1NJ8A

Crystal structure of prolyl-trna synthetase from methanocaldococcus janaschii
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
456
structure length
456
Chain Sequence
MLEFSEWYSDILEKAEIYDVRYPIKGCGVYLPYGFKIRRYTFEIIRNLLDESGHDEALFPMLIPEDLLAKEAEHIKGFEDEVYWVTHGGKTQLDVKLALRPTSETPIYYMMKLWVKVHTDLPIKIYQIVNTFRYETKHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFDTLGIPYLISKRPEWDKFPGAEYTMAFDTIFPDGRTMQIATVHNLGQNFSKTFEIIFETPTGDKDYAYQTCYGISDRVIASIIAIHGDEKGLILPPIVAPIQVVIVPLIFKGKEDIVMEKAKEIYEKLKGKFRVHIDDRDIRPGRKFNDWEIKGVPLRIEVGPKDIENKKITLFRRDTMEKFQVDETQLMEVVEKTLNNIMENIKNRAWEKFENFITILEDINPDEIKNILSEKRGVILVPFKEEIYNEELEEKVEATILGETEYKGNKYIAIAKTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Ligase
molecule keywords Proline-tRNA Synthetase
total genus 119
structure length 456
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2002-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF03129 HGTP_anticodon Anticodon binding domain
A PF09181 ProRS-C_2 Prolyl-tRNA synthetase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.30 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 C-terminal domain of ProRS 1nj8A03
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1nj8A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 1nj8A02
3L4GA 3V7SA 2DJZA 4YRIA 4HWTA 4YCUA 4CH6A 4XTWA 4P3OA 1X01A 1BBWA 3RL6A 1WQ7A 4DQ2A 2RHQB 3L4GB 4CH5A 4CS4A 1C0AA 2RHSB 4OLFA 4P74A 2ARSA 3W3SA 3TEGA 4K88A 5K1XA 4UP8A 4P3PA 1B76A 3RKXA 3L2ZA 2EWNA 2I4OA 1NNHA 2ZNJA 4YP0A 2EL9A 4OP0A 4ZTZB 3E9IA 1HTTA 1EVKA 2DXTA 3LC0A 2E65A 2ZNIA 1X55A 4P75C 4P75A 4HWPA 4H2XB 4P71C 4K86A 2FYKA 1YFRA 1GGMA 2ZR3A 3RACA 3VQXA 1VQZA 2CJ9A 3P8TA 1EOVA 3VQWA 3HXWA 4KR2A 4XU2A 4YROA 4YYEA 2ZINA 3IALA 4NCXA 2QHTA 3KFUA 3FJPA 3NENA 1E22A 4YRTA 1G51A 4TVAA 2Q5IA 2ZZFA 4AH6A 4RQEA 4ZTUB 1B7YB 3IG2A 1Z7NA 2DEQA 2AKWA 3A5YA 3NETA 3RKWA 4HWRA 1WU7A 4RQFA 1YFTA 4P72C 4PG3A 3P8VA 4P73A 4P73C 1YB3A 2Q7GA 3V7CA 3VQYA 5C52B 4EO4A 3L1AA 2CJBA 1PYSB 4H2VA 1ATIA 1E1TA 2DXUA 1USYC 2RHSA 5KNNA 3P8YA 3M4QA 3ICAA 3LSQA 1EQRA 3UGQA 5E3IA 1HC7A 2DU7A 4CH4A 3QTCA 2XTIA 2ZGWA 3V8LA 4HA8A 1B7YA 1B70B 2DTOA 3BFMA 1EIYB 3RKYA 2IY5B 4CS2A 3RGLA 1B70A 1Z7MA 2J3MA 2QHVA 3A74A 4UP9A 4EX5A 1NJ8A 2ZT5A 3V7RA 1EVLA 2E5AA 3MF2A 2Q7EA 2E10A 1SESA 2ALYB 4L87A 5K1PA 3UH0A 2PMEA 2EJGA 4H02A 3A7UA 2PMFA 4CS3A 3A7AA 1YGBA 3HXXA 4YRGA 4P74C 4XTXA 2C7IA 3TEHB 1J5WA 3HY0A 1H4VB 2ZR2A 3HXUA 3OD1A 4Q15A 4XU0A 2P5IA 3G1ZA 1WNLA 4XTVA 4P71A 3ERRA 1ASYA 1E1OA 2EJFA 2ZIOA 3MF1A 3LSSA 2AMCB 1LYLA 4ZIBA 4YREA 5C53B 2ZT6A 3HFZB 2ZIMA 4UP7A 3V8JA 4RMFA 3PCOA 3EFSA 3A31A 5C51B 3QO5A 1X2HA 1BBUA 1SERA 4XTZA 2QHSA 2ARTA 1RIQA 2C8MA 2EAYA 2I4MA 3TUPA 4YDQA 2ZTGA 2CIMA 3R07A 2DDZA 2DZ9A 4YCVA 2ARUA 2ZCEA 4X5OA 4YRQA 2DQ3A 3A5ZA 4BW9A 2LW7A 2E64A 1NJ6A 1NYQA 2I4NA 4YCWA 2ZT7A 4YRMA 4XU1A 4BWAA 3M4PA 4WJ4A 3REUA 2DU5A 4YRKA 4J15A 4PHCA 2Q5HA 3RF1A 4CH3A 3E9HA 4YRFA 4TQDA 2ZZGA 1JJCA 3QNEA 2DTIA 1QE0A 1H4QA 3HXVA 1YFSA 3PCOB 4H2WA 4TTVA 4P3NA 1NJ1A 3HFZA 3IKMB 3UFGA 2ZXFA 2QHUA 1IL2A 4YRRA 1EFWA 4O2DA 3A7RA 4KR3A 3I7FA 4XTYA 5ELNA 3BJUA 2EJ9A 2I4LA 1FYFA 4TWAA 3RIRA 5HGQA 1G5IA 12ASA 3PZCA 1L0WA 2G4CA 2ODRD 3HFVA 1BIBA 1WQWA 4WF2A 1ADJA 4H2TA 5F5WA 3DSQA 3EFRA 1WYDA 1KOGA 4YRCA 1USYA 4YPFA 4YRSA 2ALYA 2J3LA 4H2XA 1KMNA 4XU3A 2AKWB 1SETA 2P0LA 1B8AA 3V8KA 1H4SA 2ODRC 3IKLA 2E41A 3HY1A 2DKGA 4YRLA 3NEMA 11ASA 2XGTA 1EIYA 1NJ2A 4TVYA 4KQEA 3HRIA 4XEMA 1NYRA 3CMQA 3QO7A 2CGHA 2DQ0A 3HTZA 4WJ3M 2RHQA 3UGTA 3HXZA 3HXYA 1JJCB 4TQFA 3NELA 4HWSA 3QO8A 4TVWA 2ZT8A 4HVCA 4G85A 3TEHA 4UPAA 4YRNA 1X54A 1HXDA 4DPGA 1ASZA 4YRPA 2DZCA 4H2UA 4H2YA 1N9WA 1PYSA 3WQZA 1BIAA 2ZZEA 1E24A 3VQVA 3VBBA 1SRYA 5ELOA 3MEYA 4RDXA 1X56A 4TVAB 1X2GA 1KMMA 2DVEA 4XTUA 3REXA 1V95A 2Q7HA 1ADYA 1G5HA 1W66A 4HWOA 4E51A 3A32A 2DTHA 2E3CA 1WLEA 4LNSA 4YRJA 4K87A 1WPYA 2E1HA 1QF6A 3HRKA 4P72A 4H2SA 4Q6GA 4WI1A 2CJAA 4G84A 2AMCA 4XEOA 2HNIA 1NJ5A 1H4TA 3RUXA 2IY5A
chains in the Genus database with same CATH superfamily
1ECBA 3H86A 2Z8YA 3PSHA 1TQ2A 4BV9A 3CX3A 2EFGA 2KB0A 4B4VA 2GHTA 2IH2A 3VV3A 5FFMA 2E89A 2ZS7A 1H5NA 2WKRA 4XH9B 1I51A 3BJRA 3EFOB 4F5EA 2AS0A 4JT2A 1J09A 1TU0A 2FMTA 1FA9A 3FKSA 1VRVA 2OCGA 1RAAA 1LF5A 3CB4A 1Y4SA 2PYZA 3Q0IA 4DA9A 4DLXA 4NMLA 2BMFA 5AVWA 1Z16A 3KS9A 5HG0A 3EUWA 3JZDA 4RK7A 2X0IA 4L5CA 1RPZA 3ZU5A 5FJIA 4OLFA 3OEEA 2NUPB 1ZOIA 2MCFA 2ZYRA 2ZUSA 3DPUA 5JOQA 3K6RA 2RHWA 3PUIA 2V3CC 4YCNA 1MQ9A 2EWNA 1BROA 3L6BA 3U17A 3B1ZA 4Q6WA 1WLYA 4YP0A 1C9YA 1JIXA 1EM8A 1HQKA 1LRLA 1U2QA 1WHTB 3A6LA 4RJIA 2K7ZA 2X0EA 4KNYA 4ND5A 3NUQA 3GQBB 4JP5A 4IZIA 5B55A 3OCWA 4IIHA 1XKLA 2WAYA 4QQKA 1TCBA 5CPBA 5JZMA 3CURA 3HBLA 4WKOA 4AZ0A 3RSLA 5GINE 2YVAA 3B1WA 3STTA 2IHBA 4V3CA 3UICA 4PXYA 1GGMA 4O0MA 2XGOA 2HWWA 3UJAA 3D9QX 1Z4NA 3OMWA 4EY7A 3KLNA 3L06A 3JQPA 4WJLA 1PDVA 3JR7A 3K2IA 4JJAA 1ONPA 4LJ8A 4KR6A 4NX2A 5EIXA 2HQSA 4LDQA 3C3YA 4I14A 2JIMA 4R51A 4J16A 4C9BA 4KNWA 3W34A 4C88A 1FPQA 1SA0B 4M0UA 4CIYA 1X86B 1Z0AA 1RXCA 2C5LA 4LWZA 5UKDA 1EE1A 1XGKA 1Z4KA 3FXAA 1PQ4A 3NDJA 3KFUA 3WZ2A 3B1FA 3E48A 4UUMA 5KTNA 3ENZA 3PHBE 1VYHA 2IYSA 