1NJ8A

Crystal structure of prolyl-trna synthetase from methanocaldococcus janaschii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
456
structure length
456
Chain Sequence
b'MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline-tRNA Synthetase
molecule tags Ligase
source organism Methanocaldococcus jannaschii
publication title The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
pubmed doi rcsb
total genus 119
structure length 456
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2002-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09181 ProRS-C_2 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 1nj8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1nj8A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1nj8A02
1YB3A 3BFMA 1YGBA 1B70A 4WJ3M 2I4NA 2P5IA 4PHCA 2DZ9A 1EVLA 3IKMB 3UGQA 4P75A 3HRIA 3PCOB 1BBUA 4XTXA 4YRPA 2RHQA 4X5OA 1FYFA 2DEQA 3I7FA 4YCVA 2CJBA 5ELOA 2ZR2A 3QO8A 3RL6A 3VQVA 4YRTA 4UP8A 4UPAA 4KR3A 4TQFA 1NJ1A 3VQXA 1WNLA 3M4QA 2E41A 3IKLA 4P3NA 3L4GB 3W3SA 4RQFA 2E3CA 4TVAA 2ZZGA 4EX5A 2DDZA 4UP7A 3RACA 1ADYA 2DTIA 2ZZFA 3UGTA 1G5IA 4P72A 1RIQA 4K87A 1WQ7A 3EFRA 2AMCA 3P8YA 3TEGA 2ARUA 4PG3A 2EAYA 2E5AA 4G84A 4K86A 4P3OA 4XU1A 1B8AA 1SRYA 1YFTA 2I4LA 4RQEA 2I4MA 5F5WA 4J15A 4P71A 4YRLA 3V8LA 2ZGWA 2Q5HA 3UFGA 4P3PA 4CH6A 4H2TA 3A32A 2CJAA 1USYA 2AMCB 4HWOA 1BIBA 3REUA 5HGQA 1X2GA 2C7IA 3HRKA 1E1TA 4DQ2A 2G4CA 4YRCA 4E51A 4HWRA 3G1ZA 4P74C 1SESA 1NJ8A 3ERRA 3VQWA 1SERA 3UH0A 4KR2A 4RDXA 2ALYB 1HTTA 1NYRA 4G85A 4TVYA 2XGTA 4XEMA 4H2WA 4YDQA 1PYSB 1JJCA 2ODRD 2AKWB 4YRJA 3MEYA 4P73C 4P73A 2CIMA 1PYSA 2DQ3A 1GGMA 4YRFA 2FYKA 3A74A 4TVAB 3IALA 2DXUA 4YREA 3RKXA 3L1AA 2QHVA 3CMQA 2HNIA 1WU7A 2RHQB 1EFWA 2Q5IA 2EJ9A 3V7SA 2ZCEA 4YP0A 4XU0A 1B7YA 3HXYA 2QHUA 2QHTA 5K1PA 4YCWA 2AKWA 1EIYA 4HWSA 3NELA 4YPFA 1NJ2A 2EWNA 1Z7MA 3HFVA 4Q15A 2DTOA 3RUXA 4P71C 4XU2A 2ALYA 1HXDA 2ARSA 4P74A 3LSSA 1BIAA 3HXUA 3RIRA 3A7RA 2ARTA 5ELNA 1L0WA 2E1HA 2C8MA 1B76A 2I4OA 3VBBA 1WYDA 2Q7HA 2ZT5A 2PMEA 4P72C 4TWAA 1H4TA 3E9IA 3OD1A 4XTVA 3A31A 1B7YB 2DJZA 3V7RA 3BJUA 3A7AA 1G51A 3MF1A 3HY1A 3A5YA 3HFZB 1KMNA 4OLFA 3A7UA 4WF2A 1H4QA 1NJ6A 1W66A 4XU3A 4YRIA 3HXXA 4TTVA 2ZR3A 2Q7GA 1NNHA 3RKYA 1E22A 12ASA 2IY5B 1ASZA 1KMMA 2IY5A 1WLEA 4YYEA 3P8VA 2ZIMA 4YRGA 4H2XB 5C51B 3L4GA 4K88A 3WQZA 4H2VA 1WPYA 2CJ9A 2DKGA 4KQEA 1ATIA 3E9HA 4XTUA 3TEHB 4CH3A 4TQDA 3LC0A 2ZT8A 4YRRA 3ICAA 4WJ4A 4HVCA 4LNSA 2DZCA 1V95A 1SETA 2Q7EA 2ODRC 3V8KA 2E10A 2ZINA 3RF1A 3P8TA 2XTIA 4AH6A 3A5ZA 4RMFA 4CS2A 3DSQA 2E64A 4ZTUB 1G5HA 3R07A 3EFSA 3HXZA 4ZTZB 1KOGA 1C0AA 4YRKA 3L2ZA 2EL9A 1QE0A 4NCXA 5K1XA 1H4VB 2PMFA 2J3LA 4YRSA 1HC7A 5E3IA 3QNEA 11ASA 4H2YA 3IG2A 3HTZA 2ZTGA 2DU7A 2DQ0A 2CGHA 4HA8A 4XTYA 4EO4A 4WI1A 3PZCA 3RKWA 4YRNA 4BW9A 4YRMA 2DTHA 1J5WA 4BWAA 3M4PA 3NEMA 1USYC 1N9WA 1EQRA 4H2UA 2ZNJA 4H2XA 3HY0A 5C53B 4O2DA 1YFRA 4L87A 4ZIBA 4Q6GA 2LW7A 5C52B 3NENA 3TEHA 1X2HA 1EIYB 4UP9A 2DXTA 4XTWA 3HXWA 3MF2A 1QF6A 3TUPA 3RGLA 4OP0A 1JJCB 1ASYA 1WQWA 2DU5A 2J3MA 1YFSA 4XTZA 1BBWA 1E1OA 3NETA 3HFZA 2RHSA 5KNNA 2RHSB 4CH5A 2ZXFA 1X54A 2DVEA 1LYLA 1ADJA 3PCOA 1EOVA 3QO7A 4YCUA 4YROA 4HWPA 1E24A 3QO5A 1Z7NA 3KFUA 2E65A 3V7CA 2QHSA 2EJFA 2ZNIA 3QTCA 4CS3A 1B70B 3VQYA 4CS4A 3HXVA 4H2SA 4YRQA 2P0LA 2ZT7A 1EVKA 4CH4A 1X01A 4H02A 4HWTA 2ZT6A 1IL2A 1X56A 2ZIOA 1NJ5A 2EJGA 1X55A 4TVWA 1H4SA 4DPGA 3REXA 1VQZA 2ZZEA 3LSQA 3V8JA 4P75C 3FJPA 1NYQA 4XEOA
chains in the Genus database with same CATH superfamily
4BO8A 2HSGA 1AKVA 3FE2A 2PIDA 2QDXA 4C4ZA 2FSPA 3OZXA 4PHCA 5AI6A 3D2CA 4CI9A 2HCJB 2WDPA 5DGTA 2EH1A 3KOYA 3CGGA 2VTBB 2WP8J 2DTEA 3ITDA 3HYNA 1H42A 5DNUA 1FK8A 3PA8A 4NYJR 1MVOA 3OSZA 5L51A 1G1AA 1GUDA 1ECBA 2IFTA 2PH5A 2Y1GA 3DPIA 3P9QA 4FFPA 1GQYA 4UDNA 5CXXA 4RFSB 4WN3A 4BMSA 5H4GA 1LPSA 1YQDA 3MRXA 4ASUA 3WGKA 3GWZA 4GWKA 3WL3A 1BWPA 1UJMA 3KUKA 4LZLA 4I4TF 1WB6A 4V0NA 4YRTA 1H0SA 2OO5A 3GLGA 2QAJA 3RPEA 3N05A 5JE8A 2BKYX 4J76A 1GXSA 4W82A 1GAJA 2GN2A 3E81A 2K6GA 5LQKA 3LL7A 1PF7E 5LYYA 4EHNA 1GU7A 2Y6UA 1JE3A 3QE3A 2E41A 5IBPA 2IYEA 3H83A 4WACA 1IK4A 3N2KA 1RHKA 3GYBA 4HB0A 3LWDA 2L8YA 1P80A 3RVDA 3L4GB 1IATA 1XNJA 2NVUB 5KYNA 3MAJA 5EY5B 4W5OA 1DEXA 2FFHA 3TIGA 1UJCA 1RZUA 1L5FA 2V7QA 2OD7A 3MCVA 4JC5A 1B23P 4QNRA 4DQVA 2ZZGA 2RHHA 1J0DA 1YA4A 4ZU3A 3E35A 1CE8A 4E33A 1ZNQO 1ZM2A 3UK0A 3OM8A 3VR4D 2HIMA 1FTQA 1KJQA 4Q37A 4L9WA 4ZVQA 4C7VA 1WTAA 5BURA 3H2SA 4WGFA 1EWTA 5JJLA 3DEJA 5C1BA 3O26A 4NHOA 5JDCA 1SCQA 2VBFA 4ENSA 3GNTA 3GLFA 2HCFA 4Y2JA 2X5NA 2GSWA 1EUQA 4DANA 3L7LA 2HDOA 5I47A 2RH4A 2PK3A 4R83A 1XCJA 1H69A 1RRGA 3AFMA 4LDZA 4PSCA 4ZQGA 3M3DA 2Q3EA 1N3IA 1K8ZB 2L42A 2C7BA 3WGZA 4EITA 1VKNA 5JY6A 1W5SA 1W34A 4V24A 5KNCA 1RYHA 2OQIA 1MO3A 2JAHA 3I32A 1CETA 1FVXA 2KQUA 3A9WA 1AS2A 3L3BA 3PEVA 4Y0NA 5DJ5A 3I39X 3T3IA 5BW8A 4PG3A 1EGAA 1KKUA 2HWWA 2CBXA 4KW7A 2XADA 4RD2A 2DR0A 3ZEAA 1YDWA 3WZMA 2YWJA 4DBZA 1G21B 1V6SA 3VNAA 1II9A 1U2GA 1KMCA 4LJSA 1NQOA 1K0UA 5ALMA 3WLKX 4B4DA 2FPPB 2UZ1B 1SR8A 4H6WA 1Y3BE 5CT5A 3MJVA 4CMIB 2EW2A 4D9JA 3ZD6A 4EY3A 