1NJIT

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njiT00
4W90B 1YHQS 2I38A 1VQNS 2CQDA 4ED5A 2LEAA 4C0OC 1KOOA 2DK2A 3MXHP 1K8AT 2MSTA 2E5HA 2F9DA 3CMAS 2LECA 2VOOA 3MOJB 5DDQC 2EK1A 2MJNA 2M88A 3NS6A 2DITA 3BO2A 2G1DA 2MZTA 2U1AA 2ERRA 1X5SA 1YIJS 1VC6A 1WWHA 2MQMA 3BEGB 3CUNA 2LYVA 2KXNB 4FXWA 2OTLS 2MQPA 3J7YU 3PIOQ 3CC4S 1U1KA 2MQNA 5D77A 5LJ3Y 5GAGU 4CQ1A 4A8XA 1NJIT 3S8SA 1X4HA 2MGZB 2VONA 2NLWA 2RRAA 2CPDA 3P3DA 1A9NB 1X4EA 1H6KX 5GAEU 1U1PA 3MDFA 1OIAA 2U2FA 1VQ5S 3VF0B 1UP1A 3CC2S 2MJUA 2MKIA 2XSFA 4CH0S 2MKSA 1WF0A 2HVZA 2KH9A 3TP2A 2KU7A 3VAFA 4IO9Q 2FC9A 1URNA 3JB9k 3ZZZA 1ZZFA 2E5JA 1OPIA 2HGLA 4M5DB 3UD4P 2PEHA 2KYXA 2M70A 2X1FA 1U6FA 4F26A 1BY9A 2MZSA 3PIPQ 3US5A 2E5IA 1HA1A 4WFNQ 4QU7A 1WHXA 2V94A 3LQVA 1VBYA 2F9JA 2LXIA 2LXUA 2B0GA 1DBDA 4F25A 1WF1A 1YWXA 2WBRA 2OTJS 3R27A 2JRSA 2CQCA 3MUTP 4QQBA 2E5GA 2MZRA 4TU8A 1B7FA 3U1LA 3R1LA 1F9FA 3UCZP 2EVZA 3FEYB 2CQBA 2DNRA 1FJEB 2M8HA 2DGSA 3CCMS 2CPIA 5IM0A 5DDPC 1SJQA 1WG5A 3NS5A 2Q79A 2KXHA 3CCRS 3FEXB 5DM6Q 5D78A 1P27B 3OW2R 2CPYA 2CQ0A 1X4BA 3VAIA 3ZZYA 2MB0B 3UCGA 5DETA 1X4GA 2CQ3A 3U1MA 3TYTA 2XB2D 5DDRC 1H2UX 3THPA 1QVFR 2L08A 1G2EA 2I2YA 1M5KC 2CQHA 2MZJA 1JMTA 4OZ0A 2M0GB 2N3OA 5HL7Q 1VQOS 1N8RT 3IWNC 1WEZA 2RS8A 2MMYA 1P1TA 1K9MT 2G0CA 4C7QA 2DO0A 5GMKa 4U67Q 2CQ4A 2D9OA 2MZ1A 2LKZA 3BS9A 5EN1A 3G9CA 1OWXA 1Q82T 1FXLA 1DHMA 1L3KA 3THTA 4ERDA 2AYGA 3MUMP 2M52A 3UCUP 3Q2SC 2HYIB 1VQ6S 1WELA 1X5TA 4QU6A 2AD9A 2DH7A 1FO1A 4FXVA 5IM0B 3P6YC 1XN9A 2DIVA 1WI6A 2RQ4A 3NNHA 2GHPA 3UD3P 3HHNB 2HGNA 5HO4A 1PGZA 1JJHA 3S7RA 1QVGR 4CIOA 3G8SA 3VALA 2DGOA 1VQ4S 2VODA 3CULA 2EK6A 2CPEA 2MY8A 1R8PA 1UFWA 4TU9A 4TLQA 3I56S 4IOAQ 2JX2A 1FJ7A 3VAMA 2DB1A 1JJ4A 2YWKA 3MURP 4OZ1A 2MQLA 1UAWA 2HGMA 4LIRA 1OO0B 3G4SS 2MHNA 5LXYA 1D9AA 1K73T 2RNEA 2QA4S 5LJ5Y 1SJRA 1YI2S 2DHSA 2O3DA 2KI2A 5BJRA 1VQMS 3B4DA 2CJKA 3LPYA 5LXRA 4PRFA 3CCES 2BOPA 2K8GA 4W92B 2DIUA 2DGTA 1AUDA 3CXCR 3MD1A 3NNCA 2X1BA 2DNYA 2KM8B 1YTYA 2A3JA 3V4MA 1M1KT 3RW7A 2RS2A 2KRBA 1YJ9S 1X4CA 1VQLS 4UY8T 2K3KA 1HD0A 1X4DA 2LA4A 2KVIA 5LSOA 3Q2TC 5FJ4A 2DHGA 1YITS 2FY1A 1A7GE 1Q86T 2OSRA 1WG4A 3SDEB 4C4WA 2DH8A 4WIIA 3SMZA 3G96A 2ADBA 1KD1T 3MI7X 3DLLQ 1HL6A 1W2BR 1KQSR 2X1GA 1U2FA 3H2VE 2ZJQQ 5GVQA 2MKJA 3IRWP 4PKDB 1UW4A 3EGNA 2QFJA 1KC8T 1U1LA 3CTRA 1M5PC 5LSLA 2L41A 2X1AA 2MQQA 2DISA 4RU2A 2QEXS 2LA6A 1X0FA 1VQ9S 2J0QD 1DRZA 2KRRA 2ZJPQ 2RUGA 2KM8C 1WHYA 5IFMA 2CPHA 4P6QA 2G4BA 3CCQS 2KFYA 2J0SD 2CPXA 2DNLA 4V19X 3CF5Q 2CQGA 3EGZA 1H2TZ 1Q81T 4QPTA 2AYBA 2JWNA 4WCEQ 2ZJRQ 2OJ3A 2M2BA 2KG0A 3BO4A 1WI8A 5JVHQ 2XS2A 2M8DB 4PR6A 2M7SA 3VAKA 1O0PA 3CPWR 1WEXA 2KG1A 5H1SV 2DH9A 3CCLS 4IOCQ 5CYJA 1M5OC 1X4FA 1VQKS 2RRBA 2LCWA 2DNZA 3CC7S 2CQPA 2DHAA 2KHCA 2DGQA 2MKKA 1WF2A 4F02A 2MY7A 3J7ZT 3L3CA 1JJ2R 1YJNS 4YOEA 1PO6A 4YB1P 3N9UC 1X5OA 3CCJS 2DNNA 5CA5A 5ITHA 2E44A 1IQTA 3S6EA 2F3JA 5MLCV 2DGXA 3NMRA 2RVJA 2D3OR 3SDEA 4CH1A 2NZ4A 3CMES 4YUDA 3VAGA 2CQ2A 2YH0A 4WFBQ 1FNXH 2DO4A 2KXFA 3D2WA 5DM7Q 1U6BA 4WFAQ 2YTCA 1NU4A 2CPZA 1ZZNA 4IUFA 3UWTA 1FJCA 1WHWA 2DNMA 3I55S 1S72S 2VOPA 2MXYA 3MUVP 1WG1A 1X5PA 1N54B 2PE8A 3UE2A 5CXTA 2DNQA 3B4MA 2SXLA 2N3LA 4ZKAA 3CCSS 1VBXA 1S79A 2MSSA 3H2UB 4Y0FA 4WF9Q 1U1QA 3R1HA 1U1OA 4UQTA 2KN4A 2CPFA 3S01A 2L9WA 2DGUA 3EX7B 3VAHA 2AYEA 3TO8A 5DDOC 3BO3A 1VC5A 5GADU 5GAHU 1U1RA 2BZ2A 2LMIA 1HD1A 2MQOA 2KT5A 2RU3A 3P5TL 2MKHA 2D9PA 1N88A 2DNPA 5JVGQ 2UP1A 2XNRA 1Q7YT 3ULHA 2MYFA 3CCVS 2M4MA 1RK8A 4EGLA 1ZH5A 2DNHA 1CVJA 4Y00A 1WHVA 1QM9A 2J76E 2HZCA 2N7CA 1DZ5A 5IQQA 3NNAA 2JVRA 2GO9A 1U1NA 1VQ7S 2DNOA 1VQ8S 2OIHA 1NO8A 1SJ3P 1X4AA 1FHTA 2DNKA 2FC8A 2J8AA 2MPUA 1M5VC 2MZQA 1YJWS 2OSQA 3DXBA 4J5OA 1SXLA 1SJ4P 1M90T 2N82B 2FPHX 2ADCA 3K0JA 3MD3A 4LMZA 3CD6S 1U1MA 1KOHA 1H2VZ 1N52B 2LQ5A 3P49B 1FT8A 2RQCA 2CQ1A 3RW6A 4WKRA 2DGWA 2CPJA 2CQIA 2JVOA 1VQPS 1WEYA 4LJMA 3G6ES 3G71S 1D8ZA 1R8HA 2FHOB 3HI9A 2DNGA 2XNQA 2AYMA 3VAJA 2RT3A 2MGZA 2YH1A 1VBZA 1WTBA 1VC0A 2MKCA 4TU7A 3SXLA 2DGVA 2XS7A 1SJFA 3CCUS 1RKJA 2XS5A 2M9KA 4BS2A 2YKAA 2LEBA 4Z2XA 2DHXA 3G8TA
chains in the Genus database with same CATH superfamily
2BE2A 3J7A1 2CQDA 2RF2A 2GHVC 3GE9A 4KO0B 3VGVA 1N34J 1KS2A 2FVRA 1K8AT 3DCAA 2ZBIA 3A3OB 5FLXU 3IRXB 1WWHA 2PC6A 4DI6A 3NBPA 2KO1A 1N48A 2HNYA 2YNGB 5LJ3Y 3CEDA 3NAHA 4Q45A 1FEEA 1F2GA 1FX2A 4P2XA 2EBEA 2AJQA 3FBCA 5B0GA 5D3GB 3BYRA 2GNKA 3N0VA 2W24A 4KV8B 1KKHA 1NK9A 1KEKA 5A8KA 4JYAJ 3MMCB 2F9JA 1U2RA 2NYHA 5IWAF 1RABB 4NYOA 4DPOA 5IC4B 1ZETA 4X64F 2CQBA 2FJXA 4NA2A 1UPPA 2UU9F 3NOGA 4DV5J 3PVXA 4DUZJ 3BZQA 1KVJA 3VAIA 3QLHB 3NWGA 3E8OA 3ICLA 3HSGA 1CC7A 4K4VA 3MPVA 1MMNA 4DPUA 4K59A 4R0JA 3GV7B 2GIRA 1L3TA 2B9WA 2R8KA 1VISA 5K14A 3MMBA 2D9OA 3MAHA 4PEOA 1OWXA 2E7WA 2V2ZA 1KNZA 2R7XA 1X5TA 3PX0A 3PRVA 4QIGA 2IAJB 1WUUA 2R7VA 2EFNA 4UOHA 3IMQJ 4F4XA 1HQ2A 4DLGA 2YNIA 3UN3A 2Z8QA 3AA8A 2F65A 4A8FA 2A1BA 3GCWP 1V3SA 2BQ3A 2H3EB 4CLWA 4HDGA 5IT9U 4NLYA 4IFYB 2B6AB 5A8RB 3BPDA 2B5JB 1TL5A 2OMOA 2WRMA 3ILOA 1YTYA 3JXOA 2EI5A 3NXZA 