1NSTA 2BTQA 4H6VA 4YRTA 5MGBA 4TVAA 3BDVA 2ZZFA 3CRMA 1HDCA 3GP8A 2P3QA 3JVUA 2FXIA 4G09A 1JDVA 3KUXA 3BHIA 1P61B 1BH6A 1CIPA 3RRXA 1IDN1 1V7CA 1Z5ZA 4RW0A 5L3RA 4I6JA 4LXIA 1PJSA 1KDPA 3AIKA 4O8ZA 1RU3A 1CEQA 1FP6A 2GXAA 2XKBA 1BN6A 2R47A 3MM4A 1DJQA 3Q0TA 3QYFA 3UFXA 5EXDA 2YZNA 3RKWA 4HR7A 4DA8A 2XQJA 3ORRA 5F73A 2I1QA 2VAWA 1U0BB 3ZWPA 4RO0A 2GPSA 3GNTA 3CYFA 2YMQA 1RAHA 5F35A 4BB5A 3ITEA 4QL3A 5CBKA 3E7DA 3TD6A 5B2EA 1CJTC 1VIYA 2AOUA 4L5AA 1SD2A 4LFCB 3ZYCA 4EG6A 3GLGA 5ALHA 3L3BA 3HS3A 2FMFA 4B79A 5JWRA 3VGJA 4ZEXA 2QI9F 3FYUA 3KCNA 5EWJB 3W3ZB 3IXMA 3NHKA 2B30A 1UT5A 4P4NA 2J31A 2IZ0A 4PTYA 5CXSA 4RKQA 5FWYA 3ESZA 4KXXA 3OZCA 1T25A 2EZTA 2XUHA 4MV8A 4XLLA 1VLLA 2I99A 4XM0A 4XQGA 1A7AA 2H31A 2QG6A 1U7TA 3DUFB 4ZO4A 1QHHB 3C5VA 3OMLA 3S1LA 4D7AA 4U02A 3HGTA 4WW0A 4HFNA 2K7FA 1SHUX 1CQJB 5DOVA 4GPAA 2UXDB 1UODA 2X0DA 3UGQA 3ZY5A 4ZK6A 1HC7A 1V8PA 3EIUA 1U1IA 3GEIA 4BZQA 4NENB 2RGNC 5IJ9A 1N7GA 1VHDA 1CUUA 1N6PA 3H5LA 4E46A 2H1CA 3AP1A 4Q1BA 5B3LA 1M9NA 3GMTA 3MQ4A 2XVZA 4MV7A 2XMGA 4G1MB 3R5HA 3VGPA 3WRXC 2XOKA 5K7SA 2QAIA 1QC5B 3H5IA 4AU1A 4NV3A 1BTOA 1PLJA 1RQGA 3LO8A 3JZIA 3ZGNA 1F4VA 1XJWA 1YZVA 2O3SA 4UU0A 5M2QA 2X9GA 4DIDA 2ZZMA 3HJFA 4C6RA 2W00A 2D2IA 1P2BA 1EP2B 3RASA 3RHTA 1CJMA 2O2XA 4B2IA 5J58A 3D0RA 3I83A 5AKIA 1PLKA 3BMCA 2C03A 3ILSA 5E9JA 5BNFA 1K6XA 3QVXA 4CF3A 1OBCA 1U80A 1VLMA 2H2WA 3C1UA 1ZEMA 5AO9A 1G20A 4ZVRA 3VSBA 1BJRE 4U2BA 2Q46A 2QTLA 2VAPA 3LX8A 1U28A 2XCSB 2ZYDA 3VAYA 2QMOA 1ODSA 2A0KA 5J47A 2C9ZA 3FNRA 5BT8A 5C5DA 1MKYA 5A4JA 4CEHB 3ZQJA 1NPTO 2PKXA 4G97A 3B6ZA 4BE9A 3KUCA 4QLOA 3U3MA 3W04A 5JJCA 1R8XA 1EXWA 2C4VA 4B6PA 3MAAC 2PGLA 1F5NA 1MO4A 4FZ3A 4UKDA 1G3RA 4S0XA 3GLGE 1ABFA 1E7RA 4X41A 5J1SB 5A3RA 5K2MA 4PGMA 3V5NA 3L5OA 4OO3A 5FNVA 5LKRA 3UENA 3NHJA 4LRTB 4L8WB 3QVSA 2D62A 2R25B 4TT3D 2QD1A 3FTCA 2AN4A 4TTSA 3VUEA 4BASA 1QH0A 4B0PA 3VZDA 4JI2B 4FYPA 2AJTA 1COWD 3HA3A 1GEGA 1RSZA 2CXTA 1RRKA 4JB0A 5ESRA 3C7TA 3VJLA 3GUUA 4C0QC 4EBFA 2E1RA 5J4YA 2WIBA 1QK4A 1DC5A 3MIIA 4MYDA 5B1YA 2UYYA 4P7KA 5SY4A 2B99A 1XCGB 4LAFA 4CMIB 4ZIBA 2O07A 4LGCA 3FMOB 1UJBA 2WU0A 3BMNA 5KYWB 2G0TA 5E9WA 5FTMA 3NGXA 4D0NA 5GZ6A 4EGQA 4HTFA 5JBQA 2BELA 2E49A 1Y1QA 2R8OA 3UV7A 3HFZB 1KXZA 4PZUA 4MYHA 3F6EX 3L9XA 4K40A 4PLGA 3CX7A 4QYXA 4ZWNA 3D81A 2PWZA 3AT1A 1DC8A 4B8YA 2H4ZA 3INGA 2DJIA 3JWHA 3FPSA 2W2MA 1V3QE 3G89A 5C51B 1QWOA 2W4MA 4XB2A 3GV0A 3EOZA 521PA 4ZK2A 3W4IA 3EXEA 1E6WA 4XTZA 1U2TA 3ZHVA 5HHTA 2YJNA 3S3TA 3NCHA 3ZWMA 3L7MA 1ECGA 2HU7A 4HYYA 8GPBA 1HV8A 1S3SA 2XDQB 4KQGA 3RM3A 4V1CA 1Y8ZA 4ZARA 2F3UA 5BR7A 3ORSA 3RS0A 4OHMA 5HQ3B 5LD2C 4L7QA 4A8PA 5CVCA 5SZIA 5CT4A 2UYCA 5ECYA 4I9GA 2DVMA 4RK4A 2CIMA 1FU7A 4JX8A 3V42A 4I0WB 2GLUA 4UD6A 3U7QA 3I05A 4L22A 3SYTA 3KQNA 1TK9A 1UF9A 2FZLA 2QL9A 2VSQA 4IUBS 3ZUPA 1FRVA 1A76A 3FRIA 5DNDA 2H9IA 4UDYX 4QOFA 3Q3VA 3N8GA 2CLCX 2DDZA 3TSCA 4M1SA 1QLWA 4O4HB 5C8VA 2OK8A 4KQ2A 3GJ0A 1IPHA 4GPZA 1L3BA 4CM7A 3MTDA 1ZC4A 4Y6OA 3UTDA 5G41A 3NYIA 5ITSA 1GLNA 3QQ5A 1NVTA 1DDIA 2OBFA 3KTAA 3WMEA 3ZJ5A 2R5WA 4N8EA 1MJGA 1PK7A 3FCAA 3QX8A 3SKXA 4NBKA 3A5ZA 3BB3A 8ATCA 3DV2A 4QZVA 5HKKA 5K9ZA 3ITKA 1QH8B 3QWHA 4J75A 1NJ6A 4R83A 5SY9A 1FFCA 4RGBA 4F21A 1GG9A 4U6QA 2C5AA 1CUZA 4X1IA 4JC0A 2OYCA 1OGIA 4EZBA 3MUFA 2MSNA 2TYSB 4AX8A 2BFCB 1Y9JA 4DNQA 5B6PA 421PA 3LWDA 1CR6A 4L3VA 1T35A 1ZGBA 2DRIA 2JCGA 3VHXB 2GM9A 1WXDA 1XX6A 2FW8A 3R0VA 1XJ5A 2GEUA 4GOKA 4TXJA 2A7XA 3HL0A 3NONA 3NALA 2JAUA 2PBLA 3GY0A 1ZAKA 4AB1A 4D4IA 3PD1A 2SKCA 3P0HA 3V1YA 2VSFA 4B6FA 2PRKA 3P0IA 2VK2A 1QFJA 3JAWB 3IP5A 3G2OA 4Q3OA 3QBTA 1TJ4A 2HA5A 2NSDA 3IP6A 4LJ5A 1QPGA 4UHKA 1YJQA 4V24A 5EC8A 5IAGA 1H4QA 5I4KA 3VR6H 4DA4A 3V80A 1I5OA 1ZK3A 3A2NA 1U0SY 2H3HA 4N65A 4PWZA 3TZCA 4EJFA 1O4WA 5IH7A 3WZMA 4RWZA 1U8CB 2Z4RA 2DB3A 3QUCA 1L5NA 3GAMA 3OWOA 3RRNA 3PE3A 3UFGA 3BTUA 4Y9SA 1IOZA 2BZGA 1W2GA 4YRRA 1E4VA 5E7IA 1XMOB 1UMBB 3DC7A 2R7LA 2J6HA 2Z3WA 3G3EA 3QPUA 4IUCS 4J1NA 4N6NA 4OQFA 4BQPA 1J20A 4EUSA 1PV2A 4DLRA 4YMUA 3K0AB 1ST2A 1GLGA 2ZJOA 4PYKA 4XASA 3LV8A 2BN4A 1V5WA 1DWPA 1DV2A 3DV0B 3JQRA 3MTQA 3QFHA 4KQ6A 2YWJA 4XDYA 1IULA 1HORA 2JJYA 2OILA 3KOZA 4TQAA 4TWAA 2G7ZA 4Z9YA 2YYSA 5JZVA 4JP2A 4RHCA 4MHOA 4G8CA 3RV3A 7REQB 2EQ5A 2O2SA 5G0SA 4DZZA 3A70A 2V0CA 1UPCA 4BGIA 1DVRA 3CFYA 1JHXA 2L2QA 3C98A 4FOTA 4GOND 1V2GA 1J5EB 2Z7CA 3ZWNA 3U3KA 1UINA 4A3SA 5K8CA 2Y1EA 5F5WA 2XNDD 3A1NA 4KRXA 5C31A 3WL4A 3MIZA 4O4JA 1XU9A 3DB1A 4NBTA 4C7OB 1YCHA 4DDTA 3FR7A 1PBNA 5AVYA 4WUVA 4JDUA 1A77A 4FUQA 1MLDA 1DC6A 1YB4A 3H11A 1F2TB 3B6KA 3PRHA 4PTLA 1P6XA 4RFLA 5ENZA 3G7NA 3RS8A 4ETIA 1MO2A 4EL5A 4D4LA 1HOXA 4ER7A 4YAKA 3I5UA 4DKXA 1CR2A 3DMHA 1GA1A 4PEVA 4AYWA 5GGXA 3HB9A 1KMQA 1SBYA 4MRMB 5KYGA 1ZH2A 2AJ8A 2FFQA 2KBFA 1RM0A 3ZHOA 1P1JA 5CH8A 4Q3AA 1ID8A 1YZGA 5IM5A 2AFHA 4LJSA 4TVYA 4WWHA 1AZTA 1TECE 2IXAA 2EYQA 4FONA 3ER9A 3Q10A 4RMIA 4ESEA 4L7VA 1XF1A 2D2XA 3NX4A 2HN9A 3QKRA 1QFXA 1TQ4A 4LVMA 3W7BA 3UEOA 4ZN6A 1ZW1A 6NULA 3KOXA 3HI4A 1SGWA 5SYNA 1Z26A 4XYLA 1KNXA 1N5DA 2HDNB 4BGDA 3OESA 4EJ6A 2BD0A 2WJ6A 2X9VA 1JFRA 3BWEA 2QUJA 3ETEA 4NE7A 2P7IA 2AOTB 4NVRA 3WKEA 4B17A 4B8WA 5K20A 1J24A 1FTSA 1V37A 