1NJ8A

Crystal structure of prolyl-trna synthetase from methanocaldococcus janaschii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
456
structure length
456
Chain Sequence
MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline-tRNA Synthetase
publication title The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
total genus 119
structure length 456
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2002-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09181 ProRS-C_2 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 1nj8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1nj8A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1nj8A02
3LSSA 3FJPA 4ZTZB 3MEYA 3CMQA 4P75C 1HC7A 2DVEA 2AKWA 4YRFA 2LW7A 1L0WA 2FYKA 3L1AA 3E9IA 4RQEA 3RKWA 2RHSA 2E3CA 1B76A 2E1HA 4PHCA 2PMEA 4PG3A 3HXVA 4YREA 4DPGA 2ARSA 1WQWA 1IL2A 2E5AA 1E24A 3UGTA 3QNEA 2ZZEA 2E65A 1X56A 4P74C 3A5ZA 1ADYA 1JJCB 4YROA 4WJ3M 2J3MA 3REXA 2CJ9A 4P72C 1ADJA 2RHQA 3NETA 3MF2A 4WJ4A 2Q7GA 4TVYA 2ZT7A 2ODRC 3HTZA 4CH3A 3DSQA 4YRRA 1H4TA 3W3SA 4P3OA 1EQRA 2DTIA 2E41A 4L87A 5ELOA 3A74A 4Q6GA 4XTXA 3L4GB 4RMFA 1WLEA 2DQ3A 4TQDA 3RACA 4ZTUB 4P73A 1V95A 1X2GA 3QO7A 4UP9A 3TEHA 3A31A 3PCOB 1B70B 2DXTA 3EFSA 2C7IA 3R07A 3RKYA 1E1OA 1SESA 1WU7A 4YCVA 3IG2A 3RIRA 3RL6A 3KFUA 1BBUA 4YRGA 5HGQA 1YFRA 3TUPA 3M4QA 5K1XA 1B7YB 3IKMB 1HXDA 2QHSA 4BWAA 4XU1A 4H2YA 11ASA 2I4MA 4HWOA 2DTHA 2G4CA 1EIYB 4HA8A 3VQWA 1E1TA 1VQZA 4XEOA 3RKXA 1ASZA 3BJUA 1H4VB 1PYSB 12ASA 4TVWA 4CS3A 2EL9A 2XTIA 2EJFA 2ZIOA 3HFZB 1X01A 1Z7NA 3VQXA 3HXZA 3P8YA 1HTTA 3NEMA 4K87A 2Q7EA 3M4PA 1KMNA 1YFTA 3HXXA 2CGHA 2ZZGA 2QHUA 4YYEA 2AMCB 2C8MA 2I4NA 5ELNA 4EO4A 1JJCA 1USYC 1SERA 5F5WA 4DQ2A 2ZCEA 4OLFA 3EFRA 4K86A 1GGMA 3VQVA 1X2HA 2CJBA 2DTOA 2ZT8A 4P75A 2ARUA 4WI1A 4XU3A 2P5IA 4HWSA 2DEQA 2HNIA 1G5IA 2Q7HA 4P71C 4KR2A 3L2ZA 2ZXFA 4K88A 4H2TA 3A7UA 4H2XB 3L4GA 4TTVA 4G85A 1YB3A 4ZIBA 2E10A 4YRQA 4XTWA 2DDZA 4P74A 3QO5A 1YFSA 4E51A 4X5OA 2QHVA 3PCOA 2ZIMA 3HY1A 5C51B 1LYLA 4O2DA 4XEMA 1BIAA 4CS2A 2ALYA 4P72A 1W66A 4XU0A 4YRTA 1X55A 5K1PA 3QO8A 4KQEA 3RF1A 4OP0A 4H2WA 1SETA 4G84A 3A7AA 2IY5B 2ARTA 3UH0A 1B7YA 5KNNA 1NJ2A 4RDXA 1BIBA 3LC0A 4YPFA 3OD1A 3A32A 3MF1A 4H2SA 2Q5IA 1NJ1A 4XTYA 1EIYA 1WQ7A 3UFGA 4HWTA 4CH6A 3RUXA 3V7CA 1PYSA 4CH5A 1N9WA 2I4LA 4HVCA 3HFZA 3HXUA 2EJ9A 2ZR2A 4Q15A 2CIMA 3IKLA 3NENA 3E9HA 1KOGA 3LSQA 1C0AA 1SRYA 4YRKA 3IALA 4H2UA 1WPYA 3G1ZA 4BW9A 5C52B 2DU5A 3P8VA 4WF2A 4TVAB 1QF6A 1ATIA 2ZINA 3WQZA 2DXUA 1EFWA 2AKWB 4HWPA 4UP8A 3TEGA 2ZTGA 4UP7A 1NJ5A 1G5HA 3HY0A 2RHSB 4CH4A 4XTUA 1NYRA 3ERRA 3V7RA 4H02A 1NNHA 1NYQA 4YDQA 1YGBA 1NJ6A 4P73C 4HWRA 2J3LA 4RQFA 3RGLA 2ZNJA 4H2XA 5E3IA 2I4OA 4AH6A 1H4QA 4CS4A 1NJ8A 2PMFA 4TQFA 1E22A 1EVLA 2ZZFA 4YRMA 4EX5A 4LNSA 1H4SA 1B8AA 1USYA 2RHQB 3A7RA 2DZ9A 4J15A 4XTVA 3QTCA 4NCXA 2Q5HA 1B70A 2ZT6A 1FYFA 2EAYA 4XTZA 4P3NA 2EJGA 3UGQA 3P8TA 4YRLA 3BFMA 1KMMA 1WNLA 3V8LA 4YRSA 4YP0A 4YRJA 2QHTA 2DKGA 3NELA 3I7FA 2IY5A 3HFVA 1G51A 2DZCA 4YRIA 4TWAA 3V7SA 4H2VA 2DJZA 1WYDA 4P71A 3VQYA 3HRIA 2DU7A 4UPAA 3A5YA 3HRKA 1ASYA 2EWNA 1J5WA 1EVKA 3TEHB 4P3PA 2ALYB 2ZNIA 3HXYA 1EOVA 1BBWA 3REUA 3V8JA 4YCWA 2ZR3A 2CJAA 4YRPA 2P0LA 4YRNA 4XU2A 3VBBA 4YRCA 4KR3A 2ZT5A 3PZCA 3V8KA 1X54A 3ICAA 2ZGWA 2DQ0A 1Z7MA 3HXWA 1RIQA 1QE0A 5C53B 2XGTA 2E64A 4YCUA 4TVAA 2AMCA 2ODRD
chains in the Genus database with same CATH superfamily
1PAVA 5F1YA 3GGSA 3VYTB 3ZHZA 5BXYA 2IYQA 1DC6A 4MWBA 3ZLJA 4YRFA 3EGVA 5G3ZA 2CT8A 3M3DA 4BQRA 4FYPA 2BFCB 3IJPA 1WDTA 3OQPA 4LRWA 5ALUA 3HKBA 5JISA 5EIBD 1QP7A 3B9BA 1DFIA 3DG9A 1PR2A 3N2EA 2VLBA 3ZJUA 4YJFB 2NG1A 2YOGA 2QUZA 4POAA 5FWYA 3F0TA 4F2DA 1HT3A 2HHJA 2XLCA 1VGRA 5CPBA 4FN4A 4JLVA 3E84A 4DEXA 1GFWA 1OYWA 3I76A 3ZDYB 3MPUA 1KI2A 2VO1A 2NSYA 4XM0A 2V74B 4DOMA 3O93A 4C4SA 4RY9A 3MD0A 1EK0A 1PN3A 2HLHA 1SIBE 3EIEA 3ROKA 1NVVR 3ED5A 4ER0A 2P0YA 3SXUA 1IONA 1AQNA 3B82A 4PYMA 1VZ3A 3L0YA 1PJQA 3ZWKA 1OILA 3H75A 1ADYA 5FHQA 4QU9A 1OE0A 1PD0A 1E4OA 4XLTA 2RH5A 4XW2A 4D9JA 5I3CA 1R4MA 1JEEA 1P9RA 2INGX 1JDTA 3H7IA 4GI2A 5FPSA 3PQCA 1JKMA 2ZJ4A 4Y2RA 5TNXA 2WWXA 4UEKA 4HD0A 4F5DA 4O4HA 3EK2A 1BH6A 1LNQA 2WV9A 2FMHA 3QX7A 4HADA 4XSGA 5DHUA 3ZHSA 4OYRA 5F77A 3PT5A 3A7DA 4UTOA 5KOJA 4CV2A 2B8WA 4IZIA 3UK6A 2DUWA 2QTGA 3CINA 4RHXA 5COQA 4QJBA 4UE3S 3ROQA 4CMBA 4JHLA 5IFLA 3RVJA 3ZK7A 1NXSA 4MPDA 4Q37A 3TXXA 3I2KA 3VR2A 1I1NA 1U8CB 4I4TF 4JCCA 3QPAA 1OC2A 3NDJA 4ARBA 4EP1A 4EHKA 5A02A 1U0BB 1JEOA 3V8QA 1F14A 5DTMA 3CG4A 1MW9X 2WA1A 4BKQA 3SKXA 2GARA 3HPQA 5B2ZA 1ZUNB 1GGFA 4CH3A 3C6YA 4BEJA 1GG5A 1H4TA 1ZBDA 2BBWA 2FOLA 3HUFA 2EFDB 1QMGA 1UDBA 4WLUA 4AZ3A 1QR2A 2ZITA 5CDHA 3E9NA 2A2ZA 3WLQA 1FFGA 2B1IA 3ETGA 4XTXA 4ZHQA 2BGWA 3HI4A 2W2KA 4MGYR 4B83A 3B1KA 3H9QA 5G1NA 4FFMA 3GZJA 3KXLA 2WV7A 2WDPA 2RD2A 2BI8A 3N8DA 4ZU3A 1WB5A 2HA3A 1QDLB 4UP9A 3Q3VA 3A31A 1BS9A 4MCAA 4UAGA 5T6BA 2JGIA 4Q1DA 4DVGA 1EX1A 3QBJA 1KYVA 4DV6B 9ABPA 2C31A 3R3SA 1NH9A 4LZNA 5EWLB 3H18A 1I14A 1E59A 3ZV3A 1SBZA 1ZHFA 2XE6A 3D3JA 5BV2P 4QREA 1XYVA 3L0SA 1E3MA 3PA8A 