5HMZA 3TAMB 1LXNA 2GX8A 1YRUA 1CLFA 5FJ4A 1Y4ZB 1R89A 4I0WA 3M9OB 1U2FA 2MKJA 1X31C 2QFJA 2VQFJ 3MCMA 2WVCA 2MQQA 1X0FA 2H51B 4KIAA 4NLWA 2AV5A 4USUA 1EETB 3AH6A 4ZLLA 2UUCJ 3RRGA 3UD5A 2W7PA 5HANA 3BKUA 4RUBA 2C42A 3AXMA 2V69A 3RBZA 4C8OA 2CJ9A 2LU2A 2XSJA 4I7FB 3CIZA 2QC3A 1M5HA 2YQ3A 3UR0A 1HNZJ 4AUKA 4LBHA 2VBYA 3GB0A 4DF4A 3KLGA 1JKHA 4DUTA 3S6EA 4A8MP 2DGXA 2KFNA 4YUDA 5DZ7A 1FNXH 2L48A 2CYYA 3RJMB 5FDLB 2JEFA 3Q23A 2FJVA 2YTCA 2MKYA 1Y5IB 4K4TA 3GJSB 2AEMA 4RBTA 2HHUA 2HHHF 1N54B 2PE8A 3JTPA 1FNOA 1T94A 3I5BA 4H4KC 4ZKAA 2GAGC 4O0IA 1UPMB 4CI0B 1NK5A 5KFTA 1B0VA 3TO8A 3QFWA 1TKXA 3D6HB 2BZ2A 1SUQA 2P2CB 2MQOA 3J7Z5 3EPIA 4XDDA 4I2QB 2MYFA 3DU6A 3M9MB 4DR6J 4PPDA 4RW6B 5KFWA 4AT1B 1OYDA 1X4AA 2FLNA 1FHTA 4GKKF 4JI4F 2I5JB 4UF4A 3VQTA 4QWAA 1KTVA 3ISNC 1LXJA 3M2VB 4WYWA 3H0PA 2OGUA 4GVBA 4OYXA 3BSNA 1VQPS 2A0FB 4LBIA 4EEYA 1UVMA 2JZ5A 4JI2F 3BGFA 3VAJA 3HJVA 3WC0A 3M30A 1T05A 4M5NA 5KT7A 2YQ1A 5HVFA 2YQ0A 5EUHA 3A12A 4DOZA 4KGXB 1SV5A 1TTHB 3I4HX 4EBEA 5DDQC 4DR1F 1OY9A 1RCXB 1HQUA 1VMBA 2IYGA 3LAMA 3JAMY 1S77D 1D9DA 1VC6A 2P9CA 4NI2B 4FXWA 1ZM2A 2FZCB 1HBOA 4ECZA 3C6UB 1GX5A 5LOQA 4K5SA 4TXSA 3QGHA 1IKYB 3C8YA 3W63A 2F4VJ 4KGKA 4O44B 2KU7A 1ZZFA 3FBEA 2W25A 3OQ2A 2X1FA 2KKHA 1RWWB 1BY9A 1LWEA 3LAKA 4C48A 4X66F 4DG1A 3H40A 4RUHA 4J9MA 1S1UA 3HMJG 1AFIA 4F25A 3I5AA 2BANA 1HQEA 3UCZP 1TVRA 5E0OA 4IFVB 1VQSA 1HNIA 3NS5A 4LR8A 1S0NA 3FEXB 5D78A 4CO3A 2CPYA 1Q5YA 3QZ7A 1UEUA 1DTTB 5BYRA 1LW0B 2Y1LB 5DETA 3QRRA 5J2PB 1FEHA 3MEGA 4ICLA 1G2EA 2R7SA 4NLUA 2MZJA 1O5JA 2H54B 2EC2A 2N3OA 1F3FA 1WEZA 4C7QA 3MGJA 4DFJA 4ILLA 3KNAA 1TP7A 1KQGB 1HBUB 2XG8A 4G1QA 4KV8A 4QIEA 2R7QA 3I31A 3FSXA 1N33J 2POKA 4QU6A 2EC0A 4HACA 1XN9A 2QRRA 1U8SA 3HHNB 5EDWA 5BXIA 2LEPA 1HNWF 1TL7B 4EYIB 4J9RA 8AT1B 3ET6B 1UFWA 2VIHA 3I56S 3QWPA 3LTOA 2E7VA 4OZ1A 4GKJJ 1UAWA 3QLHA 3UI3A 3M1VA 4IR9A 1EARA 5LMNF 1TAQA 1HI0P 2C2NA 2JNJA 4Z7YA 3UNYA 4ZIVA 2BOAA 4M8LA 3GPAA 2XLKA 4C4WA 2DH8A 4C8NA 5I3QA 4KYZA 4DSEA 4NCAA 1UVIA 4M94A 5K9FA 4AXIA 4DR4F 4DU8A 1GMWD 3MOZA 3KK3B 3P4UB 2HHPA 4I1TA 2D74B 4ZP9A 4Q43A 3J81Y 3CJQA 2RUGA 5ETPA 3HHLB 2KFYA 1WSVA 2FLPA 3K59A 1FD2A 1VR6A 2Q66A 4ZJOA 3I6PA 2JWNA 1C1BB 4LFBJ 3O6QA 3GLJA 1H3DA 4EZ6A 4I68A 3GR0A 2Y1JA 4M95A 3VAKA 1CJKA 3MEDB 4RNFA 3W61A 5SZTA 5H1SV 3NS7B 2XMJA 4WK1A 4DR7J 1M5OC 2RQKA 5KFBA 4NCBA 4PG4A 3V4IA 3SCKE 5AXLA 4LSNB 3CMQA 1O51A 1IKXA 4QOTA 3GTYX 5DRKA 4HLBA 4KH1B 1TL3B 3HDSA 2VBWA 2KXFA 1N5SA 4LF9J 3DGPA 3EZOA 3R9LA 4JUZA 1TKTB 2CPZA 3NY0A 5HMYA 3PYDA 3PYEA 2K1RB 4ER8A 1FJCA 5DQIA 1SIWB 2DY9A 1JLFB 2WONB 1X5PA 5KG5A 5KFXA 4F0MA 2IM1A 3LW5C 2W8LA 3I0SA 2DCUB 8ATCB 4ED1A 1IBMJ 2O67A 3E2EA 1RT6A 2L9WA 2DGUA 4OYIA 1NB7A 4NXMF 4UW2A 4X65J 5GADU 3POTB 4AQYF 2GA7A 2WB4A 3MWBA 2E1PA 4WFYA 4QW9A 4DV7J 4EGLA 2J9EA 2JSXA 2DT9A 2ZD1B 4LF1A 3KLFB 2HWTA 5C24A 3AJ2A 3TJ8A 1FWLA 1SXLA 4ITSA 4JOUA 3W7BA 1HFEL 2ADCA 2JLEA 3KLHA 2Y8WA 5K5MA 4ECYA 2CAJA 1X9MA 4WKRA 2CPJA 2VPZB 2JVOA 4LJMA 4ZJQA 4ZP7A 1RQ0A 5DG7A 1R8HA 3CDAA 2LDYA 3NG8A 2UVWA 1CJTA 5HP1A 1T02A 5CYQB 1E6YA 2YKAA 2ZUAA 2DHXA 1N5YB 3C3LA 2BYCA 1RHMB 2V8DA 2ZBPA 3DRRB 2OP5A 1F5BA 2HS0A 5JJBA 2AJ2A 2MSTA 4TQSA 4H4MB 2IJFA 3OBIA 3L09A 4ZVEA 1EKSA 1IR2A 1R8AA 4KJIA 4TQRA 2VFSA 3T41A 4Q7AA 3GIIA 4CZCA 2PSZA 4LSLA 4TY9A 4A8XA 5F8MA 4HH0A 3ZO7A 3AD9C 1QTNB 3H42A 3RUBL 5KFFA 2MGZB 2WW4A 1X4EA 3W5XA 2WVDA 2D69A 3CC2S 5IV4A 2KH9A 4K5RA 3TP2A 1OPIA 4Y28C 2KYXA 4JI8J 1RTHA 2DR5A 4ZJLA 1LOUA 4PG6A 2ZH4A 2RHQB 3J80U 1HA1A 2NXCA 3WIUA 1ZA2B 3FFIB 3ITHB 1BQXA 3QFHA 4M5MA 4QQBA 3DLGA 2QLJB 1F9FA 1UA0A 3L7PA 4PG7A 3SSQA 3BKFA 4LF4F 4DV4J 3OW2R 3DU5A 1BUXA 1NUEA 2VA2A 3C6TB 2BABA 4WFXA 4WE1A 2EKYA 3IA0A 1XMOJ 1BWVA 2FZKB 1N8RT 4MKBA 1MROB 5B0CA 3QQCD 2XYPB 1IBLJ 2O01C 3KLIA 3MUMP 2M52A 4K4ZA 3UCUP 4ETZA 1VQ6S 2W2OP 3M8ZA 3AJ1A 3LP1B 3P6YC 5EGYA 3MEEA 3NGTA 4LFCF 3UVJA 5LL6d 4MK7A 2JFKA 3K8WA 3GSIA 7FDRA 4DR2F 1N32J 3Q8YA 5L9XA 2FJBB 4ZIWA 3KYLA 3RR7A 3K2YA 1DTTA 2XMVA 4A46A 1NXIA 2DRDA 3AD7C 4RNOA 5IOLA 1SKWA 3QWUA 4EO6A 5G0RB 4K8RA 1WDDA 4Y2IA 2K3KA 4DSLA 3ZZTA 2GVZB 2BE9B 4OX9J 4CDIA 5DQGA 1KQSR 1MU2B 3SV4A 3EGNA 5KFAA 3CTRA 2ZDPA 2HNDB 2XLJA 5F0UA 3JYTB 2YNFB 3UPFA 3D0GE 4WTOB 2DR6A 5EX3A 1HNVA 2JEIA 5AJ3J 1H7WA 1N36J 2FGOA 2GJ2A 4HR2A 3F41A 2J7WA 2M2BA 1PG5B 1S57A 3CO0P 2M8DB 4K2XA 2HHXA 4P9SA 1S1WB 2KG1A 3OLBA 3D28A 1S99A 2YWHA 2VG5A 3QBCA 3W9JA 2V4JA 3LWLA 4F02A 2RAQA 3ZZRA 2DRBA 1FVQA 2O5DA 4YB1P 3DM2A 5KFEA 1EIYB 5GAGI 1CJVB 2Q6BA 1AB8A 2VG7B 3R8YA 1FTCA 1RHJB 1N5VA 2GGPB 1CPZA 3TZXA 1HI8A 1J5EJ 2CRLA 3R7BB 1Q16B 1C1BA 3BPSP 4B3RF 2EEYA 1VC5A 3OFEA 4MTPA 3RBEA 4RX6A 3PACA 3KOAA 2FIUA 3CCVS 3G87A 1WHVA 2JVRA 4LF6J 5F8IA 1XR6A 4CLLA 4FF1A 2YKMA 2OSQA 1KLMB 1HI1A 3CD6S 2K1RA 4Z37A 1FRXA 4F2SA 4M5IA 5ETNA 2BACA 5F0WA 2WONA 2EFVA 4B9UA 2DR9A 3BBFA 2JL9A 1VRUB 1RWPB 1F0XA 1T0TV 3Q86A 1VC0A 1FWPA 3SXLA 1SJFA 4K0KF 2ZM6J 1KLNA 4DCOB 3KLEA 1K0VA 4FPRA 3LA0A 3IGNA 2VG6B 4WKYA 4RW4A 2DK2A 2YKPA 5IQ6A 3KJQB 1WKKA 5IWAJ 2E1RA 5H9EK 2MZTA 3GG1A 