1CY8A 5KTYA 3AJ8A 1QAMA 2FSFA 4OH7A 1E7SA 1ONOA 1SD1A 3H2BA 3A9CA 4M8SA 3KJHA 3V8NA 3NELA 2AEJA 1RYZA 4J29A 5FBVB 5HJ7A 4NATA 1QTQA 1SVIA 4GSYA 2DPLA 3MMXA 3PGMA 3RJZA 3PT9A 4BFZA 3HEAA 1G6HA 4MZXA 3W6NA 2GEDA 1J7JA 1IHOA 5DWDA 1X54A 1E2FA 4FEAA 2IZ5A 4N5LA 1S3FA 2K6GA 2B3TA 5ECDA 4BLSA 3MPUA 4MRSA 2L8YA 2VSOA 1OQAA 1GD1O 3L7CA 3VZPA 1ZVVA 1K75A 2XIJA 1AE1A 2JGEA 2WTBA 4LW8A 3AUSA 3E03A 3TIIA 4C20A 4DB4A 1KGDA 1X0VA 5K0LA 5AKXA 4C08A 5JDCA 3STWA 1BIAA 2LV8A 2ZZEA 2FTKE 2VK8A 3ZW8A 2W2NA 4DYHA 1C1DA 5KTMA 3TGWA 4ZCSA 1DWUA 2BKAA 2GK7A 2HK9A 1PKXA 2Y1GA 4IXWA 1YB2A 4RF4A 1AJEA 1JHAA 1VFPA 3HR7A 1KO1A 3SQWA 1UPTA 1BVHA 3OE1A 4R31A 4RDXA 4ZU6X 4TL9A 3KDSE 5LFAA 2P68A 3WLQA 3WL5A 1AUPA 5KNDH 3KEFA 2MJLA 1S2GA 3NNNA 4KDFA 3AERA 5B1SA 4ZMSA 3U16A 3MWJA 1OKKA 2VTBA 3JATB 5J2UF 3CPSA 3TRJA 3A2KA 1RKXA 1W52X 2PEZA 2GRJA 1JR3A 2DKOA 3UAZA 4G4JA 4R9RA 4X20A 3CUKA 1ISSA 3BCSA 3V1KA 3FNBA 1BDJA 3V1NA 5HK9A 3NDRA 4K6HA 2PFKA 5JHGB 2PX3A 1NJFA 3C6BA 1U3GA 2CLMB 1GUDA 2Y4OA 4QJ3A 4GXQA 4E51A 3QV1A 3LUJA 3RUPA 2XTAA 2KMLA 3T7CA 2W37A 2DTHA 2RHTA 5DHAA 3ZU2A 13PKA 4PNEA 1K3TA 1FP7A 3DLIA 4C0BA 4DLLA 1Y8CA 4PPGA 3NHUA 4MNTA 4RVUA 4WK2B 5T3UA 3HQ4O 1ZYUA 4YNBA 4A8HA 2G0AA 2F9FA 1N32B 1U1FA 4S05A 2R4UA 2IYEA 4P72A 5SZKB 3R3WA 3O26A 1II8B 5JC8A 3NYWA 4K9MA 2AMJA 3H1BA 3GPDG 1JJVA 3JQDA 2CMGA 4KMOA 2J0VA 1XLWA 4B6SA 3MRTA 3JCZA 2H4WA 1NQAO 2VJOA 2P2CA 3IIEA 1Q2XA 4K9NA 4M0EA 4O29A 4BKOA 5AKZA 2JG3A 3A26A 4KP7A 1V11A 4QDZA 1BIFA 4LQCA 1RKUA 3N0WA 4QUEA 5TMDA 4OHYA 1H4TA 1ESEA 2XNSA 2DH6A 4IDFA 3CNBA 1JTEA 1O96B 4HN4B 4YRIA 4TQGA 5EEHA 3RS5A 1LGYA 1Z0UA 4NBLA 4B5LA 5JQGF 4Y1EA 4JR0A 1CFJA 1MB2A 4HUQB 5C3MA 3M9LA 4DQ2A 3KB1A 4JJIA 2BGLA 4R3NA 2LE0A 4C5CA 3M4ZA 3JQ8B 3ZWAA 3IABB 2F3RA 3HV0A 1QGAA 1XBTA 4GEGA 4PW0A 1SUAA 1NMYA 5A4KA 2BKUA 3VNBA 5FADA 1C0AA 1EDBA 3KXPA 2O5CA 4JODA 4EAAA 1ZGGA 1T0UA 2K87A 1ZN7A 2HA0A 3BWCA 3GGJA 2ZYIA 1M1NB 3OOYA 4R9SA 2L42A 2B25A 4WK4B 5C1DA 3NHWA 1CQJA 2OD2A 5KX5F 4MITA 4QXMA 1J07A 2Z6AA 2XB2A 2I9PA 3T95A 5FJJA 3A0UA 3RKXA 2P2LA 4RIEA 3I0MA 2WC1A 2KJQA 2QDXA 3V1LA 1EUDB 1EHIA 3SQMA 5I7OA 4OP0A 1N1DA 4FBGA 3ZHSA 3B3AA 4HBGA 3GFSA 2YRXA 1AS3A 3MTJA 3AUAA 2O3JA 2QTRA 5CLFA 6AT1A 1I9CA 2DXTA 4L72A 4URUR 4E3ZA 1IWPB 2PKRA 3TB4A 2P6RA 5DZSA 3OZVA 4YAWA 4H2XB 2WWFA 2ZU0C 3RAGA 3RRZA 1L3IA 1NBAA 2NZJA 1FVOA 1S7CA 1RYDA 2VEDA 3H1GA 4B81A 4BNYA 1M54A 1OAOA 4UVDA 3RACA 1CVRA 2D3TA 3VQXA 2O8DB 4WXMA 3Q3EA 4PZ0A 4DMHA 1JBEA 3K9WA 1N6HA 3HKEA 2WM8A 4KR2A 2CYBA 3CW8X 2E48A 1KYQA 3H9UA 2P7HA 1XAJA 3DV0A 2ZINA 1HYQA 3F71A 4G3XA 4G5RA 4QXRA 2ATCA 3NVAA 5E6RB 3S81A 1IY2A 1IZ7A 1RXEA 2F1OA 2QYTA 2VC2B 3EFBA 2QHTA 3GA7A 4JVOA 1UP7A 1KJQA 2UUCB 2F3SA 1W4LA 3FPAA 1OAOC 4NWIA 4B3XA 5K99A 2AKEA 4KV9A 1ML3A 1LU9A 2GHIA 5DRTA 4CM9D 3G2LA 1DAEA 3H5NA 4NLLA 5AVSA 3QK7A 3WGHA 3L8GA 1RCTE 1S9HA 4IHAA 5BV8A 1UBOS 4RCYA 1SXIA 3BFVA 4JJ6A 2YN4A 2DEQA 3OPXA 3VNQA 3MJCA 3N8HA 1RM4A 3A5YA 4MKZA 1VP9A 3V4ZA 3P9ZA 4KVZA 2ZTUA 4AJKA 3IBYA 1NBME 1V1RB 4N0QA 2ZBGA 3Q6MA 4TV8B 3LYHA 2KSQA 3U56A 2HSGA 3B3GA 2VBFA 1AQLA 1ZCZA 1QH1B 3A4MA 3DWEX 2Q4TA 1YFTA 3GK3A 5AJTA 3EXIB 2W4QA 4DEXA 4OFBA 1CK4A 3DHEA 1WVMA 1E20A 3G7SA 4P73C 3P27A 4PVCA 4TL7A 1Y6RA 3V7CA 4TXLA 4X92A 3B1XA 1VHJA 4BB0A 1P1HA 5C8DA 1AQIA 1NUPA 1Y7IA 2PIAA 5HKLA 4UBOA 2KHZA 4EO4A 4PQYA 1GR1A 2AE2A 2IXTA 2Z2KA 5FOTA 3WLAA 1U2DC 3ANLA 2VH5R 5HQTA 1PYSB 5IVDA 4AY2A 2F8SA 5FHQA 5CXUA 5MDHA 2ZU6A 3ZDRA 1GTVA 2PQ0A 3I2HA 5IXYA 2RD2A 1BXRA 2H4HA 3CH4B 1A2KC 3I32A 4JVLA 1YL6A 4TX1A 4WFIA 5DBOA 3MCAA 3FCOA 2P91A 5AM4A 1HA3A 1OFGA 2WHYA 1VG9B 1V25A 1DOAA 1T5DX 4YT4A 2BKXA 4OK3A 3GT7A 2Q41A 3GH1A 5CNMA 3DSCA 4LNHA 4HA8A 4ZO9A 4MGIR 1B70B 5GM2A 3PWKA 2DUJA 2QLLA 1YHNA 2BUAA 2WF7A 3ELBA 4JENA 3RYHA 3TRKA 3Q9LA 1VIDA 2WKWA 3A6KA 3H4IA 1E4OA 3PEVA 3WJAA 1P0PA 4WA8A 5AW9A 3L43A 3EFOA 5FTWA 2B2XA 3OUZA 1WDTA 4JT4A 2CXQA 4MVJG 1P60A 1E0AA 3K3PA 2JGKA 3EGDA 3QOXA 3VR3A 3FOBA 5AW8A 2FEWB 1Z2PX 1XTRA 2ZYHA 4Z0TA 4IJ6A 4EKDA 4N5MA 2AXPA 1UJ6A 4FXOA 1I2ZA 2P9QA 2R66A 2WZQA 4N12A 3HBJA 3RVSA 3QWFA 1H22A 3L0IB 3L8MA 3M6FA 1KE2A 4E03A 5K0ZA 1F8YA 2QM8A 3W3AD 2PG3A 3GHYA 4X97A 3DAGA 3IQHX 2W5UA 3FZQA 4OFZA 5BSKA 3D4LA 1GGKA 2R5NA 1IEXA 4I1UA 4XPZA 4I9UA 1F7VA 3O4JA 1IWOA 1S8EA 2PMEA 4H02A 4O4JF 1ULTA 1RW4A 1D2NA 4N5DA 2C95A 4JLMA 4CS3A 1SKUA 2Y68A 3OKPA 3SR4A 1Q95A 2VAXA 4NSNA 1W44A 2RJOA 4QDUA 2QTCA 2Y9MB 4JMLA 4EG3A 2JC3A 1J8MF 3EH1A 2BGMA 2EFEB 3VU3A 1FL9A 5LA6F 5KIAA 1FQKA 4XWWA 3B82A 3C3CA 4K8OA 4X60A 1YUMA 1J39A 2CHFA 3OP4A 4W5QA 4G4GA 2ZR2A 2IPNA 2D1SA 3D6FA 3BMOB 4D99A 4F2GA 1UKCA 3U9LA 4H7PA 1H6DA 3AZOA 5DT9A 1WVIA 4BB9A 1APBA 1QC5A 4P5DA 4DJJA 1DKPA 1O5OA 1EJBA 1QCYA 1JYSA 2PZGA 3I62A 1LLQA 2CLIB 3B7WA 4XYBA 2Z8ZA 4K81B 2Q28A 4JR1A 4U7TB 5F9HA 1IY1A 3K5WA 3GMIA 5AK5A 5DX1A 2WZCA 1V5FA 5JADA 3HHPA 1JAXA 3NC0C 1P8AA 1P9NA 1AURA 1KK0A 4MB6A 1ARZA 5K03A 3OZUA 1UQTA 5IKPA 2AUMA 3COWA 5LDGA 3M3HA 1E9SA 5J5VA 3NPMA 2ROQA 1JG3A 4P31A 5B6JA 1FF9A 1JNYA 2QZ4A 4PPQA 2CT8A 3EFSA 3R3SA 5GY7A 2CL6X 4PLVA 4B85A 1FSPA 4NRDA 1A9ZA 2N1MA 3C4JA 1DAPA 1XVLA 3VC7A 1I30A 4OHRA 5KQGA 1PEDA 1EEHA 2HQ1A 2QHSA 2ET6A 2HQBA 