC 1LGVA 5B1KA 4K3HA 3T3PB 1A6AB 5DRNB 5IZ7A 2KYIA 3H7BA 3HE6B 3V0AC 4HHGA 2VE6A 4FHBD 5MEOB 4PJDE 2EDRA 3L9RB 2EDYA 4AY0A 3ZX1A 3RVXC 4BSJA 2AFNA 1A4KA 2OMUB 4CADA 4L05A 1P1VA 2NTFA 3GQFA 1TLMA 3ZE1B 3U46A 4MD0B 2DQTL 1DVZA 3NJIA 4JHVA 3B8YA 1P4IH 1ZVHA 4F7EB 4ZS6D 4N2CA 2WANA 2X7LB 4R7NA 4P4KC 3SDYH 1ZXKA 4LKXA 4IRZH 2C1PB 1BOYA 2R56L 4YR6A 2BVUA 2B16A 2J8HA 1JWUA 4FTVB 4U3XA 1VKXA 1WISA 1E4XL 3STZB 4XNMB 4XTRC 4XCCL 3HVNA 5JHAA 1KLUA 4TLKA 4LCWB 1BF8A 1MQKL 3T6VA 1A25A 3FFOA 1G6RA 2AGJL 4OUUB 4XMPH 4YHLH 2EO7A 3V4VL 3RPIB 2Z0BA 1KGUA 2V3EA 4X6EB 5BZZA 1A7NH 3JZYA 3FFDB 2X9XA 4Y16B 4I48A 2AV7B 5A2AA 3UL4A 1J9QA 2TAAA 3ORJA 4KVCL 3N41F 1G5AA 1MJUH 1Q4NX 4OLZH 4QT5B 2ID5A 3BO8A 3VI4A 2OMXA 3T0DA 4PV1C 3ULVC 1TKWB 4DUVA 4HW6A 2F7IA 1A65A 1K4DA 2J3SA 3H8NA 4MMYA 5AZEL 4E68A 1IC0A 1XF3A 2VSKB 3GTNA 1BAWA 1WFJA 4PMEA 5EU7C 1PW3A 2E9JA 5DD1H 4AMKL 1M7IA 5KTEH 1K4CA 5JZ7D 4XXDB 1SFHA 5FIEA 3VSUA 5SWSA 2JK5B 3RUGF 2ALWA 5ITFA 1LE5A 1HDMA 3P4LA 4LLQB 3VYPA 4Z7QB 1N0LA 2PN5A 5EH1A 1WAAF 3WUWA 4Z3FA 4GO9A 3VFPB 1JNLL 1IIKA 1QBMH 2VZSA 3FXIC 4EZLA 4ZNEE 3KGSA 4AW7A 5EO0B 1A5FH 4JO4L 2EEXA 3TA4D 1W0VA 4M4RB 2GJ6E 4HUUA 5H4YA 4NO0A 3S5YA 5I1GH 3QNXA 5L6YH 2GBAA 5E8OB 2DQDL 2OKMA 5E2WL 4JK0D 1YEKH 3GXMA 5KJRH 2J57A 4IBYA 4PJIB 1NBQA 4IS6A 1Z6JT 4WFGE 3V8CA 4M8VA 3GINA 4L3EE 5MEQB 2FBJH 3A6CL 3ZKXB 3KDPB 4KRPB 3UGUA 2DWDA 4HSAC 3V7AG 3SY6A 4KO5A 1TJHL 3N3EA 4Y19E 3K4ZA 3RI5K 3VCLB 1EBPA 3DX2A 3GXUB 3KXFA 1F42A 4L3AA 1T5XB 4PGZA 1DEEA 1SF5A 3GNMH 4GFXA 4JRYA 5E2VL 3GYRA 2WQUA 2OTUA 3X13B 1RUMH 4OJFH 3DX8A 4QKXB 3HZYB 1CDIA 4LSTH 5HHMB 3QPXL 2Q1EA 4RNRB 4YUEL 2BOBA 1DL7L 3DI3B 4OLXL 3UEQA 1T1WB 3VG0L 1NCAH 3QXAB 2OW7A 1PDKA 3O3EB 4WGWB 5JO5A 1FO0B 3AUWB 2KS0A 2I7OA 5E8EB 5TQ2H 2NUPA 5CJXA 4XVTL 2QBWA 5EOCJ 3AS0A 4YAQA 4GG6F 1G7HA 2FNWA 3IKKA 3WJJC 5K9KB 2NYKA 1OO2A 2JJSC 1AY1L 4JJ5A 2L7EA 2V6HA 4DFHA 3CFCL 5HYSG 4X7CC 4PJ9C 3QI9A 1N59B 5FLVA 5AW2B 5DO8A 5KJ4A 5ILTH 3V0VB 1N4XH 4KKNA 5I30H 3EJYC 5C0CD 3NZUA 2XZCL 4U1IA 5CSGA 1GTFA 5BV7B 1PX3A 1KJVB 4JZOB 1J0ZA 3ASNB 3ILPB 3AG2B 1IUZA 3FU7B 2HSIA 5E95B 3B2VH 1F2QA 5F6IC 4EI6B 1WT5A 2W80C 1MNUH 1U93B 2XKSA 3EYUH 1T3FB 4GY4A 3X2QB 4P2RD 5CM1A 1WUZA 2BNQE 4QXWA 4YSPA 4OV5A 2Y1YA 2VLJA 3ROLB 3RUGA 4DEPC 5BS0D 3VWJC 2ENSA 4L4TA 1U8QA 1GIGL 3O81A 5E00B 1Z3RA 4PJCB 1MF2H 1WAAA 2R0ZL 3GBLA 3J2PA 3I50L 2UZXB 4DT2A 1H0DA 2HWZH 4NHUB 1O5PA 5CGYC 1PGRB 1GZHA 1T03L 1EV2E 3GXTA 3RHWF 1GYWA 2VDNL 2ENYA 5GGVL 3MJ9L 4LDCA 2XV0A 4YO0A 2YLKA 