5L38A 3HT3A 4X64J 3CIMA 3SZ2A 2V5HG 1H38A 3I87A 1WC0A 4F4WA 1NSQA 2FLOA 2ASDA 1G3OA 1ELOA 3Q8SB 2RH3A 4P2MA 2CPDA 3KMQA 3MDFA 2U2FA 3SQGA 1URNA 3N6NA 2FC9A 3DXSX 4KY3A 3BN7A 1U6FA 3IG1B 1N5QA 3PIPQ 4C98A 4WFNQ 1WHXA 3D1OA 3V6HA 3DOKA 4IO1A 3QT7A 2VQEJ 3G82B 2JRSA 2E5GA 4K4XA 3R1LA 2YWEA 2JLFA 1FJEB 4B3MJ 4QWEA 2HFSA 1KQFB 4H4KA 2CQ0A 1IWGA 2DEJA 4GMKA 1IQZA 1M5KC 4QZVB 1PKUA 4NLRA 1VQOS 1QTMA 3ZTRA 2R2UA 4WP8A 2RKIA 5J1EA 4ZVFA 2ZH2A 2A18A 3G9CA 1ZOTA 4MIWA 3MPUB 1L3UA 2HAFA 1REVA 2HYIB 1EP4A 3OTBA 4HT5A 1RT4B 1VDHA 4CWBA 1SC1B 2HGNA 2ZOGA 5CQGA 3I32A 1RYSA 2EFQA 2JEGA 3WQPA 2PI4A 4CIOA 4FDFA 3CULA 3K89A 4IOAQ 4ANEA 4TY8B 4DL0C 2P6TA 2RJZA 2G13A 4FS1A 3DOMA 4ZMMA 3G4SS 2RRNA 2DCLA 1GFWB 2QA1A 3VZIA 2XI3A 4BC7A 1VQMS 4PRFA 3CCES 2BOPA 4CLPA 5J2MA 1PJ7A 2R2RA 3AB2B 4OYPA 4ED7A 1S1VB 4FYYB 1D1UA 1MROA 2O66A 3MR7A 3HFZB 3W2WB 3CE8A 3OVSA 2V9WA 3D66A 3TUZC 1CS4A 3FVYA 5KFRA 3KHHA 1RLCL 4ZOSA 4M5LA 3M9NB 2VD3A 4JV2A 2OPPB 4ECVA 1FKAF 4ECRA 1AZSA 2OPSB 4OX7A 1VCTA 1XMBA 1U49A 5L1KA 2JH3A 4QPTA 4DCJB 2HHHJ 2V50A 1VOMA 2J0WA 3I9ZA 3T1YJ 2E5LF 4ZLJA 2ROGA 2ZUGA 1VHIA 4J9NA 2ZC3A 2RDIA 2JLGA 2RRBA 2EKNA 4I6YA 2CQPA 3QIDA 3DN9A 5D4OA 1XC9A 1PAUB 3M4XA 2QGFB 5M2PA 3IBWA 5F9NA 5FD1A 3THVA 2UUWA 1IR0A 2F3JA 4X4QA 5A0YA 1NCLA 3MM9A 2FZGB 3W5YA 5CZVA 1QUPA 1TKDA 4HT7A 1OY8A 1ZZNA 4N56A 1NRKA 4DPXA 5K8OA 3B4MA 4B9MA 3ZNUA 1TL1B 3V81B 4DV3F 4RUCA 1CQMA 1VBXA 2WVEA 1XIQA 3AOAA 5E2QA 4DL4A 3BR9A 4OI4A 2JC0A 2ZITA 3SSSA 1JLCA 5AXMA 3QNWB 1H7XA 4DPTA 4WWSA 1RT2A 1R31A 1BQMB 2HLUA 5DS7A 1DZ5A 1N34F 4DV2F 1JNRB 3NGUA 1SPBP 3Q8QB 3MFIA 3CT9A 4DR1J 4JI3J 1TELA 1NBEB 4YB5A 4FF2A 3KTQA 2YY3A 4CLYA 2AX1A 2VC0A 2ABYA 5CCMA 4C3KA 1YZ6A 2M5YA 3RGIA 2NPIA 4ALZA 1UJ5A 1Q79A 4MKVA 1QE1B 1RAIB 3D1HA 2I38A 3VZHA 4C0OC 2VFVA 3I5CA 4LRCA 4X66J 2B43A 2F9DA 2EK1A 1RHKB 2Q1LA 3K5NA 3CJKA 1SH2A 5HLFA 1U7LA 3BBBA 3CUNA 2R8GA 4DUZF 2AU0A 4HEA9 3QJLA 2CDRB 1F3VA 4KKOB 3CC4S 5EX0A 1TK8A 3D3BJ 1KBRA 2KB2A 1GNKA 2AIRB 3TAPA 1X0PA 4LIWA 3L95X 4FNHA 2V67A 2HGLA 2AJ0A 2F5GA 4ZN1A 2R3VA 3K8VA 1CC8A 3OXLA 1FJGF 2BR0A 2VG6A 4IH5A 3CDEA 2LQ9A 3Q8UA 1V5VA 4YR0A 2XO6A 1C1CB 4LRFA 1S6QA 2M8HA 2ZHBA 3X1LB 4P7TA 4E0DA 4KHRA 3A3PB 3C66A 2W2PP 3C14B 1QY7A 4KRWA 2VASA 5T7LB 4CO2A 1K0TA 2VL1A 1JMTA 1PCAA 2X7IA 3DOLB 3R5JB 4DV0J 2ASLA 4HVZA 5A8WB 2G2ZA 5LMNJ 1IJFB 2FY8A 3QIPA 1CULA 4NA1A 5FIIA 1P9YA 2QT7A 2DH7A 1RSCA 1FO1A 4I2PA 5IM0B 3DLHA 1VRQC 4OZNA 2KZMA 4OYAA 4CYUB 4ZLPA 2VQFF 4RBUA 3ZTPA 5HO4A 1AT1B 3TR5A 1VI7A 4K7QA 1DTQB 4PAAA 2FDNA 1R8PA 4TU9A 2ASJA 2UUCF 2I8EA 4DSKA 3DRSB 4NEYA 2HGMA 4MYTA 1OO0B 1YJ7A 2YX1A 4CO5A 2AZ3A 3EICA 2APOA 1Y3JA 6AT1B 4JB8B 1TMJA 4K4YA 2DIUA 1KFSA 4F50A 2UUBF 1YJ9S 4B3OB 4MYUA 3MR5A 2KVIA 5K8MA 2QJ3A 1Q86T 3MI7X 1W2BR 1BQNA 5KT2A 1TUWA 5J2NB 3SEOA 2D1CA 1U1LA 5LSLA 1XK8A 3BKTA 2GW8A 1V5IB 3PX4A 4Y3CA 2CQGA 4LRBA 1LKZA 3G6VA 3A8EA 4O4GA 4EUVA 1KR4A 3MCOA 2RSQA 2GJFA 2XS2A 2OAUA 4PR6A 2M7SA 4RL1A 4MAKA 5HQMA 1AW0A 2LCWA 3CC7S 3LO3A 2DHAA 5KFOA 1ICEB 2AP6A 2OD4A 1OSCA 4ATNA 3ENAA 2P9EA 1HR0J 2NZCA 3NMRA 3JQJA 2D3OR 2BW7A 3QZ8A 2C2ZB 5KFPA 2WCXA 3CCWA 1XBWA 5HBMA 4O3OA 2DKOB 4RW7B 2XGQA 2QMXA 3HKWA 1NSKL 1DFDA 2HFVA 1RAAB 4PABA 2YPZA 4KPCA 4FKYA 3MUVP 2HEKA 2W9BB 3CDBA 1RTIA 3CJ3A 2B9XA 2L9NA 4WF9Q 1U1QA 1T9VA 4N47A 2KN4A 1HNXJ 1J5OB 1Y0HA 3RYLA 2JFDA 2F8EX 5I4MA 2WVFA 3GILA 4AYBD 4DS4A 3A4TA 4ZVHA 4ID5A 3MTJA 2XNRA 2H5JB 3L4BC 4WZMA 2HQFA 4ZK7M 2W7OA 2VFTA 3DLBA 3K7RA 3EYZA 1VQ8S 2OIHA 1SJ3P 5J2QB 2COLA 3DLKA 1VJWA 1AXQA 5F3ZA 3W62A 3T1HJ 1JWWA 1T11A 4HI1A 2BM1A 2IVFB 3MECA 1C4CA 2DGWA 2LLZA 3HO1A 4Q8EA 1YRXA 2NQPA 1GX6A 1TL1A 3P96A 1NSAA 2F4VF 4OHYA 3NCPA 4X2BA 2W9CA 2A6OA 2N4DA 5THWA 3R97A 4Q5VA 3W3SA 3PX6A 2DGVA 1LK5A 3CCUS 1RKJA 1R6YA 2XMKA 5SUHA 3QJJA 2Z2ZA 3GG0A 3H20A 1Q95G 3PHEA 4NA3A 3AAWB 4OYOA 4I6WA 2V68A 3NOCA 1RT3A 2IA0A 1NPKA 1TMMA 1YKWA 3R6GB 1CJUB 2D41A 1U0HA 2U1AA 4M5HA 1NM2A 5CYMB 1GTHA 1HHSA 2K06A 5EHHA 4CLKA 4IQXA 1RT1B 3PO5A 4HL9A 5HSPA 4EYHB 2FHJD 1HYSB 1HPZB 1H73A 2PGCA 5GAEU 4OL8A 3DMJB 3FDSA 3VF0B 2UUTA 2XSFA 3TZYA 5DLGA 1UWBB 4OYMA 1P8GA 4QPXA 1NJZA 2BQUA 4J9QA 3F0NA 1FKOB 2UXDJ 2J5AA 5KG7A 4F26A 2IBOA 4U95A 4A48A 3W65A 2E5IA 4LR7A 4QU7A 3HVTA 1VBYA 3OR2B 1N33F 3BGRA 1YWXA 4OHVA 4P10A 3TJ9A 1O6XA 3KLVA 5L9NA 4CM0A 4DSIA 4KHPJ 2LU1A 1NNDA 5KT5A 4WXWA 4L72B 2ILZA 2HRTA 2VPYB 2XULA 4GKJF 1X4GA 4RW8A 4OHWA 3MM5A 4GO7X 4M1KA 4F8RA 1I3OB 2K7KA 1IKWA 5C25A 3ETOA 1GEHA 3DRPB 4U67Q 1QUVA 2WOMA 1F5CA 3QPIA 1WC5A 2B7BB 4L76A 2CZ4A 4AL7A 1Y11A 1WORA 5ETTA 1UFKA 2RQ4A 3NNHA 3C16B 4L6V3 1RT5B 2HQIA 1R0CB 4U6PA 2JDJA 1ZAXA 4J9KA 2OO4A 3KDOA 2P8IA 4DJBA 2IVMA 4OI0A 2OPQB 1Q8BA 4U7UK 4JI7J 4TLQA 4F04B 4G3IA 2XZWA 4J9LA 4ES3A 4LIRA 5KT6A 4PXDA 2Z58B 4LFBF 3OJUA 3H8YA 2MHNA 1SJRA 3GFYA 3JSYA 1FRMA 2KI2A 1YBAA 3OHAA 1RACB 2IA6A 1YLXA 3PJXA 3MMAB 4QR0A 3FNNA 1RP5A 3OL9A 4WIQA 2QTWA 3QJPA 3M7VA 4OLOA 1YITS 1YG0A 4YB7A 1WG4A 5ETQA 1T3OA 4O3SA 4TNOA 3W1YC 1Y9OA 2CDQA 4LF9F 4PWDB 4Q8FA 4WU3A 1NK4A 3IO1A 3GIRA 2CPHA 