3AIIA 4ND6A 4EI8A 4ZI7A 5JRDS 4JYZA 3RRJA 2IHJA 2P9ZA 3LZDA 3HKBA 1GPAA 2ZSKA 1HFEL 2IY8A 4FEGA 4O02B 3A58B 1L5KA 2XDQA 1ZO8A 1IBLB 2JLSA 3JQ7A 4MOWA 1TLLA 4G4SO 1FYDA 3RV4A 4MRSA 2AQKA 4P08A 5J4LA 1XO1A 3ROKA 1YQ9A 1C1XA 3DBLB 2O2YA 5B1DA 3DGFC 5I9NA 1TQ8A 4O5AA 1U6KA 5A0FA 1C3EA 2KM1A 4MQFA 5A3JA 4YXWA 4B7XA 4CIYA 4XW2A 2Z3VA 3ML1A 4A6EA 4CEHA 4QARA 2PO7A 4JXZA 2CN1A 1PX2A 1ZXBA 5GONB 1DAMA 4NRDA 4DHWA 4I9GA 4BYGA 2PG3A 1YRYE 2FW8A 1Z08A 1YVPA 1ISPA 4JJ4A 2NM0A 1MA0A 2V7UA 3ZZ1A 4ZYUA 4MVWA 3TG8A 4CEIA 2JLWA 1PFYA 1W1IA 4E51A 4G07A 3N39C 3K9WA 4IINA 4WADA 1SESA 1E0KA 2VPPA 4UAGA 1XZ8A 1W96A 3CNEA 3LUJA 1U99A 4HDNA 5F9MA 3D4LA 3VHXA 4B2LA 4E5DA 1U8CB 3R7SA 4DWWA 3KJXA 3V7UA 1MTOA 1Z47A 1XZLA 1NM5A 1U28C 4Q4CA 5FWNA 3ZJVA 3KDSE 4HQNA 3DP7A 3KL2A 4K0RA 3ZV6A 4ENRA 2QAGA 4XGIA 4BX0A 4DB2A 3K9HA 2VL7A 4EPTA 1Q3HA 4RHFA 2BBOA 3CR3C 4GZ3A 3Q3JB 3T7RA 3QBJA 5EXPA 4CLDA 1VL2A 5G4LA 1AY0A 1YONA 3DT6A 3AVYA 1L4LA 4PSKA 1YB5A 3NHJA 4Z2YA 2A1UA 4DEYA 1RAHA 4EHKA 1LSUA 4YP6A 5F21A 2B7LA 1GY8A 5EP1A 4UEJA 3GCXA 4EHFA 1FNMA 1K5PA 8GPBA 1U9JA 4CWAA 4G24A 1VLHA 2BVNA 3FFBA 3S2IA 3WJ7A 1XQVA 3L0ZA 1YZUA 2V58A 2I6XA 3IALA 4IKEA 2PA0A 3SX0A 2JCBA 3TWOA 4YREA 1Z5NA 2BGNA 5B58C 1F8GA 3IQXA 2FZ4A 2R7NA 3DFUA 4RD1A 4DG5A 3L1AA 2XUHA 3DCNA 2YOFA 1LLQA 4RY2A 5JS8A 1FSZA 1U8UA 1TADA 2PH1A 3HUUA 1T6NA 1ESMA 4GW3A 4JP5A 4F6RA 1U5AA 2W2LA 3JASA 4PLGA 3IJPA 3NDJA 2O1SA 2X8LA 3LUFA 4J0IA 1M2FA 1U1FA 3B3QA 1N5JA 1CJVC 5TQ2B 3NT4A 3BF8A 1CF4A 1Y8RA 1DRVA 2IH4A 3BDIA 3TTCA 3GUVA 2GXSA 4TX1A 3FIUA 4HRXA 1ECJA 1JTFA 2PXAA 3O90A 5C7OO 1DINA 3SI7A 1MF7A 2HV9A 4UUNA 3WLLA 4J1TA 3PDHA 4BFLA 2BGUA 5L3QA 3IUEA 3T5DA 3KJFA 3KKMA 3NCHA 4KHPB 1L4HA 1GCUA 4WY2A 1C7FA 2FSUA 4L2IB 4RMJA 3VU9B 2E6UX 4RTQA 4XOIA 5CTAA 2AKYA 1OOEA 2YNMA 1E3MA 4X3CA 4YPFA 3H9JA 1V35A 2VPTA 3OT5A 4KMRA 1JJFA 2AMFA 3R6LA 3WIBA 4DNOA 3L8DA 1VIAA 1ORIA 3DOUA 4YT5A 1YR8A 3I5YA 3H75A 3H17A 4XU2A 1B0PA 1WM1A 2ET6A 3KZOA 3L5KA 3OP1A 2YH2A 1D0IA 4GSYA 1P1FA 4BFCA 1W7AA 4CQNA 2UZIR 2BKAA 1KDOA 2FI1A 2WUGA 4TRNA 3I5XA 3FN4A 2QD4A 4P74A 1D4AA 2W11A 1MBZA 1QZ3A 5KSYA 4FT2A 4QEZA 3IKVA 4A0QA 1M34B 3ROFA 1R66A 4LAFA 5KYXA 3EX7C 1N2ZA 2C4TA 4P5PA 4U2GA 1J25A 4YJ2B 1BGVA 5IAKA 1G2IA 4HGZA 1E7QA 1FP6A 1T25A 2J9ZB 2R1ZA 3FLEA 4XRGA 5KWJA 5IDXA 1RVDA 3WY9A 1ONNA 5T57A 2D1FA 1TX4B 1QKIA 2HLHA 3HCEA 3L8YA 4HL6A 4RVFA 4AJPA 1OYVA 3A6HA 3K09A 2BHTA 1YQEA 1QCZA 2IT1A 4YI5A 4D3ZA 1QYWA 4V1CA 2JK0A 1J2JA 5ER6A 3KOOA 3U6BA 1KJ9A 4YJFA 1QTNA 2C77A 4LHZA 1PWHA 2H4HA 4IUDS 4PM4A 3BJRA 3GRKA 3K35A 2HPHA 5TQJA 1ADFA 2ISSD 1X86B 4I5EA 3HO8A 5JARA 1UBGA 1ORVA 2OZLB 1L8QA 3RFTA 5IF9A 4GF5A 1U0NA 4MV9A 3AOEC 1SQSA 3UOWA 2NTNA 2QROA 1CQJB 3I83A 1N5DA 4CTMA 3UAYA 3ECSA 1YTLA 3F4BA 4D25A 3DKIA 5ENDA 4BIIA 5KTMA 4UTXA 3JQFC 4G0VA 2Q5LA 3HFZB 2P2GA 2NSDA 3QLTA 5DISB 5G4KA 5JXHA 5IT9A 3AHIA 3OPMA 3A4IA 4NBKA 3JRXA 3AEUA 3FNBA 2R25B 1SGWA 5I7VA 1E1KA 4CGZA 4QEKA 2UDPA 1H4QA 1XTPA 2ZVQX 4P92A 5LMNB 2A5FA 4O4HF 2JI8A 1SBZA 1TYCA 2ZEJA 4CG0A 3NV9A 3D3NA 2VUHB 1MENA 5B2EA 2E2WA 5CRIA 1X8XA 2HPAA 4G25A 4FCWA 3RJMA 2P9FA 4MVJI 3ZBUA 1HT2E 1QYXA 5TC4A 4MAMA 2F1OA 2AR7A 2WWFA 2BMDA 3D0OA 3ES9A 4QPPA 5CU7A 1C8BA 1U7PA 4UBNA 2Q07A 1XN4A 5BQFA 1YOVB 4P3KA 5JROA 2D13A 2PV7A 3SF8B 4OMCA 4OJYA 1Z17A 3WGYA 4R0VA 4UU0A 4LV5B 3FDIA 3LW7A 4X61A 2AF4C 5ELMA 3MN1A 3T7EA 3CSSA 4DLXA 4KXWA 4NH0A 4DZTA 1SB9A 4QVGA 1OR8A 2OZVA 4H2VA 4OFBA 2P9TA 2GAFA 4NZZA 4WN9B 5EQDA 4BVAA 1KE1A 1SG9A 2X0JA 4Z4CA 5FI1B 1NXVA 1U4NA 4ZCLA 1A96A 4JBGA 3ICWA 5ADVA 3WNCA 3PDWA 3WL6A 4MYRA 5BSTA 3IHTA 3T0FA 1RYBA 5D00A 5HR5A 2BSAA 2QI9C 2FDCA 4XGQA 4S2EA 3PEEA 3U39A 1US8B 3E9EA 2Z95A 2WYWA 3W7AA 4MYSA 1P60A 4UQOA 2X76A 3TQTA 3PXUA 4ZN6A 5LQRA 1RQGA 3C3DA 1RYMA 3B8EA 3KR0A 1KP9A 3L79A 3REQB 3B7GA 3UCFA 1EQ2A 2I3DA 4E4TA 3F73A 3C70A 3R07A 1B2LA 1HG0A 3T6KA 1LBHA 1PSWA 1T4CB 5I5GA 5DK6A 1Z38A 4BMCA 3JAMA 1J70A 3GLHA 3W04A 4B3GA 2AMVA 3IBYA 4R8MA 1A5BB 5TMDA 2YY6A 1D2EA 2C20A 3JPWA 3Q8MA 4ZV7A 2FCRA 3F7OA 4HZGA 1UM8A 3EDRA 2ON6A 4ZQIA 4JI5B 3IP1A 2E4YA 1Z45A 4BECA 4QAQA 5EGNA 4N5DA 2IYVA 3CQ9A 1MGOA 2E4WA 4P6VF 2WA1A 4J4HA 3AR2A 5B57C 4Y0AA 5H02A 3CVXA 3SC3A 1VB5A 4GD3Q 3V1MA 4JSTA 1BCRB 2QG6A 2CJYA 2ZTGA 2IH2A 1C7QA 2FPIA 1A5SB 4LY6A 2DU7A 3M89A 1NZFA 4R4JA 3SZMA 1Z4MA 4BDTA 4CM9A 1QONA 2XOKA 2J31A 2R8BA 3K2QA 3TZLA 4OLBA 1LEHA 2YS6A 3AJAA 1DIOB 1K88A 3GFRA 2YJ3A 2CHGA 3H2GA 2ZCVA 2WA2A 3D31A 3WGHA 4BJ1A 3DEKA 4DXAA 4UNPA 1HDIA 1HTBA 4IH4A 3G7UA 1MLDA 1KHTA 3W5DA 1N9WA 2BE9A 1QMGA 1K8YB 4QO8A 5AVOA 2CHFA 4XA8A 1ZH6A 1J39A 2DVMA 3FWPA 1CT9A 4MKIA 4RMHA 4MVJF 5TGZA 4CM1A 1P0PA 5C53B 3CLTD 4M9XA 4BCBA 3A9UA 4GX2A 1V1MA 5F52A 1YB6A 4BO0A 4CMAA 2XGGA 2FMIA 4TM7A 2C5BA 2UVDA 2Z04A 2V54A 3NENA 1SU7A 3CUUA 1DX4A 1KI8A 3WICA 4PTLA 4RF4A 1OIVA 1ETHA 1T4BA 1B42A 1CQWA 4ENVA 2KYRA 1YRQA 2YZ2A 5TJHA 1AZLA 3TUPA 3MWLA 2VDNB 3OX4A 1UJ4A 4IDGA 5JATA 1GGEA 3AF4A 4AXXA 3LGAA 2EARA 3V5NA 2VZ9A 3W3AH 2HBYA 4YV1A 5A5VA 5LVAA 2O7RA 3OCJA 1W4ZA 3GRYA 3QTLA 5ES3A 5JPIA 4EEKA 4O4JB 4R7TA 5FFMA 5K3SA 1J9EA 4LISA 1TMGE 1NP7A 5B3AA 