1N0XL 3L1EA 1NMBH 4Q4IA 4K5LA 3QIUC 4AEEA 2D2CC 1UURA 1W91A 1BZ9B 1C1EL 2PYEA 1L9SA 3EOBA 4KQ4H 1A0QL 4W9JC 2VDRL 4N2IA 3O2DA 3MLYH 3C75A 4Z7OF 1PQZB 4OAWB 5PAZA 2Z4TA 2WNGA 3WFEH 2J71A 4PGBB 2XYBA 1OCOB 4BFGA 5MEND 3SGKC 1Y1DA 1QHOA 3TL5A 1AS7A 3MBEB 4A67A 5FS5A 3FRUA 1F90H 4CW1B 3IKCB 2GFBB 3JSSA 3QDJB 5F0MB 2ADFH 2J5WA 1YPZE 2B3RA 3MCG1 4KRLB 5KUKA 4L48A 2J5LB 2VXQL 15C8L 4BFOA 4HV8B 1QUNB 2CWRA 3JUZA 2JKWA 3MLRH 1HESA 2R1XB 2UZIL 4IIZA 2CGRL 3DUUB 3KS0J 3UOAB 2H3NA 1U92B 4GG6A 2K8QA 4Z3TA 5IMLB 3QJFB 4W4OC 1KGYE 4LGPB 2UVEA 3PWVB 2XPZA 4KJQC 1IQWL 4AIZB 2QZQA 4Y4KC 4BZ2A 2Y72A 1IFHL 2QVIA 5A2BA 4ZW5A 2X88A 3KLQA 5D5MF 5IFAL 4NJAL 3QHFH 4X4YA 5IB3B 3ZHKA 2PNDA 1BOGB 3F2LA 4ZUUB 4RWHA 3LZPA 2X4UB 4NI3A 3PHSA 4P9HC 3LH8A 5CLTA 3MO1A 2MOQA 3BH9A 4ZUVA 4L37B 3QNYA 1AYOA 1XGYL 5D1QE 4PY7B 5IJVB 3QPQD 4IKLA 4WI5A 3BP5B 1N19A 1MW3A 3LNIA 1OHZA 1YEDA 2AXWA 2BVPB 2HVKA 1VFAB 3NCMA 1LO0H 1XDTT 3T1FB 4QPEA 3C60D 3C5XA 1IKFL 3WSQH 1K5NA 3GBML 4L8CB 1PJWA 3Q0HA 4BCYA 3EZJB 1S9WB 4BQBA 5H94B 1FBIL 1ID5I 1KPUB 1VGKA 4HOWA 5DJ0B 4N2FA 1S9VA 5CEZL 2YFOA 2D7MA 5CSZA 4J23A 3HAEG 5C2BH 1DTUA 1Z3GL 5GZOC 4YDZA 3HI6H 3H54A 4QWWC 3MLXL 5C7ZA 3N0PB 1H8LA 4Y2DC 1UXSA 3O0RH 4YDVB 5BO0D 2YXFA 4HOMA 5KS9E 3OKLB 2DL2A 5F7DB 5GGTA 2BZDA 4I7ZC 4WI3A 5GQBA 2Y5TA 1U91A 4OF3A 3FTYA 3E6HB 1ZVSA 1J0KA 1U2HA 1URZA 4BKTC 5BOJA 1TQVA 4KO9A 3FT4A 4HU2A 2YSTA 4RWYH 4L3CA 2JKLA 3K8MA 4JPIA 5GS0L 5LGKA 4GAGH 3WHE1 4TPRH 3QJHA 4PJXF 3SJVE 3BOVA 5HJGA 4PRHE 4OCRL 5BRZD 1D5MB 1GKEA 2YS4A 4NQEE 4M8UA 2ZWYA 1MN4A 1OB0A 3KLDA 1L4IA 4RFOH 2CJUH 1XZ0B 4L9LB 1BXVA 1H15A 1PNCA 2F8IA 2XV6B 2XWJA 3EJZC 5DD6B 4MTMA 3O3BA 1CXLA 3SBWA 4Q74A 4NFBA 3RWCB 1EGJH 3MV7E 2AITA 3KHQA 3T0XA 4PRID 2E7HA 2LQRA 5JUEL 4E5XA 3BT2L 1YO4A 1JZJA 5E6UB 2H0PA 4HPOL 2XWZA 3L4XA 2R0WL 2ZP9A 3GMNB 1YC8A 3LN4B 5DJ2B 2IO5A 4PW4A 1NMCB 3QULB 4ORZC 3BGAA 5D5MA 4PJ7F 4V11A 3ILEA 3W37A 1TT6A 1EHNA 4ZNCD 1BV8A 3AJ7A 2WBJB 3OKDB 4PGDB 2C9XA 1ZJAA 4ETQA 5A2IH 5DS8B 3ARPA 4IEFA 4HKZA 4OZIB 2IDTA 5I1KH 3CCHB 3FDWA 4R96B 3QZNA 1KN4L 3ULVE 4YHPB 2NY5H 5D1ZD 4IRSB 4GO8A 3VGBA 1PKQB 5B21A 2FRGP 3D2UD 3NSDA 1TZ8A 3PQYE 3VM5A 5I24A 4H8WC 2J72A 5DURD 3D07A 2AABL 4D9RD 2FJHB 1R3JB 3DROB 3QORD 2WZPA 3WU1A 2BH0A 4NPYB 2XVKA 5DJ8B 3TWYA 3WL9A 1EZVX 1MFVA 4EZJA 4Z78A 4NKDA 5DJCB 1YMMA 2DD8H 5G5DB 3QA3A 3W0WD 3GXIA 3ZMRA 3QP3A 4Z0BH 2NY6D 1SNRA 5C09E 3VXNA 4OB5H 4JNXA 1U95A 5DVLA 1DVUA 4TVPH 4YHIB 3WMPA 4LVNB 2CBTA 4GAFB 1CK0H 1B4JH 4GSDL 1EUUA 43C9B 3DGCR 