3BRWD 4NU8X 2SKDA 3PJFA 5GZ1A 3BDIA 3DLPX 3FNIA 5CDGA 2XGGA 2GAFA 2PX5A 4QUHA 5CDFE 2IBMA 3HADA 1M73E 1PZMA 1VJCA 4XUDA 1L7EA 3GLRA 1LLCA 1L7OA 4MRPA 3PDCA 3R1IA 5JD4A 2EX4A 4FBLA 2OM6A 2CV2A 3SZGA 2GX6A 1K8RA 3F46A 3JY6A 3OZAA 3BRCA 3PVZA 3Q3GE 3FMPB 4XDHA 3PVCA 4DIEA 3QVGB 2P9CA 5D6OA 4CGZA 4W8GA 1WZIA 3TOSA 3VKUA 4PQRA 4ATNA 2QMEA 4IS2A 1VMDA 3NC1C 4FYVA 1S3GA 4HKTA 4S12A 5KSOA 1V8DA 3Q8LA 4HX5A 1NQOA 1JH9A 3ORYA 4DR7B 2BTQB 5AW4A 3OOWA 4AP5A 2A30A 1Y80A 3Q7IA 4IIFA 3RFFA 2O14A 2DHCA 4OP3A 3RKRA 1B6GA 4F3TA 1XA0A 4CODB 1SWWA 1Q7EA 3DOCA 1WOMA 3TTTA 3HVRA 1PZXA 3E0QA 2G71A 4ZOLA 3W2IA 4HBZA 5JYDA 1CB0A 2AHRA 3JXEA 3LT5A 4IIVA 3KT6A 4X93A 1F2DA 1Z88A 4RF2A 5AH0A 5DN6D 5KTRA 2DFTA 2VDJA 3HYNA 3K05A 4HI0E 2IS2A 5CG2A 4J15A 1MPXA 4ARZB 1MJGM 1CUWA 3CLSD 4B1FA 2FR0A 3AB8A 1T5LA 3QVLA 2VOJA 3QA3E 1T3TA 3P26A 3R8XA 4C2BA 3UAOA 2EFDB 3VU8A 4RACA 3DDHA 1CUEA 2O50A 3K2BA 5HS6A 1F4PA 2LRHA 3C5EA 3FPGA 2GRUA 2VDNB 1ADBA 1HRDA 2A9QA 3AOGA 3DO8A 4EZIA 3QE9Y 3IDSA 1JFFB 3TLBA 2ZI7A 5LQAA 2P6NA 3AEXA 3C74A 1QF7A 4PG8A 3TE7A 4NH4A 1L2TA 1X7YB 3PCOB 1B8NA 2IZ6A 4OATA 2ZXUA 4Q1AA 5JFTA 2R60A 1ZPDA 1Z6PA 5DXJA 4BFWA 3TQFA 2RIPA 4Y8VA 4F45A 1LPNA 4LJRA 4WNAB 4JLSA 2A9RA 4AJEA 3KOOA 1W30A 2GB4A 2V03A 1CT9A 4LDZA 3SJAA 2ZXFA 3UWPA 3H97A 1P7WA 4YEDA 3V7UA 1OXVA 1EGMB 2Q4RA 3I42A 3QKIA 4IIJB 4R4JA 4ZGBA 2NU6B 1BFUA 3W1EA 3BWMA 4PM4A 1VKHA 2XMRA 1J0EA 3A4NA 4WLUA 5AI4A 5ED0A 3RWOA 3T3PB 1X7WA 5K3OA 3VNVA 4DC9A 3MFYA 4F3NA 1VIAA 3PPIA 3WFJA 4ACAA 3T94A 2QLTA 4C0SA 3PS9A 2FK8A 2JIQA 4ANFA 3WWZA 5IF3A 1DIAA 4II2A 4D9NA 2NTEA 4P8RA 2B9EA 1EDDA 3N7AA 4Q4JA 4R2WA 3WK9A 4DT1B 4EG7A 5HQ3A 1O2DA 1HG1A 3OOHA 3BXGA 1QMPA 3NDBB 1N0WA 1YE3A 2IDMA 1ZLYA 3H8JA 2JH9A 2ORVA 1J0DA 4UHJA 1J6UA 2B3DA 3KXLA 4IEIA 4DSZA 4MVJF 4CN8A 4KMRA 2QJOA 2M6KA 4Z9XA 1Z45A 1JHYA 2YFHA 2XZOA 4KDEA 1IBRA 1PJLA 4OK6A 1GXSA 4RS3A 1K8QA 4WL0A 5JY1A 1LWOA 4MYRA 3U3ZA 5EYPA 2SHKA 1IEWA 1FVHA 3BIWA 1X13A 5G1PA 3ZLTA 1Y1RA 2ALYA 3C39A 5BSTA 1X3LA 4EGCB 4F1JA 5F7OA 1XPRA 1D04A 1B15A 3FYDA 3JQBC 4E5KA 2B4KA 3DQPA 2CVHA 3K72B 4CKBB 1ZXXA 2ZJ0A 3R5FA 5HGJA 2YFKA 4H2XA 2F17A 2G8NA 1Q0QA 2XTZA 3DOUA 3A06A 4TUYB 2ODAA 1BVYF 5J2TF 3KRTA 5JANA 3FSEA 1KSGA 1E3LA 4CXMA 4W7HA 3KPYA 5DP1A 4FLMA 3DFKA 4Q7JB 3T1OA 1NW4A 4LIPD 4JB2A 5J43A 2EERA 3ENVA 3KOYA 4PO9A 3FVWA 5IXJA 4ID3A 5E3JA 3UBMA 5EXXA 4J0IA 5AHRA 4WVFA 2PX8A 4Z54A 2QUAA 2V7PA 1FJ2A 2FPIA 3DDOA 4OA5A 3KWJA 2X8JB 1TAQA 4LWQA 4TMKA 4XX1A 2VRCA 1RWBA 1YJCA 2JKYA 4XPIB 5A3QA 1YFKA 1SELA 2YJTD 4LJ9A 3QO7A 1WXXA 1A4XA 4EA6A 4JSTA 4WJ3M 3T3GA 5L3QB 1Q84A 4MDYA 4MULA 3LX5A 2BE9A 1T9GR 2WEKA 4Q3BA 3NTUA 5AJYA 1TO1E 1IXZA 1M8JA 1I4DD 1PT9A 1Z8DA 2Y0EA 3KQVA 2LP4Y 4U4AA 3VBCA 1W7AA 2VTEA 4U2CA 4HQ6A 1LQTA 4NJMA 3WBBA 1SCUB 1JJCB 1PG0A 2XNJA 3AUXA 1KPGA 4MWZA 3ELWA 1T9ZA 5F7ZA 3BL5A 2P4HX 3EIQA 3UJ8A 4IG9A 3AV0B 2PH5A 4JLPA 3TO5A 3K15A 4I50F 3JYHA 4LX0A 1SXJC 4GVPA 4JC8A 3WIDA 1HE5A 4YR7A 5DKFA 1EQUA 2JGDB 4R69A 4LJKA 3KDPA 2JVKA 3WP0A 5IUJC 1SCNE 5EQFA 2ONCA 2E37A 3PC8A 2PLAA 4L3OA 5JO0A 2W58A 4BJHB 1CJUC 4TM7A 3BFKA 1AD2A 1OFUX 3E8XA 4PZDA 4PINA 1NDHA 1YTUA 1WCV1 3Q1KA 3U6KA 4GMGA 2J09A 1A5ZA 2JCBA 4OQPA 5CFOA 1BE6A 5HE9A 3PL1A 2FPMA 3WLOA 5KNBH 3L0PA 5BWMA 4JI0B 3U4MA 4G81A 3RADC 1SAYA 2H6EA 2NW6A 2VPZA 5DCYA 3GO4A 4BQEA 4MMZB 5LQCA 3MQZA 4FFDA 5I9TA 2Y0CA 1Q5PA 4QYIB 1IC6A 2CVFA 3K4QA 5TF0A 2OXTA 3VNAA 1EVIA 2Q5EA 4EHLA 1NKSA 1Z62A 3E9CA 2BEJA 2CMDA 2BFCA 1D0IA 5E2AA 3QE4A 3SZUA 2QTHA 2YC2C 2K2WA 4EOGA 4UTPA 5BNIA 4PE5B 2FE1A 1G6KA 3HCOA 4NBWA 4LNUB 4RZ2A 1FW8A 4Y1FA 5T57A 3S68A 5JG7A 1RCFA 1VG1A 1ZK2A 2E55A 4OD0A 1XDZA 4CDRA 5HVNA 4QJ4A 2J5RA 5DEIA 2J1LA 1U8XX 4DGQA 4J76A 3BFPA 4UTVA 4Q3LA 2W2KA 2CFOA 3I09A 4UVHA 4C4TA 5JJBA 2A5FA 2EKZA 4PPYA 1FEZA 4AXXA 2UVPA 4TYMA 1U2EA 3ZTYA 3HDVA 2XRFA 1A5SB 4L57A 4TS1A 2ZVJA 1Y9AA 2E82A 3JQ7B 3PFGA 1HPLA 4OHWA 1EB8A 4QDJA 4CWAA 2SKEA 3R9WA 4YO7A 4MKHA 3CCCA 4IDEA 4JJ7A 4AO8A 1ZUD1 4PXSA 2ABWA 3PQFA 1W88A 4BVHA 4YJ3F 5ICFA 1W4RA 1C1DB 2I76A 4WAUA 1M3SA 3V8VA 4HGPA 3WLEA 3AF3A 3U62A 2IEGA 1UFOA 2YZKA 4UMEA 3O8OB 1H2XA 5CHYA 3EEYA 1RBMA 1M6HA 1Y1LA 4Y0AA 5JNVA 1WB9A 4CPDA 2CMKA 3UQZA 4QU8A 4LE0A 3TTXA 3V8BA 1H6BA 1PWYE 1UKBA 5JV5A 2JA2A 2OL4A 3RUXA 3I23A 4XD2A 4PLHA 5G53C 4FQ7A 1KQNA 4DMKA 5JE8A 1BOOA 1HT1E 2PUVA 3Q8XB 3IE0A 2HSJA 4BUCA 1L7QA 1AKMA 3HDJA 4Z0PA 1CXZA 2HLHA 4JJ8A 3V8QA 2NYUA 2I7TA 1G7RA 2JS7A 5B1EA 1TU3A 4TLCA 2QZPA 1H2FA 1RR6A 3PD7A 4TTPA 4JWKA 4LXUA 2RGUA 2B1IA 2LZ0A 1U0NA 1XK6A 2M6RA 3G9QA 5KQMA 2PX4A 3NTOA 4AZSA 5M7EA 3G8DA 2VDMB 1Y6JA 2P3SA 3PIRA 1T1SA 1PWHA 2QRNA 2X4IA 5H3HA 3UMGA 4QFMA 3WGQA 3GRFA 2AR9A 2BFMA 1VHTA 4LY9A 3SDZA 3PX2A 1N9GA 1KAEA 4Z1MA 2WFLA 2DKFA 2ARSA 1E9CA 3TEGA 4R01A 2I5PO 1CP2A 2GCGA 3HZ7A 3GQBA 2AZMA 4QOGA 2ZYVX 5DCUA 3VOSA 2CXRA 2PM8A 3EA4A 1P1KA 2SICE 4EFMA 1E18A 1AF7A 3FRHA 5GOTA 1YOBA 2PJUA 1LRJA 2NVUA 4MRMA 3HYSA 1Q20A 3B6MA 3IUJA 5CLLA 2YUIA 3HB0A 2FDXA 1SOVA 3WISA 1KI9A 5K6AC 5ARBA 1W1UA 1Q21A 4FJ1A 4B4OA 2AG8A 2J59A 5DTIA 4ZKEA 3H9JA 3S1AB 4JJ4A 3NRCA 4P75C 3I8XA 3LL7A 2GZ1A 1POWA 1F2TA 3AR3A 2QS9A 5CNJA 3N05A 4MS1A 2AE1A 2D74A 1E59A 2RONA 