1HDGO 1NIPA 1ZWLA 1KR5A 4KACA 3LY7A 4JR0A 2C07A 2FW1A 4KN6A 1ZK0A 2BE7A 3RS2A 1S3FA 3QU7A 1P61B 2ZYGA 3NG1A 4YBZA 2IEGA 5D51S 3AL0C 3Q40A 3WSTA 5AQ1A 1WY7A 3ZHVA 5KQRA 3WIUA 4TVBA 1GCIA 4CM4A 1I3KA 2WOJA 4MUMA 1YMVA 4GEKA 1RIIA 2CVQA 2WAOA 5A4KA 1Z4QA 2VF5X 5EAIA 3UBMA 4FC6A 1U1IA 1Z9BA 1M6YA 3FNRA 1U3TA 2IZ0A 3O2NA 3RYIA 4D82A 5K0ZA 2LDBA 1ITZA 2RAFA 3CZQA 1SHJA 2HTEA 3DLCA 2SECE 3IB6A 3JZAA 2JBAA 3LVRE 4YA6A 1ZS9A 1NQTA 2P8JA 3TMAA 4BNWA 2ECPA 2CCJA 2FFBA 4JBLA 4DDVA 2OG1A 1VKZA 4HDMA 3LLCA 3SN6A 4PYLA 4UPDA 4L8FA 3HVUA 4I1UA 4MUJA 1YBVA 2QVCA 3K9QO 3L7IA 2A58A 4ND2A 5LQUA 5JQWA 4DYVA 5DTJA 5GTDA 3IAFA 3D3WA 4RKFA 1TKCA 1N5IA 5KSZA 1FXWF 2IU3A 5A2QA 3NYIA 4JLJA 1JTVA 3HXVA 1WVIA 5KQSA 4F1KA 5FUWA 2HWUA 3TLJA 2A94A 1X0VA 1HE4A 3KIPA 4H59A 3REOA 3T9CA 1PO7A 4CH4A 4RV4A 3DC7A 3OKPA 1ISHA 3DG9A 3R3WA 3HB9A 2AFIA 2EBWA 4PPFA 1VHQA 3RQIA 1HEUA 5KTOA 2WJWA 3N59A 2BMVA 2VSOA 1OI3A 1U65A 3CR8A 4JLBA 1ZOPA 3E5HA 1S2LA 3ZWYA 4XB6B 4C06A 4PZEA 2GT1A 3EFEA 1RXYA 3NANA 1Y5LA 3C2QA 3I58A 4LYJA 1DAKA 3RHFA 3SAJA 1GZ4A 2UUOA 4FYPA 4CIDA 5LOVB 3L4JA 4JHLA 2NV6A 2INGX 3SU8A 4O8ZA 4ND8B 3TMYA 4UTOA 1O7JA 4LRTB 3RABA 3WJAA 4Q21A 4GC5A 3PVCA 1M2OA 1I2BA 4K1LA 1JAIA 2R6R1 3FXAA 4XEOA 2YWBA 1S7CA 3LI2A 3AWIA 2Y71A 1B93A 2FMXA 3K9LA 3PZBA 3PQ2A 1T0PA 4G8BA 5EIHA 3WAKA 2C8LA 4O29A 4U6NA 3SHTA 1FYWA 3V1TC 5AVZA 3N0VA 3TSZA 4CKEA 1L3CA 3GUCA 5ALTA 4P98A 1J49A 2VP9A 1Y6JA 1UBMS 3GJ0A 4ZI5A 5TLSA 5GINE 1A9XB 2NPIA 4NVRA 4PQGA 1G9TA 4ZVLA 3VV2A 3QOFA 2NVUA 2YJ4A 2ZYAA 1EAYA 4ZAVA 3LGSA 2XMDA 2Y1WA 2XW6A 2O05A 1J2RA 3ZVNA 3G0CA 3T38A 4FS3A 4QOSA 1Z0AA 2ZBGA 1CJTC 4CTNA 1S3IA 2B1GA 2BLNA 1AQLA 3QTBA 4CMCA 4C7OA 2GZRA 1AHHA 2VVTA 1ETUA 5JD4A 2IK8A 5F7ZA 5AWFC 1AMNA 3EXHC 2XVXA 3ZGZA 2FPLA 1VL6A 4OHMA 5LXTA 3FTNA 3HYSA 2Q9BA 1HDYA 2NPOA 1E1RA 1USGA 3PQ7A 4GBMA 2RKBA 4NG5A 5EP2A 5TQ0B 3SYTA 1GLVA 2QVYX 2X13A 5L3RA 2QMYA 2JGNA 1PJZA 3WQQA 4K6CA 2HYDA 4S0XA 4E94A 3KVRA 3VAYA 4GXNA 3BGDA 3QFRA 2QYOA 4JBXA 3I04M 5TF0A 4GGPA 3NT2A 2VTBA 1XYYA 2NACA 4NJMB 2C2YA 2GXUA 1P5RA 3FJ1A 3EGEA 4N6OA 3NTLA 5DXJA 1KA9H 4CIAA 3K70B 4CU2A 4IHKA 3WXBA 3UGKA 3QUCA 4U7FA 2Q2VA 3LUDA 4A36A 4I4LA 4TLDA 3AW8A 4PICA 1ZHHA 1ZBQA 3B60A 2EWMA 5DLPA 3CH7A 4UMVA 1FDSA 3ASVA 3EFHA 4HWGA 3HSSA 5CFRA 1WQ7A 1IN4A 3KXPA 3MD9A 4AO7A 1FDWA 2Q49A 1CY8A 3NNSA 1UP7A 1H0RA 3NKLA 3GLIB 2HHCA 3HS3A 1CDOA 2HMYB 3KAJA 4QNMA 3PNOA 2O3QA 1HYQA 2K87A 4R3UC 4CXMA 3FOEC 3LCCA 4KQ9A 4Y6QA 2Z5LA 2CXOA 2H1RA 3URMA 3FKSA 3TW6A 3KTDA 3AI3A 4YAFA 1IRIA 2DECA 1TGVA 4AZTA 3H4IA 1NZDA 3GAFA 4PU0A 4RADA 2XE8A 1JPJA 1U11A 4OXNA 4YASA 1T2VA 5FI3A 3JZDA 1N3BA 1XKXA 4EGQA 4Y6GB 4L4XA 1E4VA 4NCHA 3QY0A 4YMWA 2WTMA 2YWCA 3ZHSA 5DSTA 4L8LA 2P7IA 3FPFA 1NVMB 2Y1LA 2D0DA 3LOQA 4MGKR 4L50A 2IPLA 4BLVA 1MORA 3R7WB 2A9JA 4H3SA 3SLGA 4RDCA 3ETNA 3VKHA 3QMVA 3L82B 4QODA 1XZHA 3KQTA 4FGWA 4ND7A 4BLUA 3LWNA 5AW6A 3SJBA 3E5NA 3NHUA 3CE6A 3N9IA 1NUAA 4RX1A 3LQFA 1XDZA 4LX8A 5KO2A 2BFOA 4IOKA 1OA1A 1I3CA 1YACA 2O7SA 3KAKA 3KQYA 1NKVA 5KYUA 3P2OA 621PA 3DVSX 1QK5A 2C42A 2NQTA 3DOOA 2MYPA 1OX6A 3NHSA 4YLGA 1XQYA 2VDLB 3IPAA 1SJ9A 3BEOA 4I8DA 4PIMA 1EFCA 5K8CA 4KQIA 4HG2A 4ZO8A 1MJHA 4R1TA 3AFNA 4EQ6B 3DXZA 3DFMA 5KVQA 4BX9A 1CUCA 1QHHB 1CD5A 2OGTA 3WLHA 5E6RB 1KBZA 2VT2A 1C3OB 1U4OA 3KETA 2R8RA 1T0HB 3AMVA 1KEPA 3DJYA 5EEHA 2QK4A 3I9MA 3L0SA 4UEOA 3J7AC 2JLCA 3HY6A 3MTDA 2J0VA 4P7KA 3TLGB 2ZI3A 3WE7A 2Y27A 2QN7A 1VKRA 3MILA 9LDTA 1D1QA 1TM5E 2VNJA 3AHFA 3VU9A 5CDUA 1Z4JA 4GQBA 3WGMA 2TYSB 2R1VB 1E9FA 2RAVA 4DC0A 2PR7A 2IS6A 4RF3A 2GN0A 3A4YA 4YRFA 1XZDA 3JD1A 3QITA 1Z5ZA 2FZCA 2QRUA 2VJLA 2PUTA 1CE8B 1VYUA 5EZSA 5KX5A 4ZEXA 2O1WA 4F5WA 2QRZA 4KJXA 2RHDA 3DBVO 3R4CA 4N12A 3KEMA 1P7VA 2IIQA 3DDZX 3A7DA 2GPNA 4KXMA 1C1DB 4EYKA 3FOCA 2HU2A 1BMFD 1RSZA 1UXGA 4G5QA 4MA5A 1E7SA 2WE8A 2BMWA 3L77A 3EHDA 3KELA 5BR8B 3RUAA 3P5BA 1BHQ1 3JRWA 3KOMA 2BIFA 3TYXA 3ZU5A 2DBQA 3BIFA 1Q1GA 3NB0A 2PXXA 2ZE6A 1MJGM 1GXSB 3R6GA 2WU3A 4S1WA 3PTLA 4QGAA 3UWPA 4AB1A 3ZTWA 3WGTA 1HTWA 4XU0A 1A9PA 4GS5A 1W52X 4I50F 1JHMA 4PFKA 3URKA 1SHUX 1N36B 3HXYA 1TMKA 3I12A 2R1VA 3KPJA 2G17A 4WNYA 1OROA 3S2YA 3EDCA 4LY3A 3K32A 2HMAA 1HURA 3QU5A 1YQWA 2WPNA 1M2HA 2QLLA 1HDEA 1D5WA 3WBMA 4M1TA 4RD6A 4LRYA 2DTOA 4IYJA 3IVAA 4DSAA 3H8VA 1QZTA 3OI7A 4FN4A 4JH0A 3TQFA 1YU6A 2PBFA 1RI4A 1Z36A 2DY0A 3NBZC 2WJIA 1HXDA 4ZXFA 1Q0RA 3BQ9A 4AYXA 3U44B 4HAIA 5KTSA 2QM7A 1FRFS 3LSSA 4G9BA 2I6FA 1BW9A 4Z49A 4RTJA 1FMLA 1TA0A 1Y3CE 5HBGA 4D7AA 1LBIA 1NC3A 2D4AA 1FW8A 2AEJA 4TVKA 1C8KA 3OWHA 3PXXA 4QFDA 1F0PA 4J03A 2DFVA 4KFRA 4XYMA 5IC5A 1QRUA 1YBAA 5IDYA 1V4BA 4WERA 3IV9A 1CEYA 2WVGA 2E4ZA 1J22A 1FFSA 3SOZA 1XA0A 2ZRLA 4NJEB 1GG8A 1GSOA 4IRMA 5JLAA 4JQSA 4DC1A 2WUDA 1IHYA 1KZ1A 1Q0LA 3BS4A 3HBMA 1OBOA 3A0RB 1GA4A 5CVUA 2I3BA 4A9AA 2PX2A 2YYYA 2WTAA 3GJRA 3U44A 3T1YB 3KXKA 2RE8A 1W49A 3OD1A 3T52A 4DIMA 1NL3A 4EQZA 1BJTA 4FE4A 1T35A 2R00A 4X91A 5PGMA 2Z6QA 3ZQKA 3A6LA 4GICA 4L8YA 1MX9A 1E3TA 3DSCA 1HQDA 3IV6A 1AV6A 1QFZA 1FMTA 2DU8A 4P22A 4E6PA 2XTZA 1AHIA 3PG5A 3A6FA 3G79A 1TQHA 3ZG6A 4DC9A 1UT6A 4XEUA 5EE0A 