1IAIL 2E47A 2UXFA 1JCVA 3EKCA 3ZYJA 4G42A 3WNOA 4DSYA 4YSUA 2NXZB 4FJZA 5I17A 1IFGA 4M5SA 1F1DA 1L9RA 4RRPA 3PFQA 5C0JA 2PCYA 1GTNA 4TTDD 2ICWB 2W9DL 3BP6A 2XDHA 1UVQB 4PJXA 1RJLB 4IK6A 5LNGA 1YY9D 3O6MH 4ZXBB 2CO1A 1G94A 3OPZH 1FVDA 1I8MB 3MFFB 1DVQA 3H0TB 3CDCA 2RQEA 3MRPB 3QH3B 1JHTB 5EMYA 1QW9A 4YWGH 2OZ4H 3ZT6A 4PY8J 4JHUA 1JTPA 4K94H 4GW4B 4ZTPL 4EDXA 5KUMA 3VD9A 4DK6A 4C56B 2DKMA 3DYPA 2Y2YA 4ONHA 3BVNA 1A1OB 4R97B 4A66A 3QZPA 4JO1L 5F9DC 3GEWB 5JDSB 5DMJB 2BNRA 1TJGH 1N7MH 4V33A 5BNXD 4WO4A 4AI7A 3WIHH 5HHXH 2CZNA 5F9WB 3FBKA 4PJ7A 4BSVB 4WF7A 1QFHA 2I9LB 4NKOA 5EN2A 2ZP8A 1FZJA 3NA9L 5F3FA 3UTQA 4YK4B 1R47A 3ILQC 5INDB 3AWGA 4KXBA 5I73B 3QUZB 4PW3A 1XGUB 4HFWB 1YUHB 4P46A 1ZEAL 4AW4A 1BVZA 4F2EA 3FN0H 1RZGB 4GAYA 2DL9A 5HPMA 4RGMC 4H1LA 3ARFD 5L2KB 3QEQE 4NKMA 2ZD0A 1ZRUA 1DO5A 1PAZA 4XP1L 4ZFZA 3BZFA 3QZBA 3UYRH 1UJTA 3HFMH 5DJYA 4EJ1C 3L4YA 5SWZB 1BVNP 4JM2B 5DZJA 1PG7X 1U30A 4BUGA 2WNXA 2HT2C 3VD4A 4LSSL 4U6XA 4N3TA 3B9KA 1N6UA 4MDIA 4F9LC 3U0PB 4ZNEA 3TH3T 5DQ9A 3VXQA 3F58H 4HJGA 3GSVA 1DDTA 5T5FA 1NC4A 2W60B 3CXHJ 1RAMA 2PPCA 1EZLA 4F7PB 3VA6A 2CE6A 4MMXA 3PWPA 3ATDA 2H41A 4MDJB 4TQIA 2LW3A 2AC0A 4FQIH 3UO8B 2JJTA 1NCDH 4GLRH 1W8NA 2UWEB 4YHYB 3GBNH 1WE5A 4R5XA 3SQOH 5FA3B 1X5AA 1UXWA 2EICA 3L1FA 1SN5A 1KBKA 1GOFA 2E6JA 5T5FH 4ZMVA 3O2WH 1OD7A 1YNKH 4BKSC 5EZIH 5GXBB 3MGOA 3VG9C 4KKCC 4Y19A 1DSYA 1AJ7H 2DYPB 5D1ZI 4J2XA 4GPVA 4WTZG 3FHAA 4XMVA 3L3OB 3MV9D 5CP3H 1PY0A 5E8PA 3X3GL 1O5DT 3FPYA 2OXGB 5CZXC 2WN2A 3EF4A 4MAYD 3QUMA 1PLAA 3K81A 4NPKA 4XMTA 2SEBB 1DN0B 1NL0H 3UZQA 2H1XA 5I6OA 2ZKWA 4ODTH 1CD8A 4Q14A 4Z18A 1S7XB 4FFZH 1CDBA 3PABA 5FHBH 4B0MB 5G4NA 1KGJA 3CVHB 1NEUA 1VADA 2HFEB 3EO1A 3LX9A 4U1JA 4ADGA 2CRIA 5D4QA 2WY3B 3BZDA 3P2DA 1P4IL 5FKAA 5SWQA 3I3DA 5T1KD 4J5VA 3BKJH 3QWQB 1GYCA 4PJAF 1NC2A 5D1XE 3ZDZF 1Q90A 2GCYB 4FYQA 3SDYL 5EZOH 1U3NA 4IRZL 5I1IH 4GMTH 3VRJB 1HYSD 2EDOA 3JTBA 4JJHA 4MS8C 5BRPA 4B9JA 4I3RH 2AW2A 4PBXA 3B2DC 1DE4A 2IH3B 2GIXA 4TLTA 4XMPL 2PXYA 4YHLL 4ZMLA 2I32A 1AC0A 1A7NL 3NSFA 4U4IA 4IBQA 4PJ5A 1HHJB 5BV7C 4NLHA 4XMKH 4JFPB 4KI5D 3UYPB 1OGAE 1F3RB 2R23B 3MRRB 3Q9QA 5D7LB 4OLZL 1MJUL 1XL4A 4FEMA 2VB5A 4HKBB 1KGCD 1QVOB 4HGWA 5DO2D 3ZTJH 4CMHB 4DPRA 1EXGA 2NY1C 2FX7H 4DESA 3J7HA 2A77H 3CHSA 1UXMA 3P0VH 3II2A 4PLJD 3K2KA 4UT6H 1E9PB 5DD1L 2FIKA 1NFKA 2Y7LA 2VLKD 5KTEL 3STLB 1OQOA 4N5EC 4HAFA 3ES6A 3P9LA 1SHMA 4AKQA 1YLBB 2OMZA 3GSXB 3IWVA 3L81A 4LLUB 4R26H 3CZUB 1NIAA 5JORA 2V5SA 5I8EB 2VRQA 2EUWA 3DPBA 3MV01 