1NJBA

Thymidylate synthase
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFCIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partitioning roles of side chains in affinity, orientation, and catalysis with structures for mutant complexes: asparagine-229 in thymidylate synthase.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase (methyltransferase)
source organism Lactobacillus casei
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1996-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1njbA00
4KYAA 3I3RA 3UWLA 3IRNA 4XSEA 1TDUA 1NCEA 3IK0A 5BY6A 1LCBA 1NJEA 1THYA 1TJSA 1TSDA 3DL5A 2FTOX 3B5BA 3BHRA 2AAZA 1TVUA 1F4EA 4PSGA 2FTNA 1I00A 2TDMA 1NJAA 3INVA 1AN5A 3EDWX 1TVWA 4ISKA 1BIDA 1J3IC 4EB4A 4KNZA 1B49A 4FOXA 1ZPRA 2RDAA 3BZ0A 1TSNA 1TRGA 1TVVA 3DG8C 3EF9A 1DDUA 5H3AA 1TSLA 4ECKA 4DPDA 4E28A 1NJDA 1HZWA 2FTQA 3BGXA 3BYXA 3K2HA 4O1XD 1AJMA 1TDBA 3JSUA 1SEJA 1DNAA 1TYSA 4O1XA 1F28A 2TSRA 1JUTA 1TDAA 1KZJA 4UP1A 3KGBA 4IRRA 4O1UA 1LCAA 1TSYA 2RD8A 1YPVA 1VZCA 1VZAA 1TSMA 1JTQA 2BBQA 1BO8A 1B02A 4KY4A 1BP6A 3N5EB 5H39A 1BSFA 3C0AA 1LCEA 1BPJA 4FQSA 4FOGA 2G8DA 4Q0DA 2H2QA 3HJ3A 1TISA 1J3KC 2OIPA 4G2OX 5J7WA 1TLCA 4FOAA 3BNZA 5WRNA 4LRRA 1EV8A 1BSPA 5FCTA 4DP3A 1TSVA 4H0UA 3NRRA 4JEFA 4EZ8A 2G89A 4KY8A 2G8AA 1EVFA 1BDUA 1BP0A 3GG5A 3HB8A 1RTSA 2G8XA 4O7UA 1BO7A 1F4DA 3CLBA 3KJRA 3QJ7A 1F4CA 2TSCA 3EBUA 3UWLB 4DPHA 4H0RA 3EAWX 3B9HA 3EGYX 1HW4A 1JMGA 4DQ1A 3IJZA 3UM5A 4F2VA 1VZBA 3EHIX 1TLSA 1VZDA 1F4BA 1KCEA 3KJSA 4GEVA 1B5EA 4IQBA 4XSDA 1AOBA 1HVYA 1KZIA 1TSWA 1TSZA 3UM6A 1JMFA 2VF0A 1FWMA 3H9KA 3GH2X 1F4GA 3N5GA 3V8HA 3BFIA 4GYHA 3HBBA 4GD7A 2VETA 1HW3A 2KCEA 2TDDA 3OB7A 4KPWA 4H1IA 1TDCA 3IHIA 2ONBA 3ED7A 4XSCA 4G6WX 1F4FA 3UM8A 1QQQA 1JUJA 1JTUA 1BQ2A 1JG0A 1TSXA 3C06A 4Q0EA 2RD8B 3CL9A 4IQQA 1NJBA 1BKPA 2G86A 1BKOA 1JMHA 3EJLA 3QGTA 5HS3A 3N5EA 3BHLA 3TMSA 1CI7A 4E5OA 4FGTA 4EINA 3DL6A 1BJGA 3IK1A 4TMSA 3GH0A 3IX6A 1BQ1A 1B5DA 1EVGA 1SYNA 5H38A 3QG2A 3DGAC 1AIQA 3IRMA 3IROA 1EV5A 1FFLA 1QZFA 4EILA 1VZEA 1JMIA 1NJCA 2A9WA 4ISWA 1AXWA 1J3JC 1JU6A