4FN5A 4C0KA 1B00A 3PC4A 2C54A 4KQWA 3O31A 4M46A 4U9IS 3NRBA 5EHGA 1JWLA 1BAPA 1FVFA 3T9EA 1WQ3A 2LKDA 3N0RA 2NSHA 2FR1A 1N5LA 2GBLC 3A4VA 3L02A 1QYIA 4O4HF 3VQWA 3WA7A 3OY2A 1QLJA 5CFLA 2O7SA 4JR2A 5DP2A 2C7OA 3ENKA 2OOKA 1R4MB 2R65A 2SCUA 1SCBA 3HZOA 2CK3A 3HCDA 4O5OA 4LHSA 2VHQA 4ZT6A 2IE8A 1NNEA 4RFVA 1T2EA 2E4AA 4WK6A 3IPAA 4B09A 1KBZA 2GN6A 4L5YA 1JDPA 4Y3UA 4ZTUB 1W5FA 3N28A 5GAJA 2BISA 3UHJA 5FL7D 3KJQA 1JIIA 4WH0A 4CU5A 3RIYA 4WXEA 2YJ4A 1N2XA 1Z4QA 6REQB 2RHGB 3QMVA 2Y05A 2XYVA 3ABOB 4E08A 2ZE6A 5FUQA 3ND8A 3I0NA 4P1ZA 4KBFA 4N3GA 4GQBA 5CX1B 2YN0A 4CQMA 1XP5A 2DP4E 2JFWA 4MWGA 4HFMA 4IGKA 2ZRIA 4RQFA 2NSJA 3AILA 3D6VA 1BEUB 3FBGA 1JG4A 4EJSB 5CDHA 2I71A 2HUNA 1M2OA 1SEVA 2Y93A 3SQLA 1AS0A 2XKKA 4LOAA 1EFKA 3P8VA 4P32A 1ELOA 3GAZA 1JZTA 1PX2A 3H6KA 1H8EA 1S5PA 2DY1A 4P0TA 4X66B 2O4CA 3A6FA 2P69A 3AUKA 3IB3A 1Y63A 3HUDA 2PKQP 3JQAA 4WT7A 4ZAFA 2WB4A 2FMHA 2GUGA 2FE4A 3LF1A 3PUYA 3S27A 4U3JA 1BXZA 1JHVA 2DSTA 3SC6A 1VYVA 1Q0TA 4HS4A 3U4QA 1YRHA 2CVPA 5L9AA 4RM2A 1BNCA 3EZ2A 3ONNA 4N0PA 1XNGA 1P2UA 5DM1A 1TQ6A 4B87A 4KPEC 2VQ3A 3R9KA 2QRZA 3CEAA 2H5IA 5KJ6A 1XCPA 3REGA 1X39A 4IQ4A 4O59O 4OI2A 2XTIA 4HDSA 3GJ5A 2WSMA 1ILWA 3DQQA 2XBUA 3V8EA 2DTOA 5B4VA 4KUGA 4RTNA 5IVKA 2AV6A 2AOWA 1N5OX 5CT8A 2C83A 2ZI5A 3H3FA 3VAZA 4KFCA 3E53A 1J2RA 3DCNA 4DWOA 2WPDA 3AEKA 1BYUA 1G3QA 1E2HA 1ETUA 1XDSA 2R97A 3W9SA 1NRIA 2FEKA 4QRDA 1MXHA 1OXBB 1JEYB 1M33A 3KC2A 2F4VB 5TQ0B 2FPWA 3DGEC 4A26A 3C7AA 1I7PA 2A33A 3FMGA 3K5IA 4FN4A 1IH8A 2UYOA 4JBLA 1Q1EA 3TZEA 3RS9A 4E4YA 2Z09A 1X87A 4G0QA 1J99A 4BTVA 5IU6A 2WWXA 1DFGA 3RIXA 1E62A 2OM2A 3JV7A 1EVLA 3MSXA 1WTAA 1O6GA 3HJBA 1MCZA 3NYRA 2QMZA 3PHIA 4MKXA 2ZTLA 1SIWA 4AZ3A 4KO1S 4Q4HB 2D4HA 2HYIC 2XITA 5TQ2B 2RIRA 3ICPA 4O25A 3THWA 5BUQA 2QDKA 4MICA 3PGLA 3S1AA 1R3UA 2MSCB 3VKGA 1ZIXA 3ROFA 3A7AA 5JYCA 4XEUA 3RT7A 4BRZA 4FM9A 4GGOA 3K96A 2ZDGA 2XECA 3ZLVA 4D3FA 1Z82A 3QG1A 1BYIA 1SXGA 2OSBA 4FHCA 2CFCA 3K9GA 1W8DA 2I6QA 5KCMA 1E3MA 2O23A 2G36A 3ETNA 1UJCA 2UVPB 1TGYA 1BJTA 3QPBA 3OM1A 4DIKA 1YZKA 1BHO1 4J43A 2AZ4A 3NAGA 1O9HA 2WE7A 1TC1A 4N3CA 3F9CA 4UJ5A 1TXGA 3RG2A 4F7DA 1I6MA 3VX4A 2PSFA 1HRKA 1L7MA 3Q1LA 1KI8A 1Z4OA 1X8KA 1G8YA 1Z4JA 1F2VA 5KAMA 3LLMA 4MRVA 1PE0A 1RKVA 3QU9A 2AFIB 4OIMA 4C7XA 1CUCA 1TAHA 4ZVUA 2QZZA 1QQ7A 4NEHB 1E1OA 1R5BA 1GKKA 4GR5A 2N47A 2LIPA 1A0OA 2NUAB 4Y6SA 5IULC 1QWSA 3W8FA 4I4IA 5ALDA 1Y1PA 2HF9A 3KXKA 1Y5MA 4BFCA 1P4SA 4UMDA 4MUMA 3E1KA 3SSNA 4ENQA 1B8OA 4R8MA 4OEHA 2ZATA 5KQLA 2VXYA 4CMHA 4RLSA 4EVIA 5DEOA 1U5CA 1BMDA 1D03A 5M5BA 5JJIA 3U0BA 1JYEA 1T13A 2J07A 1MIOA 3SPXA 2X1MA 3ZE1B 1QQAA 3IPLA 3LP5A 1QH1A 3GAFA 1A5BB 2Y0DA 1L5SA 3QO5A 3HSSA 3FDZB 1JN0A 2IQIA 1DAGA 3BS4A 1U7ZA 3M49A 2CLOB 3TM4A 1SJ9A 1EGHA 2O7VA 1X6VA 1H1LB 1EFTA 1G20E 4XIIA 5DK6A 2C8MA 2EAYA 1Q77A 4D80A 3TX2A 4PZYA 1XN1A 3GLHB 3KYJB 4F04A 2OCPA 1VCOA 1ORHA 3ZVMA 3UKOA 1LC0A 4RK6A 2AQHA 1M83A 5JW6A 5KC9A 3K0KA 1BE8A 1MVNA 4WNCA 4YMLA 1TIBA 3VC1A 4AS1A 4QUDA 2ZTVA 5TQ0A 5IJZA 3R0JA 5CYGA 3NJ4A 3HB4X 1C0PA 1G1MA 1Y33E 2QTAA 1KZGB 3AESA 2ZCEA 3KK0A 3R5JA 2J8ZA 1U6KA 2ONZA 5I5GA 3HLTA 3UB4A 2MYPA 2CLFB 2QM0A 3OT1A 3NNSA 1NF3A 3IT2A 4QBTA 3TZKA 1ZXLA 4OQMA 3T6KA 4EYQA 4IKEA 5LR6A 1UUFA 4L8LA 1HE4A 3NV9A 4O63O 1VI2A 1KPHA 1NVGA 1GTL1 1US8B 2AMLA 2JATA 4IOJA 4X0EA 2P4QA 1J2YA 2X2EA 2Z4TA 1LJ8A 4ND1A 5T4EA 2G8LA 1XEAA 1RYMA 2FXVA 1EXDA 1ZWKA 2NZVG 4PCAA 1FBNA 3DONA 2X0NA 5C3UA 2GDZA 2WUEA 2FW9A 4NYMR 4C4OA 5KVSA 4YCCA 1GGVA 4A0QA 1CHNA 3T5PA 1OA1A 4KV7A 4CKWA 1II7A 3E2MA 2F3TA 4ILEA 3CVOA 1UDRA 2YNMD 3OQIA 1P44A 2RAUA 3DSRA 1U0JA 3EEIA 3KG2A 4YAJA 1E3WA 1HT2E 1WRBA 3MEQA 1DC7A 2WICA 4D9JA 1IY9A 1D2AA 1JA1A 1YK0A 3O6VA 1C4KA 2R8BA 3QKWA 3B1YA 3AFHA 3ZE8A 2ZZGA 2UVQA 4XWYA 3SLKA 1ZI8A 1V35A 3ESYA 4P80A 3KQUA 1UBEA 3R9IA 2QVCA 3QBJA 2F2TA 4DA7A 3R5SA 5I9MA 1TUBB 5CLJA 3H1EA 4OJMX 2OTCA 1SQFA 3A9SA 4L0MA 1CZLA 3GX1A 4BNNA 1V2HE 3EBLA 1RXIA 4KGXA 5AI6A 4E2FA 5C81A 3HP7A 2PUBA 1NFFA 1A5TA 1YRBA 2H92A 2V58A 3HJRA 4I4CA 1C5KA 2WSSD 2W43A 2ISCA 4H7EA 4KI7A 3AVQA 5F3DA 5IAEA 4CQLB 2I6TA 4KH1A 5KPJA 2BGUA 4A91A 4M1MA 1L8AA 4ND7A 3LF2A 4BPRA 5BSVA 1VZ2A 2AQKA 4UNRA 2EHJA 3OUUA 4YYZA 3DZCA 3DE7X 3PJDA 3I61A 4KR3A 2JASA 1JG7A 4I50A 2JVIA 2ZAGA 5ELNA 3B13B 3FCSB 4GC9A 3ILYA 1KRXA 5BV0A 1JBQA 1U7UA 3CH6A 3N2ZB 3G8CA 2IUUA 1VHLA 2OCXA 3UCFA 5BWBA 4JYZA 5IDYA 5BUZA 3SR3A 3NAMA 4WE3A 3QKBA 1GZ7A 1QR2A 3KEMA 4JLUA 4KIGA 4Q3DA 4Q19A 3DHVA 3GIDA 4FMCB 5HE8A 5KJEA 2NXJA 3PR3A 3MF4A 4U2EA 1T36B 2IV2X 1E0DA 1SPBS 3B2EA 3M1IA 4K28A 1PZGA 4HPJB 4K2HA 5IPFA 3LQKA 3OM0A 8MHTA 1LPBB 2DPXA 3B3FA 3EWSA 3I2YX 5ALYA 5EP3A 3K6SA 1Q6YA 2VKQA 4RL6A 4X6XA 3IE2A 4RABA 5A2QA 1T26A 3AR8A 1WYDA 1ETHA 1PT7A 1Z68A 5D3ZA 4YRCA 3LP6A 4YPFA 3QV2A 5YASA 3B9RA 4J7CA 3ZU4A 2VO1A 1KU0A 3FUXA 4B84A 3M1LA 3W05A 4HNAA 1XA3A 1E2JA 1I1NA 1LJUA 2WYVA 4NPCA 4Z3OA 3PHHA 2Y27A 1NYTA 3G5UA 1GM5A 2Y77A 3IPXA 1BCRB 4DV0B 4RCVA 5B30A 1RT9A 1Z6QA 2NLOA 2Q8NA 1JWAB 5FUMA 4M83A 4YRLA 2FPOA 5F3RA 5G0UA 4HJXA 1AQ6A 2DHRA 3D3NA 4X8HA 2BI8A 2EGUA 2NACA 1U8UA 4BFSA 3V7NA 3EARA 3F8SA 3GFVA 3JD2A 3K9QO 8AT1A 3EXIA 1SQSA 2REQB 2GBCA 2A1UB 2A0UA 4LN1A 5DNVA 