2G4VA 3IDSA 3WHKA 1SBYA 2RGXA 2E0IA 5L40A 3KYCB 2EWWA 3AR5A 1MB9A 2XTNA 5EWLB 1JA0A 3ZHXA 4JI7B 4J91A 4QBIA 4RDHA 3NWOA 1XQ9A 2HX1A 1CS4C 2UZ3A 3P0JA 4RLSA 4F1JA 3SEFA 4P58A 3H1AA 1AIPA 3HDHA 5FJIA 4IMIB 2QNRA 2QYHA 4RFVA 1X94A 1K9SA 4DR6B 4B7UA 1DPGA 3V8BA 1DG9A 4NPHA 1U1CA 1NBOA 4NCAA 2GH1A 3DYBA 1KO7A 4F9TA 3B6JA 1DWOA 4JI3B 3OPVA 1HDOA 3I28A 4R2KA 2ZR3A 3PUIA 4MS4B 3LMKA 1JSRA 2EEPA 1QCYA 4PPYA 1TEVA 3UIEA 5KINB 3MWJA 2C2KA 2VQSA 5JXIA 3NATA 3E1GA 1ZUWA 4DQ0A 3O21A 1TQ6A 3IJEB 1AB6A 1RYZA 3GPDG 3VBCA 1EFKA 3MINA 1T3ZA 1RI1A 4Z1OA 2IU6A 1VMDA 2DTXA 3RHTA 2MYUA 5FUYA 1KETA 2V5VA 3MOSA 5TS2A 1RZRA 4P1ZA 2D1TA 5BP7A 4YRGA 3ZDQA 3G1TA 2AC7A 3MWGA 3IVCA 4RFLA 4K88A 4KTTE 5I7UA 2ATVA 1VG9B 5K0FA 2EIXA 1ECCA 1ZJ4A 2HLPA 3T3GA 2PDAA 4ZU1X 4AFNA 4D9HA 4KGVA 4M9SA 2EGUA 5J43A 3I30X 3F0TA 4TRRA 3P4YA 1OI4A 4BASA 1P0IA 1GRRA 1Y8QB 2H0QA 3F7NA 3IHLA 2O5RA 3R8FA 4QA9A 3VX4A 4W6QA 4HVCA 1V1RB 1E1RD 1E32A 2ZIUB 2HLDA 1U98A 2XQGA 3WMRA 4BFSA 5FOQA 2YQ4A 2NQ8A 1A8UA 5EMNA 4U7GA 4E5VA 2FTKE 4DFDA 4LGYA 1Q95A 4KI7A 1NSTA 3LX4A 3CW2A 3EVCA 2XTIA 4AH6A 1KDYA 4IIXA 4H35A 2VXBA 4LHEA 4ENQA 4QPZA 2XJ9A 2YZKA 2Q8PA 3O8RA 4UCWA 4ZTUB 1CV2A 2EZUA 3ZR4B 1ABEA 1F0KA 1CSEE 2MSLA 4KNWA 2A0WA 3WO0A 5JT1A 4DR5B 4GU5A 4OU4A 4LXUA 3DYIA 2QORA 3EGXA 1RAEA 3KVNA 4K6KA 3RFCA 1NW6A 4X24A 3VZBA 3FCYA 2VYND 4G4JA 3QKBA 3FYUB 4HUJA 5K1XA 5JECA 1NY6A 4QULA 4OA8A 3S27A 3K0BA 1RKUA 4L4ZA 2YINC 3WO1A 1BROA 3U26A 5K6TA 3WL8A 3COWA 2O52A 3HKDB 3HN7A 3TNDA 1Z12A 4X60A 2FQWA 2WJAA 1O6GA 3FMPB 3X2SA 3S40A 3W9UA 2TECE 1RACA 3H86A 3WLMA 3A25A 1BDBA 3QKSB 2OOSA 2DUMA 4POAA 4BKOA 2ZSUA 1QUEA 4DB4A 3ZCRA 3WYNA 4RHUA 3UJ6A 4F86A 1PD0A 2HHHB 3AK4A 1TECE 4DN6A 1MXHA 3WLSA 3THXB 5E1DA 1SH7A 3B53X 4UOQA 3PFWO 4ZCPA 3UC9A 1B00A 2Q4RA 1GNSA 3QEBZ 3T5AA 4XM1A 3EOZA 3CX8A 1H8ED 4JWTA 5I5EA 3Q87B 1UMDB 5FPTA 1TTQB 1VDZA 1AU9A 3VYSB 4BWAA 5IWAB 4PLPA 2CY0A 2G36A 4OL9A 1Z07A 3D4NA 3CUWA 5DYYA 5HZHA 1SUBA 2FMFA 3L0PA 3AVVA 2P35A 3ABZA 1VR4A 4L27A 4F7WA 1Z4PX 3JTEA 4K6OA 2VSQA 1ZLYA 5C52B 1L1FA 2ODBA 2R47A 2NZXA 1C4KA 1Z2OX 4KL8S 4RHCA 3C6YA 3U4DA 3VSCA 1K5DA 1D09A 4JBIA 3UB4A 4D8UA 3MF2A 3P20A 3WWEA 1U5BA 3TSOA 4OP0A 4C0BA 4GNRA 3VVCA 1J4AA 1PNOA 1DXOA 4IDNA 2QXYA 3TINA 2FMTA 1MDBA 4LYAA 1WUTA 2CZQA 3CX3A 2CZGA 3K0EA 5H8WA 2JGLA 1G8HA 2GJ9A 2YVKA 2JD1A 2ZANA 4GBED 4UULA 2Q6VA 5BUCA 2XMZA 4B82A 5MDHA 4F8EA 4OUKX 3BRWA 4IJQA 1BBWA 4MPDA 1R4MA 3PNSA 1DTSA 2WTBA 1RM3A 2JCSA 4ZYYA 1Y34E 4BLQA 3ZDZB 1Y89A 5JRZA 1LTQA 4P2BA 3CLUD 5E4TA 1XB2A 3ESXA 5TE9A 3WRVA 2MINA 3TVTA 4W5RA 1EUDA 1H66A 1Q5PA 3HYRA 3K9NA 3MM4A 4OHKA 3VH3A 2YUIA 3OMLA 2VNHA 4BXOA 2HZBA 4L95C 2GVNA 5FBZA 4DEVA 1YZYA 3ED5A 4LKOA 2G5GX 3HN6A 4JAVC 4U2CA 1R0XA 4FDAA 1QHEA 1JHDA 4S1PA 1RTTA 1CZHA 1Y37A 1XSEA 3RVOA 2XXJA 4D3YA 2IZ7A 2N1BA 1CWUA 1JR3E 4KREA 4HYEA 4LA4A 5EGSA 4TLMB 3SQLA 2R8XA 2CRQA 1K8RA 1L7VC 4PZAA 5EKTA 1RRMA 3TFOA 2NV0A 3D43A 2O2DA 3ND7A 1MX1A 4U3JB 6YASA 4D0SA 3B52X 5KNBH 2IYWA 1F6DA 1QS0B 2EHJA 3M3HA 3U3MA 2D2XA 2GMWA 5FBVB 2EDCA 7MDHA 1V7QA 4AJLA 1MJGA 4LXHA 4JBHA 4N5HX 3SC2B 4B3RB 1VFNA 1TJ3A 5DW3A 1OC2A 2WHRA 1ZINA 3NBYC 4U5XA 2AKAB 3ITNA 1MDFA 4L4YA 5EZ6B 4DEXA 1G8GA 3F6YA 3M33A 1GZDA 4RLFA 4EIWA 4C89A 4RETA 3EVDA 1XCOA 1UZLA 3Q7RA 4ZTBA 3WRXC 1ILEA 2WABA 3RYHB 2A9OA 4E5KA 4D41A 5AUPB 2QL7A 2GLTA 4BQEA 4I5FA 2G80A 2BFDB 3QBEA 1MRZA 4HDCA 4G41A 4MQUA 4BATA 4EX6A 2GJ8A 3NBQA 4IL5A 4X20A 4C6HA 1DG1G 1ZW6A 2YFKA 2NU6B 5HS4A 2A1IA 2HJRA 1L4NA 1DTWA 2D2IA 1DCKA 3ND9A 4P93A 3REXA 5CLIA 4YIKA 5B55A 4FGLA 5JCZA 3UHPA 4BX8A 1N2JA 1R5NA 1WDMA 2R6CA 3PRKE 4NJOA 1OREA 2XA1A 3DF9A 3EB9A 5D3QA 5LZ8A 4YQFA 1SXPA 4DIBA 3FUWA 3CZCA 5THQA 4XVCA 4MZXA 3UQZA 3SYMA 4U2BA 4D9NA 3SKXA 1JKXA 2C83A 2OBFA 3X1MA 4YJ3A 1IZ0A 5ALJA 2XXAA 3PGMA 4V0ME 5CH3A 3H6KA 3VTFA 3SQMA 3C6XA 4YGXB 3V4VB 4AKSA 3BMCB 4E5PA 2PX0A 2RHQA 1YMQA 5BSEA 2YBEA 1ZVMA 1NSFA 3OM0A 1FYFA 4LV8B 4R9NA 3NONA 2P1DA 1KZ6A 3GLRA 1SXQA 1P0FA 1REQA 1MC5A 4D0LB 3NPAA 3D8HA 5EMLA 2Q3FA 1P7WA 2C5LA 4CCYA 4DLVA 1RCFA 2FEPA 1E66A 2Z8ZA 4WOBA 1QP4A 2B2NA 3OPNA 3OZAA 3GROA 1DRJA 5CH5A 4EUNA 4ML3A 1KFKB 1GCGA 4IIVA 2PLFA 4I9FA 4HCJA 4M1MA 4RYLA 2X1LA 1ZK4A 2MU1A 2OVFA 4G1EB 4C2BA 5DH9A 4ZEVA 4KFCA 4PN7A 2VCEA 1MNQA 1YXMA 2XNHA 1A2BA 3ADPA 5IZ4A 1KH3A 5J2TB 2HSWA 5HZKA 2EZ9A 1A77A 2G70A 1GD1O 4NE7A 2AN5A 4NS1A 2CW5A 5KYWA 4R1MA 1U8FO 2YHAA 4KIUA 4MQMA 2VK4A 1TJ4A 2G6TA 3U61B 3P04A 1XQXA 1IDN1 1KZHA 5BQ5A 2CUZA 3BSSA 4TRJA 1W581 1VMAA 3G5AA 4DUGA 3PFKA 1BH2A 1OC4A 2DYKA 2BUAA 3HHPA 3UAWA 2YOGA 1WDWB 4RTSA 2JKYA 3LPMA 4XASA 2WZDA 3I61A 3HJAA 4CIVA 4FN5A 2XVMA 4JJIA 3MSXA 4MR8A 1YIDA 4BKPA 1WUJS 4J3FA 3RTEA 4A5OA 4UEQA 1XKLA 3KAQA 4GQAA 2YMPA 5J63A 3ZCSA 2WT8A 4D6YA 2YL2A 4EFDA 3EQ2A 3JQ6A 2OYCA 2KS6A 1SUCA 1P4SA 2BFMA 4HS9A 4JWKA 1JBKA 3HL0A 3CX4A 3JVIA 4OXKA 1KQFA 1W2WB 3CRW1 2KMLA 3ZCTA 1EQAA 4JT4A 4ZAFA 1UMBA 4OHRA 5K6AA 1FX0A 2Y0BA 3O8NA 4JXJA 3CNNA 1Q22A 2Y1XA 5ALWA 3O3MB 5IKOA 5LKAA 2XUOA 3TPFA 1NAIA 4LOIA 4TXNA 3DGEC 5ED4A 1KNQA 2YWFA 1HI9A 4QXPA 3RKRA 5JJKA 4GOOD 2I4LA 3OEHA 2W2TA 3QLVC 2BF7A 2IYPA 