chains in the Genus database with same CATH superfamily
4KYAA 3I3RA 3UWLA 3IRNA 4XSEA 1TDUA 1NCEA 3IK0A 5BY6A 1LCBA 1NJEA 1THYA 1TJSA 1TSDA 3DL5A 2FTOX 3B5BA 3BHRA 2AAZA 1TVUA 1F4EA 4PSGA 2FTNA 1I00A 2TDMA 1NJAA 3INVA 1AN5A 3EDWX 1TVWA 4ISKA 1BIDA 1J3IC 4EB4A 4KNZA 1B49A 4FOXA 1ZPRA 2RDAA 3BZ0A 1TSNA 1TRGA 1TVVA 3DG8C 3EF9A 1DDUA 5H3AA 1TSLA 4ECKA 4DPDA 4E28A 1NJDA 1HZWA 2FTQA 3BGXA 3BYXA 3K2HA 4O1XD 1AJMA 1TDBA 3JSUA 1SEJA 1DNAA 1TYSA 4O1XA 1F28A 2TSRA 1JUTA 1TDAA 1KZJA 4UP1A 3KGBA 4IRRA 4O1UA 1LCAA 1TSYA 2RD8A 1YPVA 1VZCA 1VZAA 1TSMA 1JTQA 2BBQA 1BO8A 1B02A 4KY4A 1BP6A 3N5EB 5H39A 1BSFA 3C0AA 1LCEA 1BPJA 4FQSA 4FOGA 2G8DA 4Q0DA 2H2QA 3HJ3A 1TISA 1J3KC 2OIPA 4G2OX 5J7WA 1TLCA 4FOAA 3BNZA 5WRNA 4LRRA 1EV8A 1BSPA 5FCTA 4DP3A 1TSVA 4H0UA 3NRRA 4JEFA 4EZ8A 2G89A 4KY8A 2G8AA 1EVFA 1BDUA 1BP0A 3GG5A 3HB8A 1RTSA 2G8XA 4O7UA 1BO7A 1F4DA 3CLBA 3KJRA 3QJ7A 1F4CA 2TSCA 3EBUA 3UWLB 4DPHA 4H0RA 3EAWX 3B9HA 3EGYX 1HW4A 1JMGA 4DQ1A 3IJZA 3UM5A 4F2VA 1VZBA 3EHIX 1TLSA 1VZDA 1F4BA 1KCEA 3KJSA 4GEVA 1B5EA 4IQBA 4XSDA 1AOBA 1HVYA 1KZIA 1TSWA 1TSZA 3UM6A 1JMFA 2VF0A 1FWMA 3H9KA 3GH2X 1F4GA 3N5GA 3V8HA 3BFIA 4GYHA 3HBBA 4GD7A 2VETA 1HW3A 2KCEA 2TDDA 3OB7A 4KPWA 4H1IA 1TDCA 3IHIA 2ONBA 3ED7A 4XSCA 4G6WX 1F4FA 3UM8A 1QQQA 1JUJA 1JTUA 1BQ2A 1JG0A 1TSXA 3C06A 4Q0EA 2RD8B 3CL9A 4IQQA 1NJBA 1BKPA 2G86A 1BKOA 1JMHA 3EJLA 3QGTA 5HS3A 3N5EA 3BHLA 3TMSA 1CI7A 4E5OA 4FGTA 4EINA 3DL6A 1BJGA 3IK1A 4TMSA 3GH0A 3IX6A 1BQ1A 1B5DA 1EVGA 1SYNA 5H38A 3QG2A 3DGAC 1AIQA 3IRMA 3IROA 1EV5A 1FFLA 1QZFA 4EILA 1VZEA 1JMIA 1NJCA 2A9WA 4ISWA 1AXWA 1J3JC 1JU6A
chains in the Genus database with same CATH topology
4KYAA 3I3RA 3UWLA 3IRNA 4XSEA 1TDUA 1NCEA 3IK0A 5BY6A 1LCBA 1NJEA 1THYA 1TJSA 1TSDA 3DL5A 2FTOX 3B5BA 3BHRA 2AAZA 1TVUA 1F4EA 4PSGA 2FTNA 1I00A 2TDMA 1NJAA 3INVA 1AN5A 3EDWX 1TVWA 4ISKA 1BIDA 1J3IC 4EB4A 4KNZA 1B49A 4FOXA 1ZPRA 2RDAA 3BZ0A 1TSNA 1TRGA 1TVVA 3DG8C 3EF9A 1DDUA 5H3AA 1TSLA 4ECKA 4DPDA 4E28A 1NJDA 1HZWA 2FTQA 3BGXA 3BYXA 3K2HA 4O1XD 1AJMA 1TDBA 3JSUA 1SEJA 1DNAA 1TYSA 4O1XA 1F28A 2TSRA 