3T6JA 2GFFA 4EBCA 4Y2MA 2ZWPA 2WSEC 4KC5A 4LR9A 2ALYB 2BE7D 4Y6IA 4F3OA 4BCAA 4P73A 2OKQA 1IBMF 4QW8A 1EQ0A 4B3RJ 4IOCQ 2E9ZA 4X65F 4JV1A 2YBVA 4B9VA 5D4LA 4PUOB 3Q8RB 5AE2A 2YKNB 3WC2A 3CCJS 2GQQA 2FJEB 4DV7F 5ITHA 4RO0A 4G6VB 3RBDA 2OELA 3C15A 3K57A 4DL3A 5DM7Q 3CJ4A 3CNQP 3MR2A 2DY1A 3E01B 4N76A 4QIVA 2MXYA 2KFZA 2EBGA 2XGPA 4NLPA 1VQYA 2QX0A 4WBFA 1ZS6A 3HX9A 2CPFA 5F3TA 5DGBA 4PXBA 1BC6A 2Y1IA 3DLEA 2FLLA 5GAHU 1LW2B 2DXFA 2KT5A 4PZVA 1C0TA 3KUHA 2M4MA 4F0HA 5F9LA 3GYNA 2HQCA 4QWCA 4R0EA 1KDNA 5KFNA 2BXJA 3VGUA 1JLAA 2MPUA 4RW7A 3DXBA 1RT7A 3V6JA 3ZTSA 4CTAB 4P75A 2I1RA 4DXLA 2J7KA 2W9BA 3A8JA 5IT4A 3G71S 2V0NA 2Y8YA 1UFLA 1B99A 1G6BA 1J5OA 4TU7A 1F1BB 4JI8F 2F40A 4MH8A 3QO9B 2OPRA 3PTWA 1H74A 1NMEB 3JAMU 2W01A 3EVMA 3CMAS 4EBDA 1EAYC 2BDPA 5DO2A 1JLGA 3V6KA 2MJNA 1QSYA 3BM7A 4EWTA 5J1NA 4CO0A 2C2DA 5KFCA 2G1DA 2ERRA 1RBOB 1LFWA 2MQMA 4DV4F 3PR5B 3X3UA 1Y7PA 2Z2YB 2OEKA 1QSSA 4IRKA 2ZDOA 2ROPA 1XMOF 3MEKA 3FJ2A 4FNIA 4MK8A 4R5PA 4R25A 5LMUJ 4DSFA 3OR1B 3UQSA 4NCGA 3PEJA 3KHGA 2GVDA 4USHA 1IBLF 1NZ8A 4Z7CA 4QR1A 3AY0A 3TX8A 2H65B 3MPDA 1Q1KA 2GS8A 3O5TB 4Y2KA 2FB0A 2GMJA 3P45B 1S9EA 4CT8A 1EKRA 1LWCA 1MN7A 2CWKA 1N32F 4IG0A 2ZH8A 1FRIA 4ZPCA 1MMDA 5K20B 1R0AB 1FD8A 2QMWA 3THPA 1HIYA 1PSDA 2CQHA 2FHJA 3WX4A 2UZAA 5C2GA 4DCPB 2IBKA 1JIHA 1DLOB 1KTQA 1ZPWX 2J9DA 2CQ4A 1S0VA 5BYSA 5I42A 2K2PA 2LKZA 2B9EA 6FD1A 1JLEB 4C11A 3LP2B 2CJAA 4O3QA 5I3PA 4U9RA 4OX9F 2LDIA 4DPYA 1S0OA 4BLGA 4JV5J 3VHQA 1YBTA 2ZZTA 3AFGA 2AX0A 4OX8A 2VODA 1VS3A 3FC9A 2CPEA 2MY8A 2HS3A 3M32B 1QJHA 1NK7A 1ZPVA 2DB1A 4DDFA 3MAAB 2MLZA 1RTJB 3MM8A 5AJ3F 5E3CA 4C8LA 2VC1A 1N36F 4O3RA 1YRTA 2V8PA 3RTVA 3NGDA 1K73T 3MM7A 2QA4S 2J6TA 5M2UA 2CVIA 1QAIA 1S76D 1VRTA 5DJBA 3M2UB 2DGTA 2KYZA 2E5LJ 2OH2A 3D4JA 5B09A 3LUYA 2A3JA 1Q7LB 2KRBA 2X51A 2XY5A 1IR1A 9RUBA 1FK9A 3MF5A 5LSOA 2DHGA 3JQKA 3PRDA 3J81U 4LF5J 2ZZNA 1KD1T 2GZOA 3Q22A 4USMA 4H4OB 2GQCA 2MLYA 4GC6A 3TEGA 3I96A 1LWXA 3M8WA 2LA6A 1MNEA 1LFPA 2ZJPQ 1RJJA 5IFMA 3ZZOA 2ZOMA 1ZAWA 4DQPA 1J5EF 1S1TA 5C42B 1S1XB 3BO4A 3UNGC 1E6VA 3QT8A 2H5EA 1WEXA 3M8QB 5CYJA 2VZ9A 3QATA 2BKNA 1X4FA 4IG3B 2YWFA 4RJVA 1TV6A 4X4OA 3NRBA 3PW5A 3J7ZT 3L3CA 3ZZ0A 2IJNA 3CWJA 3BGUA 3D5MA 1C0UA 4LF6F 3ADAC 3PXGa 4TKTA 2ZOFA 3CMES 2DVIA 2CQ2A 4NX9A 4DV2J 4WFBQ 3W8PA 2FVQA 4MKYA 4WFAQ 2VUGA 3CD7A 1N6QA 1HBMB 3OD2A 1LNQA 5CXTA 3FEZA 2N3LA 3TA2A 3CCSS 4OV6A 1PAEX 3PYFA 4QYZK 3R1HA 2YNHA 1JLQA 3S01A 4DL6A 4J9SA 1T9XA 3VAHA 1IKVB 1FNMA 2R8HA 2F8MA 3S1TA 3A3NB 2ZM6F 5CABA 1HD1A 2HBQB 4F2RA 2R7OA 3C2PA 2PI5A 2RIJA 2J76E 3HVAA 4NL5A 2DNOA 1V3ZA 4LUBA 2D7SA 4PG5A 2B8PA 3N5FA 4M5GA 1UL3A 1UA1A 2CG8A 4LMZA 2HHWA 4NLVA 1H2VZ 4OIXA 2LQ5A 5EWGA 3F56A 1SJ1A 1D8ZA 1T9WA 1PILA 2RT3A 2PN6A 6FDRA 4DX6A 2QLBB 4R8UA 2XS7A 3DYAA 4X4TA 1S6OA 4USTA 2AQ4A 3GP9A 4LSZB 5CD4A 3FCVA 3OSNA 3PKMA 2LEAA 1TK0A 2VQEF 1KOOA 1X9SA 3TWZA 1NK0A 4ZPAA 1RWUA 2QZ8A 1D0EA 1QLNA 1NDCA 3TA0A 3FGVA 1HBNB 1FJGJ 3N4WA 4B3MF 3TW0A 1U24A 3AOBA 1YIJS 3CJTA 1U26A 3W66A 2IC3B 3OHBA 3HK2A 3MPYA 4P2SA 1M1HA 2MQNA 4USKA 1RISA 3OUYA 5B0FA 4RBVA 4ZCIA 3GFXA 2P6SA 4IDKB 2MKIA 2HQGA 3I0RA 2HVZA 3VAFA 1RU2A 3MCNA 4RW9A 1I1GA 2XZDB 1REGX 3MZIA 4PQUA 1DQ9A 2Z30B 2HNZB 4Y2CA 2OTJS 1Y00A 3W2VA 1HWUA 3EJMA 4TU8A 1FTRA 5A6PA 5KOXA 5KFVA 3BSCA 3HKZD 1FKPB 4P74A 1KVKA 4X4RA 1QD1A 1LWFB 4MFBA 4HHHA 4JI0J 4YHHJ 5HL7Q 3KJVB 4Q0BA 1VHFA 4DL2A 1ZAVA 2YX7A 4C8YA 2LP4A 5EN1A 2HAIA 1UEVA 1FXLA 4NLXA 2VHGA 4FF4A 2UUBJ 4X4VA 1ZBTA 3UN5A 1T03A 2BV3A 5D6GA 2Q3PA 1WI6A 1LQ9A 1MWZA 2YPYA 3T6BA 1SL0A 4C0HA 1JJHA 4ZHRA 3IS9A 1S4FA 1RWOB 3QT6A 2H1YA 3DI6A 3VAMA 1AUSL 4KBIA 3EDQB 4ZVQB 2K7JA 2BJ7A 4ED6A 3T1YF 4URGA 2HIQA 5LXRA 2PFDA 4J7CA 3M2RA 1X4CA 1OY6A 1YZ7A 2CZVC 1X4DA 2WVBA 2Y9HA 3IAM9 4UT4A 4CM2A 4CH7A 2FHMA 2X1GA 4PKDB 4I56A 1UW4A 3HSJA 1D8YA 2KRRA 3EGWB 1FDBA 3HLUA 4DWIA 2G4BA 2CFXA 2ROEA 4XO0A 4OFZA 4V19X 1S6PB 4P7VA 4ES2A 4DL7A 4WCEQ 2LFVA 3F73A 2W2NP 4YR3A 2NREA 1SC4B 3CJRA 4KGVB 3H98A 4DN9A 3M8PB 4DL5A 3CCLS 3NWRA 5KFHA 4DLEA 4URQU 3SV3A 1YJNS 4ECQA 2BMBA 1MLAA 5MAOA 5KFLA 1XTZA 4I69A 2ZE2A 4D3GA 1FRHA 4NWBA 5J1PA 4ELTA 2CWXA 4H4OA 1NLKL 3H59A 4JI3F 1B3TA 2B9YA 3UWTA 4U7UD 4ZVGA 3BGLA 1TUVA 1MWQA 4DSJA 4FZVA 3OLAA 1NDKA 1HARA 4Y0FA 3Q89A 2E1MC 3BGOP 2XWXA 3BO3A 2AGOA 3LGNA 1YDLA 1Q8KA 3VGSA 2Q43A 4FKXA 4OJHA 2D9PA 2EFPA 2R8IA 1TKZA 1JK9B 3QMQA 2P9GA 5B7WA 1Q8IA 1VQ7S 3OL6A 2BJ3A 4KO0A 2J0XA 2FC8A 5DQHA 4Q2MA 4USVA 1M90T 1WNEA 3BREA 4RU9A 1V6HA 2ZVSA 1DY3A 1KOHA 3IRXA 2HIYA 1U47A 3N6MA 1UZHA 2CQ1A 1RDRA 5IZHA 3ETMA 1KHWA 4RLEA 4ILRA 2YNGA 4FXDA 2VA3A 3BQ2A 2DEIA 1RLDA 1RXOB 4QCLA 1IN0A 2FGCA 2R2TA 5D3GA 2VJVA 1RKIA 2XTJP 4NLQA 4KFBB 4CT9A 4BS2A 3VR1A 2PA8D 1DAXA 3G8TA 4W90B 5HVHA 3OXGA 2HVHA 4DHVA 1FVSA 1NB2A 2CJXB 5GAEI 1R3NA 2E5HA 2ZEJA 2LECA 1JLBB 2VOOA 3MMCA 3GU0A 3MM6B 3NS6A 1UWAA 1WC6A 4OHXA 4M63A 2LYVA 7FD1A 2MLXA 3KK2B 2OTLS 2AZ1A 1U1KA 3VGTA 1RTDB 1Q78A 5D77A 1T9YA 3V6DB 3S8SA 1R7IA 1Q4RA 1FXDA 4CO1A 1XR5A 3TQEA 4DV0F 2WTFA 4ZPVR 2BE2B 1DQ8A 2WW8A 4RNMA 