5I76B 2Z1PA 1QBML 2TSAA 4E9LA 2F7PA 3GS4A 2IQ9H 2FB4H 1R3HA 1XVSA 4V1DA 3HNVH 4HC1A 1A5FL 2YWYA 4ZS7H 1M56B 5L6YL 5I1GL 4WCYH 2E9BA 2BPBA 3CVCA 5CGMA 2FJUB 5B1JA 4ZX3A 1Y1UA 1YEKL 2BXZA 5HGBB 4JCWA 5KJRL 1JZ8A 1EXUB 1KEMH 3TNNB 1S8DB 3Q7JA 4HD9A 2YWZA 4GUQA 4L8SA 1UD5A 1J05B 3SYPA 1SUHA 3QO0B 5L88H 2FBJL 1T7YA 2WKOF 3BI9X 3MRBB 5E9DE 4C57C 4LLWA 5IVXB 1G9MC 3ML9A 1JYXA 3VH8B 1RZKH 2XPGA 3QDMB 3CFKA 3QJSB 5IESH 1G0YR 3GNML 1UFGA 1IGIH 4YLBA 4P3CH 2J5LC 2NW2A 3RTQC 1KMGA 3DJ9A 1RUML 4OJFL 4PJAA 1LLAA 4LSTL 4F8TA 2ENQA 3B5TA 4B7LA 2R9HD 2FJFA 4PWEA 1EDYA 3VXTB 4XHJC 3MLWH 3B9AA 1NH6A 1NCGA 1XEDA 3BAYA 4MX7B 4S2SB 5AWNH 3VXMA 1SHXA 1F11B 1NCAL 1OCZB 1SOXA 2NY3D 4L9DA 5D7JD 3KHOA 3NJHA 3S3SA 3QFJD 3UTTE 1FZMB 4Q6KA 3BGMB 4YSRA 1L7TH 1KIRA 2V3DA 2XIDA 4HKJB 5ALCH 1FIGH 1AS6A 5TQ2L 1D5ZB 4IBVA 5IW1A 2PTVA 4BGDA 1BQSA 3L4VA 2XXCB 2JB6B 1I1FA 3P4MB 4PS7A 3TBYB 3C9NB 5D1QA 4FA7B 2MIZA 2XWCA 3P69A 2EH8H 4OVVA 5EFIA 3AGVA 1KPVA 1JUFA 1V3JA 2AQ2A 1V7MH 3KPSB 4W6YB 4XMWA 4A2DA 5J6HB 4KNUA 1CGTA 2F1BA 5ILTL 1N4XL 3GRWA 3IN2A 5I30L 3CFQA 4GFTB 1LE9A 2OMVB 3Q8FA 3QJXA 4MMZC 2WKGA 4GQPH 2QSVA 5HGAB 2DF3A 1TNNA 5E4IA 2DRUA 4ZS6C 2E4TA 3B2VL 4QOKD 1RURH 3ZBMA 1CD1B 1MNUL 5FKPB 3EYUL 5IVNA 3DYMA 3VFMB 1A6TA 2QPSA 5E1IA 1P7QB 5DJXB 2PWDA 3GRWH 1MCJA 1W6LA 3HR5B 4ZAKB 3OHXB 3P2BA 3GRBA 2NXYD 4XE5B 4M00A 4QRTA 2WB1A 1LNUA 4M8RA 1AO7E 4A63A 1SVZA 4UNUA 4W9LC 25C8H 1MF2L 4JHWH 2EDWA 2O5XH 3TO4B 4WGKA 2HWZL 5ID1A 4CC1A 5AVUB 4Y9CA 1FRGH 2ENJA 2FSEA 3GSQA 3NEOA 1JZFA 1GJIA 3D3VB 3FU5A 3O9WD 1JIBA 1GA2A 2P8PB 4X4ME 5T3XD 4PRHA 1NMBL 3MZGB 3NFSH 3GMRB 5E1HB 2EDNA 1X5XA 3X14B 5C8JB 2OM5A 1UM6H 3IB4A 4KQ4L 5HGGS 5C0AE 5KG9B 4XN7A 1KIPB 3U6RB 2WKOA 4KI5F 3QPKA 3MLYL 1Z9SA 2E46A 1ZT1A 3GSWA 1NMAH 5E94B 5KSUA 3WFEL 5JZ7C 4NZUH 3OGCB 4IOIB 4JAMA 3UDWA 2XJLA 4QRUA 1IIIA 3C8KB 3ECBB 2CKBA 3ESOA 2R27A 4LVHB 5I23A 3QWOB 2CR6A 1P5VA 2RA1A 4L9LC 2G2PA 2P52A 3QUHA 1F90L 1NGXA 3FQ4A 2GABA 3PWUA 2HLAB 4LNVA 3UXFA 4BQCA 2A6IA 2ADFL 4LCYB 2H6UA 3US0A 4NGHH 5DYFA 5AG9A 3GMOA 1AZVA 3D2TA 3LZQA 4DEWA 3WJLA 3VWKB 2IPUK 3ZDYB 4NRZB 1Z0NA 5I66B 3MLRL 3ATFA 4GG8B 1NMCC 1HVXA 4NN7C 4WEBH 1ZGLB 2APVA 4TSBH 3HUJB 1D6EA 4OBSA 4AC4A 2J6EA 2J1YA 3EYFA 4JFEB 4JFQA 5D72H 5KYXA 5FO9A 1D7CA 1FA4A 1BD2B 4KKLD 3GJFA 1WCBB 1D6VH 3UCRA 3PQYA 1OCCB 1H9DA 3E8VA 3R06A 5A6MA 1SLWA 2ENPA 2NY0B 2KI6A 1AD0A 1IBZA 5B3JE 2V9QA 4YSOA 4BHUI 4F92B 4Q9CA 1GSKA 3S3JA 2P5EE 2P44B 3ULVH 3R4RA 2EDFA 4U6VH 3SDDD 4G6AC 5FFOA 1DQJA 4YHZH 3GJFH 