1JUTA 1TDAA 1KZJA 4UP1A 3KGBA 4IRRA 4O1UA 1LCAA 1TSYA 2RD8A 1YPVA 1VZCA 1VZAA 1TSMA 1JTQA 2BBQA 1BO8A 1B02A 4KY4A 1BP6A 3N5EB 5H39A 1BSFA 3C0AA 1LCEA 1BPJA 4FQSA 4FOGA 2G8DA 4Q0DA 2H2QA 3HJ3A 1TISA 1J3KC 2OIPA 4G2OX 5J7WA 1TLCA 4FOAA 3BNZA 5WRNA 4LRRA 1EV8A 1BSPA 5FCTA 4DP3A 1TSVA 4H0UA 3NRRA 4JEFA 4EZ8A 2G89A 4KY8A 2G8AA 1EVFA 1BDUA 1BP0A 3GG5A 3HB8A 1RTSA 2G8XA 4O7UA 1BO7A 1F4DA 3CLBA 3KJRA 3QJ7A 1F4CA 2TSCA 3EBUA 3UWLB 4DPHA 4H0RA 3EAWX 3B9HA 3EGYX 1HW4A 1JMGA 4DQ1A 3IJZA 3UM5A 4F2VA 1VZBA 3EHIX 1TLSA 1VZDA 1F4BA 1KCEA 3KJSA 4GEVA 1B5EA 4IQBA 4XSDA 1AOBA 1HVYA 1KZIA 1TSWA 1TSZA 3UM6A 1JMFA 2VF0A 1FWMA 3H9KA 3GH2X 1F4GA 3N5GA 3V8HA 3BFIA 4GYHA 3HBBA 4GD7A 2VETA 1HW3A 2KCEA 2TDDA 3OB7A 4KPWA 4H1IA 1TDCA 3IHIA 2ONBA 3ED7A 4XSCA 4G6WX 1F4FA 3UM8A 1QQQA 1JUJA 1JTUA 1BQ2A 1JG0A 1TSXA 3C06A 4Q0EA 2RD8B 3CL9A 4IQQA 1NJBA 1BKPA 2G86A 1BKOA 1JMHA 3EJLA 3QGTA 5HS3A 3N5EA 3BHLA 3TMSA 1CI7A 4E5OA 4FGTA 4EINA 3DL6A 1BJGA 3IK1A 4TMSA 3GH0A 3IX6A 1BQ1A 1B5DA 1EVGA 1SYNA 5H38A 3QG2A 3DGAC 1AIQA 3IRMA 3IROA 1EV5A 1FFLA 1QZFA 4EILA 1VZEA 1JMIA 1NJCA 2A9WA 4ISWA 1AXWA 1J3JC 1JU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYA A;  3I3R A;  3UWL A;  3IRN A;  4XSE A;  1TDU A;  1NCE A;  3IK0 A;  5BY6 A;  1LCB A;  1NJE A;  1THY A;  1TJS A;  1TSD A;  3DL5 A;  2FTO X;  3B5B A;  3BHR A;  2AAZ A;  1TVU A;  1F4E A;  4PSG A;  2FTN A;  1I00 A;  2TDM A;  1NJA A;  3INV A;  1AN5 A;  3EDW X;  1TVW A;  4ISK A;  1BID A;  1J3I C;  4EB4 A;  4KNZ A;  1B49 A;  4FOX A;  1ZPR A;  2RDA A;  3BZ0 A;  1TSN A;  1TRG A;  1TVV A;  3DG8 C;  3EF9 A;  1DDU A;  5H3A A;  1TSL A;  4ECK A;  4DPD A;  4E28 A;  1NJD A;  1HZW A;  2FTQ A;  3BGX A;  3BYX A;  3K2H A;  4O1X D;  1AJM A;  1TDB A;  3JSU A;  1SEJ A;  1DNA A;  1TYS A;  4O1X A;  1F28 A;  2TSR A;  1JUT A;  1TDA A;  1KZJ A;  4UP1 A;  3KGB A;  4IRR A;  4O1U A;  1LCA A;  1TSY A;  2RD8 A;  1YPV A;  1VZC A;  1VZA A;  1TSM A;  1JTQ A;  2BBQ A;  1BO8 A;  1B02 A;  4KY4 A;  1BP6 A;  3N5E B;  5H39 A;  1BSF A;  3C0A A;  1LCE A;  1BPJ A;  4FQS