4S0ZA 1UBSB 2HM7A 2VC2B 3QWAA 4HYYA 4J15A 1M54A 1M1NA 1CZKA 1G63A 4Y1RA 5AVUA 3B1KA 2O07A 4WK6A 3T3PB 3UW3A 2G9ZA 4ME6A 2Q5HA 1CZLA 1SVOA 4RH1A 1RR6A 3L18A 3ENNA 1JB9A 2FZGA 1A9RA 3QTTA 1I33A 4J0EA 1OXVA 2B83A 3UFXA 3K6SA 1W36D 1N33B 2R7KA 4P36A 1TE2A 1O5OA 2GZSA 1DIAA 5B5SA 1ABFA 3IVGA 2NU6A 4UTRA 2NO1A 2PZMA 2AS0A 1X19A 2PJUA 1T0IA 2ZE7A 4JR1A 5CEFA 3NHLA 4HWOA 4QOJA 4YAUA 2N0SA 3NXSA 4E3ZA 4MUYA 4JNKA 2CYCA 2HJGA 4KRXA 4CV3A 1U2TA 1G2QA 1LK0A 3BICA 3P5SA 5H1YA 1ZK3A 4HGNA 2DZDA 2ZTVA 3KT8A 2BI8A 2IYLD 4HUQB 4BIMA 1QO0D 2AC2A 2AFIB 4QGFA 3THSA 4F56A 2SNIE 1XCBA 2BP7A 1Y63A 2ZULA 2X0FA 1RAAA 2H17A 3LT1A 3VZCA 4CW7A 3KAPA 2Q3HA 2BF4A 2WWTA 1P1HA 2FF5A 3VYRB 4FZVA 1GYQA 4TT3A 3O82A 4DDHA 5A06A 1LLCA 3ADKA 3H5WA 1KVRA 2AG1A 4BNFA 1RXSA 2GK4A 3ESCA 4NY1A 1RCTE 1TKRA 1XIVA 4L9RA 4E1BA 2F3RA 5J47A 1TMOA 4QOHA 1EX9A 4BE7B 2DFLA 4DNQA 5DULA 4H2WA 1IHUA 4EAQA 4URZR 2VDWA 1C4OA 3EWAA 4AX8A 1MT3A 1O94A 4L5BA 4XM0A 2ZAOA 3WKDA 1RKXA 4DKJA 1ESEA 1K7YA 4P73A 5HDBB 1M8FA 1RQNA 3M8KA 4PLHA 4EKEA 5CFMA 5DBHX 3TB6A 3E22A 3SWWA 1DDIA 3GVCA 4RGBA 4Y18A 3CJTA 4UBKA 2WHPB 2GZAA 4B8ZA 1H8EA 5EP3A 2GAIA 2P6MA 2CEAA 4PFSA 1Z0IA 3U3JA 4CIBA 5L95A 4RJJA 4O5OA 1VLVA 3IJRA 3ZWMA 1ZH0A 3KEQA 2KLBA 3B6ZA 2PGNA 4JJZA 5EG5A 1C30A 1THTA 3BEDA 1AA9A 1QK3A 1XZMA 1Z8FA 2YXLA 2C7VA 3EOAI 3PF8A 4IFIA 5L6LB 5K3AA 2QBYB 1PQUA 3UHAA 3NTUA 3IAHA 4KKVA 3WL7A 5ADHA 4H3HB 3QUSA 5IARA 2YWEA 4JDPA 5CW2A 3VO2A 2OKCA 4LZOA 4KU4A 1TAHA 1C81A 1ENOA 3H2ZA 2V0CA 3BKXA 5IAEA 3LHIA 4XARA 3OOYA 5IMBA 2O8BB 5FI5A 4Q82A 4B34A 3LWBA 1E8NA 2OD9A 2JHGA 4XPIB 4Y2UA 4HWSA 2F9LA 3U7RA 2DOKA 1YULA 1ZCFA 1XKQA 1TYAE 3I2KA 3TPZA 4L4UA 1Q12A 4RJIA 1C9YA 1QHXA 1HDXA 1QGUB 3OLVA 3LIPA 4DTCA 1IN5A 4F3CA 5KJFA 3LYAA 3UBTA 1QB7A 1SXGA 2C9DA 3G02A 3VYWA 4ROSA 4JB3A 4MYHA 2Z7CA 4GSKA 2LTAA 2GCNA 2QRJA 1F17A 2V6GA 4PWYA 2JZOA 1NT2A 2HEGA 2V65A 1O4WA 3Q8WA 4IBOA 4EZEA 1IVYA 3N2NA 1T6BY 4YXFA 1BW9B 4ZO9A 2C4NA 2VA8A 2FKAA 2YQZA 3HXUA 2QKYA 1KVTA 3ANSA 5TPZA 4ZICA 5KS2A 3U7HB 1KI1A 3OX2A 4HXYA 2HCRA 2BDTA 2HIAA 2QNBA 3PICA 4CEJA 3LPNA 1FDTA 1WSAA 1K5GA 4G4GA 4UPVA 4IQ8A 3FTQA 1CQIA 3JQFA 3V8QA 6AT1A 1T43A 3ROQA 3HXLA 2RK4A 1GGHA 3D7NA 1EAMA 1ZM4A 2XRMA 1BKSB 2DEUA 5CTJA 5CLJA 3VDQA 3GJ3A 3TRJA 2XAUA 3IBFA 3AVTA 4NZYA 3RTAA 2EJWA 2WJZB 4OP2A 4WBNF 3AZPA 2Q3JA 5AK0A 2PMEA 1SKYB 1HLGA 1CF2O 1IG3A 3FPSA 1P4HA 3UY4A 4RANA 2BD0A 3MJRA 4L5IA 4RKWA 3SE0A 1MAWA 4Q7MB 1WB9A 5D86A 2J08A 4LNUA 3NHBA 3EF0A 4DLUA 3SIRA 2BEUB 1GQFA 4OHPA 3LE8A 1WQ3A 4Q3AA 2CLMB 5A5DA 4HPJB 2XRYA 3USZA 4EY6A 1FMFA 1DTEA 2FZ5A 3BGSA 2J4DA 3CLTC 1NFFA 4KNYA 2G77B 4EUHA 1QGAA 1IUKA 3KKEA 4RY8A 4C05A 1NASA 2OOKA 3G2OA 3W7BA 1R8JA 5B3KA 1Y1PA 3PV0A 4QFCA 3LQRA 5IAAA 1OGIA 5FBWB 4IG9A 3NVDA 4JCOA 3VMMA 1YDMA 4O4LA 5BSWA 4EJ6A 2P62A 3D2BA 1GHTA 3MWEA 1FB5A 1QH0A 1FZTA 2VZ0A 5BV2P 3T7AA 3HB1A 3R5KA 3UEOA 1SO8A 5ELLA 4DLBA 2JJ2D 3M6UA 1U81A 1HKUA 3L4KA 4GIBA 1WSDA 3E9RA 5KOHA 5C32A 1F48A 1W44A 1IONA 3ORHA 3PXBA 3MUNA 1J8MF 4ACAA 3HDTA 2FW0A 3EY9A 2G76A 3I1IA 4DLNA 2QLTA 1Q2UA 4L22A 1RBYA 1UKEA 3KVVA 2G40A 1GUYA 4J7UA 4U4AA 3TTSA 4LHXA 1FFXA 4HTAA 4N0DA 2YX1A 1RFGE 1KPGA 5BMOA 4L75A 1NC1A 1WQ4A 4XB2A 7REQA 4WNIA 1CUSA 1NSYA 4YFVA 3PFCA 1BEEA 2CL6X 3KJQA 3H8JA 4X1KA 4XYLA 4HWKA 4RVGA 2O3SA 2CJPA 3CB2A 5GV8A 3FLAA 3JYHA 2PVCA 3PFHA 2HL6A 1N2XA 1RWOA 3R0IA 4XLTA 3GGSA 4A8JB 2CJ9A 1W5TA 2YXNA 4LDNA 5J5AA 3CE9A 2X0RA 2Q99A 1XVUA 2ZTUA 3ZHBA 4CH3A 4IOJA 4WOKA 3TI9A 2F2TA 1Z06A 3S68A 1IN6A 1XEXA 1XNHA 1A95A 3QXSA 3RHSA 2G83A 2ZSJA 5JSYA 3EZ2A 1SVWA 1YQGA 4JHXA 4L57A 2NXNA 3E7DA 3ENVA 1E9RA 1SUEA 1VCIA 1MABB 1XQ1A 1EFHA 2JFPA 3C87A 3NORA 4JT2A 4RSMA 3GJXC 1NATA 4RFSA 5C34B 4TKZA 2V8OA 4PPNA 3AYXB 2A4MA 5ES4B 5D5PA 3ZD7A 2AC4A 2GK3A 2NUPA 3DSQA 1L5ZA 3PHLA 4DV1B 1EEXB 1P72A 4GPBA 3AHEA 2FJUA 4I50B 4RZSA 4COOA 2AOWA 2VDPB 4PPQA 1CRWG 1M67A 2EATA 1RPNA 5HIJA 4EVIA 3A11A 4Z4GA 4FYWA 4ZO4A 3TL2A 4FHDA 4EHAA 3DMNA 5F7JA 2QE7A 3T5TA 2B98A 3A1EA 3Q0TA 1VE6A 2OHVA 4TYYA 4OQZA 4WT7A 5C18A 4BZWA 3FGPA 3EUAA 1LCIA 4HDSA 3F97A 3T5GA 1NHGA 3O1JC 2OK7A 2CHQA 2H4FA 3QRWA 3A9RA 1UQTA 3ESAA 3ZJYA 3HZOA 1CFZA 1X42A 4GOLD 4WOJA 3HCWA 5F78A 4A6XA 2O8VA 1PKXA 1O77A 1CR2A 1TPYA 2CFTA 2Y66A 4CL0A 4F4DA 2LXNA 2VATA 4IDFA 1G4HA 1K6IA 3IAXA 4CUKA 4G1MB 4WJZA 5E38A 1PR9A 3D0QA 4I50A 4YUZA 3VZPA 4LE0A 1ZD5A 3WR5A 4ZT7A 2XWSA 3Q1KA 5CB0A 1MOQA 1E96A 2IBMA 5IFLA 3L8GA 4EGJA 1PR1A 5BPFA 4FLEA 1XA4A 2ZYUX 3WG9A 5JMTA 3SSNA 1FBTA 3NBUA 3S55A 1NMQA 3KP1A 4B3CA 1D3AA 2EV9A 2F8LA 1LI5A 4C0SA 5KIAA 2QRMA 4L73A 3IQZA 1JDBC 1M3SA 3BBPA 3IT3A 1JBEA 1K7CA 2CYBA 3VNBA 1NW9B 1TM3E 1MW8X 1Q6YA 2WM9B 2E89A 4HEJA 3P9IA 2Z2JA 1NURA 3AFOA 4OQXA 1XZQA 2GTPA 1V47A 4NTZA 3WYCA 2XNJA 2LW7A 1KC1A 5LP6F 3H42B 1O5IA 4UNRA 2V59A 1Q6ZA 3ABSB 4FM9A 2ACVA 2XF8A 3HO1A 4E3WA 4XTWA 1NI4B 3M2PA 4HN2A 5B2ZA 4AJHA 2HSDA 1WNTA 2EEZA 4IDDA 1E0AA 2FDXA 1UXKA 4EARA 4Q3OA 4IVPA 1Q57A 3MJDA 4QDTA 4R16A 5TR9A 2JH8A 3CKMA 2IXEA 1E1CB 1X1CA 2C0PA 2WJYA 3CPEA 3KYDB 5B7GA 2XVYA 5BV8A 4IF4A 3TFWA 5JFGA 1J5PA 1Y1SA 5EPOA 1WZUA 3LSYA 4HMPA 3IDAA 