3GW8A 1QYXA 4QUEA 5E3JA 4KVGA 3EEBA 4ZVOA 1PT8A 2IE8A 3JRXA 2C9DA 4HRXA 3VU9A 3BK2A 5BN4A 2FDCA 5IJ0A 1NSFA 3QTBA 3B3AA 1RYFA 1FFXB 3AQIA 1W48A 1HOXA 4NIMA 1NMQA 5IWAB 3W6PA 3WGLA 1DO2A 4JLAA 5L45A 4FMDF 4G67A 3WRVA 4N0MA 2GD1O 3W2EA 4OJKA 3V2HA 3WNDA 3KPVA 2QROA 4OFBA 5K0ZA 1LH0A 2MSEB 3LUFA 4EYOA 1M5UA 5JC8A 1X38A 4J16A 4DWWA 5ITZA 5AW2A 1Z12A 1LN4A 4QOEA 1V9SA 4XH9B 1A27A 5E3HA 2BI4A 5E95A 1BZYA 4WXEA 1O2DA 4AJIA 1XVIA 2FMXA 5ES4B 3CF2A 3OSUA 5HE8A 3K1AB 4B6EA 4DA9A 3GGOA 1BXGA 4O02B 1KSFX 3FVTA 4FSXA 2FSSA 4OBBA 5DOVA 3X2SA 4HA8A 4WXPA 3TGWA 1XXHB 1AURA 5AKHA 3HJRA 5HFAA 3GRUA 4GGOA 1QYWA 1FDWA 2Q27A 1G0NA 4OJNA 1HV8A 3GHHA 3TLMA 2FZCA 3PHGA 2JBHA 1PWEA 1YS1X 3IQXA 3NTUA 4NMLA 5TPZA 3T6KA 3TLGA 3H2JA 2WTMA 1LLDA 2NVUA 4KAAA 1U2QA 4YCAA 1IWOA 2PO5A 4LGVA 5AXCA 2JCVA 4B0OA 1KK3A 4W7IA 1G5QA 2IHUA 2PUCA 4BBAA 4R01A 1Z7NA 1Y3FE 1XT6A 3AJAA 3W9YA 2PCJA 3CUTA 4Y2QA 3IE1A 3ICEA 1PJSA 2HK9A 2I7TA 2VNJA 1G4HA 2R7MA 3R7LA 4F4FA 4OBXA 4L15A 2YMMA 4C78A 4OQMA 3OUTA 5AKIA 3PRJA 2AXNA 5HR5A 3IP3A 1FA9A 1MVOA 2IHBA 3SIWA 1FIUA 5DB4A 2Z2XA 3RC2A 1IU9A 4P5DA 3U7EB 1ZRNA 2FEMA 4GYJA 3BRCA 4TPKA 5BT9A 2QHUA 3M1YA 1S3SA 3D3WB 3ZW7A 2XF8A 4KREA 1OWLA 1NRXA 4PFKA 4F86A 3THWB 3HGMA 4J0FA 2FP4A 3HZOA 4WCFA 2WU1A 2I7VA 3F78A 3G49A 2VRNA 3HBFA 5DCUA 4Z0HO 2IXTA 2R6R1 2QTHA 2VEOA 4CLOB 2QM8A 1PSZA 3GLHA 2H00A 3H5RA 1PF7E 1R4NB 1PUXA 1YFZA 1Y1KE 1KVTA 2JANA 3D5EA 4NENB 1H65A 3WLTA 1R9MA 4YA6A 1QHHA 1KDOA 1ENOA 1K08A 4GPEA 3R5JA 2VL7A 1H2ZA 1LPSA 2XWBF 1N4DA 1R5BA 3BORA 2CWWA 3DQZA 2R6HA 4BMNA 2FQYA 1RM0A 2R7KA 4GUDA 4EJSB 2B92A 2DTOA 3FDZA 1TRHA 3P9RA 4YUXA 2FWNA 3ZU2A 2QG6A 4AQ7A 1WB9A 1ZGAA 2O48X 3DS8A 4HG2A 1GTZA 5TGDA 4UNNA 4B3BA 2ARUA 2AR9A 2NMVA 1RSZA 3ROMA 4MI3A 5LZ9A 4G6ZA 3F98A 4B47A 3ZCSA 4HFMA 4U39A 2P5IA 3KAJA 3RVQA 4KFRA 1I6LA 3EVNA 3SFVA 2HNIA 1DADA 4HT4A 1TCUA 3OQIB 4HSGA 4QWWA 4IDGA 1ULZA 2IPLA 2P77A 3VR3A 4UKDA 1O54A 3QE4A 2VYVA 3HEAA 3RR2A 1AKEA 1LI5A 3FRIA 3CX8A 4CKEA 4UVGA 2GCGA 1YBAA 4JKYA 1I94B 2VJYA 3RCBA 3PWZA 2XGGA 3ADKA 4HEHA 1ZN9A 5AW0A 1CJVC 2PWYA 2HU5A 5A4FS 3NC1C 3FZNA 2J9GA 1A9RA 4FR5A 4KPUA 3R6DA 2AZMA 2EQAA 1VSTA 2HPAA 3TSAA 3DBRA 4IHAA 1ZPDA 4F3YA 1EQ2A 2VTVA 3RRXA 1IHXA 3VHRA 5IULC 2IHNA 2H4ZA 4ZC1A 4M1MA 1VB5A 3NATA 3LT1A 3QKBA 3NJ8A 1XIVA 3HY1A 5D3MB 4DCGA 5ICFA 3A2NA 3RFVA 2HA0A 2B69A 3EVCA 3O6VA 3EULA 4HLUC 3USZA 4CZ2A 3VHLB 1Z37A 4JYAB 1W66A 2C98A 2WOJA 3L0CA 3T4UA 1VJRA 4R0MA 4IGIA 4ESEA 4J2TA 1W6UA 1QYVA 4WK0B 3WB9A 1G16A 2C4HA 3GOHA 3K1ZA 3VO1A 2BD0A 3QE0A 4Q1FA 1GL3A 3GK3A 3MEQA 5F7JA 4J0JA 3WK7A 3G2MA 2OP1A 4LCEA 5LLSA 4ABYA 3ZHUA 3N05A 2X7HA 3I04A 2OXRA 5FBQB 1U0RA 1XHEA 3DOFA 3T7KA 4RTPA 4A4DA 5GIPE 3GLFE 2QQEA 1LPPA 4MGZR 1PQYA 4QBFA 1HDEA 3CUWA 4U7DA 5FUXA 4HGRA 4QECA 4YPFA 4HYTA 1YL5A 3V1MA 4DE5A 5C8VA 5FEMA 4LFBB 5DMHA 4WN9A 2ZRBA 5E4FA 3QV2A 3CN9A 4U7WA 5C8YF 1A7JA 2G5PA 2COUA 3C45A 3AVTA 4Z7OB 3M5CA 2P2GA 3PPYA 1I8TA 4HWTA 2WYIA 3CGGA 3GA0A 3A2LA 3O95A 1G8AA 1KYXA 3OZSA 4L3OA 3L0BA 3N8GA 3UPUA 3RUXA 1DAGA 1YJAA 2QAGC 4ZO8A 4ALMA 1HI9A 1KETA 3HM2A 3Q72A 2BELA 3BH7A 3W6NA 1FVHA 3RAFC 1I2ZA 5DHRA 1BXZA 1Y5IA 1NNUA 4DF3A 1RJWA 1OLSA 3EQ8A 4PYJA 3ZTYA 1A8PA 4HP8A 5I7OA 3WWDA 2FSVC 4IJQA 4RXTA 1AQLA 5DX0A 3IUBA 1JDNA 5I45A 4LS3A 3CLRD 3HR7A 3HP4A 1XDSA 4MKZA 3T3HA 2OSVA 3KTOA 4IG4A 5D8DA 3WYNA 1YDFA 3H8VA 3CW9A 1V2HE 3TI9A 5M34A 2WIFA 3MGBA 4KRXA 1XR3A 5JH7F 4OGGA 5G1PA 4KXUA 2IJGX 2J46A 2YWGA 1FXUA 3JV7A 4AKSA 1ZVVA 4Y7DA 4WFJA 3DKPA 4FWBA 1Z82A 1XE3A 3AIMA 3SYNA 2ZE5A 2BBTA 2OZLB 3I37X 3IRVA 5CGZA 3FNGA 3CUEF 2XTAA 4GQBA 1QOQB 3IBTA 1PUJA 1MXHA 4MQBA 4QQKA 3W1VA 4KPFC 1NBHA 4U7HA 1QB8A 2V7GA 2B8NA 5C52B 4MVJH 3IAHA 4YHBA 4OQFA 4Q7EA 1UDVA 1FUUA 5DLYA 5IDWA 1S7CA 1GITA 4G5FA 3FBTA 5ERGB 3VC1A 1CUBA 1KC1A 1RS0A 5KWVA 1I7SB 1NQOA 4R6WA 1YIOA 3HYRA 4HZUB 4IHJA 4X7BA 5K6RA 3V97A 4NH0A 4RAOA 4E12A 1QX3A 2HUPA 2YH2A 3E7XA 3ZU6A 2GM4A 4JCOA 4Z53A 1MU0A 2CFRA 3ZC3A 1G5HA 3PIDA 3KD3A 1Z5VA 1THGA 3JQGA 2JAUA 4PG4A 3EXIA 1F4LA 1P0QA 2GYVA 4S3MA 2DUUA 3L0PA 4DARA 4MGHA 1DAKA 1DDOA 1WCIA 2IYXA 3HXLA 3WNZA 4JITA 4EL0A 4FD2A 4BIIA 5J2TA 4J03A 1I7DA 1J0XO 1N2CB 1W9HA 1MAWA 1XZGA 4JHXA 4MYDA 1WS6A 4UE2A 3R7FA 1ANKA 3RO7A 1DAEA 2R1VA 1ADFA 2WJIA 4MVXA 2E4UA 1OXBB 3OQ6A 3GLSA 4ZI7F 3BL8A 3O3CA 2IC5A 3KM0A 5KSYA 1P3JA 3VH4A 2NXNA 4RZQA 4EZIA 3TQFA 5LLDA 4JOQA 5EKDA 1QZUA 3IESA 2ECQA 4M8NE 3VZRA 5GTDA 4V0MA 2I4OA 5DGIA 4A3SA 4FOPA 4M87A 5C37A 1FXSA 2WTUA 2VRCA 4B3JA 1P8AA 2D1RA 2O0JA 1X7YB 1GNLA 3HI6A 2BE9A 3OVMA 4PWYA 5FF9A 4AWBA 4V0KA 4LE1A 4V38A 4X6UA 4Y2TA 3TN7A 1VJCA 3I61A 3A9CA 3DE5X 3W34A 4Z1OA 3PCXA 2ETVA 3R75A 3T35A 2JI6A 3BCSA 1NMSA 2RSLA 3X1JA 4B33A 3FWYA 1YB6A 4XIFA 3PL1A 4EFDA 3MS4A 5DYTA 3OOSA 5EL0A 4JC4A 4J1TC 4IXMA 3WQQA 4F4HA 3NHJA 1VSBA 4FI3F 4TRMA 3W9BA 4X84A 5JHHB 5JI3E 4NYJR 2Y8EA 4PBRA 5MFZA 4O2AA 1T5TA 4EYGA 4E5SA 3SMVA 3JALA 4QVGA 3TZCA 3U13A 3NAMA 2BHNA 4BYGA 3VR6H 4M4SA 1C30B 1XMJA 2PAFA 3O8QA 3MYYA 1IWBB 1ZNZA 2ODTX 1UBKS 1KTIA 2E5LB 2XA2A 3K1YA 1E4VA 2BR5A 4FN5A 2QPOA 4M36A 1D5CA 5AOVA 4DPKA 2BCGY 4XEUA 