A;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  3HJ3 A;  1TIS A;  1J3K C;  2OIP A;  4G2O X;  5J7W A;  1TLC A;  4FOA A;  3BNZ A;  5WRN A;  4LRR A;  1EV8 A;  1BSP A;  5FCT A;  4DP3 A;  1TSV A;  4H0U A;  3NRR A;  4JEF A;  4EZ8 A;  2G89 A;  4KY8 A;  2G8A A;  1EVF A;  1BDU A;  1BP0 A;  3GG5 A;  3HB8 A;  1RTS A;  2G8X A;  4O7U A;  1BO7 A;  1F4D A;  3CLB A;  3KJR A;  3QJ7 A;  1F4C A;  2TSC A;  3EBU A;  3UWL B;  4DPH A;  4H0R A;  3EAW X;  3B9H A;  3EGY X;  1HW4 A;  1JMG A;  4DQ1 A;  3IJZ A;  3UM5 A;  4F2V A;  1VZB A;  3EHI X;  1TLS A;  1VZD A;  1F4B A;  1KCE A;  3KJS A;  4GEV A;  1B5E A;  4IQB A;  4XSD A;  1AOB A;  1HVY A;  1KZI A;  1TSW A;  1TSZ A;  3UM6 A;  1JMF A;  2VF0 A;  1FWM A;  3H9K A;  3GH2 X;  1F4G A;  3N5G A;  3V8H A;  3BFI A;  4GYH A;  3HBB A;  4GD7 A;  2VET A;  1HW3 A;  2KCE A;  2TDD A;  3OB7 A;  4KPW A;  4H1I A;  1TDC A;  3IHI A;  2ONB A;  3ED7 A;  4XSC A;  4G6W X;  1F4F A;  3UM8 A;  1QQQ A;  1JUJ A;  1JTU A;  1BQ2 A;  1JG0 A;  1TSX A;  3C06 A;  4Q0E A;  2RD8 B;  3CL9 A;  4IQQ A;  1NJB A;  1BKP A;  2G86 A;  1BKO A;  1JMH A;  3EJL A;  3QGT A;  5HS3 A;  3N5E A;  3BHL A;  3TMS A;  1CI7 A;  4E5O A;  4FGT A;  4EIN A;  3DL6 A;  1BJG A;  3IK1 A;  4TMS A;  3GH0 A;  3IX6 A;  1BQ1 A;  1B5D A;  1EVG A;  1SYN A;  5H38 A;  3QG2 A;  3DGA C;  1AIQ A;  3IRM A;  3IRO A;  1EV5 A;  1FFL A;  1QZF A;  4EIL A;  1VZE A;  1JMI A;  1NJC A;  2A9W A;  4ISW A;  1AXW A;  1J3J C;  1JU6 A; 
#chains in the Genus database with same CATH topology
 4KYA A;  3I3R A;  3UWL A;  3IRN A;  4XSE A;  1TDU A;  1NCE A;  3IK0 A;  5BY6 A;  1LCB A;  1NJE A;  1THY A;  1TJS A;  1TSD A;  3DL5 A;  2FTO X;  3B5B A;  3BHR A;  2AAZ A;  1TVU A;  1F4E A;  4PSG A;  2FTN A;  1I00 A;  2TDM A;  1NJA A;  3INV A;  1AN5 A;  3EDW X;  1TVW A;  4ISK A;  1BID A;  1J3I C;  4EB4 A;  4KNZ A;  1B49 A;  4FOX A;  1ZPR A;  2RDA A;  3BZ0 A;  1TSN A;  1TRG A;  1TVV A;  3DG8 C;  3EF9 A;  1DDU A;  5H3A A;  1TSL A;  4ECK A;  4DPD A;  4E28 A;  1NJD A;  1HZW A;  2FTQ A;  3BGX A;  3BYX A;  3K2H A;  4O1X D;  1AJM A;  1TDB A;  3JSU A;  1SEJ A;  1DNA A;  1TYS