3UD4P 1GMUA 2RF2B 4OYBA 2HPUA 4LQ9A 2C2KB 3BBCA 1IJEB 3IFEA 2F63A 3OTEA 3TUPA 2LXUA 3G86A 3CB4A 5KG1A 3W5ZA 1YJTA 5F8HA 3NAIA 2KTQA 3HHEA 2CIMA 2QL5B 3FQLA 2HNYB 5IS2A 2DGSA 5DDPC 4KT0C 2B3TB 2IHR1 2IAJA 1RB0A 3HHLD 2YWGA 1WC4A 2MB0B 3UCGA 1OJ4A 5HI7A 4C8ZA 5JMNA 1H2UX 2OEMA 2HLTA 2ZFHA 5A8KB 4USIA 4IFYA 1UW9A 4NRTA 2B6AA 1TQLA 5A8RA 2B5JA 2IM3A 1L3KA 3T5JA 2BJEA 2I9SA 5HMXA 2FJDB 1WELA 3TAMA 4LBPA 2F8HA 3ENVA 3KG0A 2ZH3A 2J9DE 4FVCA 4YMEA 2JEJA 2Z2LA 2CADA 1BMQB 3L7OA 2WZ1A 2ZBQA 1T9TA 2ZH1A 1EETA 1V3RA 1XR7A 3D67A 2XY6A 5K14B 2V63A 3MMBB 5HK4A 3CW2C 2KL8A 3SIPB 3UR3C 5HAOA 2ATCB 3GSDA 3RAXA 4ZPBA 2IM0A 3PW4A 2FHKA 1DQAA 3DC2A 4I7FA 1VYAA 4WZQA 1HL6A 2CNLB 2YNIB 1HR0F 2UVVA 1RA6A 4DQRA 1VQ9S 1DRZA 2FVSA 4J9PA 2ALZA 4DX5A 2J0SD 4N77A 5HMWA 4NYPA 3SCIE 5FDLA 3BSAA 2G2YA 1YK9A 2G0JA 3MPWA 1HNXF 1SCJB 3JTNA 5L39A 3RG6A 3TQ1A 3NMAA 3U7JA 2DNZA 3R3TA 4HH1A 2VBZA 4TYBA 1WF2A 1JJ2R 3O1LA 3M05A 1PO6A 5CA5A 1IVZA 5CH7B 4YB6A 1Q0NA 2VPWB 2VKZG 1U25A 3RU0A 4A8SA 2RVJA 1IXKA 4I2QA 4RPFA 1S6UA 2V8GA 2OMLA 4K2JA 3FCWA 2DR8A 4RW6A 3H90A 3T1HF 5GAHI 2X3GA 1PJ6A 1C4AA 4DMZA 2XMWA 1WG1A 2I5JA 1S10A 4UOGA 3OPKA 4RKUC 4FS2A 3SCJE 3HSDA 3KK1B 1S79A 2XSJB 3H2UB 3VCDA 5HVGA 4DN0A 3M2VA 2ZH7A 4PQAA 1PC5A 4WYLA 1SB6A 1KN6A 2J8SA 1VK3A 3G6XA 1SH3A 2XYHB 3KLGB 1SBRA 3ONQA 1JKHB 2UXBJ 4DV1J 4HYKA 2MKHA 1FRLA 5JVGQ 5E41A 4CP5A 3E51A 1NHVA 3DNCA 4B9LA 5F8NA 4FYDA 1RBLA 3GQCA 4CCHA 4L75A 1OYEA 2FPHX 1OSDA 1AYEA 3EE3A 3ZFVA 3B8HA 4NI2A 1NHUA 2E29A 3M8SA 3N01A 3C6UA 4N7TA 1TKXB 4OV1A 3M6XA 2DNGA 1SUQB 4P2FA 1IKYA 5AE1A 5E3AA 1WTBA 2MKCA 3W8GA 3ZZPA 2UXDF 3TVYA 2LEBA 4Z2XA 4O44A 1XMQJ 4ZCMA 3AXKA 4F4KA 1ACMB 1YBUA 5DZ6A 4YDDB 1FRJA 5HQ8A 4DFMA 4OLPA 4A47A 4GVLA 2PMZD 4B3TJ 5H9EJ 1X5SA 3PFEA 2QA2A 4KHPF 4GVBB 3HVRA 2BJ1A 1VBKA 2C2OB 3PNIA 2J7UA 4IFVA 5GAGU 3M30B 2W1BA 5L46A 1Z2ZA 1UETA 1VFJA 3D6MB 5KG4A 3HHDA 4GC7A 4WP9A 1LW0A 5J2PA 4IO9Q 3WBZA 1S49A 2BRLA 1SV5B 2BX6A 4ANDA 1HWLA 1RGVA 2ZZMA 3PCOB 4KFBA 1HQUB 4C8KA 2IPOB 2MHEA 1B64A 1WF1A 1S59A 3R2DJ 5T41A 1HBUA 4ZVPB 2NPFA 3MUTP 1HBOB 4LF7J 3FEYB 2QO3A 1HHTP 1S5ZA 2CJQA 5ETOA 1D09B 4JI7F 1I94J 2V8VA 2Y0BB 1TL7A 2CQ3A 3VWSA 1RTDA 3KNGA 1NH7A 3ET6A 1LWEB 3D7SB 3N6LA 4A8KA 4MJKA 1HHQA 3FMWA 3UN2A 4DG1B 2DO0A 3IM9A 1S1UB 4NLTA 2IJRA 5C2CA 3ZTOA 3FUYA 3BN4A 2OHDA 2BANB 3LF0A 2VF3A 1HQEB 4YY3J 5AE3A 3R7SB 1TVRB 4F67A 4FXVA 4NLOA 1HNIB 3QSYB 1N56A 2G9OA 3H2LA 3Q24A 5LSRA 1KHVA 5HATA 2GIFA 1ITPA 4ED2A 3VALA 3MEGB 4ICLB 3KK3A 1J27A 1GMWA 3HHLA 3BDEA 2PT0A 1FXRA 2VFRA 4F4YA 4UOCA 1YI2S 4FF3A 3TOQA 5GMEA 5BJRA 2Z56B 3LPYA 4G1QB 4ZCKA 4W92B 3CXCR 3NNCA 2IDLA 4HACB 3MEDA 3NL0A 2JC1A 1LV5A 4ELUA 3SDEB 3J7AN 2DD8S 4DU7A 2IRXA 4LSNA 3H5YA 3D6FB 3TANA 2ZC4A 2EWHA 3DDNA 1TL3A 5CZXA 3M1VB 2H4WB 3TEHB 1TKTA 2VDHA 2RUSA 1Q81T 4NZ6A 2KG0A 1JLFA 3KXDA 4CLUA 4EU0A 4P52A 2GO8A 2BBEA 2UUAF 3QGGA 4OI6A 1OPZA 1VQKS 1C2PA 3R6LB 3FMBA 3HHKA 2PO4A 3RB4A 4ZN3A 4NLDA 3POTA 2R7RA 4DV6J 1G7CB 4CH1A 4EK2A 2YH0A 2YWWA 2QL9B 1H98A 2ZD1A 3CO9A 3KLFA 2CNNB 4JI6J 1MMLA 4IUFA 1S72S 2HW3A 2E66A 4MT1A 1CJKB 3QAUA 4NASA 3FZBA 2H48B 4B9SA 2DNQA 4AL6A 2MSSA 2OI2A 4JBCA 5K8PA 2HZVA 4XK8C 1RAFB 3V4IB 4K4SA 2B4OA 2W8KA 3FBBA 4EMDA 2HVEA 4NMXA 1IKXB 1NAQA 2J9CA 4HHJA 1N88A 2UP1A 2GAHC 2YKQA 4FBTA 2W4PA 2ZNZA 3DGPB 1ZH5A 2DNHA 5CYQA 2N7CA 5IQQA 4IQMA 1U1NA 1N5YA 4K4UA 4PWUA 3DRRA 5E7OB 2J8AA 4ZITA 4J9UE 3SFGA 4I67A 2KT3A 4H4MA 2AGQA 3P8BB 4LRAA 1HW9A 3IGVA 3MD3A 3I0SB 3D54A 2VU5A 1RT6B 2IDEA 1NEEA 2ZVIA 3KK1A 1HWIA 5ADZA 1OMSA 1YGYA 2MGZA 3MR6A 3DHWC 2DPIA 5LMUF 2GJIA 2PA3A 2XS5A 4KE5A 2B51A 5C24B 2QYGA 4O23A 2V6AA 1RTZA 3GV8B 2E1CA 3MOJB 3FFIA 3ITHA 3KLHB 4RWWA 4DZ6A 3J7YU 3PIOQ 1SKRA 1OQ3A 4XTTA 4XDCA 4C3LA 4K4WA 2FYXA 2UV8A 3OJSA 2AEJA 4Y2AA 1OIAA 3C6TA 4NEZA 1UEKA 1CJTB 2AJ4A 5HP1B 1E6YB 5ETSA 2JOQA 2WSFC 2V2QA 1QAYA 3BSOA 2KT2A 4B17A 4C6AA 4C3MA 3B82A 4OQJA 5K8NA 2KZZA 2C2MB 1RBAA 2F7VA 4JV5F 1S9GB 1FE4A 1ZTTA 1WD6A 4LSLB 3LP1A 1SJQA 2W4CA 3HF5A 3MCSA 5DM6Q 3J81j 2BW2A 2BUNA 2QLWA 2QSWA 3U1MA 3TYTA 1BGXT 3DRYA 4OI2A 4F4AA 1RTHB 3GZ7A 5F8JA 2ZKTA 3TNVA 1K9MT 4OJ3A 2DYAA 5GMKa 3WDOA 1GQEA 1N4LA 3UW1A 1S12A 3T5HA 5G0RA 1FCAA 1SKSA 3D0IE 2HKEA 4LF5F 3DLGB 4OZJA 4RR5A 5RUBA 1TZ0A 2GHPA 2FJAB 1U45A 1XNRJ 3UD3P 2RDJA 3HD1A 2GVZA 2QA4G 2WK4A 4P72A 1GMVA 3WIVA 3CJ5A 1SH0A 3HJFA 3S7RA 1MU2A 4XIUA 3A8IA 3AQPA 4WE1B 2JX2A 2HNDA 1JJ4A 3JYTA 4J91A 3GV5B 4W98A 3VVUA 2YNFA 3OL7A 3BJYA 5D0GA 2HHVA 4XAKA 1F6TA 5LXYA 4DR3J 3V5RA 2LQBA 4LRDA 4O4RA 3N28A 2O3DA 4JI1J 1PC4A 2CNKB 1MN9A 2QMUB 3H5SA 2RILA 4ZVOB 3KLIB 1AUDA 3VQSA 5CCLA 5KG2A 1Z4UA 1XERA 3RW7A 1FDNA 2QL7B 1VQLS 3CJSA 2OFHX 1S1WA 3MEEB 1HD0A 3KG4A 3SI8A 2YXLA 3UVJB 3T5KA 3DLLQ 2V8HA 3EM1A 3HZGA 1PBAA 5KFSA 1RWMB 4N8NA 1NJWA 4OZ3A 4L73A 1CJVA 1QDUB 1W2IA 2ZWOA 1PYOB 4WU2A 4QWDA 4DX7A 1ZA1B 2DNLA 2VG7A 2C22A 3JSBA 2YX4A 2GGPA 4M5KA 3D3CJ 3A1YG 5D0RA 4K50A 3EMTA 2QG9B 3IR5B 4UOFA 4ECUA 4W4MA 2NXNA 1WKJA 2RU9A 3PHTA 3RRHA 4WP3A 4YFUA 4LREA 4ZCLA 3HVWA 1ZM3A 2HVDA 3GJQB 