5B6JA 4BNNA 3BJZA 3QHQA 2PPLA 4XAQA 5ITVA 3UOGA 1Q3KA 2BP7A 1OXXK 4GOMD 3WIOA 3O92A 3C3CA 3D81A 3GRVA 5FL3A 2LKCA 3AUTA 3CPJB 2GI4A 1BE6A 3P8ZA 2IT1A 3C0KA 1UM8A 3NXKA 3ZUGA 1J2YA 2BFMA 3C3YA 3V4RA 4KPGA 3MQ4A 3V8MA 3QEBZ 1J4AA 4HB3A 3M2TA 3QPCA 4DBVO 4MQ6A 1T3HA 3A5YA 4OUKX 2P1RA 4KVAA 4BE7B 4ZZIA 3CKLA 1UMBA 3RODA 3KFLA 5B4VA 1NIJA 1PDWA 4P3PA 1E61A 3B7PA 3EDQA 4B1FA 4Q4AB 4GYYA 2OCLA 4CR7A 1RE0A 3QUCA 2VQSA 2X2FA 1M3SA 2GLTA 2C2YA 5H3LA 4CF5A 1SKAA 1ACLA 4XI9A 3WBFA 2ALYB 2BR4A 2XNDD 1EDDA 1YSCA 3PGMA 4G9GA 5IUKC 3RF6A 3MLEA 4R5HA 1HNXB 2GLXA 5JFGA 5BQFA 1VGQA 3KZOA 4MI1A 3AP2A 3P4XA 2DY1A 4D3XA 5KOIA 1ST2A 1UIRA 2EC5A 3BWDD 2JCSA 3MINB 3QY0A 4LA4A 3RUFA 3T99A 3LO5A 4LRXA 4A2PA 5K09A 1QHGA 2F6RA 3EGXB 4L7VA 4XFJA 4IS2A 1W29A 3O4GA 3EW9A 4EHFA 1YR2A 2JGLA 1N2GA 4D25A 5IM4A 3ZY2A 4RL4A 3ZLBA 4ND7A 1E9RA 1W1IA 2OM6A 1RYYA 4DXHA 1WU8A 1R12A 1BGWA 2AN1A 3CZQA 3STHA 3ICAA 5FUBA 2H1SA 1I7QB 1FZQA 1FPMA 2SECE 1A8UA 2BT4A 3D4PA 4MVJF 4DIFA 1RIQA 1ORTA 4ZKEA 3C5HA 1UZLA 1ZH2A 2P78A 1XB2A 4KQCA 4EF6A 3KPWA 4RA6A 1W30A 2BGJA 2QF7A 4PHHA 2PMWB 3FSEA 3L7MA 4DLBA 3TFWA 3BWMA 2YDXA 1GTMA 2I2CA 3RSZA 2YXBA 4Q9JA 3REOA 3UYKA 5BMOA 2EOAA 1DXQA 3NTQA 1SOUA 1K6IA 2ES4A 3HYLA 2WJ4A 3UJ6A 1AK9A 3AVUA 2YJ4A 1Q6YA 4AO6A 2G67A 4YHHB 2YOFA 3MRTA 3PQ7A 3EDOA 3RJ5A 2JIOA 2Z30A 1VA4A 4LOLA 3W9UA 5GJBA 1Y42X 2PNJA 5JO9A 3PYXA 4B2LA 2FMIA 1DUVG 1GP2A 1NVWQ 4KLCA 5DYWA 4C3ZA 3N39C 2GCPA 4FDUA 4YMVA 4ICIA 4M1YA 3H1TA 2EXXA 3IKTA 3B1FA 1XCMA 3PR3A 3QNEA 2J3DA 3TOVA 2OXTA 3PCRB 2X6TA 1GU0A 3U6BA 3WA6A 4NBWA 4QQFA 3TCNA 1SVSA 2CZCA 2PKRA 4K6MA 1JJCB 5EJ4A 1O6BA 2FXIA 1J9GA 2XT0A 4ZVUA 1SUFA 9ATCA 3BB1A 1D9XA 3RANA 4D9GA 4BPBA 2WJ3A 1C8BA 2XHEA 3KCNA 4EUFA 3QNUA 2PS0A 3MG9A 2AZ4A 4HDNB 5BNWA 2JCYA 5FTNA 2CL5A 4HDOB 4OXRA 3HQ4O 3S27A 3ZQJA 5HOEA 3QFSA 4WZ6A 1CUHA 3ZGZA 3MMZA 5CMLA 2ZAMA 4EHBA 2YFQA 2ZB8A 4IGAA 5DYYA 3NBQA 1THMA 5LXTB 1VL8A 2JVKA 2WSSD 4QGGA 4ZARA 2C7RA 3MF2A 2I71A 1TKAA 1X80B 2AW5A 1AHHA 1XAJA 5SYAA 4QG7A 5KNCH 4WJ4A 1OLXB 1VHJA 3GXBA 3ODGA 4K6KA 4O0MA 1E9AA 4PZPA 1TJNA 4KMMA 2IEIA 1ZMBA 2DAPA 5DYNA 4DDWA 4YJGB 1P1HA 2IU3A 4NMMA 4Q3EA 1YIAA 3CGWA 4PV7A 3HTZA 4AKEA 2I80A 5CLLA 3DHNA 5KYKA 5MN6A 2I76A 1HK7A 1W87A 4G81A 4I14A 4RE6A 4PG8A 5JMPA 3NEJA 4KJXA 2ZWIA 1YGPA 1GA6A 1LJ8A 3AWIA 2E7ZA 4L87A 4TLLB 5L7TA 1NZDA 1UDAA 1P5HA 2YNMD 3GWGA 2VZ9A 4B34A 3INGA 2HFKA 4RMFA 3K4QA 5J4HA 2EW8A 3UA4A 5G53C 3RK1A 3IV6A 1ES9A 3RACA 2O7SA 1N2ZA 5I9IA 1CS0B 5G3YA 3AR6A 5TQJA 1ID1A 1IYZA 5D3ZA 2CHVA 3K94A 5E6SA 3THSA 3AH8A 3H05A 3IKJA 3TNJA 2C3PA 4BQOA 3G5AA 2ACWA 3TOXA 5GONB 3MT9A 1UPCA 1X19A 3FVWA 5IC6A 4EG8A 4NULA 4MW2A 3DTVA 2F59A 3IG2A 4Q4HB 5LOVA 2Q29A 5BNZA 5CX4A 2PY6A 3ZCVA 3JQ7A 3T8YA 3DDCA 2VYFA 3O8OA 3V42A 3NP7A 1SHTX 3IKVA 1C3EA 1K89A 1SELA 4ND1A 3VR1A 2XMRA 3OAAA 1ODCA 4F4IA 5HTOA 1W8DA 3F5DA 4IZHA 1S0UA 2D3WA 2FEWB 3PDJA 3QU5A 5DW0A 4CFZA 1GSOA 2P3OA 1OX6A 1XD9A 2XD4A 1Q17A 4BNDB 1E8NA 1I0ZA 7YASA 3S81A 1NXOA 3H1EA 1Q6ZA 5CVUA 5FTWA 1E2BA 1P80A 2EGUA 2HLNA 1DJQA 3RT1A 4CV1A 2ODPA 1CQIB 4O4HF 3IP5A 2G82A 3FMOB 3TIXB 4R2XA 4LDAA 2VVTA 5EG5A 1GEEA 5H4GA 4KMSA 4FYVA 4FTWA 1BWQA 3LW7A 4Q4LA 1DCJA 1ASZA 2WSIA 4Q9DA 4RV4A 3FI0A 4M54A 1GDTA 3WKDA 2J4CA 3O4JA 3QUTA 4MK4A 4AP5A 3WMFA 4FDLA 3IUJA 4U5XA 4C2AA 4XTRA 2NO7A 4FMCF 3S1LA 2IZ5A 1MF7A 1BDJA 1HDCA 1CIJA 3B5JA 4BFYA 4N47A 4EK9A 4P2BA 1RI3A 4LYFA 1RHRA 2V9ZA 5FBLB 1DC4A 3SM9A 4CF4A 3MMXA 1O5OA 1ZIOA 3AERA 4E31A 4Q1EA 3EDRA 3Q7RA 1XZHA 3OFJA 4GUAA 3THOA 2ZROA 5ALDA 3V8RA 1H2YA 4BJ1A 2AL7A 2H0AA 2RGXA 3DTYA 3DBOB 2JS7A 4RDCA 5A3SA 4CMEA 2NV2B 1QQAA 4OXNA 1FRFS 1Z4IA 4ZDJA 4LKOA 3N2LA 4ZHQF 1K7XB 4M1KA 1PWZA 5CB8A 3LXXA 1RKVA 1IHUA 3AHDA 3I30X 3ND8A 2O0HA 4IIJB 3D1LA 3QVOA 2C8MA 3R40A 2HWXA 4H7PA 4JJZA 2Q9BA 3BB4A 3GRPA 1JEQB 2DUMA 4YT4A 5ITWA 1UXHA 1JEYA 4QC2A 4DCNA 4S05A 3ZBTA 2GCOB 3WHPA 2A57A 2NM0A 4R6XA 3ZXXA 3SC2A 4DLKA 2ZIZA 5K20A 2V55B 4OLFA 1EP9A 3LKVA 2BV3A 2ZGVA 5H70A 2ONZA 1Z2EA 3GH3A 1NUQA 1XXHE 4G5GA 1Y8AA 4PQGA 4DMRA 1QRSA 1E1KA 2AIRA 1TQ6A 2VXYA 4I36A 3ZWDA 1EG2A 4MSUA 4K6CA 3WLAA 5EWJB 4AMVA 2A9RA 3HA2A 4K3UA 2CJBA 5CXXA 5BXQC 1H66A 3I9JA 1DHTA 4J8PA 4Y6PA 5FB3A 3ZHBA 1YJ8A 3OJLA 3IJEB 2EG9A 5K5EA 1KYQA 2COKA 2FSFA 1AGNA 2R8YA 4BS9A 1USKA 1OWOA 5GV8A 1FYDA 1YC2A 1KVRA 2KPOA 2ZSFA 3M6VA 4I99A 4N5DA 2N47A 5IU6A 3R8FA 4WKNA 4BKOA 1R6BX 4LBWA 1ZM7A 4KU4A 3RW9A 3TQCA 4WKCA 1JMYA 3IT3A 3VPDA 4KXYA 5B3AA 1SRQA 2V4MA 3Q15C 1HM5A 5DYGA 5E6RB 3TQTA 4B3DA 2YOHA 1CY1A 3V7YA 3F49S 3ZYCA 4LF6B 2GAOA 2VDWB 3S8EA 4WZBA 2E21A 2YWRA 2GASA 4C4TA 1O97C 2B25A 4P4SB 4ZZ1A 5AUOB 1XOIA 1YNSA 4HQNA 4YACA 1DJLA 2I3GA 5I7WA 3JQAB 3A1FA 4NJOA 1NQWA 4QPPA 4TSRA 4OHYA 4YO7A 4Z2AA 8ABPA 4PEVA 2I8CA 2ZWPA 4NJMB 1YV9A 4GRIA 5FTJA 4D43A 1BIFA 2X5JO 2BSAA 3I53A 1H5NA 1C9YA 1VPEA 1JXQA 2C5BA 3SC6A 2VWQA 3Q5DA 1PZMA 3FDIA 4JQOA 3UMCA 1WXIA 2BRUC 3CUSA 4UAVA 3V4FA 2QJTA 3VU1A 1QXSA 3F2IA 4ETWA 2G40A 3A8TA 4UFNA 1H8ED 4XXHA 2WM8A 2Z5VA 5L6LB 3KNZA 2YC2C 3FYTA 1NI4B 4ZI2A 1RRMA 1M73E 4HB4A 1ESCA 1TYAE 1A8SA 4IDFA 4R3NA 3GEIA 2JATA 