1P7ZA 2WR8A 1UBLS 2EP7A 4G65A 1U3DA 1I3MA 1QIKA 1UZAA 4DNXA 5BSVA 3ZLUA 1CRZA 2RHSB 1M8GA 3LXUX 4AAYA 3R3SA 3TKYA 1EK1A 1EJ2A 1FYXA 4G5OA 4X65B 5FNVF 1NXQA 3EWSA 5CXQA 3CTMA 3RUFA 1IVSA 1IEWA 5G0WA 2P91A 1RLMA 3I3OA 1Q11A 5CK5A 1U0SY 2IEYA 3PFGA 1G42A 4BFUA 5JEDA 2XT9A 4B3FX 1GU0A 1XXHA 4PG5A 1TIKA 2IV3A 1EEHA 2RGWA 5EJ6A 3DFIA 4L0MA 3F6RA 4J0KA 2QLMA 3U4CA 4WLVA 4Q39A 4DRZA 4JP2A 4B44A 3WRYC 2XZLA 1P62B 1WXFA 1YCFA 2FV8A 3CVJA 5EZ5A 1OV4A 2A0KA 2DH6A 3UUWA 3HFJA 4Q66C 1V11A 1TZ2A 5IJZA 2D06A 3IHWA 5AM5A 3BXHA 3X2FA 1PVDA 2F3TA 3AR3A 1QSGA 1L5LA 3DZGA 3FVWA 3JQ8A 2GAJA 2XY4A 4NL4H 1IWPB 2QT1A 4AUMA 2HMTA 3N3BC 2HNBA 3QA3E 4QRHA 4DA7A 5LQJA 4YRQA 2P0LA 1WLYA 4G01B 5REQB 1NVAA 1SBCA 2IE0A 3V4OA 1JBQA 2WKQA 1W1WA 2GHIA 2XA9A 4NZMA 3ZIAD 3E9MA 1ISIA 2EF1A 4XVRA 4ALMA 4N3NA 4PIVA 1ARZA 1P1KA 5KAMA 3SLKA 2OO5C 4BMOB 1ZWKA 2D5AA 1FX0B 4G8CA 1QP7A 4RS3A 5LQAA 3WA6A 1IL2A 4BL5A 4DLAA 1S3GA 3V9PA 3EA5A 2YZNA 4OHZA 3MFYA 4HTFA 3DB2A 3M5CA 4CZ2A 4DM4A 1QAOA 2OAEA 4IEEA 3U9TA 4BQSA 4OA5A 4EMTA 4LI3X 5HA5A 3R3ZA 1DSSG 3TQOA 2Y68A 1H4SA 3JYOA 4E4RA 5TT0A 2QLJA 1XMQB 2C5GA 5ILGA 2ZSBA 2RAPA 4WN9A 2VOJA 3M0EA 2Z0MA 3TD2A 1H3EA 2D1RA 1TT5B 3FMVA 2JFXA 4Z9YA 1GAQA 4PTZA 4QUAA 4H16A 4QXMA 3SJAA 2DZ9A 3ABRB 1L9KA 3K0FA 4FR2A 3K6KA 5DO9A 1OTHA 4DGSA 5LIPA 1OY1A 1G41A 2FX3A 3ANMA 4FMBB 4P75A 4LMRA 5FR1A 3AQ4A 2Z4RA 4PINA 3FCCA 1HZZA 1XRLA 1V8OA 3P94A 5AI5A 3VU1A 4LCEA 3E1SA 4R1NA 3TR0A 4DT1B 4U7TB 2QL6A 4Q7EA 2FZWA 3ORQA 3PIIA 1WXEA 4MUAA 4RPGA 4IM7A 4BEJA 3DKPA 3UMSA 3L0DA 4X7BA 4URVR 1RZVA 2QTFA 3GGPA 4Q5IA 3TBHA 4B5LA 2D1QA 2E49A 5ECDA 5BY2A 5LDHA 2CNOA 2EX0A 4HNGA 3MAGA 2R8EA 1Y9JA 1BMDA 4DDKA 3R9KA 3R20A 1JLLA 3QKUA 2D2EA 1XVAA 4C0KA 2GN6A 4CKWB 2FZLA 2GVZC 2OC4A 1T9KA 3BE4A 3IILA 5CNJA 4BNHA 4YV2A 2V6MA 3AI1A 4NU5A 1SBHA 1UPCA 3NRJA 3QFSA 3VR6A 2ID7A 4KN9S 4UVHA 3HU2A 1NVXQ 5A4MS 5HKAA 3OFNA 5ALNA 2J9YB 3LFHA 3UJ3X 1LJ8A 2H4ZA 2GD2A 4S1TA 5HKOA 3VSBA 1M1YA 3A2LA 3D59A 3ZU6A 2BI4A 2H2DA 1UCFA 5GM1A 4BFZA 4UP7A 3IXLA 4HQ0A 4LF6B 3ZZNA 1EQUA 2GLUA 4URFA 4GG1A 4QLOA 1NW7A 4O59O 4DJDC 2IXGA 3FVVA 3SFTA 4II3A 1CDEA 2G08A 1ZGZA 3DBOB 2VFAA 3CLUC 4K8RB 2COUA 2IC5A 4RHYA 3KB6A 3SQXA 2YN2A 2C59A 3LF2A 4KQ1A 4OI4A 1ZEJA 4ZO7A 5LCXA 5IT0A 3IRVA 1Y6ZA 3QVGA 4GH5A 1TD1A 4QWWA 2MMGA 4V1CI 3MTAA 5A3QA 5KJCA 1FJXA 3GX1A 1BYUA 2VF8A 1Y5MA 4M1QA 5GJBA 1IB0A 1KK1A 2OUIA 4YQYA 1I5EA 3DOIA 3I2HA 5LUBA 3N2ZB 2POQX 1AUPA 1YMUA 4RMNA 4CMEC 5JD3A 1ORWA 5EIAA 3I64A 2ZUBA 3NJ8A 4ALNA 5ALZA 5IAGA 2R5WA 2JD2A 3L6CA 4J2OA 2OD2A 3GVIA 3OZVA 3VGPA 1N5MA 4E14A 1H6DA 2DAPA 3L7BA 3NO4A 1GP2A 4MYCA 1AHPA 1JH8A 2G6BA 2FH5B 2ZIXA 4MV4A 2DT8A 1BCRA 1P2DA 2HA6A 4P71A 3AEKB 3IR6A 1OFUA 3GPIA 2OT3B 1FSFA 4PLTA 4R01A 2FN4A 4RZ3A 5DCWA 4C03A 3THYB 5KAPA 4MWDA 2ZGWA 3DEZA 3P52A 1ZMTA 1LZKA 3LZCA 5F77A 3E4CA 4NNOA 4G5YA 3REQA 4BVEA 1E9AA 1T5SA 3GIDA 4OAOA 1HE3A 4DTIA 3OWXA 1L7OA 2PGOA 1ZSVA 1HMYA 3MWYW 2GHTA 4QD3A 1E5VA 3T12A 3OUZA 5CB6A 1U7ZA 3C6KA 2VTDA 3A32A 3GLHB 1A9ZA 5HCIA 3CW9A 3KKNA 5ALEA 2DTDA 2XHZA 1BIBA 4YMGA 1E9BA 3AHHA 1A8SA 2OYSA 4D46A 2ZIAA 1JT9A 2H2GA 4IMJB 4DCGA 3Q5GA 3I6ZA 4JEMA 3V7FA 3KJNA 4MS3B 3MQFA 4HPWA 2IU4A 2AIRA 1XDGA 2PSEA 4URUR 5L6MB 4RNDB 1JV2B 4YT8A 4Z4QA 4Z2AA 2V7TA 1SERA 1N9GA 1TVCA 2ONYA 3A9VA 3FA2A 2B2XA 3P2MA 3JQGB 4EBBA 5JJBA 2NVOA 3H11A 2G1JA 2Z83A 2WU1A 3I4CA 1XDDA 4WKOA 3S6JA 4Z1MD 4R40A 3B1YA 5H9VA 3K1AB 3HVHA 1VFPA 4TVYA 4Q48A 1Z26A 4WE3A 2XGTA 3PXDA 3RSFA 5I3CA 4KPEC 4YLEA 2QX4A 1E5TA 3IPRA 4PX5A 3RBAA 4AMUA 3VH2A 1MAAA 4MSUA 4P32A 1XD9A 1EWKA 3AX6A 5LDDC 4GI7A 4TWJA 1JJCA 4XPIA 4WZAB 4F93B 5E9QA 2PAAA 1SCBA 4C7KA 1NQXA 1QV6A 2VJBA 3SHFA 1ODCA 3NC1C 3W79A 4MR7B 3AGQA 3E48A 3R09A 4EA7A 2FW7A 3VR3D 1UEIA 4TMYA 4AJNA 2EW8A 2NXWA 3R74A 1JFTA 5ED0A 1V8FA 3HKCB 2W6MA 3KD3A 1P1IA 3KC2A 5DBFA 1QG4A 4DPLA 2AFRA 3LU1A 1JF8A 1NA5A 5AKEA 1K06A 2EYQA 3Q5DA 4JMLA 4A1FA 4M6WB 2FEMA 1UPXA 4RVCA 1DE0A 5E7MA 1HEYA 2YC2C 2GLXA 1N9GB 2F43B 3ETCA 4ZRNA 5GJVC 2BRUA 3TLMA 2F67A 1KZ9A 1Y4ZA 3I1YA 1AGRA 1GG5A 5C0OE 2DJ5A 4G0ZA 1QPGA 4RQAA 1P9WA 2W0MA 3FYTA 2VP0A 3QW2A 4EVSA 1F38A 1DP4A 2ZPTX 3RVMA 1HZZC 1Z83A 3TUJC 1HNWB 1EFRA 4M4SA 1JZTA 2ZR7A 3QWIA 2VWHA 5KCMA 2IYRA 4LVMA 4UTNA 1QWSA 1O57A 1XDSA 1X7WB 4UM9B 3ZE0B 1J1IA 3AEUB 2OBLA 3HCDA 3P97A 1B7YA 1I6MA 1GL3A 3G0DA 1M34E 3OEWA 1C4WA 2GVDC 1PVOA 2JCXA 3WK4A 5HW0A 1SOVA 1ZRHA 4B3DA 5KPJA 4WKPA 2QA5A 3BXOA 4Z7JA 4CI0B 5HGXA 3E84A 1ZP6A 1OWOA 3EVZA 1SC4A 1DKLA 3DPSA 5BN4B 1KAHA 1FFCA 4PZCA 2NU8A 4A2PA 2Q1TA 3BQMB 4N49A 4WCVA 3LCRA 4XVQA 4FYXA 3BZBA 3FCEA 2UUAB 1WXXA 5TF4A 1XP8A 9ABPA 2C2ZA 5L4LA 4FEYA 1FJ2A 4CMIA 3CWCA 4HPXB 4PG7A 2HLNA 3HABA 4XWAA 3RC9A 2A0YA 2YFQA 1JSCA 2I7TA 5K01A 2CFOA 4P38A 1DAFA 2WKPA 4INJA 3TEJA 3WNQA 3CG4A 5FUVA 4R54A 1P4JA 3GRCA 3Q12A 2MCFA 2FJ0A 2QB5A 4R0MA 2XECA 1I1OA 4QBHA 4YAEA 2WNIA 4KXQA 4K26A 4X92A 4UHEA 5ISMA 2H9YA 3JQ9A 1ACLA 1GT91 4GR4A 4W5JA 3SEZA 1E2MA 2E87A 3PEWA 2HA5A 1CCWA 1JR2A 1WCYA 3G0BA 1R00A 4V02A 1P2FA 5IVKA 2OCLA 4FGUA 2I2CA 4HDKB 4YR7A 5BQOA 1QZXA 4B7AA 3KR2A 2Q7HA 2IBSA 3QVWA 1ZR4A 4QM6A 3BIOA 