2D31B 3LRGA 3L4ZA 3MLTA 3L2MA 4AXWA 1C5CH 5D9SB 4KX9A 3DC0A 3WTSA 5C09A 3MGTA 3S3PA 1LO0L 1TVDA 3FU3A 1TR7A 3CQFA 3WIIH 1R24B 2IALA 4WZ9A 2VDQH 3WSQL 1FAKT 2G4EA 3P3YA 3DSFH 4G8GA 2ZOTA 4JFDB 1PSKH 1PZSA 3MC0A 2BCKB 1J12A 3UFIA 2EUVA 3S37H 8FABA 4N8VB 2OXHA 5KW9H 4M3HA 1BZOA 4LVNC 5C2BL 4XAKD 4PM1A 3HI6L 1T1XA 3HG2A 4TTGA 3MR9A 3G04B 3O0RL 3HC3H 1Z9LA 3HB3D 1XF2A 4X50A 1K8IB 2BX5A 3QIWB 5DEGB 3O2VH 4HZAA 2BW4A 1VERA 1ZMYA 3VGAB 3LH2H 1C08B 2DI7A 5ENWB 4AQ1B 4BDVB 3FQNB 1PS3A 4RWYL 3QDHA 2FVNA 4GAGL 1F56A 1JV2B 4TPRL 2NLJB 1J48A 1NGZB 2F1EA 1FL5A 2XOTA 2BP0B 4PUBH 1C8PA 1FL6B 2PPEA 3WNIA 2IH8A 1IE5A 1ZT4B 4U1NB 3B7YA 4V2CB 1MCWM 3MNDA 3M07A 4NM8H 4RFOL 3O11A 2CJUL 4OCWH 1JZDC 2DYRB 3D08A 1GGYA 4IJTA 1I7ZB 1UOVA 2NT1A 5F9WC 4Z7NE 4CU7A 1LQSR 4YDKH 1EGJL 1JV5B 3HRPA 3FUFA 3NFNA 3QO1B 1NINA 1QSEB 4HCRA 5K1JA 4YFEA 3WELA 3L3HB 2JKJA 3EGXA 3ZIYA 1EFXD 1UWGH 2X3AA 4WW1A 3X1FA 4J8RB 4WNSA 1ZHBA 5DI8B 1AHWB 1S7UB 1OW0A 3ABMB 1JYWA 1B6UA 1X7QB 5JMOC 3CZKA 5DHDA 4QRPD 1VEOA 3G7TA 1H6UA 3SY0B 3CH1A 3FO0H 3F00A 5JOEA 4AENA 3S8WA 4MXQD 5K1NA 5E6ID 1SN2A 5KJ7E 3STBA 5I1KL 3HRZA 3O45A 2V2WA 1KTRL 2FO1A 2QV2A 6FABH 2Y7OA 2NY5L 3G6JE 4LNRB 4Z7VB 3OKOB 4BHUA 1FWXA 3ZT7A 4U3SA 4UQ3B 2JXMA 1AGEA 4XNXH 3V5KA 3DARA 4HJIA 2WLJA 2CK0H 2R29A 2DLHA 1IFRA 2B59A 4KXCA 2N0MA 3V4LA 3MPCA 2R2HA 4DKFH 3S36H 1XGTA 2OYMA 4M56A 4NUJA 5E6SB 3BIKB 3U1QA 2DD8L 2F7QA 3KYMA 2AF2A 3FQXA 2WLMA 1F3JA 3OXRA 4FFWC 4UNTA 1Q0YH 3N50A 1QO3B 2JKIS 4Z0BL 2R29H 3MRHA 3M1OA 1KB5B 4U1MA 4BWUA 4CVZB 3VXPA 4OB5L 3L3OC 1TCMA 4TVPL 3G5ZB 2YQ2A 2ZUTA 1CK0L 1B4JL 2C9AA 2X41A 1DR9A 4NO5A 4HOXA 4O2CB 4YSEA 3BUQA 4LEBA 5K39A 3FC8A 2WINA 2I07B 4P3DA 1HTYA 2ERJC 2LU4A 3QPQC 2F53B 3FO2A 3L1GA 2M83A 4TSAH 3H9SD 3NRFA 3FOMB 4XZ4A 1JZ2A 3EO0A 3M7OA 1RHFA 1ILSA 3O6ML 3OPZL 4JZJA 4RA3A 2I9TA 1HZLA 2X6CA 3QJTB 5AOLA 4KO6A 3LRSB 3TIEB 2BOCA 5KBLA 4YWGL 2OZ4L 2YAOA 4K94L 5C2UB 1PU0A 5EU3A 4EXPX 3WNJA 5BUPA 4LOUD 1T22B 3L5HA 3K72A 4RAVA 1AGDA 4BK5C 1GGIH 3BAKA 3HHSA 3NN8A 5HYJE 2GPZA 2XVBA 2Z0UA 2V7NB 2YC1B 2AJXH 3DETD 1ECZA 5D7IB 1IKNA 1J8HB 4F80A 4R4NC 4POYA 1TJGL 1HWHB 1N7ML 4RDBA 3WNMA 3EYVA 4R0LA 4PTUA 3WS6A 4PJFE 3WIHL 5HHXL 2R0KH 3FQWB 2BO0A 4OD3H 5CP7B 1JHKH 5IVOA 5DZNA 3P3SA 3PDGA 3HZ3A 5HHNB 4WTQA 4OJAA 3NDZE 3CJJA 4X8XA 2P24A 1F00I 2HJFB 3ZE2F 2VKWA 3C2AH 3FN0L 2N7BA 3SKOB 5DLLA 2DM2A 5FM5O 2B2XH 2XX0A 3EBGA 1T0NB 2IQAB 5A2LH 2AEWA 2R0LH 3VI3E 5ESAA 3SE9H 5DWPA 3I3EA 3S35H 4B9KC 3UYRL 3HFML 1DSFH 1Q94A 1F4WH 5E8NA 