2G1PA 3GJQA 4BX8A 3KKKA 3JVVA 4XU0A 3RYFB 1COZA 4QBKA 1FYVA 3BFKA 1O3YA 5IZCA 1X13A 3HM9A 1Q0RA 1D4OA 2VNAA 4GXNA 4BGUA 1P2BA 1SOVA 1Q1GA 2ZIFA 1SETA 3A7AA 2W98A 3KZCA 1K97A 5BQOA 3BHMA 1WBDA 3UH0A 1DPGA 3PUIA 4O4JB 4JODA 3ZXSA 5A6VA 1W9MA 4XYLA 3QXSA 4DG8A 4MR9B 1L4YA 2HF9A 1A9TA 5HCIA 3TE6A 5JD5A 1UT5A 4U0KA 1BCSA 1Z63A 2ZVQX 4FGUA 1OKKD 3FKSA 4N4AA 2HMUA 4FBMA 1CFJA 4KQWA 3I52A 2BI7A 2FN7A 2O7NA 4TL9A 5JDCC 3DMDA 5JFTA 5KQLA 4C08A 2IX3A 1I6MA 2IYLD 4S1VA 3L84A 4FGLA 4F56A 1SK9A 2BZGA 2WT8A 3FNIA 3LRXA 1J20A 5FOXA 4LQLA 3S1AA 4REMA 1UOEA 2ODBA 1PQUA 3VSCA 5JD6A 4LJSA 3K1TA 1ZK1A 3GDOA 3B51X 1FDTA 2F9FA 3A4NA 2PR2A 4MA5A 4QQNA 2RFLA 1H1LB 6LDHA 1J97A 5HUQA 2XXJA 3KLOA 5EPEA 1XVTA 1QWSA 2V54A 3QWAA 1W5TA 2A33A 4ZT6A 5CFPA 3SICE 1H8HD 2O50A 3QUSA 5EXXA 3C5CA 2O8DA 2O1SA 1K3UB 4Q15A 3PGXA 5KEIA 4B17A 4XVRA 2R62A 3C6KA 4W82A 4PM4A 5K8UA 1MLDA 4Q4JB 1V35A 3OCJA 2EQBA 4S1TA 5DLDA 3WFIA 4DMUB 1XFDA 4QYTA 1GCUA 3WQRA 2FRXA 2C88A 1EUYA 2XUPA 3N0WA 4PGMA 5B6IA 4IMJB 5ESXA 1V3QE 4TMWA 1Q21A 4QDKA 5BSUA 1IPEA 4B0PA 5IN5A 5G0WA 3IH5A 1UFVA 2JD2A 2QLBA 3D8NA 2D5BA 4FFWA 3K32A 7MHTA 1WPYA 4J0DA 3UGJA 1A95A 1HZZC 1ZJYA 4MQLA 3TG2A 2AH5A 4KV9A 4QM6A 1C1XA 1QIJA 3U4QA 1O77A 2CZGA 4OXQA 3OA2A 1MX5A 1W5FA 3SLKA 1IM8A 4RSHA 5CB4B 3TGLA 2H6EA 3QM1A 3TS1A 2W42A 2EIXA 1KKLA 3G2QA 3HH8A 1PG2A 3I4FA 3NASA 4XCVA 1JH8A 3HJHA 1G8HA 5KYXB 2PVSA 2WWGA 4Y7CA 2VEDA 4LNUB 4INAA 4MX8A 3SVZA 5ITZB 1ESDA 2DR2A 2EBHX 2QAGB 3F5FA 1V8ZA 3JYQA 4CUJA 4MLZA 3T1YB 3BX1A 3DQPA 4MGEA 4CH4A 4F0JA 4D45A 3I62A 4J0QA 1UDCA 4AJKA 3WWCA 4QTZA 3ZWYA 2RBEA 3ER8A 1RT9A 4IRUB 3IBGA 4J3FA 4KACA 4D3FA 4QVIA 3CRQA 4MWOA 4UBLA 2FZLA 4PTYA 3TE7A 2F4NA 1UJ2A 3T3PB 1BFKA 1GA4A 1H0SA 3OQMA 3LLUA 4NCHA 1VE1A 2J67A 3HB1A 4D6XA 4EFKA 3JSAA 3NHBA 1ZD9A 3WWEA 4BNHA 1IZ8A 1I5EA 5KKCA 1N0WA 4Q0MA 4RQFA 1IBSA 1S8AA 4KXLA 3T15A 1M83A 2NQTA 3AYXB 1CUGA 3JZFA 1QO9A 1R4AA 4J49A 5HF5A 4HGPA 4UM8B 1YJQA 3ABRB 2ZIXA 4NYMR 1SVKA 2OO7A 2V3WA 4XGNA 3FI9A 4R40A 2CDRA 2VP2A 1DG3A 2RHTA 3UG6A 5E9QA 4EG0A 1E92A 4INZA 4R05A 4MQFB 1T4GA 4YMLA 2QYOA 2H1IA 1H4SA 2IEYA 1B8AA 2WD7A 3GUCA 2XOEA 3Q9UA 1FX0B 4ZRDA 3A7RA 5C1IA 1SHUX 3TIVA 3BXXA 3JZAA 4BYMA 1KPHA 1NRJB 1TU0A 1B42A 1L5SA 1NSTA 2ZVJA 4YRBA 5CFMA 4RF4A 4HN4B 4BE4A 2HJWA 3A11A 4EFMA 1ZCAA 4N5IX 4P3NA 5D86A 2C7VA 2W6OA 2ZJ1A 1DX6A 4H7EA 3OI7A 3K9CA 3RWBA 3VR4H 1YCGA 3PT9A 1WUIS 2VH5R 2XCUA 1GQFA 2J08A 3CUVA 1NLZA 1FK8A 4GW3A 1N2CE 2HO4A 3M81A 4Y0NA 1G51A 3D6FA 4YJHB 5TRTA 3SFZA 4I5GA 1IBMB 3HJCA 3SIXA 1T1SA 4PPGA 3D6MA 2FFBA 5ICGA 1JJAA 2C7QA 2JIZD 3QWBA 5C46F 4NBRA 1FPQA 1YI8A 4QOGA 3U3XA 2BFFA 3CWZA 5AUPB 2C95A 2PH1A 2WWYA 1X9IA 2XGSA 2BIFA 1T5IA 3AY0A 2P6NA 2OG1A 4YAOA 5G2OA 4IHJF 3RRNA 4J0EA 2SKDA 3KKZA 3UNXA 3B6ZA 2IU0A 4U2EA 3AU9A 3GZNB 1J1ZA 2GA9A 4B6QA 5JHGB 2ORYA 2IEBA 2JFZA 3K0FA 1QM5A 1ML4A 3UFXA 1AN9A 4RYLA 2ZS9A 1D3AA 2W2OA 3E7WA 1CR2A 3H5LA 4OA8A 4XB2A 4PZYA 3C1UA 3SY8A 1NR5A 3H65A 3PUJA 3CSDA 4NATA 4DQDA 2XJ4A 1WJGA 3HXYA 3CXRA 1GCAA 3HV2A 4JR2A 5J2TF 2QY6A 8OHMA 2X8WA 3JQQA 4Z9XA 3REUA 3N2ZB 3L6OO 1WR8A 4LK2A 4LVOA 2Z5GA 4E2FA 4ZCIA 2B8TA 2J48A 3TKAA 2WSMA 4D8WA 4C7OA 4EW3A 2FUG6 3DBHB 4YRNA 2GETA 4W8GA 3ER6A 3RS0A 2CRQA 1IFXA 2VHJA 4GYKA 3PNKA 3M4NA 4Q02A 3ONEA 4L7QA 5H80A 1IN8A 1TW3A 1MMFB 4QKQA 1WHTB 4LXTA 1X54A 3VXKA 3H17A 3NT4A 3P2KA 1RAHA 4LV8B 1DAHA 4PZUA 4ENPA 3EG5A 5C8ZA 1Y6FA 1DWPA 3NUGA 4IMPA 4OLJA 1B6SA 1PL6A 1JKJA 4E14A 3W3AD 5CA0B 3AKDA 1TGVA 3OEEA 1VKHA 4RHYA 1GKUB 1MGOA 3B89A 3QXGA 4TGLA 3ZIUA 5JATA 2WQ7A 1PS0A 3U4HA 1ILWA 3RFCA 3L8YA 2I67A 3KVVA 3RARA 3SOZA 4YCDA 2WF9A 3LSSA 4XWOA 3CMQA 3TDNA 4X61A 1HC7A 1V16A 2MDTA 1GDHA 4U0JA 3A6HA 2WINI 4WH0A 3LY7A 1WIWA 3QVXA 5CYPA 2B0CA 5HX7A 4WV3A 1A9PA 2DPGA 3VR5A 1BXKA 4O2AF 3G5LA 4E4RA 1WVMA 1IMOA 4L4YA 1QAOA 4PSKA 3SEFA 3CLSC 4BNLA 1RBQA 1ULBA 2F1KA 3I4LA 3R24A 3LL4A 3U1BA 1TFRA 4MDFA 5HM8A 4PXAA 1J8MF 1B76A 1CV2A 4IICA 1M1NB 3WB0A 4ER3A 4QDUA 1SXHA 4H60A 3UMRA 4ZO6A 1UPFA 2H4JA 3LVKB 3AP1A 2NSHA 1BU5A 1YS2X 1WQWA 4JUCA 3UY4A 3C7TA 3HCFA 1PR0A 4DUGA 4KQ1A 3SBXA 4OIFA 2QX7A 2QN6A 4TS4A 4M46A 3R7SA 4XYMA 2X41A 4L57A 4JI2B 1N8KA 1XCBA 4L76A 1MOQA 2W83A 1NN0A 1IOVA 1D0VA 1CUAA 2NXWA 3OEYA 2OQVA 2FFAA 3T9EA 2VZ0A 2VPWA 1EGMB 2XX3A 2YXNA 2VDNB 1NPDA 1F5SA 3E8XA 4N5NA 4Z9YA 1IDOA 2BMVA 2JLYA 2XXAB 2ON6A 3A2MA 4X95A 1LLFA 3UMJA 1QV6A 1GPDG 2RGBA 3L4SO 1GPJA 2IVZA 2ZRQA 3HVJA 3SP1A 2WIKA 3CX6A 2VF8A 2C03A 3RQIA 4P72C 1A88A 3I45A 4URHA 3EGIA 1GFZA 1Y3BE 3K0CA 3BICA 4IV8A 3OQJA 3V1YA 1YQXA 3OHMA 4V39A 2JLXA 3SE7A 1PK8A 1SUPA 3ISVA 1PR5A 4IEFB 4M76B 1TYBE 1AMOA 4GEKA 3OIFA 1KMHA 4V2IA 1J49A 1WZUA 2QHXA 2AUMA 4QOJA 5HF6A 5DISB 3U40A 4ZVQA 1JU4A 3DE3X 3V2GA 2D8MA 4BMOB 3ZBPA 2EJTA 5IM4F 3OF2A 1OX5A 1OXVA 1ZVKA 5JSKA 1Z39A 3TZEA 4ZOQI 2PUBA 3AEQA 1MR3F 2DPXA 5D5HA 3DJYA 3G2LA 4BNWA 3ABQB 3ESZA 1V7CA 4D6YA 1OA1A 4JASB 5AM1A 3KKNA 1OPXA 3KL4A 3U44A 4HEA1 5F9MA 4EVQA 1ZN2A 5ELOA 2JIMA 2P9QA 4MO2A 1X1TA 4JLNA 3LUKA 1SXJD 5MGBA 4C9BA 1WLEA 2G0NA 2GN8A 2V7QD 4AJOA 1NP3A 3TZBA 4Y3UA 1II8A 2GPAA 3HDJA 2IYEA 4C4PA 