3P9CA 5IX8A 3KSBC 1V4BA 4M6WB 4QPDA 4HYTA 5EHNA 4FBQA 1WX1A 3G88A 5KYVA 4NJEB 4DJ5X 5LOVF 3GAAA 3TAUA 5FULA 2JLYA 2QW1A 1JVNA 3NTLA 3MB5A 2IZOA 3B36A 1I9GA 1UJ5A 4N40A 4AK9A 5EP1A 3RTDA 4D02A 4INZA 4EW6A 3VTIA 4ZQFA 3C1OA 3P52A 1T4GA 5H8WA 2FPSA 1CQIA 2G9RA 1JR6A 3R75A 2ZPAA 4HH4A 1QTNA 4I50B 4P38A 4UPEA 2F4NA 3F6CA 3I8OA 5E8JA 2YHBA 5JSUA 2ZAIA 4DG5A 2QYSA 1WY5A 3OZRA 3EH2A 4DPGA 4QYTA 2E4XA 3SE7A 1LPMA 3JQ7A 3G9ZA 3NANA 2HPVA 1H2AS 2PJDA 3HKEB 1TC2A 2H9YA 1YB5A 3M9XA 2F67A 3K2EA 1GV0A 3L6EA 4W7SA 5BNWA 5BUSA 1JH8A 3I6MA 3SC2A 4WBNB 3ADOA 3KSZO 3UYKA 1KMHB 1E24A 1L5HA 4DR1B 4WDQA 1OIWA 1E79D 1M34E 4XFJA 3CX6A 3BXOA 1M66A 4RIIA 1A4RA 1J8FA 1SRYA 1MTOA 4BNZA 2J3HA 2GM4A 1CRZA 2BH2A 1LZLA 3PU6A 3R3XA 1XVTA 3M6IA 1P1BA 3LLVA 2B6HA 1ZN9A 2G88A 3I73A 3MUNA 4LXHA 1FOEB 2I91A 5FYQA 1KMMA 1SY7A 2DVEA 3LUKA 1S89A 1VDMA 3LQYA 1ULAA 3FNFA 5A4DA 2Q5JA 3ZLJA 1RI1A 2YJZA 4DE5A 4U7PB 3EVTA 1GQSA 1ONNA 2QRVA 5GIPE 1WUKS 3WQQA 2FYTA 2HDHA 3IXQA 1VE9A 1AUVA 4BVKA 5ERXA 1H5QA 2C2KA 2CZQA 4GP9A 1G60A 1G5HA 3RWBA 3WI7A 4AG6A 2FK7A 5ITVA 3ANSA 1RIFA 3CXUA 5EA2A 2HCJB 1GEEA 3KPWA 4RAQA 5C1IA 5AUPB 2YWBA 2B4RO 4NY1A 3ZHZA 5COAA 2I2BA 4YJ2A 3ZDFA 4LYDA 5T67A 4O4JB 4JC4A 1J97A 1WLEA 4MGEA 4BTEA 1XPOA 4D46A 2O0KA 3BTSA 3UIEA 1QF6A 2LR0A 3EC1A 4PO1A 4QG7A 3QLTA 2P35A 2Y6VA 1MNAA 3IIMA 4Q6GA 4ZGGA 3LFUA 3K9NA 3TOCA 2JIPA 1AMNA 2MINB 3EBPA 5FR2A 5KNDD 2COEA 2PUAA 5BWNA 1GTRA 1ZOLA 3BGOS 3LBNA 5IDVA 4O3FA 4MVJI 5D5QA 3PDHA 4I1RA 4OY3A 2QW0X 2XUFA 1L4BA 3L0YA 4ZJYA 5JRJA 4X44A 1EE9A 2WHRA 4OOFA 4HQKA 3G1TA 4ESVA 1A4IA 2OCDA 2QJFA 3E9YA 3FBTA 3QUBA 1A8SA 4FGWA 5HF9A 2PLRA 3IA2A 4BAGA 2BF4A 1C4XA 1ZIOA 2GBGA 2ZYAA 1SCAA 3G8BA 3MJSA 4K9PA 4OHBA 3ONWA 4QPNA 3V7SA 4AS3A 2HWUA 3DSDA 2W6MA 3X1KA 4A16A 3A0RB 3U1TA 3INTA 4FINA 4JQOA 1TKRA 2EFYA 4WGGA 5DHSA 1WUYA 2V9PA 2Q3EA 1HBJA 4LOKA 3NG1A 1TIPA 1Y98A 1ZL2A 4KW7A 5DGHA 2GPNA 3O8CA 1R4AA 2P75A 2FV8A 4QEKA 4WOCA 3D2AA 3IGFA 1ACJA 3QHQA 4AJLA 2BHNA 4KK4A 2OY0A 2DLNA 3CTMA 2BKEA 3R0ZA 5AVKA 4EB6B 4ND8A 1VLJA 1QHHA 3WV5A 3HKCB 3ILXA 4CEIB 2G3YA 3MS4A 1AA6A 3BERA 4X9XA 4BGUA 4K88A 1U9YA 1ZUNB 3N2NA 2G06A 1E1QA 3OIUA 4QG3A 5A5DA 4Q05A 3G9XA 1K98A 4P33A 3NB0A 1KEKA 1SG0A 3P96A 5JR3A 3NBFA 1AQJA 1NNHA 2X3FA 2V65A 5GVSA 1J8QA 2ZSEA 4KRGA 1P4GA 1GKLA 1OXKB 1W9HA 2BOVA 2WMDA 2YZ7A 3E9IA 3AF4A 3ED1A 3O8QB 3TTUA 1PQPA 4NICA 4I6GA 3OHPA 4W6ZA 4FW8A 4ZCPA 4CKXA 4O2BB 4W1SA 4G5QA 3KR1A 3U6BA 4RLFA 1T9KA 1X94A 1X2BA 2PD3A 3U7HB 4OQ4A 4RM3A 4XAQA 1G4AE 1FFWA 3ORQA 2IOHA 2IXFA 1OZGA 2J87A 3NBXX 4H16A 5EERA 1YC2A 2CHQA 5A3JA 4ZHQA 1ODKA 5FXMA 2I6SA 4DT1A 3C4VA 4G0XA 1DBSA 4KREA 2P9BA 1IAVA 4FDAA 1XHLA 5JS6A 4HB4A 1Z2CA 2I6XA 4US0R 5A0TA 3IJ5A 1VPEA 2V7QD 3TL2A 3KVRA 2BMWA 2F43B 4FBMA 4DDMA 1QFMA 3IALA 2C82A 2OXRA 2VNIA 3MAJA 4IF6A 4MUBA 1I3MA 2ZBPA 2J5BA 2IXGA 3SF8B 3WMRA 3NMUF 3DQZA 1N4AA 1AK1A 4D57A 4XSHA 5IBQA 4DCTA 3WBFA 3IELA 4BMVA 1P7YA 4TV9F 4AY6A 1ZUWA 1PHRA 4W1RA 1X1EA 2NZUG 3MLBA 1CZHA 1QYWA 2B5OA 2FQYA 1NG1A 1TT5A 3CLTC 3HWWA 5CRIA 1Z7NA 4J9VA 4N3BA 4QPJC 5K6AA 1ZCBA 5FNVF 2WG0A 5H81A 4X8MA 1IEVA 3UMBA 1NBOA 1VRWA 4EATA 3E4DA 3UJPA 4YJFA 2PMDA 4BKUA 4DWJA 4FR0A 3AL3A 2ZSAA 3AR2A 5T6MA 1CG6A 3HN7A 3V9PA 3HJGA 4P4SA 4REQA 1P1RA 1O95A 1RWOA 2VP5A 3R0XA 3U7EB 1TJYA 2RBEA 3P9RA 2XT0A 4PYRA 1SHJA 1IN5A 1HDRA 4MQ4A 3UAYA 4ZI7A 3TRHA 3WFIA 5JVDF 3EXFB 3H65A 1WQ1R 4PBTA 5KOHA 3FB1A 2FWBA 3KSDO 4J0HA 2HSEA 4WSOA 4XA8A 2M1XA 4ZYUA 1SC4A 4CG3A 5F9MA 3FFBA 3CKMA 5IDWA 2VNJA 2WVAA 2Z2IA 3PUHA 5G0WA 5L51A 3P0JA 3QX7A 1XZEA 3RTCA 1USYC 2Q1WA 4LYFA 2PZAA 4P7FA 3ZYZA 3KQPA 5A7HA 2QVLA 3AK4A 1RFGE 4NHEA 2UXCB 2O8FB 5IYZB 1E9EA 2DPHA 4RDIA 3EODA 4FE4A 4YQZA 3QKTA 4HZIA 1B7YA 1WW3A 1YCDA 3F7TA 3GN1A 3EFHA 2LXNA 3G5MA 2OC4A 4KODA 4NONA 2JI6A 3V55A 1P72A 1I3KA 1WXEA 2J4DA 3U81A 3OEWA 3PFBA 3VU0A 2H1VA 5FA8A 3AKYA 1MDBA 2PAFA 4AJPA 2IYVA 5JISA 4RSMA 4G67A 1C30B 5GPBA 2XCUA 3RAPR 4ND3A 1O6FA 1R8QA 4D4JA 5BOSB 3VDRA 3DFZA 4DV1B 2WVJA 5E7MA 3FETA 1P9LA 1NW5A 2LVBA 5JVDB 3DDNA 1ORDA 2EP8A 2OFFA 5KC8A 1YVPA 1RM3A 5H9WA 3GT4A 4UE2A 2GYWA 3N2LA 4TKUB 2UU9B 4IVNA 4D8WA 1KIAA 4GYJA 1EIWA 4F1KA 1R15A 3AR9A 1MABB 1DTWA 3HM9A 4UUPA 2O8DA 1PV1A 3UT5B 4OMFG 1DRVA 3N2IA 3Q8MA 4BO5A 4OGKA 2ASVA 4JOQA 3KV1A 5D3MB 4R8RA 3IL2A 3W2TA 1V3TA 2IODA 4KRYA 3WTBA 5KS2A 3GEEA 4B3TB 2X14A 4EEZA 2BMJA 2ZJ1A 4QICA 4B4UA 5CG1A 1AT1A 4XX0B 2V98A 3BFJA 1P4RA 1RMQA 3OIGA 1TVMA 2E85A 2Z9BA 3VHQA 2OBLA 1AKRA 1RWVA 2QORA 2A58A 1VKOA 2WD7A 1KQOA 3SM9A 4DUPA 1GZ3A 4ZI3A 3H4VA 3ZWCA 1K7FB 4TZ0A 3KWLA 2HKIA 4D9IA 2B7LA 3Q72A 1Y81A 1SC9A 2OKGA 5EIAA 3OKAA 4H3HB 3P9IA 4A5OA 5BRJA 4TM8A 1WEKA 4JOSA 5CA0A 4TVKA 3ZV4A 3ZIUA 2JLBA 1NXVA 1IMJA 5EJFA 1YS7A 3GD5A 4IUDS 1Y7HA 1ZJZA 1SRQA 1XZDA 1Z25A 3IPCA 3LDUA 4JLNA 5KB3A 1YR8A 1JMVA 5ALQA 4YREA 3NM4A 4EJ2A 1G7TA 1II0A 2A9VA 3ZWQA 1O89A 3RVRA 2FUNB 3ISTA 3ZOKA 1DRUA 1UANA 2MSWA 3F6YA 5J59A 5K3BA 4BBJA 4RMFA 3RODA 5BQFA 1FJXA 3D8HA 2X3YA 4FSDA 2H1LA 3KZKA 1T6XA 1NVMB 1DXOA 2X40A 3AX6A 1OWMA 5JD6A 5EIEA 1OLUB 3LC1O 4JFAA 1BW9A 2BL4A 2FVXA 1MZVA 4UQOA 4XKJA 1WBDA 4QELA 1PG5A 1W85B 1SERA 2XMSA 1RZ3A 2XSZA 2OHVA 4N01A 1DINA 1E3DA 