3S96A 4MQTB 4X5QA 1M05B 3PL6D 5FXCH 5JIQA 1CFNB 1KOAA 4A7TA 4Y2DA 4BCXA 4CL7A 1TVHB 3DJTA 3INUH 2C4FT 3F58L 1ONQB 5CLXA 3L08A 3SDXF 4DWHA 3JWNG 1ZLUH 3MDJA 1XV8A 3CFBB 2H1LM 1A4JA 3MUHL 1J18A 3IMTA 3U30C 1SJMA 3T3PF 4FQIL 3GMPB 4N0UB 1GC1C 1KCWA 1NCDL 5JIKA 3UMNA 1D9KA 3GBNL 4AVIA 5K9OA 4NYLA 3SKMB 3SQOL 4IW4C 4JRFA 1G9NC 5E9NA 4N4YB 4P2CG 1ZLSH 1UT1A 2WB7A 5F9JB 3MBXH 3O2WL 2XNAA 1YNKL 4WU5A 5EZIL 5IROC 3VFRA 4F7MB 2GB2A 1UCTA 2QLYA 1AJ7L 3GT6A 4WUUD 3IF1B 2Q3ZA 1L0PA 1CLOH 3CSYA 3BVWA 4MZ3A 5TDPB 4I89A 4K4KA 3S2AA 4YLQT 4UM8A 4HHWA 1OTTC 4ANVA 4PV8B 1QRNB 3MUZ1 2W91A 2WQ8A 3Q3GB 3IDYB 1J5CA 1YNLH 4ZMPA 4M61B 3MUY1 2VL5A 1NL0L 5FF6B 3VXUA 1QSFB 2F6AA 5ANME 4ODTL 1AG6A 2X4PB 1KNOA 1V05A 4FFZL 3PXHA 4FJYA 2KERA 1FG2A 5FHBL 2H32B 3WUZA 3GMLB 3PY9A 5FGCB 3MMEB 4GRWB 4Q8BA 1GHFH 5D2NB 1A8ZA 1CFMA 3UAJD 3QEHA 2K6YA 4DFIA 3FCTB 1ADQH 4WW2B 1ZLVH 1EEQA 3BKJL 4ACPA 2JQZA 1BQHB 1U3YA 5EZOL 5F70A 1QMUA 5I1IL 3L5WA 4GMTL 5LDSA 4ZPVB 3SGJC 4Y5YB 2H2PD 2QQNH 1SXCA 4FMVA 3G5XA 4ELME 5JQIB 3IK2A 2CIKA 1ZJBA 5C08B 4TTDC 1CZ8H 2NX5B 1IAOB 3EJUA 4JGMA 1JK8B 4I3RL 4POZD 2ZOUA 3IS0X 3RWJB 3UAAA 5CCHE 2Z65C 4J1UA 3HS0B 2EIKB 1IGCH 4FMKA 3T2NH 1NDTA 3PXJA 4EUPB 2E9IA 2VZ3A 4XMKL 2VMFA 5JNYB 1N64H 5EC2A 1UC6A 1K3IA 4Z7QF 4JY4A 2Q9OA 4H8WH 3MNVB 4NQUA 1PFCA 2BVTA 2V9RA 3SIKA 1XX9C 3E1ZA 4X5XA 5AW8B 3GC3A 1V5JA 2FX7L 1Z5LA 2CRZA 1KCKA 1T66D 5IBLD 3SDXA 3QB7C 2YD4A 4OZ4A 2A77L 1I7TA 1JD9A 4HJSA 5EIIB 3P0VL 5IB5B 4F15B 3OHXC 5B38G 2QKIB 3GUTB 3W2DH 4UT6L 2DMCA 3QWRA 5EU6D 1A6AA 5DRNA 4OFYA 3TO4C 5ADOH 2VDMH 3MNZB 4PJIF 3HE6A 5FO8B 5D6CB 2OTPA 2YRBA 3DMMC 5C0ND 4R26L 2FE0A 2X1PA 4F2MB 2CA4A 3L9RA 1ZLWK 1JZ6A 5LWYH 3HS8A 1MY5A 1MCSA 1G4MA 2OMUA 3ARFC 4L0YA 3SQBB 4L2LA 1ZVYA 2IQ9L 4EIUA 1SXZA 2E27H 2FB4L 2MQ3A 4QHKI 3RE0A 3V0DA 4F7EA 1MCEA 3HNVL 3PP4H 2KT6A 1HCVA 1L6PA 2X7LA 3HVDA 4ZS7L 2JKTM 5E1GA 4N2OA 2CUAA 2C1PA 4WCYL 4NT6B 3P02A 4P2RE 5J9PB 1E8WA 3T4AC 3Q5TA 4GXUN 4N6RB 4XPGH 4FTVA 1U36A 1KEML 2XU9A 5MERB 5BS0E 2R7EB 2E59A 3STZA 3WFZA 1SOKA 2E5EA 3F01A 4LVHC 5L88L 2VR5A 1YA5A 4XNMA 4PRPD 4LCIH 4X5LA 1E7UA 4LCWA 2A9AA 4OUUA 1U8JB 1RZKL 3CE1A 4P23D 4V2BA 4OV6F 3RPIA 4X6EA 3FFDA 3SZ6A 2IV9A 4Y16A 2AV7A 5IESL 1IGIL 4GEJA 3D06A 4P3CL 4P2OB 4YZWA 4FXGB 4XI5C 3E1F1 4QT5A 4XWGH 2HLFD 4HMCA 4RBPH 4BH8B 2NCEA 2FEJA 5INCB 2VYRE 3MACH 1S3RA 1PYWB 1KY6A 3UC2A 4GMSH 3MLWL 4B9PA 1TKWA 5CCKH 5AWNL 1JDAA 1F13A 1OEZW 4H0IA 5ALCL 1L7TL 2DB8A 2ITDB 5JIDA 1FIGL 1WZAA 1B0GB 1WA2X 3H55A 3LMJH 3Q6GH 4XXDA 