4ZC8A 3U7GA 1RPZA 3OIUA 2Y1WA 1TQHA 1Y7HA 4KLRA 4BQEA 1YDEA 2MINA 2GRJA 1UPBA 1P4RA 3E1GA 2QUAA 3VZSA 3R7DA 5E6UB 4MVJD 1T8PA 3ZNQA 1B70B 3D2CA 2KBFA 2JHFA 2I4IA 5IABA 3CLUD 4KP7A 1LDBA 2JFFA 4W9NA 4JUDX 1GZ6A 2P65A 2IZOA 1SD2A 1E9VA 1RPTA 3BCUA 1GILA 5HIAA 1XNJA 2ZI4A 1IDN1 1Y7LA 3EXFA 1NU8A 4I1RA 4Y1RB 4MP3A 3FTEA 4WW0A 3B48A 3G7NA 3SQLA 3FSJX 4XVUA 4ZI3A 1L7PA 2J5KA 2Z98A 1I36A 1YU9A 1CY6A 3W2IA 4BX3A 3HMQA 1G4AE 2WR8A 3F1KA 4JB0A 3V4ZA 1B7YB 1KI6B 4B6PA 1U2DC 2Q21A 4Y6QA 5A7FA 4Z4GA 3KWJA 3R7BA 2W0SA 3S5UA 4H2YA 3L7IA 3NONA 4RGYA 1CVIA 5IRCD 4AKTA 5C7YA 3H1AA 4Z7NB 3DAGA 3EFOA 3D8BA 3K4HA 3F9CA 4RTRA 1R1DA 2Q4OA 3E8SA 2IKQA 3A14A 5TJ9A 3INNA 4JR1A 4RPIA 4UQOA 2QD3A 4WSOA 5CM2Z 4NX2A 2VHWA 3BGVA 2G17A 3JQEA 2IRWA 4G89A 3VI3B 2OXIA 1VM0A 5CPFA 3D4OA 3OTQA 4JJIA 1L4UA 4QYWA 5KJCA 3JAKA 4I9HA 5H8WA 1HE8B 2N46A 4HJRA 4AN4A 5FV7A 5E4YA 1PWYE 2GJSA 4JROA 4QHTA 3LS2A 1NE2A 4CS3A 4E15A 2P5SA 5ALMA 1F2UB 2PWZA 3I9NA 4R2LA 2WFLA 4OATA 1NRIA 1GRQA 3AR8A 3HXZA 2JC3A 3D5QA 3O2QB 1YI1A 3Q8WA 2Z5LA 1P75A 1V4BA 4IJWA 4JQYA 1Q77A 2DWOA 4HNAA 3RHSA 4NOMA 3ANYB 5KQSA 4KE9A 2OGTA 2W90A 5FORA 3CJRA 1D7OA 5U1PA 2WMOB 1N3LA 1NYTA 3LA8A 4HX2A 1JL3A 2QZ9A 1JHZA 3HWSA 3PC3A 3VC2A 2WICA 3C2QA 4H08A 4B4UA 2RHJA 1PZXA 4OGFA 4OQDA 5DM2A 4KQIA 4RV9A 2QJRA 1Z22A 4DEYA 1G5RA 1MUUA 3Q3GE 1JI0A 4I1IA 3CJTA 4K05A 5T4FA 2VTBB 1ZY2A 3IAM6 3RPEA 1IIRA 4DDHA 4DXAA 3VJLA 2XNHA 3EISA 1NU6A 2WBLC 1I80A 1YS4A 2ZTVA 3CO0S 4FFLA 1DZIA 3O31A 1F0YA 4BXOB 3HR4A 2AC4A 2CCJA 2X6RA 4DRYA 3UAVA 4MUBA 2DXIA 3BYZA 2X19A 1W0KD 1AXEA 2ZRDA 3P96A 1BWRA 3D54D 2HJHA 3VMFA 5LOVF 2X4LA 1KAEA 2X0KA 4HAOA 1JYSA 1NR1A 2YTZA 4XQEA 4IIDA 4L2IA 3UENA 1GL9B 4DLTA 4F9EA 5IDXA 5FAKA 4FDMA 5LMUB 2A5GA 3O4FA 3S2YA 5L40A 1P77A 1LEHA 3H1GA 3IAFA 3ZWXA 2ZI3A 2WG2A 2ZRAA 2H31A 3AJ8A 3B70A 5BSTA 5TQ0B 4X1IA 4B82A 3QHPA 5CAEB 3B2NA 4ZGBA 2FKAA 1U7TA 4AS3A 3HNPA 4A36A 4A6XA 4LMBA 2WWVD 1AGYA 2EGHA 1NKVA 5KKAA 1N3IA 3DDWA 4PPFA 2GMWA 4BO6A 2HC9A 4G5SA 1GGHA 3MMSA 3TW8A 4BFUA 5GVRA 2CLSA 3IBCA 1MG0A 1D2AA 1BE8A 4CFSA 5KBYA 5LQCA 2UUAB 2AOWA 2CWDA 3T5CA 4H27A 2JZCA 2X9NA 3AJRA 3LDAA 2OYCA 5JWRA 3AUUA 5DHAA 3IEVA 2C8LA 5C1OA 4PZAA 1ZLYA 3JQDA 2WWWA 1EBFA 4WNIA 2E9SA 3RAEC 1Q0ZA 2DDZA 1RE1A 3B78A 2HIAA 3BTOA 4FZ3A 4PCUA 5BQPA 1OJLA 1J07A 1Z0KA 1KI8A 2AF4C 1YQUA 1MC1A 2WKWA 3EN0A 3JASB 1HE4A 3IR6A 4HQRA 4BVHA 4I4IA 4EGSA 2IGTA 1M34E 1M8FA 3LC1O 3V7UA 1Z0FA 4DZZA 1H94A 3CLTC 5E1OA 1JEAA 4KSCA 1GG8A 2ZQZA 4RJKA 3H83A 2ACVA 1ZRHA 2YHIA 4WIAA 1QVAA 2HSWA 1XP5A 3DE0X 2OE2A 1HKUA 1NUAA 3HUDA 3OO0A 5FL7A 3RUIA 3TFOA 2AUTA 2YINC 4C7BA 2CJWB 3BCRA 3WLLA 2BKYX 3VMMA 3RHTA 3PHBE 1II7A 1URPA 2H3EA 4TV9A 1SU4A 1M6NA 5B1DA 2J0EA 2X0NA 2XVXA 3LXMA 4IHQA 3VR2D 2HMWA 1XFAA 4TYWA 1P3Y1 5K0TA 1N6HA 2PZFA 2VCHA 5FOWA 3DMPA 3AM4A 2QN3A 2IS1A 2HMTA 3FNHA 2AOUA 2Y93A 3EPRA 3NOQA 3AJEA 5LYJF 1M7GA 2IUTA 4PZDA 2C83A 1SVNA 3NRCA 4D4LA 1BYUA 3R3VA 1DAIA 1WXFA 2YWFA 3B9RA 3K2IA 5IAOA 4US0R 1Z7EA 4V1CA 2O19A 1MQSA 3O7MA 2Q5IA 4NNPA 2PUDA 1E1LA 4BV3A 1RKQA 5DMXA 4P4LA 1XKLA 5KC9A 2XA9A 5C5DA 1Y4ZA 5D84A 2FWMX 3AKEA 3PRHA 5IKOA 4DADA 4ZQGA 1QO7A 1E3SA 1N9WA 3BULA 1A9XA 2F3UA 3OE5A 2YZ7A 4A6EA 1Z29A 9GPBA 2NSJA 4HVCA 2HDWA 3PC4A 1WABA 5CEFA 4HGOA 4C21A 3FFWA 4CTMA 2BGLA 3B2EA 1D1TA 4JKOA 4KXVA 1LBEA 5LYYA 4DT1B 4I50A 3HUTA 4GZ5A 3ZJ4A 4OGWA 3I42A 3JPYA 1WBBA 3R7NA 1E6CA 1R0BA 1OI2A 3NHWA 1G21A 3WX0A 3PTAA 4XM2A 1Y8RA 3MZ0A 3N87A 3OH8A 4MJXA 4J7AA 4W1PA 4E6PA 4EDHA 2FDRA 3FMIA 2DQ4A 2MYNA 3Q7QA 3P9NA 4JBXA 1M6VA 3SYKA 2BGTA 3CYFA 4XRGA 1R0KA 3EHDA 5JEDA 3OKPA 1GQRA 4UXIA 4YRDA 1IMJA 1ETHA 5J40A 2BUCA 4FYWA 3NGXA 1GXSA 4JC8A 4UBMA 4YAKA 3KYCA 5KTKA 5F2KA 2Y0DA 4CR8A 3R3UA 3EG9B 3G17A 3VPBA 2OBBA 2OVBA 4DSAA 2BEVB 2FPIB 3U4CA 3NEYA 2OHVA 3WIBA 4HR7A 3L7DA 2Z43A 2ANCA 4MLDA 3P71T 3A9WA 3MW8A 3WXMA 4RSGA 4IJ5A 1N36B 1WZIA 4G36A 2HM7A 3QPUA 3ND6A 1YO6A 2CLCX 1E6KA 5CDFE 1UEXC 2L8YA 5BQ5A 1JDBC 3VTIA 1J8YF 2KB0A 3U80A 3OJXA 4LYDA 1MTOA 1I4EB 3NRJA 2NUBA 1QZ3A 5DNDA 1RNLA 4M99A 3RROA 3H11B 5TPZD 2H52A 3H97A 4XIJA 3VQTA 2EFHB 3GXOA 4XFDA 1QVZA 4OM7A 2D7DA 1M1XB 4OH7A 3W1WA 4CGZA 1H2EA 2GNAA 5DHFA 5REQB 5F52A 1V11B 1P2TA 2XH8A 5DXFA 5FI0B 1IY9A 2YS6A 4UE6A 1SKQA 4GH5A 3LPAA 2B7BA 4L1KA 4ACAA 1R3UA 2VHEA 2C29D 4WY2A 4LXXA 3U3KA 1SHKA 4UHHA 1GNVA 2UUBB 1H2HA 5I8PA 3FGNA 1DRVA 3IUMA 4QLAA 1HT2E 3GLFA 4RPHA 5EJEA 1YB5A 4RZHA 4I8IA 5CVEA 1QTRA 4UVEA 2QZZA 3ADBA 2I54A 2BONA 4PNPA 3TJZA 4FLMA 3PSAA 2XB2A 3EA5A 3IAEA 1VCNA 1KJIA 1EVQA 4H2XA 5E3IA 3IDOA 1V3UA 2ECPA 3ADPA 2WK1A 4QU0A 4FMPA 4EJ0A 2X4DA 4ROSA 5U4QA 4AW9A 2ZI6A 1QUEA 1RAEA 3MAAC 1KDVA 1WY7A 2YFYA 4YJ2B 1CJCA 3DMYA 3SGLA 1EVLA 4YRMA 4OY3A 1CDZA 3U49A 3U60B 1YH3A 2CUNA 5C35A 4R1TA 5B1SA 3VBEA 1A5ZA 2XDYA 4GQIA 2XEDA 5HRCA 4BJHB 1M2OB 5JIBA 1R0CA 2IW3A 4GICA 3HCCA 3C5WP 2GXAA 2ZIUB 4TMYA 1Z6GA 3ZX4A 2ZWVA 3EJ6A 3OHPA 3PV0A 3QF4A 5ABPA 5AVSA 1AO3A 5KYUA 1AKTA 1A82A 2FUKA 3LKDA 3MHTA 3EX7C 3K72B 2HR1A 3U0BA 4YP0A 4QRDA 5EAIA 3P2IA 1TVEA 2GUWA 2Z6VA 3NELA 4H18A 3A3PA 3I7FA 4L0CA 3WYDA 1ZCFA 4GM4A 4ER7A 4TTPA 