1IQTA 3KFWX 3SDEA 4NE9C 1HNVB 3PM9A 1U6BA 1RWKB 1NU4A 2BEFA 2FJWA 1KRPA 1WHWA 1WTFA 1HWKA 3H7HB 3UE2A 3V2UC 1S0MA 2B4VA 2SXLA 1KLMA 2ACMA 1RAOA 5LT5A 4ZVSB 1NDPA 3MAQA 2VG5B 1H0HB 4UQTA 4B02A 3A13A 2V4JB 2NXJA 1I51B 5BR8J 3DM2B 2VB6A 1VRUA 4O3PA 2BQRA 5A2QY 1RK8A 2R7TA 3DLJA 4BDPA 2CKWA 2RE1A 3DDKA 4DR5J 4ZLNA 4ED8A 3EVOA 3TUIC 2AF6A 2ILYA 3QRPA 3NLCA 3UDCA 1U2CA 4N8OA 3DRXA 4KQZA 3RW6A 2C2EA 2CQIA 2ZHOA 2VBXA 1RI7A 1FDAA 3LWMA 3RR8A 2KJWA 1JX4A 2V4RA 3QSIA 3R2CJ 3GJRB 4HKQA 1FF2A 5A6WA 2QFIA 4OI3A 4ECXA 1NK8A 2A6MA 4NYZA 1YHQS 4OYWA 2XMUA 3IG1A 2IMWP 2HBZB 4B3SF 2YKMB 2WHOA 5KTQA 2DJWA 4IRCA 4MMOA 2M88A 2V2VA 2UV8G 1GAOA 1Z2LA 1FA0A 4U8YA 4ENOA 3G82A 3BEGB 3RBXA 3SSRA 5HQLA 2KXNB 3G6YA 4X4PA 5FLXY 3W60A 4HTIA 3HP6A 1DARA 1UMJA 2QLFB 3BV8A 4ZPDA 4X4SA 3U1NA 4JI0F 3TI0A 4YHHF 1UP1A 1VIOA 3KLEB 9ATCB 4E8UA 3TZWA 4RW4B 3MHYA 2NCKL 1FERA 3U02A 4F7VA 1SVDA 1U0SA 3DKDA 2LXIA 1Z1ZA 2CA9A 3R27A 4J37A 1S97A 1WC3A 1R8CA 1GTEA 3GIKA 2CXEA 2W9AA 2EVZA 3TARA 3JSMB 1XNQF 1RT4A 2HQDA 2BKPA 4ANCA 2ZHAA 1X4BA 2JJ4D 4FN5A 3ZZYA 3SQGB 4DQIA 2L08A 4TY8A 2GMHA 2M0GB 5GMDA 2IVYA 2RS8A 3Q83A 3LH2S 1L5UA 1EB0A 4F0KA 3DOKB 1W25A 4CLTA 3OT9A 5ETLA 3I4PA 1S1VA 3JQMA 2MTLA 4ZS6A 1KFDA 1XWLA 4Y65A 5KT3A 3W2WA 3QGIA 2HG4A 1S9GA 2DPJA 2XWYA 3SCLE 3PRBA 1QVGR 3HULA 3G8SA 2DGOA 1EJ7L 2NSCA 2XY7A 4XPCA 4OZLA 5GADI 2OPPA 1ROFA 1AROP 2OPSA 1JQGA 3FQKA 5LJ5Y 2DHSA 3VTIA 2EFOA 2RKIB 3SBMA 5J1EB 2E7XA 4E98A 2CJKA 5IT0A 1RCOB 1I5OB 4JI5J 1REVB 3PO4A 5IT9Y 2DNYA 1M1KT 4L3NA 2G2OA 1EP4B 1SQFA 3OVAA 1F9EB 2CG4A 1RZMA 3R5BA 5KFZA 3PV8A 3VVTA 4NZ0A 4C2MA 4O3NA 5A76A 2YVSA 2OSRA 3ISND 1UJ4A 5E33A 4TYAA 2ZBCA 1FE0A 4OX6A 2PD1A 3IRWP 3A8KA 3K58A 1NDLA 4RU2A 2J0QD 1D9FA 4CNYA 2KM8C 3DOMB 1GH8A 2ASYA 3GIMA 2OJ3A 3B54A 3CVKA 4F4ZA 4ECTA 5F41A 5J2MB 3NCQA 2FQQB 3JS9A 1JXVA 1MSWD 3V81A 4CLZA 4YQWA 3KWMA 1BD6A 2MKKA 2MY7A 1CS4B 2QIFA 2IRUA 1EHWA 1APSA 1AZSB 4O0NA 4QIFA 1BQMA 3KJNB 5CD4H 3RB6A 4LQ3A 1SKUB 2DNMA 4NLGA 4KPYA 3HXMA 2ZNYA 3L7UA 2HQ3A 1VLYA 1B7YB 3KHLA 3GYGA 5KFMA 2PFFB 1WKLA 4LF8F 2AWZA 7AT1B 4USWA 1HW8A 2LMIA 2ZH6A 4PCQA 5A0YB 4J9OA 4DS5A 1Q7YT 3MM9B 3PZPA 2P5VA 1CVJA 3LALA 3R5AA 4Y00A 1R43A 3R5GA 1QE1A 4X4UA 1OQ6A 5KG3A 1KP6A 5D0EA 2E9TA 4OYZA 3K17A 2N82B 3RAMA 1HMVB 2L3MA 3O8WA 3NGRA 1JLCB 1YX2A 4KKOA 3GIJA 1DJ0A 4J90A 3CD0A 2FHOB 4RWXA 2OEJA 5DGAA 1RT2B 2UXCJ 1B0TA 3IR6B 3FBFA 3T19A 2KVQE 3AJDA 3IXQA 4PYAA 4QJVA 4DUYJ 2C1EB 3BYPA 2Y0SD 3R7NB 1IBCB 3IAS9 3PG9A 4TVAB 4PWWA 2XLIA 1RADB 5DG8A 2XMMA 2Y1RI 1C1CA 2FVPA 4ZDNA 4V19J 2MDAA 2ZBRA 2VONA 5JXSA 3P3DA 1A9NB 2RDDA 4LFAJ 1H6KX 2W2MP 3BF4A 1QAJA 4ED3A 3OTOJ 1VQ5S 1HKAA 1D3WA 3CD5A 2AT1B 1IBKJ 3C14A 2HMIB 4DZDA 2PIIA 5T7LA 2E5JA 2NXUA 3AA9A 2M70A 2DBBA 3EGVA 3DOLA 1IWAA 1UKUA 4CRJA 5A8WA 4UZBA 4TN2A 2HS4A 3CJKB 2AGPA 2B0GA 3FRYA 2Z57B 2VICA 5HLFB 4JV0A 1K44A 2CQCA 4ED0A 2PMWA 2LQ8A 2GCFA 2DNRA 2WB1D 2CPIA 1TL4A 5IM0A 4I6AA 3CDWA 5EWEA 4UZCA 5AT1B 3CCRS 4CYUA 4WTYA 1ZYQA 4C0BA 2CZ9A 1FI4A 4PXCA 2HBRB 2JHEA 1Y5NB 2VFUA 1XEZA 2HSEB 1DTQA 1NJXA 2XB2D 1LEOA 4AD6A 2I2YA 3QYYA 2BM0A 3DRSA 2NUUG 4FYXB 4URSA 5AXNA 1YQHA 3IWNC 2Z0GA 2G0CA 4BWJA 1Y10A 2GHWA 1CBKA 1RAGB 4X62F 3OFFA 1RAHB 2X3DA 2MZ1A 1SQEA 2DRAA 1R6VA 4UTGA 3CJ8A 2AJ1A 1RU1A 3Q2SC 2I0XA 5D4PA 1JNZB 1S6QB 4B3OA 2DXDA 3VV2B 2HRYA 5DG9A 4ZVUB 5KFGA 5CAAA 3PJ9A 3DHXA 4YN3B 5J2NA 2UU9J 3OV7A 1RAJA 5KFUA 3JSMA 4M5JA 1N0UA 2A2CA 4GO5X 2VDIA 4UQGA 2UVRA 2IYIA 1RYRA 1X7VA 2RNEA 1FX4A 1U09A 2B8QA 3BR8A 1Q5VA 3QIPB 1BHNA 1CULB 1S4EA 4BC9A 4F3QA 3UDVA 1NPPA 3MD1A 2D3ZA 2DXEA 2X1BA 2UUAJ 2AHOB 4I2PB 3LGHA 4UY8T 3KKFA 1N0VC 3LOUA 3ZNJ1 1A7GE 4NXNF 2QE5A 4WIIA 3G96A 4LVNP 4H54A 3JTOA 2L41A 5IC6B 2X1AA 5KG6A 2QEXS 5D4NA 4P6QA 2MQ8A 2IRYA 3ENWA 3OFGA 3I9V9 2HWIA 3T5LA 2AMCB 2AYBA 3T1AA 3TUJC 1O0PA 3EDRB 2F4FA 3M8RA 3H4BA 1TR0A 2UXBF 1BQNB 4DV1F 3RZAA 4Q2LA 3N9UC 2LQJA 3GCXP 1IM4A 2KDOA 5E3RA 1UVKA 4KB7A 5B0AA 5KFDA 5IV3A 1YJUA 3B6BA 3MMJA 4O4GB 1ZTWA 5J2QA 4P71A 3H4DA 4NPOA 2G0IA 3T9NA 4WXOA 2RB7A 4D3HA 2HK3A 2QN6B 1U1OA 4QYZJ 4G1IA 4YEAA 4N41A 3LP0B 1U02A 1KWMA 3EX7B 5KG0A 2WSCC 3D6TB 4IYQA 2RU3A 4AFFA 3P5TL 1XMQF 3ILLA 4IH7A 2QYCA 3AD8C 3ULHA 5G4DA 5HBMB 3KHRA 2V2KA 2KHDA 2GO9A 3FRZA 1FRKA 1BWEA 1NO8A 3Q8VA 3IWLA 4OMFG 1S7HA 4B3TF 1T3NA 2MZQA 1YJWS 3FCHA 2NXEA 1A0OB 1RTIB 1SJ4P 1PIEA 3NCRA 1CJUA 5CYMA 3I82A 1TFYA 1R8BA 3OXFA 2WBMA 1RT1A 3KG1A 1HYSA 5ETKA 1HPZA 2AYMA 2OLWA 2RHSB 4DFPA 4ID5B 4CNZA 3GONA 2YH1A 3TA1A 2GC8A 2B4PA 3DMJA 2IMOA 4NMLA 1ZM9A 2HHTA 3J7YI 1UWBA 2PMHA 3HFKA 1PBUA 2FTRA 2IIHA 1VQNS 5LM7E 4ED5A 1FKOA 4QYRA 2XM3A 2HBYB 3DLKB 4QBUA 1UTAA 2W7AA 3OR2A 4YS2A 4LF7F 3BO2A 4GKKJ 4JI4J 3NP5A 3MECB 1K1QA 1WOOA 4A4JA 2VKRA 3HT0A 1I94F 4F36A 1JB0C 1K1SA 3K5PA 1FFWB 1NJIT 1HMVA 1XJWB 2W9CB 2NLWA 3MTKA 3O2IA 3PW7A 5B0EA 5T14A 1M1GA 4JI2J 4NRUA 1NJYA 2MJUA 4CH0S 5EWFA 4KSEB 3FSYA 4DQQA 3OFHA 2R7UA 3IR7B 2MZSA 2HFNA 4LT6A 4QIWD 2NSBA 3CJ2A 1RT3B 2V94A 5JUMA 3DRPA 4YY3F 1LK7A 1U0HB 2IFXA 2MZRA 3J80Y 1B7FA 1X9WA 4OJ1A 2YKOA 1M0SA 