3T71A 3OR7B 3LXBA 4MAYC 4ODUB 5MENE 2JK5A 2EH8L 3TVMC 3GWJA 2BRRH 3LXAA 3ZHFA 2OL3H 1V7ML 1OSYA 3OLIA 3WIAA 3IJ9A 4LLQA 4PJCF 1MDAA 1HL9A 3KPOB 3VFPA 2J1XA 4L1BA 1KCUH 1CF1A 3EDFA 3CGTA 1B2YA 1AKJB 2BP8B 5EO0A 1BVNT 4M4RA 4TUUA 1K6QH 2CRMA 5E8OA 1N26A 4K7PY 3ZZQA 1RURL 3EFOB 3V4VB 3VQMA 2BW5A 4ES8A 2ZF8A 5EPMB 2DIAA 4PJIA 5KVEE 1X44A 3BZ4B 4DKAA 1HYSC 3GRWL 3LOWA 4Q58C 4MNHB 5MEQA 4QEGA 3BRGC 3Q2WA 1C5DB 5EUOB 25C8L 4JHWL 4UYQA 3VCLA 7PCYA 2O5XL 2ZWNA 4ZX5A 1T5XA 3WY1A 2Y25A 1FRGL 4DOHB 1N68A 1L9OA 1JPST 3X13A 3S7GA 2FO4B 5BOPA 3AT8A 3HZYA 3H1ZA 4HWZB 2EABA 1AG0A 2A3TA 4RNRA 5DO2C 2ISDA 5BCAA 2CGZA 3DV6B 3NACH 3NFSL 1T1WA 5KSAD 4UQEA 1KYAA 4D2NA 3QXAA 2XBZA 1F3DJ 3O3EA 1P84K 4HS8H 1UM6L 1OIOA 1ZTMA 3PCYA 4UAOC 2DQEH 5E8EA 5LGJB 3FSAA 4PLJC 1NMAL 2DQCH 1M57B 5K9KA 3OZKA 2WOBA 2Z7YA 4NZUL 4OJEH 3B5GA 2RR3A 4GIOA 5CCGE 2CBOA 4FNLH 5JQHC 3BZEB 1Z2KA 3ZDXE 4UM9B 3EADA 1N59A 2ZCKH 3O6LH 3PPSA 4O02H 2VLMD 3V0VA 3VACA 3VE0B 2FT7A 4NGHL 3MLUH 1D3CA 4AYMC 4O9HH 2NY7H 1KJVA 4JZOA 3V6FB 3ILPA 1S7SB 3CZLA 2DQ6A 3DA0A 3FU7A 2TSBA 1UTDA 2QQLH 3SGEI 4EI6A 4WEBL 1TU2B 1U93A 3VTAA 5E6RB 1T3FA 1AHWC 3FKUS 3K6NA 4TSBL 3CFJB 2JH2A 3QQ4B 4ZW6A 3ABGA 4KKAD 5D72L 4DH2A 4DGWC 1CDGA 4G7VH 4J3SA 5E99H 3RB7A 1D6VL 2VJXA 3S2CA 4KNTA 5E00A 1MW2A 4PJCA 3IETB 5BRZE 1VFBB 4L4VB 1YAZA 2VDLH 2UZXA 4YMPA 2CPCA 1OGTB 3HLKA 4NHUA 5ACMA 2EDTA 3T77B 1BBJB 2V37A 2PO6D 1ZY9A 3ULVL 3BVXA 4U6VL 4YHZL 2P80A 3CDYA 2E6PA 1C5CL 3WENA 5FOBB 2R9HC 3RIFF 1BZ9A 2GAZB 5BJTA 3FUDA 7CGTA 3MGAA 4KKPA 5I0ZA 1KCBA 3HMXA 4CSPA 4JG0H 4NS0A 4TVSa 3WIIL 1Q0EA 2VDQL 5HHOD 1PQZA 4OAWA 2X3BA 3H2WA 4A68A 3DSFL 4PGBA 2ZXEB 1PSKL 1A3RH 1PAMA 3SPCA 4UB0H 5A6IA 1RZ8B 4O4YH 1S5HB 4OCLC 5HHVH 2CGYA 3MBEA 3HI5H 4Z7AA 4OLEA 3S37L 3BMVA 4XMXA 5KW9L 4CW1A 3IKCA 2GFBA 4OI8A 3QDJA 3IDNB 1JF1B 2X89A 3VW3H 1CXKA 2YD2A 1M3IA 1SQMA 2D0FA 3HC3L 2BHZA 4J27A 4GAJH 4HV8A 1QUNA 4G7YH 4GBXB 3TZVB 4XCNB 3LN9A 2XX1A 2R1XA 4H26B 4W9HC 5IVXE 3DUUA 3NP3A 4D9RE 5TE7H 1R17A 3BVVA 3RDJA 5IMLA 1O6VA 3QJFA 2WQRA 3O2VL 1GCFA 1UJ3B 5DMYA 3DUSB 2FAUA 3LH2L 3KYAA 2HZHA 2PKDA 1DVTA 2VDNB 4IKKA 3PWVA 5F2FA 3IMSA 4A2HA 1AMXA 3O8XB 4AIZA 1LEKB 2ZUVA 5IHUH 3W0WE 1RP9A 1IGJB 4PUBL 5J57B 2JI2A 4AUJA 1E4WH 4F8QA 1YYCA 2C9SA 1RP8A 3PYCA 5DHVB 2OMYB 2A74B 5FUOH 5GRJH 5IB3A 1URIA 2ADJB 3AM8C 5MEPB 2VDRB 1A8JH 1BOGA 1L6ZA 2Q3AA 4ZUUA 2G0LA 3BFOA 5HYIA 4NM8L 2X4UA 4FL4B 4FG2A 4YC2B 3QT2A 4OCWL 3BPLC 5FFLA 4CSZA 3D25B 5C6TH 4QLWA 1FLTX 4WWKB 43CAB 2CLZB 4L37A 4YDKL 