5KU1A 1ZHHA 2JARA 2H5JA 5HXAA 2P0EA 2K87A 1UBSB 4TWAA 5LB4A 3Q2KA 3RH0A 1JR4A 3VR3D 3NALA 3R9IA 3CRW1 4BKUA 3I12A 3D31A 3HRIA 3QFCA 5AK4A 3ZV6A 5GM2A 3OBBA 2VDUE 1MHPA 1SVIA 2C2ZA 1IHOA 1ASYA 2H65A 3BA1A 3LYUA 5CVCA 4R8LA 4ZQIA 4BVJA 3RV4A 1EVKA 4JSTA 1JILA 1HY3A 1CKEA 3TEHB 1KIAA 2GHIA 4IWNA 1DIOB 2UUCB 5GWXA 1YS6A 2ZSDA 3K92A 4I8DA 4UDOA 5CVDA 5CVVA 4ZVKA 4F60A 4OJYA 3ZDQA 5JXIA 4IQ4A 3VR5H 4DLWA 2O0LA 3WRYA 3CIFA 4NCIA 4UXHA 5FV4A 1YCHA 2P0AA 1UWKA 3NUQA 3MM4A 4M49A 3GCXA 2PUAA 2DB3A 1OXUA 2R6FA 4LOKA 4S12A 4KRFA 3OESA 2QRLA 4O8CA 5HQ3B 4ZAXA 5FBHA 5DRYA 4FBWA 3QVGB 1MOZA 3CLVA 4ZU1X 3ZJTA 3FTDA 3IULA 1I7LA 4INPA 1NBWB 1JWLA 4WZZA 4M53A 3RS8A 4KPEC 5P8WA 1D2RA 4OHMA 1UBUS 1FX1A 2P79A 4EMTA 4D26A 2FFJA 3ZTWA 3D02A 5JYBA 2OORA 1KQFA 3PFFA 4KX3A 4EI9A 2QSJA 3IVCA 3T5BA 4CEHB 3NKLA 1SBCA 4B2YA 1O4VA 2P27A 1JMKC 2DQ0A 3O5AA 4CQLA 2QYSA 3A4TA 4X8HA 5K6TA 4KB5A 1JBEA 2C2XA 4I7EA 3UANA 5ALNA 2WPNA 5IDYA 2O1EA 1VRVA 2OHJA 4RTOA 2R0QC 1SVMA 2O5CA 3FZQA 2X9VA 5T67A 4LHVA 4ITVA 1EUZA 1WY5A 3AJ9A 2XDQB 1WCWA 3T3IA 2FSPA 4HYQA 4KZPA 4G0UA 4G37A 3VU8A 4H6XA 1L0BA 3MWFA 3LQFA 4AUMA 2AKWA 5K3OA 4UEJA 4AJJA 1WF3A 5EIOA 2NT4A 3ENQA 1R6DA 1ZI9A 1Z06A 3MMNA 5F21A 2ZCVA 3GT0A 3HO6A 4QX6A 3WHKA 3ZU4A 2DCMA 3N8HA 5SZKB 1S01A 1RWQA 5EGSA 5B2EA 2IXEA 2H5IA 3DCIA 4G0ZA 4F3CA 5FDFA 4PHCA 5JNRA 1Z9BA 2H92A 1Q1NA 1FDIA 2CNNA 1P7PA 3NWBA 2HHLA 5EUQB 4IDDA 2ID8A 5DIFA 5DW3A 3RBXA 5A4DA 3KE9A 3T7EA 3WXBA 1CEYA 4ZEMA 2Q1TA 1H6DA 3OZIA 1ZGJA 3R9KA 3NV9A 2AHOA 4GBGA 1M75A 4RIFA 4G2NA 1IN5A 4OK6A 4QPCA 4AYWA 4GX1A 3WYAA 3A5ZA 4G2TA 4Y0VA 5FPYA 2AW3A 3ZOKA 1SUIA 4OHBA 4BC0A 1ZOPA 4Q4DA 5A4IS 2RKBA 5EVCA 2BAGA 4UUAA 2P75A 3S8MA 4C4OA 4KE6A 4AZVA 3JARB 1PLLA 5BV0A 5CD9A 1K1EA 1XU9A 1A9ZA 3ORHA 3T3NA 1H3FA 3BM5A 4K6OA 3ZEAA 1Z4OA 4JGIA 2QGNA 1XVLA 1YI0A 3WGIA 1OASA 3CLRC 1ISSA 3G2KA 4FHEA 1O95D 3GUUA 2MSCB 3F8TA 3GLRA 3BIOA 5B4UA 1FYWA 2IF0A 3TO5A 2WIJA 3MSCA 4XR9A 2KW5A 3ZVMA 4MARA 3FZEA 4WINA 3RKUA 1PJ2A 3W6ZA 2DWPA 4K26A 4M6WA 3WIEA 3HO8A 3JTEA 2YVLA 3C24A 3AF0A 1L5HB 1PP4A 2ZT7A 1S8FA 3OFKA 4L9WA 4LVUA 2P6RA 1Z0JA 2EW1A 2WLSA 2PL1A 1YMVA 2UVDA 3CJQA 5AK0A 5HEKA 1A2OA 4BLUA 3SXJA 5EQDA 2DYKA 3DVAA 3N2IA 4FDTA 3T38A 1IJEA 4LC1A 1W93A 4G97A 5GQSA 3GVIA 1RPNA 4V3BA 3NU1A 1U0SY 2REQA 4WE3A 4Q24A 2JD0A 4XQ0A 3E9DA 1Y3DE 3FB4A 2NO4A 4XYGA 1GPKA 2A5DA 3CR7A 3ELDA 2CN1A 2DQ3A 1NV9A 4RK4A 3WMXA 3CCBA 4NZRM 4MIYA 5KPJA 1XQ9A 1NG1A 4FOTA 3H9CA 2XMSA 3JVUA 4MPPA 2ZCUA 3KTDA 3AINA 3L0IB 4MAFA 3VU3A 1AB5A 3AEKB 3P19A 2ZXEA 3QEAZ 4MR8B 2P4QA 1VJ0A 1LDGA 2HNBA 3PCOB 2DBYA 2VRCD 5JV5A 3LYAA 1TIGA 4UEQA 2JW5A 4NPCA 1YFKA 1JHOA 2A6PA 3DB2A 3AUSA 3HFGA 3RKYA 1XN4A 2J87A 4BMCA 1DS6A 2M98A 3OPYA 1V48A 4MQUA 3CSSA 1HQDA 1AVTA 1DTWA 2P9ZA 5FLYA 2HWWA 1MENA 1CVLA 4L8YA 5FXMA 4EA7A 5EMNA 2DRIA 5BQXA 4KIWA 1Q1EA 1CXZA 4RQUA 3I9V1 1EAMA 4D7AA 4YMHA 3THXA 3IKMB 3CH4B 2D0PB 4EG3A 1UFOA 3FPLA 1KZ1A 3ZIDA 4D9CA 4LJ8A 5B37A 5JD4A 2QZ4A 3F90A 3EQ7A 4CM7A 3A3NA 1DQNA 3IQIX 3KV1A 1N9GB 4RVDA 2X1HA 3DEJA 4NONA 4OHUA 3BGOS 4YCBA 1Z6AA 5AKZA 1T2DA 2I4MA 1BVYF 2H1LA 2BMFA 3BG5A 4FDAA 4J2HA 3RVLA 3U62A 4BLPA 5A9SB 1U04A 1SQGA 5KUTA 2HB6A 3AI7A 1TIBA 2X4IA 3OU6A 2W11A 2GK4A 1H0KA 4LXYA 2FX2A 3DZCA 5EZYA 1E1TA 2YJ5A 4OMCA 5IJ9B 4O4IB 5JAUA 5KO2A 4DCVA 2I0FA 4RTQA 5INTA 1RXWA 1MZPA 2XCTB 1OH6A 1BA3A 1H4VB 1QK5A 2CMKA 4CF6A 5AVZA 1U8ZA 4IF6A 2QRVA 3UCXA 2PWPA 1QGED 4EW6A 1WKCA 3L5OA 2C4UA 2BFCA 2EJFA 2O3RA 3IC5A 4QD3A 2VFAA 1KIMA 1E0DA 1FP4B 4CDNA 2P6OA 4E7PA 3PEWA 3D2AA 2VDRB 3O1LA 4YJFA 4YALA 4BLTA 1L5QA 4NJEB 4CMGA 4TS9A 1T8RA 2PSJA 4KR0A 4RADA 2DLCX 3M4PA 5KTOA 4W4TA 3BVPA 4UUPA 4KHPB 4EMUA 2HCRA 4B6SA 5BR4A 2B4RO 4PICA 3ILHA 3VHXB 3HXXA 2EYUA 3RHZA 3L4EA 1ISPA 1AD2A 3DPSA 5GOZA 5GIOE 1Q3TA 1PK9A 2HPZA 3I2JA 2APJA 5ELNA 3I5AA 4JK3A 2I2DA 3ANLA 2W6JA 2EKPA 3F46A 3Q0IA 3RJMA 4X3CA 1UF9A 1YR3A 3AR3A 3NWPA 4K6HA 4R83A 1EVEA 4YEDA 1U8UA 3FX2A 2O3SA 5CW1A 4EUKA 5DK6A 4ZVTA 5JUWA 5T41A 1D04A 4EHAA 4ZANA 3L7OA 3VNRA 3LV8A 5TSDA 5KDLA 2PEYA 3UF0A 4L5YA 1LI7A 4EEKA 3NYQA 1S2OA 2OFFA 1DZ3A 3HACA 4HBZA 4EABA 2B94A 2YCLA 3A1DA 1W7AA 3C6MA 3BD9A 2GF9A 3EIQA 3L6RA 3BXHA 1IUKA 1ODSA 3A37A 3JQRA 5ECGC 3T3OA 3K0KA 2DEQA 3CVUA 3SXUB 1JDPA 4IXNA 5DLEA 2K7FA 1Q92A 1THTA 1ZUNA 5I6DA 2ZBDA 4M0EA 4OYYA 1ZAKA 2VDOB 3WGZA 1FUEA 1R4MB 2ZUSA 3L5KA 3Q3JB 3QLUC 5BRNA 2D1SA 2GRAA 1ZXLA 3N9IA 3UGKA 4PC3A 4K88A 1KMQA 2AG8A 2AN4A 4JJAA 5FWAA 5KHOC 2IXDA 1IVNA 4QWMA 5B1IA 1L8LA 2AJ8A 3A7UA 2TMYA 4S2EA 3BMQB 4XCXA 3ZQ6A 5JXGA 5CT6A 1MIOA 1C14A 2XE8A 2BBSA 2WHYA 3ZD9A 4CT4B 4DJTA 4B44A 2ZDGA 1H85A 4A0FA 1B8VA 2OVFA 3SZMA 4G26A 5AI6A 4JVOA 4C4YA 1QAMA 4BNZA 5EXTA 3KKEA 1JJFA 2ID4A 5LQKA 2A3NA 2XWSA 2Y1GA 2VHYA 4RCZA 5ESDA 2PS1A 4HS4A 1VA5A 4DLSA 3F8SA 1NLMA 2ATIA 2UUPA 2ZSIA 3AFHA 2ZIMA 1U3FA 5ICMA 1D8TA 3VO9A 3HJAA 1PU2A 2YZMA 3PQEA 5EWLA 1N5RA 4RKQA 5IVKA 2G08A 3ID6C 3HYSA 3EFBA 2OZEA 1BIAA 2W48A 2EL7A 3BREA 3Q3EA 1A9OA 1GQYA 4L74A 4FFPA 4IVQA 1ZH6A 1I4OA 3W4KA 4RS4A 1NTOA 3CTPA 3Q2IA 3V6LA 2C4WA 4AZ3B 3NMUF 1LRLA 3CNEA 2ZRGA 3RF1A 1YB1A 