1VMKA 4I8IA 3VA7A 1QP7A 3OFND 5I7HA 3AVWA 5IKOA 2P30A 1VQ1A 3ER8A 1IUOA 3V32A 2HCTA 3T7EA 4HX9A 1X7DA 4BMSA 3TNDA 2WUFA 3SJBA 2LPMA 2NYRA 3AYXB 4LJYA 4E22A 2GILA 1XI2A 3F8TA 3MWDA 5E8RA 3RSFA 3DYIA 5TRTA 1RWPA 5G4KA 4YXWA 1YZYA 4HO1X 4XGNA 1URPA 2D1TA 3NHPA 2ENUA 3HYLA 3ACDA 2QTNA 1KIFA 3MA0A 4V02A 5DULA 2GQ0A 3PFKA 3B7PA 3NEPX 1Y1KE 4HGOA 1E2KA 5JS2A 3NDPA 2TMDA 1NP7A 3N0TA 4DTCA 5C80A 4W7IA 3AYZB 1J21A 4IUYA 3N6VA 4ZQGA 5JTUA 4HDMB 1ZMRA 1FXWF 2WHPB 3M3PA 3SWWA 4C07A 2XVXA 2AN5A 4Y2TA 2XWJI 3NEAA 3T1NA 3WY9A 1FP2A 1VRCA 5BPFA 1GHTA 2FW7A 2H52A 1LLDA 3HRHA 2DBVO 4JK3A 3AQIA 3KZ1E 1W59A 3AERB 4NH0A 2YXEA 3N59A 4A8JA 3X2FA 5HZKA 3RUAA 3TLGA 2C7VA 5TLSA 1PQUA 1W76A 2M6SA 1UBFA 3THYA 4C76A 4G1EB 1XPUA 4UOQA 4YJ3B 3GJ8A 2WIFA 4NZYA 1HX7A 1EMDA 2ZJFA 5BURA 1RQXA 5K0FA 4JZKA 2C7BA 1N8NA 3NJ8A 2XUAA 1QRTA 1FFDA 1X2EA 2AX4A 2QT1A 3T38A 4GI2A 4F3YA 1GKYA 4JUAA 3I5YA 3TNYA 4PFSA 2W2PA 3IT0A 1VBFA 4D3SA 2DTIA 1NMSA 5ARCA 2QWXA 1TOAA 1COZA 3M70A 4RU1A 2OPBA 5DVZA 5EWLB 1T36A 1X9GA 4B46A 4ZPJA 4G8JA 2XRYA 3H83A 2WU1A 2NV6A 1YZUA 1Y89A 4D3DA 4H31A 4K9RA 3KYCA 3WRYA 5F7XA 5I9LA 1XRRA 3W5BA 4DRXB 2FWNA 3VZSA 3KOUA 5CX1A 1QPZA 5IT9A 1LDNA 2G9QA 4CKCB 2ZETA 4KWTA 5DYGA 1ZH4A 3WHIA 2C3PA 5L4NA 1AZWA 3FDXA 3OTHA 3BXEA 5F4BA 5H70A 5C5CA 5DNCA 4IMJB 2PBFA 2W9XA 3GLKA 5ITZA 2AOVA 3IMEA 5DTRA 2UVDA 3B2QA 4DMUB 4DLSA 4G26A 4X1KB 3GG9A 2B7CA 4DLBA 3KSMA 3MJVA 4YRDA 4JUBA 4BGEA 2ZRNA 3B2NA 5EQDA 5EMJA 1EWVA 3RUDA 4RXMA 3Q6IA 2CFIA 3ZVNA 5CA0B 5L3QA 1JEQA 4YMTA 4FCWA 1YMQA 3I04M 1E2IA 1NBIA 4JELA 3KJXA 4R05A 5FNZA 3R7WA 5KYXA 2V5AA 3U4IA 3FJYA 1Q0LA 4ETWA 2YWRA 2P79A 2IYUA 2YHIA 5JROA 1L7AA 4N6GA 2JARA 5GVRA 1K8XB 4M49A 4WOKA 4XUGB 5LQSA 4Z49A 2JGAA 4V0ME 1QIEA 2H2DA 4LRWA 4Q4LA 3IE1A 3QP9A 3F5QA 3PUVA 4EL0A 4ZZ0A 1WPQA 2IPOA 2I3BA 3QEKA 3CE9A 3ELDA 5D1HA 4DV5B 1JEJA 3G1WA 1Y1SA 3NCTA 4DAOA 3I2GA 4BO8A 1PN3A 1RACA 2QKYA 3AG5A 4HAYA 3S6JA 3DULA 3V8KA 3V4RA 2CC2A 3BF8A 1MOQA 2FN8A 1X8XA 2OR3A 3FZEA 3L7OA 4IXTA 3T34A 5LDDC 4TZKA 3R9XB 2IEYA 2HQOA 2A86A 2O1WA 1D6JA 2NIPA 3VR4A 1W6RA 2HMYB 1P18A 4A6PA 5H9VA 2MR5A 3RANA 4QQFA 3TF5A 2Q0QA 3QZUA 3FYTA 2GZRA 3PHJA 3C7CB 2WT9A 1W1IA 2R9VA 3DEKA 5EJIA 2HCRA 3UJDA 5EIOA 3SNHA 1AK9A 1BVUA 2BLNA 4PAOA 3RVMA 3TL6A 4EVQA 2VUSA 4XI9A 1KJIA 4R0NA 4DXAA 1SBHA 3AR4A 4XGRA 1KJJA 3E22B 2RHRA 2GYVA 2Z5GA 3C8UA 5D3KA 2D5AA 3HYCA 4I55B 2EW1A 1E61A 2QTTA 4TRRA 4YBZA 5C46F 1G59A 4BKMA 3RAJA 3RS7A 1VJ1A 1J42A 3HU5A 3QU5A 3E8SA 1ZKMA 3NTRA 3FWZA 1ZJWA 4X84A 2I67A 3MINB 3C8DA 4UUNA 4JH0A 1E2PA 4NIMA 1TTTA 3NHYA 5KSWB 1R8YA 5KWEA 1CEYA 4HWSA 2EFHB 3TIFA 1ODTC 3LCCA 2QRQA 2QYOA 1RYYA 3DMFA 3TEHA 1QGDA 4MLPA 4EEKA 1L7BA 4UPAA 1LV8A 2GXQA 1YVDA 4N0EA 3CVWA 3UJ6A 4OYRA 1JE0A 5I48A 5CIYA 2OB1A 4GLBA 4JUDX 2ZE7A 4ISCA 4B7ZA 2OO5A 2CNNA 1FFBA 4LMBA 1B4DA 4H2UA 1GUAA 2MYUA 3G0OA 1AKYA 4LZPA 3TIXB 5C4GB 3X2EA 4DBZA 4LVJA 3BN3A 1N9WA 1LPOA 3MMZA 4GFDA 4M38A 4G07A 5CURA 5E1BA 3BD7A 5JS8A 1X7YA 4L4XA 4PFQA 4UVGA 3B3QA 4AQ7A 1I36A 1M2EA 1K6MA 4OQXA 2W4IA 4DQLA 5BWOA 1QANA 3DG9A 4QVKA 2R1UA 2YOHA 4GOOD 4Z4GA 1QBGA 3JX9A 1KJZA 2CK3D 5FRDA 4HAVA 4L6CA 4ARAA 1FP1D 2OHHA 1ONSA 4AL4A 1N9GB 2CW5A 4HAUA 3TZHA 2PEYA 1TA9A 3Q5GA 1PT8A 3F7OA 2CRQA 3MGBA 5LDHA 3WDLA 3TTFA 3FSRA 4WESB 4C4RA 4LVIA 3U19A 1XD2A 5JCXA 3QIVA 5JAQA 2JFHA 1EWRA 5T3YA 4J0GA 5JNLA 4LRXA 1LF0A 1E6UA 3FTPA 4IINA 3NORA 4II7A 1FS4A 1V9CA 4OXNA 1AMUA 3AONB 2IS6A 2DWOA 4EPXA 5SZHB 1KS2A 1B74A 5BSMA 4MUYA 3JD1A 5COBA 4IMRA 4HF7A 2CNWD 1U90A 4LGVA 3JQ6A 1FNSA 4QO8A 1FSSA 3CKLA 4E5YA 1NUQA 2Q0SA 4UMFA 3GLFE 2WY2D 2QMQA 3EZYA 3ICOA 2VAVA 3O8OA 4URZR 2BUCA 2E1HA 1GGHA 3OHSX 3UANA 1N7JA 2HEGA 3QUTA 4FSHA 3BRQA 2O0LA 4UCWA 3O4RA 2VWHA 1JXOA 4AN1A 4UHBA 5HTOA 2EF0A 3U48A 4OMUA 5IK2D 2CJAA 3TDNA 1XQWA 4H7DA 3VR3D 4WN3A 5L8VA 2HNIA 1EYZA 2GFHA 4OGFA 3RFCA 2X19A 4HN2A 1SQ6A 2OECA 5AKJA 5DRYA 1CCWA 1MG0A 4J1SA 2HPHA 1K3FA 4W9NC 3SHQA 2E5WA 1G9XA 3DHWC 5A05A 5ITWA 1WQ7A 1YDGA 3EQZA 2CUTA 3ULKA 4I81A 1FSGA 2P6OA 3GN2A 3BSSA 1VPDA 4H0FA 2YH2A 1YBHA 3D8TA 4I1YA 5JFGA 5IN4A 2IEAA 4CH5A 4CS4A 1GL3A 4OFWA 3I9OA 4F1WA 3F9IA 5EUMA 3AHGA 1DQPA 1EJ0A 4RTOA 1LVGA 3DOIA 4ZV7A 4FHDA 3VYUB 3ZCXA 1K0UA 3LWNA 1E2BA 1NKVA 3ICWA 3K1TA 3A1SA 4M7RA 1C7QA 3MTBA 4IW3B 4L95C 4M60A 2O8CA 1YNOA 1LLUA 3AI2A 4OUDA 2WWTA 1R66A 5BY2A 4HD8A 2V97A 5D6NA 4A1FA 2P6PA 1NIPA 1RPAA 4HQ0A 1P75A 2GBLA 2GTIA 4JNKA 4YAEA 3RVBA 3LPNA 3TBKA 1BZYA 4EY5A 1OT5A 5T8KC 1C8KA 4X45A 4UU1A 4EJSA 4MTLA 1XXHA 5JQWA 2A92A 4I2NA 4RXUA 4H15A 5HFJA 1UKVY 2AEEA 3GUZA 4K5QA 4HAWA 4BMZA 2PZLA 3CRRA 4CI9A 3BCUA 3PC6A 3OKFA 1PNRA 3M83A 4RD0A 4XTRA 2VLBA 1EG7A 1E2EA 1Z47A 1ZJ5A 2ERXA 4CMBA 5KKNB 4QOEA 1PIWA 4CDMA 1WBBA 2BSXA 3T7TA 5DNUA 1YSCA 4INPA 2C2GA 3OQPA 2DTDA 4QFDA 4D5GA 4IVPA 4LGMA 3O8DA 4W5WA 3IESA 2AJDA 3SSOA 1RRMA 4LF7B 4A7PA 3UUFA 4OREX 4I2VA 1Z38A 2Z3ZA 4ZT4A 2QGFA 2PQMA 1JA9A 1I7QB 1B7YB 2AEFA 4R2IA 3IAFA 3SX4A 2M32A 4XQ9A 5IEBA 3WRVA 1D7OA 1DG3A 1ESZA 4ZXPA 4BNTA 2ZR9A 1R0RE 1J56A 3FWHA 3QMMA 1XTTA 2IPMA 1UBUS 4G9BA 4FMDF 4PGFA 1R0KA 1JF8A 2XE8A 2GEJA 3W5UA 1QKKA 3DYBA 5E95A 2G08A 3PC7A 4EI7A 3JAMA 2YOFA 3PNPA 2WBLC 1RD4A 3BD8A 