1JP5A 4PY7A 5IJVA 4BH7B 3BP5A 5LUMA 4XNZB 2BVPA 4K55A 2X4SB 3MKGA 2X0VA 4D94A 1P6FA 4IHOA 2TRYA 3T1FA 4AMXA 1UWGL 4NZDA 2JLPA 1JTTA 3VXOA 4L8CA 5T1MB 4BA8A 2FECL 4G5ZH 4WSGA 1S9WA 3D85B 5JW4Q 1M71A 3LKQB 5H94A 1KPUA 3KWXA 5DJ0A 1NWPA 1FC1A 1QPXA 2Y6SD 4FYSA 5J06A 3BZ5A 3VB8A 3F62A 4FNSA 3FO0L 3D4ZA 3QQ9D 4QTHB 4MJJA 1MCOH 4HIEB 1Q9WB 4NUPA 4YDVA 6FABL 1WS7A 2CUIA 4H5SB 3OKLA 4PRNA 2OQJB 3EH4B 1VEPA 2ICWI 5F7DA 5TK4A 1XO8A 5CMAB 1ACCA 1RHHB 4XNXL 1JPEA 2MCG1 2CK0L 1OPGH 1XR8B 4K71C 4DKFL 3CD4A 3S36L 2J44A 2QPUA 1KSRA 4ZMOA 2J1KA 4FZEH 1RV6X 5FO7B 4KKLC 3OMNB 3BAEH 5TTRA 4M4PA 3D51A 1Q0YL 2F08A 2N4IA 1CD9B 2NRDA 4J28A 1MCCA 1QPPA 4JO8A 3RJQB 1D5MA 3EHBB 4HUKB 4YPJA 2R29L 2X1OA 2VOTA 4MRCA 4L5FE 1XZ0A 4L9LA 5DD6A 1MLBB 4Z3GA 2IWGA 4D0BB 2MPAH 2Q7YB 2BSDA 3IFLH 4ZUSB 3RWCA 4N3UA 1SHWA 2ZG2A 3V6ZA 4IBWA 3AXHA 3NCYP 5B8CC 2YQ3A 2QEJA 3R19A 3GMNA 3LN4A 1I9JH 4MCZB 5DJ2A 5I6PA 1MW0A 1XEUA 4TSAL 3QULA 1CFSB 1E5CA 4NQDD 4I87A 1HIMH 4X83A 1AGBB 2RB8A 4Y1AB 4PJ6A 4G8EB 2WBJA 3OKDA 2P28B 4YEEA 4PGDA 3CU7A 1TLKA 4P2QD 3U9PH 5DS8A 2DJUA 4K8RD 4F57H 2CDEB 4OZIA 2CM5A 5KAQF 3MA9H 3MOAH 3QJQB 4HF5H 3CCHA 3TJHC 1GGIL 5CZRA 4GP8B 1EA9C 3LEYH 4XP6H 1DVSA 3U79A 4BFEA 2AJXL 3UBXB 4IRSA 2EO9A 1PKQA 3MV9E 4AGPA 2DMBA 3HB3C 2V2XA 5I82A 1V3MA 1F4HA 5E0QA 4JM2F 3NIDB 1T04A 2R0KL 3GJEB 2FJHA 3GIZH 1R3JA 3ZR5A 4XCEB 2EVIA 4OD3L 1JHKL 4KROB 4NPYA 5DJ8A 5DJCA 1XR9B 2NDGA 1TNMA 5EZLB 3DX7B 1MCQA 1VLXA 1MRFH 5G5DA 2XN9B 3C2AL 5EBMB 4OT1H 3KL0A 3MROA 2P26A 2B2XL 1KXQA 4LQFH 2E9WA 4WO0A 4NOFA 2GITB 3I9GH 2UWEF 2R0LL 5JXED 3SE9L 5I0XA 4N0CD 3S35L 3S6CA 1AR1B 4YHIA 1DSFL 3IDMB 4N68A 1JL8A 2WVVB 1KBGH 1F4WL 43C9A 2IOOA 2ZXAA 1FFPB 1CLCA 1UA6H 4XODA 2QFPA 2QKIC 1YDPB 4CVUA 3ZIMA 3Q06A 1UT2A 5C9KA 2YRLA 2G3ZA 3ZVVA 1YN7B 4LB8A 3INUL 3K1DA 4GI8A 2ICWA 2AI0H 4HLZH 4K7FB 2A6JB 2IF7A 2XQYK 5ICYB 1RJLA 3ZTDC 4ZXBA 1OM3H 3BUDA 3MFFA 1BYPA 1OAKH 1K85A 3H0TA 4A1RA 3MRPA 3QH3A 1JHTA 1OSZA 4LPCA 5EIQA 5I0YA 1NCNA 4P59H 4OQTH 4GW4A 4RQQB 3ALPA 2E56A 1KENH 4MJ5B 1ZLSL 4C56A 1BFOB 2JTDA 3NQKA 4MXQC 5DQJB 3MBXL 1A1OA 3N43B 1BREA 5JDSA 1UADC 2KHAA 4ELKB 2WBXA 2WLLB 2P46B 4E9SA 1CLOL 1JDCA 1N70A 2NCMA 5CKGA 4FXLA 1NFDB 2I7SA 2DQHH 4HJJH 4BSVA 3UYOD 2VLKE 3O3DB 5JLZB 3R0NA 4WFFD 3KL5A 1YNLL 4G59C 5INDA 2B15A 3L5XH 3QUZA 1XGUA 1UOLA 3PWLB 4HFWA 1KTJA 1YUHA 3LKRB 5JHDD 2VMDA 1M2VB 2C3VB 2DQGH 1E0OB 4FXGC 1RZGA 4K5OA 2KZWA 5D2LE 3TYFA 5L2KA 1T2QH 1MSPA 1ML0A 3MRFB 1GHFL 2NNCA 5HYEA 2W0LA 1DQKA 3L6FB 4B9IA 1A3LH 2Z4QB