2PQ6A 2UUOA 2VATA 2QX6A 1YK0A 4WBSA 1I1QB 1JVBA 3Q3CA 3AVOA 1V26A 2CMGA 1L4LA 4I9UA 3FMGA 5KNNA 1NBME 4JJEA 2RAPA 3R09A 4IEEA 1T3LA 4F46A 5JSHA 4FFNA 5LOVB 2P30A 1RXEA 1ZRSA 3DWGA 1GZSA 4QO8A 4TN5A 1AKQA 4RDXA 1NF3A 2Z8ZA 3DVRX 5E2BA 3ZE8A 4P7KA 5LP1A 3SVTA 2HQ1A 1JFTA 5KAMA 3DOUA 3K1AA 4BWYA 1N0UA 2UZ1B 3T7SA 1WUYA 2K4MA 3KP1A 5DDIP 2X8BA 3G13A 2CB0A 2W9XA 1NJ1A 2W37A 2WFAA 3FSGA 5I9SA 4DLLA 4IFTA 2CHGA 5IH7A 5IUNC 1XXHA 3F6CA 2A1TR 4CH6A 1Q16A 5KYTA 1AJEA 1P61B 3LWZA 4G0MA 4GXTA 1WA5A 4LY0A 1RVV1 4S1NA 1EM8B 4JBWA 1WPGA 1DC8A 1E3DA 2X2PA 1L4FA 4TWJA 3SHVA 4BNIA 2HTFA 1SH7A 3H16A 5AD1A 2QP4A 4LXGA 4CM5A 5C5CA 1NW4A 4YTEA 3TLCA 1L5ZA 3WHLA 5AIBA 1DAOA 1RTTA 1DIGA 2VLIA 4EZBA 1E3WB 1PNQA 1YUMA 2C3YA 1PLJA 1ST3A 2QTVA 1MZVA 2C42A 3DZBA 4L28A 4PWZA 3OUUA 1L5LA 2Y71A 2QRPA 1RXUA 2OAP1 2X3UA 1KPIA 2HLPA 4MVJM 2IYTA 5DE3A 5CFQA 1FDUA 1G6HA 3LSQA 2RHCA 3CKYA 2I6FA 3TR0A 4GIBA 3I5YA 3KUCA 2GR9A 3RC8A 1OREA 1YA8A 3CZAA 1NV8A 3SJUA 3D3WA 4I19A 3OAAD 2OLEA 1X94A 3PKZA 1BE1A 3KS9A 3BWVA 1UODA 5HZKA 1H2RS 2OD2A 1V8FA 3KQSA 3P97A 4FHGA 1R9NA 3H9EO 1Q44A 1RHQA 4TLCA 1MRSA 1J5XA 3CKMA 2HV9A 3D3QA 2QY9A 3K5HA 1UJBA 3R5TA 2O9JA 2NVUB 2Z2IA 1SA0B 1R4NA 4G07A 3T9FA 3F8WA 3GZ4A 4NENA 3K6SB 4OV6B 3I8SA 2GEJA 1KI3A 1KYWA 1YA4A 2JH8A 3VJRA 2AMLA 1LX6A 3ZU3A 1RCTE 3IUYA 3G6WA 4N0DA 1E9CA 3IOBA 2I34A 3KUXA 3BGIA 5FOQA 1A9YA 1BU8A 4EJSA 4AMBA 1J21A 2ZTSA 3O8NA 4FCCA 2Z8YA 1FSGA 1IPFA 4LI0A 4MRMA 4Q9IA 4NYIQ 3IELA 1ZFNA 1Y1SA 1ZSYA 4TV9F 3WGJA 3IEMA 4FGKA 1TJPB 2H2IA 1DELA 4Y6RA 4G5XA 4TSKA 4YP6A 3SDZA 2XCOA 5FPTA 2PKCA 1NW5A 1N0VC 3OQIA 1Y4SA 3PE4A 1OY1A 4YRZA 3GN1A 4RV5A 4A92A 4Q3AA 1VLJA 1NW3A 4MRNA 3FG9A 1ZGCA 3GLIB 4RPKA 4P73C 4ENSA 3L8EA 5D1HA 5ICEA 1GLVA 3DNMA 4XGQA 1UJMA 1RRVA 2BFBA 3EAFA 2ZNJA 4JBYA 2LPMA 3AF1A 1Z38A 2CVQA 3HR8A 4L02A 3HXMA 3GMSA 3SCZA 4A16A 2P11A 1MABA 1P1FA 1V25A 1A8IA 1P44A 1BH2A 2GB4A 2IYSA 3LO8A 4KQ2A 4ZJPA 2OWEA 4V0NA 3S5JA 1KVSA 4GKKB 4R68A 621PA 3DNPA 4P4UA 3OZDA 2GQ0A 1XAIA 3II6X 2V6BA 4Q7LA 4V2UA 1D5WA 5C0OE 4B4DA 4I50F 5D3MA 1T1EA 5ARDA 5H0IA 3WLMA 3WGVA 1VP3A 1T9AA 1XJQA 1Y82A 5A3VA 2DKOA 2P68A 2EAYA 1G5TA 1RP1A 1JYFA 2J0VA 4PO1A 1G59A 2XJ9A 3V34A 3WBKA 4B35A 2PZMA 3NWOA 4MZXA 2J5RA 2Q6TA 3PZRA 2G28A 2DKGA 3T3DA 1JU9A 3HA3A 3W78A 4TZ6A 4OX9B 4FP9A 1JW9B 4AROA 1CQJB 1NJSA 4FXOA 2JA2A 5CLJA 2R4TA 4C22A 2E1PA 4KPUB 3UOAB 4OQYA 3FRHA 2VSOA 4CKZA 3KVYA 4DCSA 3WL3A 1OAOA 1V5GA 1WXXA 4RHTA 1IHDA 1JHAA 3EWSA 5HMLA 4OP1A 3RDPA 4FLFA 2X5XA 3DWIA 2XZLA 1M7HA 1MD9A 2VNHA 1LS6A 2AV6A 3GPBA 4N48A 5EIHA 1SURA 2RI1A 3EEFA 4MQMA 2HLDA 4OL9A 5EQTA 1J00A 3V9AA 4F7WA 4JI5B 5KDOA 3RADC 1ADCA 3ACBA 3BIJA 3BZBA 3DDUA 3JXEA 3DV0A 3TTFA 1IEWA 5T3YA 3U37A 4D3YA 1AQIA 3GJTA 4PNEA 5JTTA 3D4BA 1QHEA 2WKQA 2AE2A 4M9UA 3TB4A 3TW4A 4DB4A 1DWUA 3O47A 3AQ4A 3N6XA 5E7IA 3WFZA 2VDKB 2ZTHA 3ZWWA 4NQRA 2ZETA 1R6UA 4AMGA 1EG7A 1RI5A 2IZ1A 2GZSA 5AM3A 4ZMRA 1FSPA 3AR2A 1K5DA 3D6NB 5K6AC 1D2GA 2C3MA 5IAGA 1D9ZA 2OZLA 4WN9B 4HO1X 1JJ7A 2PUGA 3DFIA 4NVRA 5THKA 3IDZA 1KC3A 1NNI1 1UBJS 2VNKA 3LG2A 3T0GA 2B2CA 4BY9E 2XGTA 1G55A 3WIUA 2HIMA 3ZY5A 1GZUA 1Q0LA 4DB2A 3GLQA 5AVTA 4GI5A 3CVYA 3FKSD 4Z9AA 3BSFA 4BMXA 4S1OA 2JAQA 3PRYA 3GD5A 4CQMB 1JPUA 4Q82A 2O4UX 4WQMA 4LVMA 1XQ1A 4RFVA 2GKGA 3WGUA 1FDVA 3DEIA 2J0UB 2VSFA 4HZUA 3JQFA 1OOEA 5MHTA 4JJ7A 1EXNA 3OZFA 3KSZO 4J7XA 2I6SA 1DKLA 4DIDA 1N4AA 4KO4S 1J9ZA 1DBVO 1N0HA 2ZJZA 3QJGA 3L43A 2I2WA 1GG2A 1GGNA 4QTXA 3OZVA 5EXDA 4C6SA 1FFSA 4LK3A 1DSSG 1Q0HA 2WSYB 2E3CA 1RQGA 4FDVA 1SHLA 4E7OA 2E1HA 2GFIA 4A23A 1QB7A 3L6UA 1MFPA 3S0JA 4EARA 4IDQA 1M9NA 1N2CA 2D1TA 1HL3A 5TMDA 3WWPA 1OR8A 1UIMA 2H16A 1U31A 1W76A 1JG6A 1FFAA 1Y7IA 5C4GB 3WMEA 3MCTA 4QDXA 2ZDQA 1U3DA 4CLHA 4MLCA 5JECA 1JZQA 4H3SA 3RK0A 5BWCA 1TF2A 3FW1A 1NN1A 3NI2A 4FX5A 4F4DA 2H1OA 1X56A 2O3UA 3EE6A 4LHSA 5CB0A 4NG5A 5D7NA 1DBWA 2XUGA 3GFOA 4M8LA 4IPTA 5ALOA 4A10A 4BCBA 3EOAI 3AB3A 1DC7A 3OJEA 4CG2A 4D4JA 3EEOA 1ECGA 5DIZA 1PSWA 4YROA 4LVKA 1E0JA 3PC6A 4KOEC 3SQDA 1VDMA 3MLBA 2NNWB 4GT1A 4MHTA 2WD8A 4UBKA 3V8BA 1NAHA 3QMPA 1SQFA 2LBPA 1X7YA 3G2NA 5EP3A 3DL0A 1GHTA 1VLVA 4G09A 1PNOA 4GMFA 3UTDA 1JH9A 3WDKA 3EXIB 3HVHA 2YW9A 2OZVA 3REXA 1FP2A 4DLRA 2QVXX 1WCIB 3WKEA 2QTNA 1YGYA 3UZUA 2WE8A 4H1UA 1G17A 1WQ3A 5EMLA 2Q2QA 2PQ0A 2HYDA 4OOFA 1D4AA 3TRFA 4OI2A 3GFQA 4I4LA 1TYDE 2C00A 4CYMA 4UTPA 1P0FA 3AESB 4KN9S 1JT9A 1I3LA 4B3XA 4CWAA 5HKOA 4RVHA 2Q7GA 4RZUA 2Q1YA 4LG1A 1TQ8A 1UPAA 2NTEA 5G41A 4GDMA 4QGSA 2J09A 4B43A 1C30A 3AGQA 3PGVA 1WOYA 2A9PA 3HDGA 4NFSA 2BKEA 5EZ5A 1F51E 1WVIA 5BSHA 1XYYA 2IPNA 4JUAA 4AKGA 4UOQA 3DBLB 3WP1B 1J2UA 2CDBA 3DQQA 3TGPA 3WBMA 1TD1A 2FMKA 2O07A 1Q7BA 4XGIA 5B7QA 3LGXA 4PZ0A 3DVSX 3W5UA 1TCVA 2Q4TA 1L1FA 3PFHA 4HWGA 3IV9A 1JZSA 2I29A 4MAAA 4WNYA 1DIHA 3O2NA 4TQDA 4MROA 4V0RA 4KUHA 4YMWA 3G85A 1E2MA 4HMPA 3D2BA 3BE8A 3OE1A 4M9QA 5IAKA 3RSOA 3T61A 4BCDA 1P1KA 3I0NA 1GO2A 1EHCA 2K2QB 3RU3A 5CG2A 4Q4AA 3T7IA 4ENTA 4I9GA 1SPXA 1RYDA 1KI9A 4MS4A 2JKZA 4RIGA 5HFJA 1R10A 3G2JA 3NCTA 2IOHA 821PA 3QSYA 1A5TA 3JALB 4JX9A 2NZJA 5CCXA 5DBHX 5H1YA 1JQBA 