5H3LA 3GDHA 4GEGA 4P72C 2VEDA 4UARA 1W5AA 1QPBA 4OMFG 5EMKA 3INRA 1LWNA 4YEDA 2IKSA 5JALA 4LUCA 3HA5A 4IGAA 2RHGB 2RK3A 4IF6A 2H9IA 4X1KB 2H1HA 2W48A 1GTG1 2X40A 3L8MA 5F33A 3V7RA 1XALA 5K3EA 5IYZB 2APJA 2SKDA 1Z0SA 1V0JA 5JZOA 3GJSA 1P4AA 1F60A 1KK0A 5M29A 4OBXA 3PLAE 5EIXA 2Z2YA 3DE6X 4GOJA 3GZJA 5DN9A 3RAEC 4IYRA 2GF0A 2OPBA 5B1HA 1G7CA 1W1UA 5BMVA 3MG9A 2XIJA 4XPZA 1JJVA 4EBFA 1CIJA 3HHEA 2DQ4A 3UA3A 1G8FA 3LPAA 4MP8A 4OKSA 3OTOB 3B36A 4WF2A 5C1IA 4A27A 1V7CA 4MO2A 3VBEA 3QFFA 3RU3A 4L6CA 2A35A 2ZJ1A 3WWDA 1JJAA 3TBKA 3EARA 5KX5B 1E3EA 3FM9A 1OPRA 1NJ6A 3PHBE 2DG2A 5AUNB 2ZUSA 4UDYX 1JYEA 1GZUA 2YXBA 3K96A 1PK9A 3N8KA 4BNMA 1U9IA 1MW9X 1U3UA 2F43A 2FQQA 1GL7A 1QFSA 3ND6A 3VVLA 1K66A 3IBTA 4DMRA 1NNHA 2XYRA 3N7AA 4UVEA 2IYUA 4MGEA 4BCDA 1Z16A 3AERA 3ZGYA 4BLTA 3ZTYA 4CDRA 1XDWA 2JJYA 4KQHA 1V8ZA 2VYVD 1GZSA 2Y4NA 3OY2A 1ASZA 1FYEA 1SIBE 2VH5R 4HAOA 1TDJA 4H15A 3PNKA 1KMMA 1LJUA 2QT0A 4UREA 5CYOA 1B3BA 5BNFA 3WQHA 1PW7A 1WE2A 5D7NA 1U2EA 4H2XB 4RL4A 1TKBA 4EKDA 1GEGA 4XWWA 1O0SA 1TI7A 1ZITA 2DHCA 2WFLB 5F4ZA 3S44A 5YASA 2AMLA 5AKYA 3VKWA 3ZNOA 4EG6A 3UGJA 3QYJA 4YAJA 1KK3A 5J4VA 2QHXA 1P74A 3H05A 1NRIA 5DWDA 2GYUA 3KWMA 5KYYB 4PIPA 4LJRA 4TQDA 5AKGA 4CMGA 1N6IA 4LDAA 3WP0A 5KYUB 4DUZB 3BVPA 3CLSD 2NAPA 1QLJA 1QIHA 2BLLA 2R1TB 1H6AA 2XRZA 4ETWA 5IG2A 4HAUA 4I5DA 1C7IA 1LPBB 2BAGA 3RVPA 3TTWA 5TARA 3B5EA 3VGJA 2E10A 3B3FA 1M0EA 3RGGA 1PZHA 5C4GB 3QFTA 1CJMA 4FHCA 2Z9CA 1RWMA 1UBOS 4GDFA 1AJEA 1Q84A 4JX9A 2Q3MA 4Y1GA 4RMFA 1I9CA 2W6ZA 1DXYA 2F17A 2H9AA 5TDHA 4F96A 2BFCB 1RZRD 4BEBA 4EVQA 3HXZA 4DCOA 2R0QC 2JIQA 3B3JA 3P0IA 4LC1A 3T0GA 1XRQA 2QJTA 3HDQA 3JR7A 2IDMA 3ZE8A 2HCTA 5AUOB 4O1HA 4JVLA 3L07A 1FFWA 4QYIA 4D5GA 3J81k 1LD3A 3C1AA 4JUCA 4RA9B 4JXXA 5TVKA 2VDMB 3GWGA 3PGJA 1MB3A 5F51A 5B7PA 4R3WA 4CUZA 4G26A 3H9GA 5KJ1A 1PR4A 4KAAA 1EG7A 3R4VA 4Y9TA 4Q4LA 3RS4A 1GPYA 2H1WA 3JQAD 3L41A 1Z6XA 1CUXA 3M81A 4I55B 1C3JA 2CV0A 1AURA 3HTZA 2VYFA 3JQBC 3P9KA 4OO3A 3H5VA 4WUVA 4YAWA 3STTA 1JHOA 5JPCA 1XA3A 1DWPA 4IGIA 3M83A 4M36A 5F5LA 1G8JA 1U63A 5ALHA 4S05A 1OSNA 3AETA 3QELA 4XTCS 3PLNA 3HB7A 4A26A 1EHIA 4YRMA 1N7IA 2B5VA 4BZZA 2IXDA 3L40A 1VL5A 4ZOLA 2ZBPA 4IPTA 3WTCA 3ZQUA 4CRWB 3NJ4A 2P6UA 1R0BA 1Z2DA 2ZNJA 4EKNB 3KQQA 3PQ5A 1WW3A 3UMMA 2ZLBA 1VGVA 2A67A 4LQ4A 1ZNZA 3EMVA 4UW9A 3QSYA 1QG6A 1C0KA 4KH1A 1I3NA 2VHYA 1S01A 4RM2A 5AO9A 1JXAA 4U7DA 3I09A 1I6WA 4TYMA 5KYVA 2CLFB 3A05A 1H93A 3MXOA 3HWRA 2IQ5A 2OM2A 5AJUA 3ZBTA 2A2YA 4N4AA 2GZ3A 3PKIA 4P53A 5J2UF 2LIPA 1A9OA 3PU6A 1A8QA 4LPSA 2XPCA 3INYA 1QGOA 5HX7A 4DPKA 2VDWB 3SZUA 2R66A 3CW8X 3ISVA 1QMPA 4IWNA 1PZNA 1ODLA 4HH3C 4TZ6A 5HKKD 4BB5A 4RTMA 1I94B 4FFSA 3SY8A 1OWNA 3F6EX 3LNCA 4LXGA 3NTQA 1X7YB 1MXFA 1Z82A 4Q12A 4GKVA 1BD4A 1XAJA 1U7OA 4OK5A 1FDIA 3HXKA 1RWKA 1PR0A 1KVQA 2GKGA 2DF8A 3DHNA 4QGGA 2PD4A 1YE3A 1UBCA 1U1EA 1O03A 1D4ZA 2J09A 4IWYA 5D6NA 1T9AA 5HS6A 6CHYA 1WX1A 2FFQA 4FOPA 4ZEOA 1CZOA 1GSHA 4R8VA 1SELA 2JL1A 2FSFA 3SC4A 3W8EA 1B14A 2PGAA 4B3XA 3WOVA 1W88B 5ARBA 1IY0A 3BJMA 1LFDB 1J23A 2DC1A 3DL2A 4XFDA 2IVZA 4BP8A 3HI6A 4JELA 5B6PA 4BB0A 5K03A 1AKNA 1QH8B 3V3TA 1GG2A 2A2ZA 2JGDB 4ZMSA 1Y7HA 5SYNA 4NDNE 3WC4A 1E24A 2HR1A 1Q7GA 4FYIA 3MLBA 3IAEA 2CDRA 4KSCA 1BMQA 2FZEA 4OPMA 1RPTA 1NJSA 1U0EA 1XL1A 4JJGA 4JP8A 4F6CA 2X0IA 1SB8A 2RJ3A 2OZLA 1ZGHA 1X1RA 3PHJA 1KP2A 2FSSA 3TOEA 3GUYA 2GA9A 2ZRNA 4IJWA 2PV0A 3QTCA 1ULAA 2HEIA 5HOEA 2OAP1 1TU3A 5K0JA 2PD3A 3DTYA 1Q0HA 4CL2A 1DG3A 1XLTA 3JWPA 3MUFA 4KE6A 2XZDA 1YSCA 5CBPA 3X43A 1EVKA 3AG5A 3GGGA 4ZVOA 5KDDA 1ZH4A 5C5CA 1Z0UA 2JJMA 1N0UA 4FFDA 2FY8A 4MA0A 4RCVA 1GQSA 3ZWPA 2O50A 4J0CA 3BRSA 2JD0A 2YZ7A 3IAS6 2H2WA 2OBYA 2PZKA 3A2MA 1JEJA 4RGQA 4GRIA 4OSPA 3TOSA 4CTOA 4PG4A 1B16A 2WIGA 4A0FA 4KIWA 1UH5A 1NDQA 1WS6A 3BCUA 4ZT5A 1UBRS 2PHZA 1RPJA 2GGSA 3KX2A 4M1ZA 3DLHA 2ZYRA 2EQBA 2QZSA 1JHZA 3GEIA 3L1JA 4PZ9A 2IYFA 2QMQA 1PL0A 2FEOA 4D57A 1ZHOA 3CZ9A 4TTPA 3SQNA 3I8OA 5FPYA 3Q7PA 4PEVA 2HT1A 4K5QA 2GESA 4TVOA 1T0BA 1U0TA 1EJ0A 2PA3A 4GBGA 4AKHA 3O75A 1SA0B 5CT4A 4R8RA 5CG1A 1E89A 1PQWA 3TKLA 2Q5QA 3TAUA 1UOPA 4PSAA 3EUFA 2FPPA 2PBRA 5EI5A 2HF2A 4B6PA 7MHTA 3AKEA 3RG2A 3KJIA 3GJZA 1GPNA 2HCBA 2HUPA 1G21A 2VZEA 2E9SA 4KP7A 3D6NB 1UPFA 2ZJ4A 1ZK2A 2VJQA 3QPCA 3U3ZA 4JV5B 2JGDA 2IUEA 2CK3D 1HK7A 3V7NA 2Q2OA 1UMCB 5AXCA 2WJ3A 5K0BA 2BTQB 3ORSA 2GBFA 5FWDA 1JDPA 3VQVA 3D4BA 3GFVA 3LUHA 4P4GA 4WOCA 4CF6A 1DMRA 4PLZA 13PKA 2SHKA 2HK8A 5KPDA 4CHGA 4KAFA 3ZKWA 1KEZA 2BONA 1LW6E 2HOQA 2W8ZA 3EXHB 3QLJA 4GO1A 2FF7A 4TKLA 4UBLA 4V0SA 1JR4A 2IZZA 1X9GA 2WWXA 2ZYSA 3GFOA 5AJVB 4C7XA 3OAAD 5KWIA 2RD2A 4J1SA 1SCAA 2BEVB 3AXTA 4FFNA 2RKWA 3QP9A 3ZJUA 2W2QA 2Y9PB 3NUGA 4QJ3A 4I6JA 2RAUA 4DOMA 5AM3A 3BSWA 4Z7OB 2CUNA 2WM3A 1JIJA 2V5AA 5LP1A 1RAGA 3NJRA 1CRQA 5ALYA 2P9GA 3LKVA 3TS1A 5B6IA 1WU8A 4HAWA 5EHXA 4CN9A 3EGWA 3ZXYA 2ZRQA 5KVAA 3HLYA 1N8SA 1QR6A 2R6AA 3KB2A 2ZUTA 4LZPA 3KSUA 3ODPA 4HVAA 5DNEA 3HUFA 2XRFA 4BVHA 4MS4A 3U7FB 5J4YA 3W5BA 2P11A 2P2NA 1ZRSA 4D9CA 1JDTA 3G9QA 1G8PA 1Z35A 3QELB 1W75A 4KZPA 3BIWA 1TPZA 3L8EA 2W6PA 1N1MA 3EE6A 1VSTA 2B6NA 3KZMA 