1EZZB 1F60B 5HJYA 5E5NA 3KDNA 2Q79A 3GFZA 2KXHA 3C16A 1RT5A 3UDLA 3ISZA 1WOPA 2OPQA 5DDRC 1RUSA 5AXKA 4OZ0A 4A8QA 3C19A 3BQ0A 1Q8LA 5KFIA 3B78A 2MMYA 1P1TA 3HVTB 1VJQA 2HMIA 3EWGA 1G1XA 5ETRA 4JYAF 3BGRB 3BS9A 1UCNA 3U27A 1Q82T 4KR0B 3THTA 5D15A 4ERDA 3MMAA 2AYGA 1RWXB 4UY85 3KUGA 3H5XA 4OJGA 2ZH9A 2DIVA 3AODA 2LVWA 4PG8A 4DV5F 4ZVTB 1S9FA 4MIAA 4RW8B 1VQ4S 3NKYA 1VGYA 2XMTA 3MM5B 4PWDA 2CNOB 3MURP 1AFJA 2VH7A 2MQLA 1IKWB 5C25B 1HWJA 3D0HE 2BJ9A 4Y34A 1SQGA 2C3MA 2WOMB 3GR1A 4C97A 3CCTA 2XO7A 2K8GA 4L3KA 1WOSA 4AXJA 2NYIA 3MR3A 2KJVA 4U96A 3V4MA 2RS2A 3GYXB 2V9KA 1NH8A 1JJCB 1T7PA 2FY1A 2CUYA 4IH6A 4DV6F 1OS5A 4PUOA 2BJ8A 2YKNA 1KC8T 1UVJA 1NSPA 2NS1B 2DISA 1HNWJ 3DFEA 4JI6F 2AW0A 2QV6A 5ETVA 2VJUA 3E01A 2ZJRQ 1TK5A 4DFKA 1PJ5A 2W4DA 3AB4B 4ZA1A 3CPWR 2HURA 5ETMA 3HHLC 1P6TA 2B7CB 2VPXB 3WHIA 2ACYA 4NOHA 4HDHA 4YP3A 3ZC4A 4A8OA 2DHHA 2J6SA 1LW2A 1QSLA 4DR4J 3PYGA 1FDDA 4IKAA 2H4YB 2VOPA 2UVUA 3IN5A 4FVMA 4CTAA 3PKYA 3RB0A 4KTQA 3LPEA 2OFGX 1X8DA 5E3PA 1NZAA 2HWHA 1A6LA 2CJBA 1RHUB 3GJTB 5DDOC 4NZ7A 3SYZA 1B4SA 1HNZF 4RZRA 4GRSA 4RNNA 4HI2A 1HLWA 3C15B 5H9FJ 1SIZA 1QM9A 3QO9A 2XHCA 4B3SJ 4PXEA 2C3YA 2V4QA 3WX8A 3K0JA 4C8MA 3BDPA 3PY8A 1UJ6A 2R42A 1N52B 3K5OA 1FT8A 2RQCA 2RMLA 3DLEB 3PFOA 4BHQA 2XBPA 3HI9A 3OTCA 3TVKA 3TJAA 1C0TB 5HROB 1VBZA 4NXMJ 3LP0A 4AQYJ 4ZVRB 4DR6F 3OR1A 2OUGA 5IXUA 4BBYA 1JLAB 1W7WA 2BA9A 3W9HA 1CG2A 2N7YA 3ZZUA 3G2XA 1U6ZA 1EQMA 1RT7B 1JXLA 4L74A 3DDIA 2PEBA 2HFUA 4ED4A 3PW2A 3O44A 4G65A 2XYGB 4KH0B 1XNQJ 1CEZA 1UZDA 3RAQA 2FUG9 2MEWA 1X4HA 4N5SA 2K3IA 2G1HA 3UFCX 1R0AA 2Z4PA 1F5AA 2E1AA 2MKSA 1WF0A 2OPRB 3AOCA 3CDUA 3M6UA 4QWBA 4M5DB 5F8LA 3ZXWA 3BB5A 2GMLA 4C9DA 1DLOA 1N5TA 1JLGB 3LQVA 2PDAA 3C46A 1JLEA 2WBRA 3LP2A 1XNRF 4U8VA 2C3UA 3FZ2A 3CCMS 1KQKA 2HHSA 2Z2MA 2R8JA 4DEZA 2M3DA 1P27B 3MFHA 3PR4A 4ILMA 4DQSA 4S0MA 3OL8A 2D3O1 1RAEB 4R5PB 4DR3F 3GMGA 3R5DA 3M32A 1ZM4A 1S48A 1ULRA 2NUHA 4B9NA 1NK6A 4NCGB 3MAAA 1RTJA 5KT4A 4JI1F 2HVIA 1SI9A 2GVDB 3ELHA 4QR2A 4EFAC 4I4BA 4UUWA 4DF8A 3ENQA 2NR0A 1FFSB 4DPWA 5U47A 1O8BA 4LF2A 1DHMA 3M8YA 3M2UA 3T3FA 5B08A 1S9EB 5CHCB 5C7PA 1LWCB 1H72C 4IG0B 4E2FB 4HTJA 1PGZA 1V9OA 3N79A 4LF4J 1NHKL 3TVZA 1FJ7A 1PYTA 4ES1A 5L8RC 3OTDA 2VV5A 1TAUA 4FP9A 2R4FA 2C3PA 2GV1A 1Y3KA 2FD2A 1RWVB 5I42B 4CLSA 5L1LA 4C11B 1GT8A 5KFQA 5C42A 1S1XA 4RNHA 3T9ZA 4YDXA 3IWXA 3BQ1A 2HFZA 5I3UB 3M8QA 1SL2A 2LA4A 3Q2TC 1FFGB 4IG3A 2ADBA 1DURA 4U7CA 3H2VE 5GVQA 4JP8A 5H9FK 1KVIA 4LFCJ 4AL5A 3EZ5A 1YJVA 3MM8B 4DR2J 3CCQS 2CPXA 2IY5B 3MM7B 3O3LA 3AQOA 3CF5Q 5L1JA 1VRTB 1HBMA 2HZAA 3NEKA 1XQIA 4J9VA 5JVHQ 4ID8A 3KUEA 1RHQB 5BR8F 2DH9A 1FK9B 4FYVB 3QAEA 2EXUA 4B9TA 4G1PA 2I6WA 4X4NA 4LF8J 3JSRA 4YOEA 1IKVA 1X5OA 3KMSA 2NZ4A 3VAGA 2DO4A 4ZP8A 4TLRA 3D2WA 1U48A 4DR5F 2QSFA 2XZTB 1S1TB 5KFKA 3DGVA 3FSIA 1RWNB 4A8YA 1YSJA 3AHPA 1E6VB 3W9IA 3IC1A 2FVCA 3QGPA 1TFWA 1T95A 4ZP6A 4OZ5A 4DR7F 1TV6B 2EG1A 2Y3YA 5E3QA 1FESA 2AYEA 4MK9A 1C0UB 1KSPA 4CO4A 2DNPA 2H5IB 1RHRB 3ILIA 1YVFA 5DLFA 3NNAA 2HZCA 3AT1B 3HZEA 1N6QB 2BKOA 4DBQA 3NBPB 4IR1A 4X84A 1UVNA 4J5OA 4WJBA 4FPIA 4ZPTR 1HBNA 1U8WA 2B4UA 4NLSA 2YNHB 1JLQB 4OI1A 3P49B 3PJWA 4ELVA 1S7IA 2IC3A 3TZZA 1WEYA 2XCAA 3G6ES 1W26A 4CLFA 1WSRA 3CGIA 2XNQA 3FKBA 2HFOA 4OZ2A 1SL1A 4IDKA 2V34A 4WK3A 3Q8PB 1MWYA 5KAKA 1NKCA 4ETXA 4USJC 4XPEA 1TUGB 2QLXA 2J6UA 4OHZA 3MXHP 1X60A 1FWKA 2AEFA 2WAQD 4IOBA 2DITA 5M2RA 3CCZA 2D3UA 2HNZA 1IM6A 1NKEA 3P5BP 2MQPA 1GXTA 5HN0A 4BWMA 4CQ1A 4ECSA 1G4CA 3TX0A 4I64A 3WZ0A 2RRAA 1WACA 5B0BA 1WDTA 1U1PA 4R8UB 3DYAB 3HCXA 1FKPA 3SFUA 4DX8H 3UDEA 3QT5A 3JB9k 3ZZZA 3N5BA 2AJFE 2PEHA 4V1Ak 1LWFA 2XI2A 1F9HA 2ZH5A 5KFYA 5HROA 4K0KJ 3KJVA 3US5A 4X62J 3EUNA 3IBCB 1DBDA 1GXLA 1U4BA 3H5UA 1R0BG 1AA1B 3IM8A 2CJYB 3U1LA 2C2RA 4EZ9A 4HHUA 3HD2A 4WPAA 1WG5A 3OUYB 2EFGA 1T8EA 1GK8A 4EI2A 3M6VA 2HRUA 3TAQA 1I6JA 3I0RB 3QRQA 1QVFR 1WC1A 4FYWB 3PEHA 2ZKUA 4RW9B 1WJ9A 3EXCX 1P9QC 1BE4A 4JI5F 4PQUB 4FBUA 2AKWB 4M5DA 1L3VA 2DR7A 4KAIA 1TU0B 3W2VB 2N4CA 4A8WA 2A2DA 2AD9A 1Y5LB 1UVLA 4NXNJ 2R9LA 1MW7A 3D1QA 1PYSB 3E3XA 3ILJA 3D68A 3LGMA 1M5SA 2ATLA 4LVOP 2EK6A 2A10A 5BYQA 5F8GA 4MFBB 2YWKA 2EW9A 4AE5A 1MG7A 1RA7A 4Q0BB 1B0PA 1EX8A 2CVEA 1K47A 1QAXA 1D9AA 2C3OA 1S6PA 2C28A 3EZUA 3GFHA 3EVWA 1NKBA 3B4DA 3KJFB 3M6WA 2LXFA 2KM8B 2EPIA 1YJRA 1T03B 1CQNA 3M8PA 1VK8A 3R5CA 2GQ2A 3PW0A 3SMZA 4ZHRB 3IS9B 2BJDA 2ZJQQ 2XQCA 4YR2A 4EO8A 1BLUA 1IUJA 2H9ZA 3DI6B 1M5PC 4MIBA 2W2QP 3RB3A 2BVZA 1WHYA 2XEXA 2HK2A 4WFZA 1VIXA 3OVBA 2DTJA 3K5LA 3SQOP 3EGZA 1H2TZ 4B08A 3OSPA 1J2VA 4PPZA 1RE1B 1WI8A 1SC6A 3M2RB 1L3SA 2R2SA 2RQMA 4KGMA 5D8HB 3TRGA 2KHCA 2DGQA 3F44A 3EPGA 3CJ0A 1CSJA 3BH6B 5I3UA 2DNNA 2E44A 3IP0A 1Q53A 5MLCV 3Q0AA 3W64A 2OD6A 1T9UA 1F2HA 3ZTQA 4ZPWR 5L1IA 3EXYA 4KHMA 3I55S 1NPRA 1JXEA 3HFVA 3FK4A 3IBFB 1SC3B 3BH7B 3HM9A 1R27B 1B70B 2F1FA 5KOWA 5A2QU 1T05B 1P1LA 2UXCF 2XC9A 1U1RA 1KONA 4IRDA 4DUYF 4KGZB 5C5JA 1GXUA 4PYDA 2ZE2B 3G8QA 3HSZA 5B0DA 2E9RX 3D9BA 4MKAA 2RD5C 2HHQA 3RRKA 3GWCA 2GIQA 3PDNA 2DNKA 2BRKA 3NGSA 1M5VC 4F3MA 1JLBA 3MM6A 5D0HA 3UO0A 4RUAA 1U1MA 4Q44A 2L9DA 2EG2A 2B56A 5KFJA 3CSKA 1URRA 2Q6CA 3KK2A 5HJXA 4ECWA 4LFAF 4DV3J 2O1PA 3OTOF 1IBKF 2XCPA 3K5MA 3V6DA 2XMAA 3H25A 1VLOA 3L9ZA 2R7WA 3HPOA 1TKZB 2XHWA 2IM2A 2M9KA 4UUXA 8RUCA 3LANA 3NGKA 1BXNA