A;  4O1X A;  1F28 A;  2TSR A;  1JUT A;  1TDA A;  1KZJ A;  4UP1 A;  3KGB A;  4IRR A;  4O1U A;  1LCA A;  1TSY A;  2RD8 A;  1YPV A;  1VZC A;  1VZA A;  1TSM A;  1JTQ A;  2BBQ A;  1BO8 A;  1B02 A;  4KY4 A;  1BP6 A;  3N5E B;  5H39 A;  1BSF A;  3C0A A;  1LCE A;  1BPJ A;  4FQS A;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  3HJ3 A;  1TIS A;  1J3K C;  2OIP A;  4G2O X;  5J7W A;  1TLC A;  4FOA A;  3BNZ A;  5WRN A;  4LRR A;  1EV8 A;  1BSP A;  5FCT A;  4DP3 A;  1TSV A;  4H0U A;  3NRR A;  4JEF A;  4EZ8 A;  2G89 A;  4KY8 A;  2G8A A;  1EVF A;  1BDU A;  1BP0 A;  3GG5 A;  3HB8 A;  1RTS A;  2G8X A;  4O7U A;  1BO7 A;  1F4D A;  3CLB A;  3KJR A;  3QJ7 A;  1F4C A;  2TSC A;  3EBU A;  3UWL B;  4DPH A;  4H0R A;  3EAW X;  3B9H A;  3EGY X;  1HW4 A;  1JMG A;  4DQ1 A;  3IJZ A;  3UM5 A;  4F2V A;  1VZB A;  3EHI X;  1TLS A;  1VZD A;  1F4B A;  1KCE A;  3KJS A;  4GEV A;  1B5E A;  4IQB A;  4XSD A;  1AOB A;  1HVY A;  1KZI A;  1TSW A;  1TSZ A;  3UM6 A;  1JMF A;  2VF0 A;  1FWM A;  3H9K A;  3GH2 X;  1F4G A;  3N5G A;  3V8H A;  3BFI A;  4GYH A;  3HBB A;  4GD7 A;  2VET A;  1HW3 A;  2KCE A;  2TDD A;  3OB7 A;  4KPW A;  4H1I A;  1TDC A;  3IHI A;  2ONB A;  3ED7 A;  4XSC A;  4G6W X;  1F4F A;  3UM8 A;  1QQQ A;  1JUJ A;  1JTU A;  1BQ2 A;  1JG0 A;  1TSX A;  3C06 A;  4Q0E A;  2RD8 B;  3CL9 A;  4IQQ A;  1NJB A;  1BKP A;  2G86 A;  1BKO A;  1JMH A;  3EJL A;  3QGT A;  5HS3 A;  3N5E A;  3BHL A;  3TMS A;  1CI7 A;  4E5O A;  4FGT A;  4EIN A;  3DL6 A;  1BJG A;  3IK1 A;  4TMS A;  3GH0 A;  3IX6 A;  1BQ1 A;  1B5D A;  1EVG A;  1SYN A;  5H38 A;  3QG2 A;  3DGA C;  1AIQ A;  3IRM A;  3IRO A;  1EV5 A;  1FFL A;  1QZF A;  4EIL A;  1VZE A;  1JMI A;  1NJC A;  2A9W A;  4ISW A;  1AXW A;  1J3J C;  1JU6 A; 
#chains in the Genus database with same CATH homology