3L1KA 3QLJA 1KI2A 3DDWA 4H1VA 1YHZA 5ALMA 2GFIA 2XB8A 2WYWA 1DLJA 2EF1A 1F8GA 1WXHA 4EFDA 4XVRA 3R5XA 4B82A 1WD7A 2QB5A 1KYWA 1W47A 2W2TA 3CF6R 1MX3A 1D6SA 3ABRB 3ECSA 4PSKA 5IUKC 5C52B 4K0KB 3GELA 1A8PA 5F33A 4CLEA 4WXYB 1XQYA 4EYEA 3QLUA 3TGPA 4G8DA 4H2VA 3BD6A 5D84A 3RKUA 4Y7CA 1JJIA 4X65B 2B82A 5AVJA 2YNMA 1WW2A 4P82A 3W5SA 5A9RA 5CFZA 3DE5X 1GRNA 5BMOA 2E5LB 4HNAB 1YK1A 4OYLA 5A04A 4C1NA 1H9CA 2UUOA 3Q4GA 5B1IA 4AP9A 4XFDA 5CU7A 3TW8A 2ZTMA 1OPRA 1TF2A 2EKPA 2G5PA 2PR2A 1J1ZA 1AU9A 2HCBA 4BLRA 3IBTA 4NBVA 4HK4A 2EJWA 4B7UA 4QASA 2RJ3A 3AOEC 3F6RA 3MFQA 1KFJB 3L0DA 3VC2A 5BW8A 5DASA 1JHRA 4N1AA 1PW7A 1N6RA 2DH5A 2JAPA 3OG9A 2YJ3A 3DVAB 4Z0NA 1FXWA 1HXHA 1OJLA 4JI1B 4XEHA 3HACA 1QZUA 4BVEA 1RE1A 2R7AA 3EGEA 1U98A 5HCIA 4C0XA 1G5RA 3IMFA 4E11A 2PZJA 1DUSA 1E6MA 2BEWA 1HQDA 1ID1A 3IULA 1W75A 2CUNA 1UFVA 3KKQA 4FYMA 4OXRA 1GARA 1SEPA 3DEIA 4G86A 4RF3A 5ELLA 9LDBA 4UBIA 2WJHA 2H4FA 3KB2A 1YZHA 1GAXA 4WY5A 3O84A 1F2UB 2XCIA 3U4HA 4YCAA 1S01A 4MVCA 5G4LA 3WNDA 1RXVA 2FJ0A 3W5HA 2YYYA 1YA4A 2I1LA 5FWAA 4P54A 2WI8A 3BUSA 3VUFA 4EFNA 4Z99A 4ZT3A 4I9NA 1HYGA 3WOVA 2C8JA 2H5JA 1E89A 1CS0A 3A7UA 2JD1A 1FUEA 2AJCA 3KQTA 4BMCA 1QE3A 3OPYB 3G02A 4Y9UA 4H1HA 2GESA 5TX7A 1TUBA 1D4AA 2GCOB 3EZNA 1QTIA 2W8ZA 4NCIA 2FX2A 4QPCA 4Z9BA 4EMUA 5IAAA 1NQVA 1IJKA 2XUIA 3WLLA 1B0ZA 1C8BA 2GHRA 4L85A 5A7GA 1IM5A 2BMVA 3OF2A 5B4TA 1YUNA 1H4VB 1OZ0A 1RHJA 2WFMA 1JQKA 3P2JA 2XMCA 4R5MA 1XN4A 2C97A 3RTEA 2B4YA 1YS9A 2B98A 4R6WA 1CUBA 4TXHA 3T7JA 4CM9A 1I1HA 2KWIA 3LIPA 1U1EA 3C4QA 4DM4A 4CEIA 2QD2A 3G1ZA 1EFPB 2UUPA 5AUQA 1ZR4A 3H2KA 1MC5A 1D1QA 3D4BA 2IEIA 4MHSA 4OLHA 3VU1A 1GCAA 4JA0A 4DQUA 3VKFA 4QUBA 5JNWA 2IOYA 4ZJPA 3WGVA 4QTTB 3LSSA 3ZIAD 1K4MA 1TPYA 3G9UA 2VNAA 4EPVA 1JAIA 4MWEA 3GFFA 3U39A 4MV0A 3KPJA 1QHXA 3E3LA 1P74A 2I8LA 4EHDA 1NRXA 1TZ2A 3DLTA 3QVGA 2OZPA 1E3IA 1W88B 3CLRD 3V8JA 4QGGA 1FCJA 1ENPA 2PMWB 1K92A 1AO3A 2Z2YA 4U8GA 3CZQA 4UTRA 4J3NA 3I3SR 5HGXA 1ZX1A 5IW8A 1NJSA 3CEMA 1KI6B 4H1WA 1U5BB 1X15A 2JFFA 1JAYA 1KZHA 3MBIA 3SYNA 3HFRA 1XTJA 3AEQB 1MAAA 5BQ5A 4V2IA 3BT7A 1YV9A 3L7BA 1RMTA 4D9CA 1B1CA 2FZGA 4CKEA 4QT4A 4RVOA 2ZUVA 3I1FA 4FIDA 5BXYA 3PRKE 5A0FA 4YMVA 1GGNA 2AG6A 3RNLA 3KEQA 4N76A 3BE6A 1QIDA 1XVIA 2HIAA 2I4TA 4KQMA 2Q7XA 1MO6A 4EB0A 4U7WA 4WXHA 1VHQA 3DPSA 4LZLA 2BBOA 5EWMA 5IJXA 3FZNA 3N8NA 1TQ8A 4CU2A 3D4IA 2GJ9A 4BVJA 4PR0A 1WZ2A 2F1RA 5BVGA 1EK2A 2N75A 3QVOA 2YHAA 2IE0A 4C87A 1V6SA 2Q5CA 2IYYA 2BSQA 2W48A 2DT8A 4QU9A 3N1UA 3ZBPA 5BV2P 4IJMA 2OLEA 5FTNA 1ECLA 2X0RA 4N7JA 3OF5A 2DQ3A 4NEGA 1NURA 4GDMA 5FF9A 4BW9A 1GNQA 5G2OA 2FSSA 2GLTA 2NG1A 2D7CA 3Q15C 5TDHA 5H0IA 2DM6A 1U0RA 2I4NA 2GLXA 3LDFA 4ADSG 2XJ9A 3RNOA 6YASA 5DBHX 1L4UA 4RXTA 3RBZA 4UFNA 5EVJA 4O4IA 4R9VA 2WKPA 2Z98A 3TCNA 1JJAA 2QR3A 4Q6BA 3EULA 1B6RA 4F8YA 1Z5VA 2ES4A 1M0SA 2D1RA 3FHLA 1USVA 3EA0A 4GZMA 2H51A 1MABA 2MYNA 2ZZKA 1J25A 1W48A 1R0CA 1NUAA 3G5TA 2HIMA 1SURA 1E2MA 1EFVA 2J45A 3FKSD 4FZJA 3JVVA 1USIA 2BI7A 4UVEA 4ARUA 1N7HA 1FLDA 4D1YA 4E88A 1MB0A 5KQSA 4YWJA 4GU5A 3D1VA 4HN9A 4N5IX 4IXNA 1HNZB 3LGSA 1SC3A 1YNSA 1JQ5A 5EP4A 1U1GA 3QY9A 2GN0A 3QU2A 4XM1A 3ORFA 3DHNA 3OEED 3WWOA 3NUGA 1FRNA 2RC6A 3FUUA 2VYND 1U02A 1I1QB 3CEHA 2IHYA 1AXGA 4H9GA 4IIDA 1CY7A 4E33A 4POOA 1XOIA 1Z56C 3O3OB 3QELB 4HATA 2GMWA 4LF5B 4AY3A 4F46A 4Z1MD 5C35A 3VJRA 1JHMA 3I2FA 3O1LA 3TOXA 3T61A 4O2DA 3IAS6 1QU2A 2AXEA 4MP8A 1ISGA 1MHPA 2HRCA 3ZHBA 4RK1A 4WLOA 2O8EB 3MUEA 3S2YA 1C7EA 2WABA 3DT6A 3KJZA 3W77A 1KHTA 2VYQA 3IDQA 1VPTA 2EK0A 2XE7A 3M2PA 3RUCA 3AM3A 3GCDA 1KTVA 3QSGA 5D5HA 1J8YF 1UZLA 3WMFA 4BNDB 4F85A 1QUFA 2WTEA 4OQDA 5IS2A 4O0LA 4XLTA 1XTVA 3HL4A 2CXSA 4LX8A 4E5VA 2I78A 2VSNA 1LX7A 1R4ZA 4CFZA 1C7JA 2A4KA 2OHFA 3EG9B 4L16A 2SBTA 2O2GA 4TTQA 4W1QA 1PJ3A 5KU7A 2FZEA 3EAGA 4ND2A 2ZIWB 4WF2A 1ADJA 3WYGA 4FS3A 4UE3S 1UJ4A 4GBMA 3ZY2A 1CR1A 2NM0A 1YCGA 2AGVA 3NOQA 2TMKA 1YR1A 2KYRA 1J0AA 5TMEA 2J48A 2V7VA 1TVEA 4Z4QA 1JIQA 3T15A 3GGPA 3O7MA 4PYNA 1J70A 3NATA 4CMEA 3GJSA 1CSEE 3TLCA 5F21A 2CLDX 4FHFA 3STHA 3PJGA 1DSSG 4YBRA 4N18A 1JKJA 4CZ2A 5TPZD 1ES9A 5FKJA 5A1TA 1TCAA 1DX9A 4JUCA 4NL4H 1GT91 2Q21A 4DNFA 5F1KA 4U7JA 2ADMA 1C9NA 4DEYA 4E5PA 1T0IA 4IRXA 2J5KA 5B7NA 3VDMA 1TLLA 1YONA 1IN8A 2QLJA 3BGSA 4WLFA 4ALNA 1PEKE 1V7QA 2C7RA 11ASA 2A9OA 1W4AA 1Q22A 2ZIXB 1HDOA 1WB5A 1V1MA 3LE8A 4F4FA 1ML4A 1JVBA 1QHNA 4K6MA 4PX5A 4D41A 5EHXA 5FAKA 4Q3EA 3BJZA 2ID4A 4QJIA 3DO5A 1B6TA 3VNUA 1PL6A 1FX1A 4JYPA 4ZANA 3V2GA 5BW6B 2HJWA 2QRGA 4YIHA 3KE8A 1JIKA 1V4NA 3DM5A 1LBHA 2REQA 3TTYA 4QATA 4CTOA 4D6PA 1H3EA 5LNK1 4ALJA 1T3HA 3HXZA 2QPAA 3EC7A 3IA7A 3ZU6A 4CQLA 1O77A 1ANKA 5B58T 2JZCA 2FA9A 4W5OA 1SUIA 3QKUA 3HXYA 2CLHB 1QAQA 3QKSB 4NOMA 5TNXA 1CY0A 2RG7A 3R7LA 4DYDA 4DR5B 1KQPA 3FUWA 3Q7EA 2UUBB 3EAFA 4N39A 1NOIA 2Q2QA 1AUOA 3KKMA 2OD9A 4JKIA 2AA3A 2WE8A 1HKUA 1OIXA 4ZRNA 3UW1A 3ETLA 1XHFA 2ANBA 4MW5A 4RHXA 4GI3A 3OAAD 1W19A 3NASA 3WL7A 1BWSA 4ML3A 1ZNXA 3FW1A 3TW8B 1O4VA 1WSAA 4LVUA 4JI3B 3LCVB 3Q3IA 4K6KA 2QQ0A 4BMDA 1UQUA 2WSIA 3OEHD 4RQAA 5AKGA 5EE3A 1ECFA 2BGIA 1H0RA 5H3LA 3CUWA 1PFYA 1THMA 3W7VA 4CL0A 3GJTA 1Z5WA 3HUFA 4IJUA 1SHZA 2GDJA 2MSLA 2R8PA 2ZSFA 3BH6A