chains in the Genus database with same CATH topology
2BE2A 4W90B 3D1HA 2I38A 3J7A1 3OXGA 2CQDA 2HVHA 2RF2A 2Y0SD 2GHVC 3VZHA 4C0OC 3GE9A 4DHVA 4KO0B 1FVSA 2VFVA 3I5CA 3IAS9 2B43A 1KS2A 5GAEI 2FVRA 1R3NA 1K8AT 2E5HA 2F9DA 2LECA 3DCAA 1JLBB 2VOOA 2ZBIA 2EK1A 3MMCA 2Q1LA 3K5NA 2XLIA 3MM6B 3CJKA 3NS6A 4OHXA 5DG8A 3IRXB 1SH2A 5HLFA 1WWHA 1U7LA 2PC6A 4M63A 3CUNA 2LYVA 7FD1A 3KK2B 3NBPA 2XMMA 2R8GA 4DUZF 2AU0A 2KO1A 2Y1RI 2OTLS 4HEA9 3QJLA 1C1CA 1N48A 2FVPA 4KKOB 4ZDNA 3CC4S 1U1KA 2HNYA 2MDAA 1RTDB 4V19J 1Q78A 2YNGB 5D77A 5EX0A 5LJ3Y 3CEDA 1TK8A 3NAHA 3V6DB 3S8SA 1R7IA 1FEEA 4Q45A 1F2GA 1Q4RA 2VONA 1FXDA 5JXSA 2KB2A 2EBEA 3P3DA 1XR5A 4CO1A 1GNKA 1A9NB 2AJQA 1H6KX 3BF4A 5B0GA 5D3GB 3TAPA 4ED3A 1QAJA 1VQ5S 1D3WA 1X0PA 3CD5A 4LIWA 4DV0F 2WTFA 3L95X 4FNHA 2HMIB 4ZPVR 2PIIA 2BE2B 5T7LA 2E5JA 2HGLA 1DQ8A 2WW8A 4RNMA 3UD4P 2NXUA 2GNKA 2AJ0A 3AA9A 2RF2B 2M70A 2HPUA 2W24A 3N0VA 4KV8B 4LQ9A 1IJEB 2DBBA 3IFEA 1NK9A 3DOLA 1UKUA 3K8VA 1KEKA 3OTEA 5A8KA 5A8WA 3MMCB 4TN2A 2F9JA 2HS4A 1U2RA 3CJKB 2LXUA 2AGPA 2B0GA 3G86A 5IWAF 1CC8A 3CB4A 3FRYA 5KG1A 4NYOA 1YJTA 3OXLA 1FJGF 2BR0A 5F8HA 2VG6A 3NAIA 5HLFB 4IH5A 3CDEA 4DPOA 2LQ9A 4JV0A 2CQCA 1ZETA 2KTQA 4YR0A 4ED0A 3HHEA 2GCFA 1C1CB 2CIMA 4X64F 2CQBA 3FQLA 2HNYB 2DNRA 5IS2A 1S6QA 2FJXA 2WB1D 4NA2A 2M8HA 2DGSA 2ZHBA 2CPIA 1TL4A 4KT0C 5IM0A 2B3TB 2IHR1 5DDPC 2IAJA 4I6AA 2UU9F 3CDWA 5EWEA 3X1LB 4P7TA 3PVXA 3CCRS 3HHLD 4WTYA 1ZYQA 4C0BA 2YWGA 4E0DA 4PXCA 4KHRA 2JHEA 1Y5NB 3BZQA 1KVJA 3VAIA 2VFUA 3NWGA 3QLHB 3C66A 1XEZA 2MB0B 3UCGA 3E8OA 3ICLA 1DTQA 1NJXA 5HI7A 4C8ZA 1CC7A 4K4VA 2XB2D 1QY7A 4KRWA 1H2UX 3MPVA 2VASA 5T7LB 2I2YA 3QYYA 1MMNA 4CO2A 2BM0A 1K0TA 3DRSA 2VL1A 2NUUG 1JMTA 4K59A 4R0JA 4URSA 5AXNA 3DOLB 3GV7B 2GIRA 1YQHA 3IWNC 2ASLA 4HVZA 1L3TA 2HLTA 2ZFHA 5A8WB 5A8KB 2Z0GA 2B9WA 2G0CA 4BWJA 2GHWA 4USIA 2R8KA 5K14A 1IJFB 4X62F 3OFFA 3MMBA 2D9OA 2MZ1A 4IFYA 3QIPA 4NRTA 3MAHA 1SQEA 2B6AA 1OWXA 1TQLA 5A8RA 2DRAA 2B5JA 2E7WA 4NA1A 2IM3A 1L3KA 3T5JA 2BJEA 2AJ1A 2I9SA 3Q2SC 5FIIA 2I0XA 5HMXA 1KNZA 2FJDB 2R7XA 1WELA 1X5TA 2QT7A 5D4PA 2DH7A 3PX0A 1FO1A 1JNZB 1S6QB 4I2PA 4B3OA 5IM0B 4QIGA 2IAJB 3TAMA 3DLHA 2F8HA 3ENVA 2HRYA 4OZNA 2R7VA 5DG9A 3KG0A 2KZMA 4ZLPA 2EFNA 2VQFF 4RBUA 5KFGA 5HO4A 2ZH3A 4F4XA 2J9DE 3TR5A 4DLGA 2YNIA 1VI7A 3DHXA 1DTQB 5J2NA 3OV7A 2Z8QA 3AA8A 4FVCA 1RAJA 4YMEA 5KFUA 3JSMA 2FDNA 1R8PA 4TU9A 2Z2LA 2ASJA 2JEJA 2UUCF 4A8FA 2I8EA 1N0UA 4DSKA 3DRSB 2A1BA 2A2CA 4GO5X 1V3SA 3L7OA 4UQGA 2UVRA 2BQ3A 2HGMA 4MYTA 1OO0B 2YX1A 2ZH1A 4HDGA 1EETA 2IYIA 1RYRA 1V3RA 1XR7A 4CO5A 1X7VA 2RNEA 2XY6A 5K14B 1U09A 3BR8A 3MMBB 4NLYA 4IFYB 3QIPB 2APOA 1Y3JA 2B6AB 5A8RB 2B5JB 1TL5A 2OMOA 3UR3C 4K4YA 4BC9A 4F3QA 2DIUA 2WRMA 3MD1A 2D3ZA 2X1BA 1KFSA 1YTYA 4F50A 3GSDA 2UUBF 2EI5A 4I2PB 3RAXA 1YJ9S 4UY8T 3KKFA 5HMZA 4ZPBA 4B3OB 2IM0A 3TAMB 1N0VC 1LXNA 2GX8A 3LOUA 4MYUA 3PW4A 2FHKA 1DQAA 1YRUA 3MR5A 1CLFA 3DC2A 2KVIA 5FJ4A 1Y4ZB 5K8MA 1A7GE 1Q86T 4NXNF 2QE5A 1R89A 4I7FA 4I0WA 4WIIA 3G96A 4LVNP 4WZQA 3MI7X 3M9OB 1HL6A 1W2BR 1BQNA 2YNIB 5KT2A 1U2FA 1HR0F 2MKJA 5J2NB 2UVVA 1RA6A 3SEOA 2D1CA 2QFJA 1U1LA 4DQRA 4H54A 3JTOA 5LSLA 2L41A 2X1AA 2MQQA 5KG6A 2QEXS 1X0FA 1VQ9S 1DRZA 1XK8A 2FVSA 4KIAA 5D4NA 4NLWA 4J9PA 2ALZA 4P6QA 2AV5A 2GW8A 2J0SD 1EETB 2IRYA 4N77A 5HMWA 3AH6A 3PX4A 3ENWA 4NYPA 4Y3CA 3OFGA 3I9V9 5FDLA 3SCIE 2CQGA 2HWIA 3T5LA 3BSAA 1LKZA 3G6VA 3RRGA 2AYBA 3A8EA 4O4GA 4EUVA 2W7PA 1KR4A 3T1AA 2RSQA 2XS2A 2OAUA 4PR6A 2M7SA 2C42A 3MPWA 3TUJC 1O0PA 1HNXF 3JTNA 5L39A 3M8RA 3H4BA 4C8OA 1TR0A 4MAKA 2CJ9A 2LU2A 2XSJA 3TQ1A 3NMAA 4I7FB 1AW0A 2LCWA 3U7JA 2DNZA 3CIZA 3CC7S 3LO3A 3R3TA 4HH1A 2DHAA 2VBZA 2UXBF 1BQNB 1WF2A 4TYBA 3RZAA 1M5HA 2YQ3A 4DV1F 5KFOA 4Q2LA 1JJ2R 3O1LA 3UR0A 3M05A 1PO6A 3N9UC 4AUKA 2LQJA 2VBYA 3GB0A 5CA5A 5CH7B 2AP6A 4YB6A 2OD4A 3KLGA 4DF4A 2VPWB 1OSCA 1JKHA 2VKZG 1IM4A 4ATNA 3S6EA 4A8MP 2P9EA 1U25A 3RU0A 2DGXA 2KDOA 4A8SA 3NMRA 5E3RA 2RVJA 2D3OR 2KFNA 1IXKA 1UVKA 4KB7A 4YUDA 3QZ8A 4I2QA 5B0AA 5KFPA 2WCXA 3CCWA 1S6UA 1XBWA 2V8GA 5HBMA 4O3OA 5KFDA 1FNXH 4RW7B 2L48A 2XGQA 2QMXA 2OMLA 2CYYA 5FDLB 3HKWA 3Q23A 2DR8A 2FJVA 2JEFA 1DFDA 1YJUA 4RW6A 2YTCA 3T1HF 1Y5IB 4K4TA 3MMJA 4O4GB 5GAHI 2X3GA 1ZTWA 4RBTA 5J2QA 1C4AA 4DMZA 2XMWA 3H4DA 2HHUA 3MUVP 4NPOA 1WG1A 2W9BB 2I5JA 2HHHF 1N54B 2PE8A 3T9NA 4WXOA 3JTPA 1FNOA 3CDBA 1S10A 3OPKA 4RKUC 1RTIA 1T94A 3I5BA 4H4KC 4FS2A 3SCJE 2RB7A 4D3HA 4ZKAA 3CJ3A 3KK1B 2B9XA 4O0IA 1S79A 2L9NA 2XSJB 3H2UB 3VCDA 4WF9Q 1U1QA 4N47A 4CI0B 4DN0A 1U1OA 3M2VA 4QYZJ 2ZH7A 4PQAA 2KN4A 1PC5A 4WYLA 1SB6A 4G1IA 4YEAA 4N41A 1J5OB 1KN6A 3LP0B 1Y0HA 3RYLA 3EX7B 1VK3A 2JFDA 1NK5A 5KFTA 3G6XA 1SH3A 1B0VA 3TO8A 2F8EX 5I4MA 3KLGB 1TKXA 3GILA 5KG0A 2WSCC 1SBRA 3ONQA 1JKHB 2BZ2A 4AYBD 4DS4A 1SUQA 4ZVHA 2MQOA 4HYKA 4IYQA