4K81B 1YFJA 3SZOA 4KFUA 4A2CA 4D8WA 1LLFA 3OA0A 5FL3A 2Z98A 4H27A 4R41A 4IDOA 2Y0DA 3DMFA 3QEMA 4RXUA 3FOZA 4P34A 3ADDA 1N3YA 3CRVA 4MWZA 4YMVA 4NCIA 2M6SA 2EC5A 3UMJA 1YHZA 1QU2A 1VLZA 5BOSA 3ER6A 2YASA 1J9GA 4XFJA 4XOUA 2ILVA 4ETIA 1Q7BA 3N0TA 4NFLA 4DRXA 2OM6A 4WCFC 3FCSB 3V34A 3QQPA 2G72A 3MMSA 4FQ7A 2ZJ6A 2DLCX 1JLSA 1EK0A 2VP4A 3E2PA 3U17A 3UAOA 2PKRA 5IZCA 2EFHB 4PHHA 1K4KA 3O38A 2HF7A 2YR0A 4MYTA 2X86A 4B4UA 5BN5A 4OQ4A 4IY1A 3TSAA 4DCVA 3NHWA 4YRDA 3PDIB 1PJRA 3V42A 4DIDA 1QORA 3HZZA 3M9LA 1IY9A 4RF5A 4P4SA 2CLIB 1VZ2A 1SUPA 1H6BA 4GX1A 3FDZB 5EMMA 4EEZA 5A4IS 4KUEA 3EZNA 2PUJA 1JWBB 1P7YA 1C1XB 1EUYA 3UFGA 1DLJA 2PE5A 1J5EB 3GRUA 5K3DA 3EPJA 4P3PA 3VISA 3BTVA 1OASA 2HMUA 1PWEA 4W1RA 5GV7A 2R7LA 4R1PA 3TN7A 4F46A 4FMCB 2WLSA 3P9PA 2WHQA 1YI1A 1V96A 4KDFA 4BU0A 5B7QA 2C58A 4NFYA 4KODA 4A8JC 4KV9A 1ISFA 3ASZA 2I3AA 2FE1A 3CT6A 3MRVA 4PZLA 1U2DA 3TGWA 1RIFA 5K2OA 4OBEA 5EKXA 1GGFA 1GUAA 4JZYA 2C7GA 2DQSA 4JLDA 4HBGA 4ONEA 3VI3B 4AP9A 4PYJA 1UPTA 2HV8A 1R4AA 2Q6OA 2WOOA 1L7MA 2NZUG 3BF7A 4BBJA 5HIAA 1YIAA 2WZBA 4PN3A 4JI2B 3LTNC 4NCBA 3IAM1 4GT1A 4UFPA 5IK2D 2XMBA 5AJXA 1QRRA 3AUAA 2SICE 3NALA 4WHMA 1IUOA 4O1IA 5DMXA 4RDXA 4BFYA 1ZJWA 4MWBA 2ZUUA 3QKIA 1GCOA 3IODA 4YP7A 5CXSA 2HHJA 4G85A 4YJHB 1QGED 2EFGA 5C8VA 3PEUA 1S2MA 3GQVA 3INGA 1THGA 1YFZA 2NXJA 3OQIA 4ON9A 5ALFA 3ZU2A 5B53A 1YOVA 1PYSB 1T4MA 4CG1A 4NZRM 1Y1QA 3LC1O 2PUCA 1MAVA 3LCMA 5EXEA 3U4MA 2J9FA 3IQEA 2H5IA 6LDHA 2V45A 2FPGA 3LKZA 5IC6A 3BUSA 2TMGA 1G9SA 3U60B 4EY8A 4TPKA 3CZRA 1G0NA 3UT0A 3PD0A 2B1QA 2ZKLA 4M0MA 4BUZA 2ZWIA 4KRYA 2R86A 1V1MB 2X0DA 4ATNA 2VZLA 3A74A 1T36B 3F3KA 3I76A 4TKVA 1ECPA 1NW5A 4GPAA 2BWJA 1PHRA 2C2MA 3QVOA 4LDPA 4EG4A 3TLEA 1QH1B 2OHHA 3RK0A 4PNEA 1T8RA 3HV2A 4BTLA 2A9QA 1DBRA 1PU2A 2EFEB 4TL8A 1UXHA 3A27A 5PNTA 4OGLA 2OV8A 4AJ2A 3LWZA 4INPA 4J1NA 1J8VA 4YCLA 5K8UA 4S12A 2HNIA 2OMEA 4NAUA 4Q6BA 1VJDA 1XRRA 4YQZA 2E4XA 2HFJA 5A5FA 2P9YA 3E2MA 3F90A 1S1CA 3R40A 3WKBA 1QYCA 2WD7B 4TKMA 4EMSA 3ZHQA 2R7MA 5IN4A 4Z9AA 1O94D 5CB4B 2WV7A 2RI0A 1GV0A 4JLMA 4C88A 4MPJA 2AKEA 2Q2NA 3R9IA 5E2BA 1U3WA 2XCLA 3BMQB 4HNQA 1RVV1 1F6BA 4NFHA 5HF5A 421PA 4BO4A 1J0XO 1F7VA 5K1PA 4YCWA 4S1OA 5FOSA 1A71A 1HF3A 2IJGX 4FDLA 2AG6A 1Z4IA 1N57A 1QJCA 4OQPA 5C81A 4B85A 1E2NA 3A4VA 4U0JA 4WKGA 2PCJA 1AD2A 2LD4A 2GN4A 2JJ1D 4Z8XA 1FU4A 2G88A 3AEQA 3IKTA 3FSGD 3U1TA 3RVKA 1XTJA 2A92A 2EP8A 3PXCX 4GSLA 3JQPA 4L85A 5JLJA 3NFYA 3RTGA 2Y1EA 5LQDA 2GXQA 4UAUA 3T5CA 1NNSA 5CDFE 4N3BA 2A0XA 4DLZA 2WIJA 1WNFA 4MCJA 2PH3A 2XYVA 4LXIA 1VPTA 3DZJA 3JAKA 3LP8A 3JSXA 2AD1A 2R8PA 2DERA 1UJBA 1U7WA 5DYIA 2W9XA 4MEAA 3QBDA 3SFZA 3LPLA 1X2EA 2FSIA 3PDCA 4QTUB 1R9GA 1LN4A 3NGMA 3FWNA 5F3DA 4RELA 3EW9A 5DKFA 2ARTA 1IUPA 5ELNA 1I2MA 1N2CB 2IYOA 3T5MA 5G1PA 1L0WA 2B2CA 4G09A 5AVSA 4IUBS 2A0FA 1YKGA 2QM0A 1KNXA 2NT3A 2C8MA 1QQ7A 4KOAA 3WYGA 2AJBA 1UM9A 4TXJA 1CR0A 2GD1O 4OUDA 2J0UB 1XD2A 2VWGA 2O8DB 1TM7E 2CT8A 4WLEA 4IMPA 3IH5A 1TVEA 3Q1LA 2C98A 1SD1A 1KGDA 4HMQA 3U4QA 3R0VA 1WKVA 1H4TA 2YYAA 2J4CA 2ZR9A 2R97A 3OZWA 2B21A 4QDOA 4BKUA 2A86A 4AP5A 4L4RA 3R8XA 4ECAA 3IVRA 2AK2A 2O19A 4KLCA 5AH0A 4BWGA 4D79A 1ZD9A 3Q9LA 1PX0A 2NZ2A 1YZ3A 3M4NA 1CS0B 4R68A 5DYWA 3U5ZB 1T5LA 3HCBA 4WCFA 1PDVA 5J1TB 3TCXB 4HZUB 4DBVO 4C4YA 3GCWA 5L9AA 3HY1A 3F9IA 4MGIR 6Q21A 1V7PC 1LC0A 5CNKA 2FP4B 4RHTA 3RLIA 3INTA 3B1WA 3A1NA 4G4IA 3UVEA 1QIDA 5CBKA 3VTHA 2PSSA 2XNKA 1QH1A 2CBGA 4G2NA 5JANA 3GLKA 4RABA 4BTEA 4C08A 5CCEA 1EDOA 3PCXA 1ZHFA 3NH9A 2FOLA 1R2QA 2CMFA 4HYQA 4UTVA 1EXDA 1ISMA 5K3OA 1KJNA 1IJKA 3G8DA 3BGVA 3MTGA 2OFOA 2A9RA 5M5BA 1BRTA 2Q27A 1HLDA 1U90A 2GAAA 4TL9A 4GP9A 4ZVVA 5F2NA 1E92A 4FJ0A 4REOA 2UUPA 1GRVA 1XK7A 1ZU4A 1KEWA 4NAHA 4CM8B 1E79A 4PAMA 2IY5B 1Z7WA 3KNZA 4EJSC 2Q4EA 4OXQA 2BGJA 1BU5A 1UDRA 3WYEA 3BOSA 1CIPA 4DUPA 3O83A 4FX2A 2HHAA 4GOKA 4W7IA 3UJAA 4X64B 2V0GA 1PUJA 2ORYA 2RSLA 2WKRA 3RIGA 1N8NA 2ZIZA 1NUUA 1XG5A 1YJQA 2CMGA 1XN1A 2MTBA 3EODA 3L4BA 1RFLA 3O95A 4HNSA 1NN5A 1ZCAA 4WW0A 5FWAA 2QW1A 4B33A 2X9VA 1G18A 4XJTA 1E2UA 4ZZ2A 5DM70 1XD2B 2O8DA 1D2HA 2C54A 3HA7A 3OZGA 3CWZA 3L9XA 1M0TA 3U7IA 4JOCA 5TPWB 2BKUA 3UCEA 1CQXA 1GA1A 3COPA 1PWXA 4RVDA 3VR0A 4QL3A 4H60A 1KAGA 4CCYB 4H6PA 4QPNA 2DFKB 4CMBA 4AM8A 1GNRA 1GZ6A 1WABA 1ZK1A 4GECA 1LVUA 4ZZ0A 4O3MA 3HKEA 4OHVA 3ZIHA 1FEZA 1RE1A 4MICA 3ZIGA 2XNSA 4IRUB 3LVKB 1LDEA 3V80A 2J6HA 5T3UA 2VKTA 1Z6AA 2A6PA 2PVPA 4OP1A 4AJIA 4L72A 4LVKA 1Z29A 1LF0A 3LOUA 2L0XA 3DAFA 3I9FA 3TD6A 4Y6LA 1P1CA 4PFJA 2WJPA 3WB1A 5JQGF 1A88A 2G9UA 4KN8A 3J7TA 5EYPA 1OXUA 4BP1A 5B64A 5BRJA 5BORA 3RUHA 5I9LA 4XUCA 5LJIA 2O8CB 3FYUC 2VYCA 1DJOA 5D2CA 1NWHA 1KYTA 4J9VA 1E2LA 3FOWA 2PMFA 4ZAWA 2WB4A 4LYDA 4RSGA 2JGRA 3U19A 4K8OA 1AQIA 3VYUB 2PR2A 4GKBA 5FORA 3DBIA 1D9XA 1H5NA 1E9CA 3PKJA 4HVLA 2OCPA 3ONNA 5I4BA 5L45A 3EZLA 3FZNA 4GM0A 5KC9A 2YN0A 2ZRMA 3O4RA 3O74A 3Q6IA 3W9SA 3AF3A 1M1NB 2NADA 3IDQA 3W5VA 4YV7A 3K0SA 1TF5A 2HC9A 2QQGA 3MGKA 5EE9A 2DQ0A 2J6IA 4YUAA 1UC9A 3RYFA 2WD7A 4DLSA 5A02A 1D4OA 4WI1A 3TSYA 1TVKA 1YQQA 1L6RA 3ELUA 4HDOB 3PZCA 1M1ZA 4BW9A 4JB0A 4LRSB 3G3EA 3WAGA<