 4KYA A;  3I3R A;  3UWL A;  3IRN A;  4XSE A;  1TDU A;  1NCE A;  3IK0 A;  5BY6 A;  1LCB A;  1NJE A;  1THY A;  1TJS A;  1TSD A;  3DL5 A;  2FTO X;  3B5B A;  3BHR A;  2AAZ A;  1TVU A;  1F4E A;  4PSG A;  2FTN A;  1I00 A;  2TDM A;  1NJA A;  3INV A;  1AN5 A;  3EDW X;  1TVW A;  4ISK A;  1BID A;  1J3I C;  4EB4 A;  4KNZ A;  1B49 A;  4FOX A;  1ZPR A;  2RDA A;  3BZ0 A;  1TSN A;  1TRG A;  1TVV A;  3DG8 C;  3EF9 A;  1DDU A;  5H3A A;  1TSL A;  4ECK A;  4DPD A;  4E28 A;  1NJD A;  1HZW A;  2FTQ A;  3BGX A;  3BYX A;  3K2H A;  4O1X D;  1AJM A;  1TDB A;  3JSU A;  1SEJ A;  1DNA A;  1TYS A;  4O1X A;  1F28 A;  2TSR A;  1JUT A;  1TDA A;  1KZJ A;  4UP1 A;  3KGB A;  4IRR A;  4O1U A;  1LCA A;  1TSY A;  2RD8 A;  1YPV A;  1VZC A;  1VZA A;  1TSM A;  1JTQ A;  2BBQ A;  1BO8 A;  1B02 A;  4KY4 A;  1BP6 A;  3N5E B;  5H39 A;  1BSF A;  3C0A A;  1LCE A;  1BPJ A;  4FQS A;  4FOG A;  2G8D A;  4Q0D A;  2H2Q A;  3HJ3 A;  1TIS A;  1J3K C;  2OIP A;  4G2O X;  5J7W A;  1TLC A;  4FOA A;  3BNZ A;  5WRN A;  4LRR A;  1EV8 A;  1BSP A;  5FCT A;  4DP3 A;  1TSV A;  4H0U A;  3NRR A;  4JEF A;  4EZ8 A;  2G89 A;  4KY8 A;  2G8A A;  1EVF A;  1BDU A;  1BP0 A;  3GG5 A;  3HB8 A;  1RTS A;  2G8X A;  4O7U A;  1BO7 A;  1F4D A;  3CLB A;  3KJR A;  3QJ7 A;  1F4C A;  2TSC A;  3EBU A;  3UWL B;  4DPH A;  4H0R A;  3EAW X;  3B9H A;  3EGY X;  1HW4 A;  1JMG A;  4DQ1 A;  3IJZ A;  3UM5 A;  4F2V A;  1VZB A;  3EHI X;  1TLS A;  1VZD A;  1F4B A;  1KCE A;  3KJS A;  4GEV A;  1B5E A;  4IQB A;  4XSD A;  1AOB A;  1HVY A;  1KZI A;  1TSW A;  1TSZ A;  3UM6 A;  1JMF A;  2VF0 A;  1FWM A;  3H9K A;  3GH2 X;  1F4G A;  3N5G A;  3V8H A;  3BFI A;  4GYH A;  3HBB A;  4GD7 A;  2VET A;  1HW3 A;  2KCE A;  2TDD A;  3OB7 A;  4KPW A;  4H1I A;  1TDC A;  3IHI A;  2ONB A;  3ED7 A;  4XSC A;  4G6W X;  1F4F A;  3UM8 A;  1QQQ A;  1JUJ A;  1JTU A;  1BQ2 A;  1JG0 A;  1TSX A;  3C06 A;  4Q0E A;  2RD8 B;  3CL9 A;  4IQQ A;  1NJB A;  1BKP A;  2G86 A;  1BKO A;  1JMH A;  3EJL A;  3QGT A;  5HS3 A;  3N5E A;  3BHL A;  3TMS A;  1CI7 A;  4E5O A;  4FGT A;  4EIN A;  3DL6 A;  1BJG A;  3IK1 A;  4TMS A;  3GH0 A;  3IX6 A;  1BQ1 A;  1B5D A;  1EVG A;  1SYN A;  5H38 A;  3QG2 A;  3DGA C;  1AIQ A;  3IRM A;  3IRO A;  1EV5 A;  1FFL A;  1QZF A;  4EIL A;  1VZE A;  1JMI A;  1NJC A;  2A9W A;  4ISW A;  1AXW A;  1J3J C;  1JU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...