4FZVA 4PIMA 1SCBA 2Q3VA 2OQIA 3BTSA 3MCWA 4UNPA 4Y2UA 3RIRA 5EXEA 3VOBA 4CGYA 3RL6A 2XVAA 4GO1A 4PX3A 4ETNA 1YF3A 2PX5A 2WFZA 4AF7A 4HAZA 3P0EA 3PC8C 2ZRCA 3IIMA 2CJYA 1DL5A 3MINA 4HAWA 4V0QA 2KLHA 2GCIA 4ERXA 3EGXA 5AVJA 3GDGA 3I6YA 2X4GA 3LDFA 4RX1A 5LQRA 3VJMA 4DCMA 4FEYA 1NPYA 3L2OB 3HMKA 1A69A 1VL0A 2VTEA 1DT3A 2XYHA 4MJ3A 4N7RA 11ASA 4E5DA 3AVWA 1XDZA 1L3BA 1X8KA 4RJ2A 3HCNA 4LBYA 5DCLA 1KBOA 1UMBB 1C8LA 5FFNA 2OQRA 4HYEA 4K7JA 4Y9SA 4OU4A 1UC8A 4O1IA 3TDMA 1HQYE 2P4HX 1VYHA 2C96A 2PO7A 3B6KA 2M1XA 3VQWA 2CKDA 1VQZA 1PV4A 4P81A 5U4XA 1YU6A 3D3NA 3KKQA 3OA0A 2OD9A 3A4YA 4XYBA 5IBQA 5JYEA 2JK0A 4FONA 3MWGA 5E8RA 3UJCA 3TF5A 3LVFO 1EVJA 2ZB2A 2B3TA 4ONEA 2Q4RA 4X92A 1M1YB 3GUYA 3HE3A 2REOA 2Q7OE 4H4EA 1TFUA 1MPXA 4MQEA 2PG3A 1CJUC 2HAEA 5EPUA 1M74A 1Y81A 3ZHCA 2JJMA 1YDHA 4JT9A 5K0GA 5DVZA 4FZ5A 2IY9A 1HO3A 1HORA 3PFCA 1XTRA 2ZAYA 2C77A 2VT2A 3ECSA 4L72A 4BEBA 5KINB 2IS4A 1RM4A 3GCWA 4HEJA 1V45E 4IP0A 4WZAB 1G3UA 1GU1A 1FP1D 1AKUA 1STOA 1T6NA 1U2PA 2JKVA 3PNPA 4N0PA 5FJJA 5C31A 5FBVB 1LLQA 1BW9B 1TAHA 1WW2A 2QLTA 3FOWA 1ECFA 3A6LA 3FY4A 3LQ4A 3DAOA 1NC3A 1SU8A 4FM9A 3QHAA 1RAIA 2Z09A 4QATA 2I4NA 1U65A 3ZHXA 2W2MA 2Y0PA 2PLWA 3PNBA 1JJCA 4XJXA 3W2FA 4BTEA 3ONWA 1WXDA 2CNWA 5K0NA 1CUUA 2X2OA 3ET4A 4BVKA 3N6RA 2VAXA 3RRZA 3TAHA 1KOJA 4JI0B 1PDOA 1Y7TA 1E0KA 1RI4A 5F5WA 2GILA 3I6BA 4Z6KA 5EHXA 2JBAB 2D00A 2WJHA 1IRIA 3IP8A 1SVUA 3OIDA 3OEED 4HDNA 4I6JA 3ZNPA 3LFTA 4EHIA 3AVVA 3MPOA 4ZCQA 1XPOA 3IE2A 2O8BB 4C0SA 1YR9A 3F7TA 2C58A 4LN1A 4K46A 3REGA 4AG5A 4M3NA 4G5YA 3CLKA 4ETMA 1B0UA 4TRNA 5HJ7A 2BYTA 1KMCA 2AOVA 3I04M 2E37A 5LXTA 3PHIA 4Q6BA 1P1CA 2I03A 1QP0A 1J39A 1M66A 2MMGA 3Q98A 3VR5D 1E0SA 1X80A 3TVDA 4BV8A 5F1OA 1OLXA 4MV0A 3KJEA 2IS6A 3RU2A 3IIKA 4HH1A 4HWSA 1OV6A 4LQ4A 1D0SA 3FCSB 3BXEA 4YJGA 2BN4A 1AY0A 1ZQ1A 1GAEO 4G5OA 5IN4A 3O0DA 4AQYB 3P9KA 3WLKX 1F8UA 1XHLA 1B00A 4XDHA 4KXQA 1CLUA 1EDEA 4US1R 3L2ZA 2CJFA 3KWLA 4DR5B 3A9SA 2Q5QA 4JB3A 3OM1A 2GFQA 3AONB 4JEIA 5JPDA 1QBGA 1Z5OA 5JJCA 4NLLA 2VAPA 1RC1A 1NOJA 3EUEA 3L8DA 4MW4A 1XEAA 2Q9UA 1PL8A 4IUCS 3VAZA 1FS5A 3WLHA 4DUGD 4QNRA 6CHYA 3VYSB 2FW9A 4B81A 1U7WA 4QJ3A 4LF4B 2C3OA 5EE9A 2DQZA 1MV5A 3VPCA 3G2OA 1TUBB 1E3JA 1CJSA 3BILA 4NU8X 3RTCA 1CS0A 2GTPA 3KD2A 4H0CA 4RVUA 1MTZA 2P5UA 2UVPB 3EVDA 2ZSEA 1MX3A 1NXPA 2IYAA 2H1RA 2QENA 4Z2YA 1MO6A 2HK7A 2Q1UA 1TIPA 2C2OA 1GY8A 3BHNA 4UATA 1LVUA 2CXHA 5GONA 1OYYA 2FN4A 2IH5A 1JB1A 2VN8A 5HJEA 1SUCA 1C4KA 2CUTA 2D1YA 1W35A 3NH6A 4X6XA 4D3SA 4GVLA 4TROA 1MPTA 4BO3A 3IABB 5KYWB 2XUHA 2HJ9A 3LL7A 1M54A 2ZR0A 4KQMA 4I1SA 4LCJA 4NOJA 4Q4HA 4QU8A 3SFTA 2C4VA 4AY3A 4RXUA 4CUKA 3WP0A 4H15A 4KRGA 4LYJA 5JNSA 5LIRA 1ADBA 1DQRA 1KU0A 3ECCA 2M6KA 1K7FB 1KJZA 2DP4E 3QTLA 5DOZA 4QPDA 5ALPA 4JP3A 3ROGA 4H2WA 1XZFA 1KZYC 1YJBA 5CHEA 4RY8A 4K40A 4TTIA 1NVTA 5EEGA 1SCDA 3MJCA 3T7CA 3ZI4A 4EG4A 4KQ9A 1ZLXA 3Q0EA 4QSHA 4A0RA 3DZIA 3IDQA 4MUNA 4ECAA 3D4NA 4BNDA 1EGHA 3DHEA 1TL7C 3GZTB 1S9HA 2A5LA 1FJGB 5IARA 1AX9A 2FX5A 4M0MA 1BX0A 1TZMA 2OV8A 3D0OA 3E9YA 3SJCA 1CQIA 4H4DA 5EERA 5CA1B 2EDCA 3AVXA 2A88A 3AVQA 3UFGA 1NOIA 1RZUA 3AXTA 5I7UA 4IKPA 2HDHA 1PQPA 4DJEC 2AG6A 1DV2A 4M0LA 1AA9A 1IAVA 2C54A 3DTVB 2FFQA 5AOCA 1YQQA 1KZ4A 2I7DA 2H1WA 3H4IA 5K05A 5MFPA 2QZPA 1CZHA 3DBVO 3PR1A 3Q3HA 4F1KA 2WU8A 1JJBA 3DONA 5BYKA 3RUPA 4PFQA 2EV9A 2C0CA 1N92A 2PM8A 2X9QA 1P0PA 2PH5A 4P4TA 4UU0A 4DLYA 3OJFA 2PH3A 3RABA 2OCGA 1KXZA 1PEAA 4BZQA 3ZWPA 1JE1A 4FFOA 2W6ZA 1J9EA 3DOOA 4LKRA 5DP1A 2ERCA 2RJNA 1S4MA 3FNQA 2R97A 1P19A 1U8TA 4IILA 1KY5A 1TAUA 4A5OA 3D9QX 4UPEA 1UXOA 1JPVA 2ZYGA 3IT1A 1L5YA 1ZD1A 2DFTA 2ZTMA 3AF3A 3ELUA 3HN6A 4LDZA 4MGIR 3W2GA 1SXPA 4IXWA 4G41A 1OZHA 3PNYA 4KITB 4B9EA 1Q0QA 3IPLA 3ABIA 3KKOA 3RYCB 5FWXB 3GFSA 2DHDA 3VH2A 1I4LD 2XMDA 1X8JA 4IIJA 3VKFA 3HUEA 3OFSA 4QUHA 2E4WA 1DP4A 2FLKA 2JDIA 3P8VA 2MHCA 2ZPTX 4JBHA 4TVAB 3NEAA 1JEQA 2EG5A 3NBKA 2UXBB 2RGDA 2WSLA 2OTCA 3WGHA 1NFFA 1QCYA 2GCOA 4I2VA 1KSJA 2VZ8A 1YZ3A 4BAZA 1JIIA 2AEMA 1M34A 2ZJAA 4HZIA 1QNLA 3K9BA 3FMPB 5IK2A 3MJVA 3AP3A 4GEGA 2BDTA 1J1IA 4UEOA 1JHDA 5FKJA 3R8CA 3WQHA 1Y2IA 1RQ8A 1Z13A 2ZB3A 4DQLA 5EWJA 5ICCA 3X43A 1G5FA 2R6ZA 1KAGA 3RS5A 1BMTA 4Z54A 4HBGA 2XVZA 3IR7A 4IKOA 3BF8A 1IVYA 1RYEA 1X1SA 2FW8A 2LXNA 3PXCX 4KG7A 3RS4A 1FTNA 2RGUA 2J7KA 4B8ZA 2HNAA 1NYRA 4HUJA 1ZW1A 5ANRB 3FVRA 5EMMA 1BDBA 1RQRA 1YVEI 1LGYA 4DR4B 1TUGA 2A1TS 3EZ7A 1VM6A 1P73A 4IH9A 3FFTA 4H7JA 4KTTE 3D3EA 4ZZ3A 1M8KA 1OBOA 3EVAA 4UMDA 5EE1A 1YGBA 5E6RA 5FULA 2PRKA 3JSXA 3X1WA 1RMYA 4IBOA 2HK6A 5ADHA 1DUSA 3I23A 3WLNA 1WCV1 2VDWA 4TV8A 4MVWA 3HN7A 4D4HA 1U2RA 4GKBA 4Q05A 4P4SA 5HA5A 4EAAA 2WY2D 1ZAYA 1DRWA 2JD1A 1B23P 3JQAA 2DFNA 2I62A 1BOOA 1H4QA 2CNDA 3OZBA 1FRQA 1KQPA 4ZODA 4NJMA 1AHPA 2BVNA 1N33B 4A0HA 2DWUA 3CPEA 4JVNA 5BMVA 1M67A 1VL1A 5HK9A 2NO5A 2Q5LA 4G0WA 2DULA 3O1JC 3OD5A 4M8IA 3FE2A 3LGSA 4NP6A 4U63A 3ZZUA 1VHTA 5J4VA 2FZEA 1QV9A 3G0OA 3QY9A 3HPRA 1R6TA 2RHQB 3B3JA 2DZ9A 2Y9PB 1W4LA 4L5BA 1GQSA 4IDPA 4MPRA 4KMRA 4RUKA 3L8HA 3NBYC 3UAXA 1NI4A 1ZEJA 4J94A 1LC3A 2Z9CA 4YRSA 1OU0A 3BGWA 1C3JA 5IC4A 4XX0B