The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
119
|
sequence length |
456
|
structure length |
456
|
Chain Sequence |
b'MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Proline-tRNA Synthetase
|
molecule tags |
Ligase
|
source organism |
Methanocaldococcus jannaschii
|
publication title |
The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
pubmed doi rcsb |
total genus |
119
|
structure length |
456
|
sequence length |
456
|
chains with identical sequence |
B, C, D
|
ec nomenclature |
ec
6.1.1.15: Proline--tRNA ligase. |
pdb deposition date | 2002-12-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00587 | tRNA-synt_2b | tRNA synthetase class II core domain (G, H, P, S and T) |
A | PF03129 | HGTP_anticodon | Anticodon binding domain |
A | PF09181 | ProRS-C_2 | Prolyl-tRNA synthetase, C-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Translation Initiation Factor IF3 | C-terminal domain of ProRS | ||
Alpha Beta | 2-Layer Sandwich | BirA Bifunctional Protein; domain 2 | Bira Bifunctional Protein; Domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Anticodon-binding domain |