1NJIW

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1njiW00
3OW2U 2QEXV 3CCRV 1VQOV 1YI2V 3CCQV 3CCVV 2OTJV 3CCMV 3CMEV 1YJNV 1YHQV 4WFAV 3I55V 1M1KW 1Q82W 1VQ5V 1Q81W 2OTLV 3CC4V 1YIJV 1VQ7V 1K8AW 1R73A 1W2BU 1K73W 1VQLV 3CPWU 1VQ6V 3CC2V 1VQKV 1N8RW 3I56V 1VQPV 3CCJV 4WF9V 1YJWV 1KC8W 1KQSU 1KD1W 1VQNV 1QVGU 1VQMV 1VQ8V 3CCLV 3G4SV 3CMAV 1M90W 3CC7V 3G6EV 2QA4V 1NJIW 1YITV 1S72V 3CCSV 4WFBV 5DM6V 2D3OW 1Q7YW 1Q86W 1QVFU 1K9MW 3CCEV 3CCUV 1YJ9V 3G71V 1JJ2U 1VQ4V 3CXCU 4WCEV 1VQ9V 3CD6V
chains in the Genus database with same CATH superfamily
1XNRB 3U10A 1O9HA 2ZIMA 1Q81W 3NR7A 1JVMA 1ZL8A 2YEVA 5DN6G 1M56B 3CC2V 2CK3G 2YXHA 3OAAG 3HKDB 2HG5C 2Q0AA 3JD3A 4J11A 4QIWF 2DOSA 2OIEA 4DR4B 2YI8A 3K59A 4XDJA 4JI0O 1JR9A 1DK1A 1YTFB 2EX3A 5B1AC 2HKOA 2LGWA 1NS1A 3L71H 1GMGA 2ZNIA 1AROP 4IIJB 5CB4A 4KUMA 2E5LO 2P67A 5LHIA 2FYUH 2LP7A 4JI2B 3K9SA 4JZ2A 2FTKA 5IT9N 1MABG 4K3AA 1YF2A 2R9IA 4MTGA 1NI8A 1SA0A 1Y6XA 3ETQA 4ICGA 4MTOA 3W7WA 4B08A 2UUBB 1XHXA 4LF4O 4MVMA 1Q86W 2ZE7A 4Z1VA 3VQVA 4I0XB 2ZDIC 1QCEA 3O9OA 4FLTA 2IW5A 4DV4O 2Q68A 5EBWC 5L3DA 3BA9A 3LDEA 2L6LA 2GSMB 5FL7G 4IHJB 4RQFA 3PJSK 3OUSA 4PI0A 4LFAB 1YXBA 3B8NA 4WCEV 1KUQA 1IURA 3H9VA 4TV9A 4X8AA 1V54B 1NBMG 1GN2A 4O2AB 3FD9A 1QNMA 1VQNV 4PA6A 2JRIA 1FJGO 4TOIA 4O2BA 4DV2B 4I5SA 4DV0O 3BABA 5KX5B 5LGUA 2LFRA 3JCZA 4R7CA 1K5QA 2UXXA 3OEHG 1WA8B 4CZZA 4FLWA 4AQYO 2NR5A 3L74H 4K8ZA 2CTRA 4OXSA 1VF5B 1E1RG 1G6UA 4O2BB 1I5XA 2Q0OC 2WLIA 5B1NA 2QDOA 2Z5UA 4ZBMA 2A0LA 5J2TB 1H2GA 2AW9A 4LF8B 1VQ6V 4AI8A 4DV5O 1K92A 3B8MA 4KHPO 2ZQMA 1Y74B 2R9AA 2LFSA 3JARA 1JX9A 4H33A 5IYCO 3VBBA 2NNUA 2Y0PA 4ZOLA 3KZIZ 1S5LZ 2X7RB 2WA4A 3SYPA 2ZNJA 4QPKA 3JAMN 3D3IA 4QNHB 4FFBB 4LFBO 1HNWO 1GRJA 1I7FA 1ROPA 5JH7A 3G6EV 4AQYB 1AB3A 4DUZB 2GTAA 3L9DA 4D7SA 1FXKB 4X1KB 2VS0A 4B3SB 4O4LB 1TAEA 4MTFA 1LUWA 4FLYA 5KA5A 5LYJB 4JI5O 3OFNG 3ETEA 4K0KO 3OEEG 1DGSA 4O4HA 2IJKA 4F6RA 4R8CA 2YI9A 1SQFA 1PKXA 2F95B 4YJ2B 1SQBH 1OCRC 4TSFG 3K79A 4LCUC 1NT2B 3RVZA 1BSMA 4HAMA 2LO1A 4FIPC 5B1OA 3DXRB 3L70H 4DV2O 2GBOA 3B77A 2YS8A 5JQGA 1GK9A 2W6IG 3B4SA 3E83A 1SERA 2ZCEA 3BY6A 3TCUA 2CTQA 3D36A 1WPBA 5IJ9A 3UT5A 3T1HO 4ZHQB 4JTAB 1AJNA 4JTCB 4NKGB 2XAQA 2Q69A 3CD6V 4PV1B 2P4VA 3ABUA 1FXKC 1AJPA 1HWYA 4EB6A 1TVKB 2AHZA 1AVMA 3M8AA 5BR8O 1IBLO 4CS4A 1N0NA 5H6RA 2JJ1G 3ZCCA 5IE9A 1AP5A 4MSWC 1WNSA 1WB8A 2CE4A 2DWDC 2N74A 5JCOA 4JGSA 1SZTA 1M5IA 5L3GA 4DR2O 4LF9O 4DR3O 1FXKA 3E22A 1ZSPA 1ZAUA 3DGEA 3AEIA 4TWKA 2CDYA 4PI2A 5BMVB 2HR3A 4I7ZB 4UFZA 3CRMA 1Z5WA 4OGQB 3SGIA 3P3PA 3HKBA 1NQTA 3GB7C 2GHYA 4U3JB 2LJ2A 2RDCA 3NXSA 4DW0A 5JCOC 2PGGA 3OMIB 2ZM6B 1SZXA 3IJ4A 4KHPB 2W6JG 1F51A 3RYIB 1FPOA 4FZ0A 4X64O 1YEWA 4AILC 2XAJA 5BZBA 2UU9B 4YHHB 1KMIZ 4UCOA 1ENVA 1YZBA 2XAFA 1IXBA 1FFTB 1G8MA 4F6EA 1TGOA 4QGPA 2ZE5A 3AG2B 4B3TO 3E8FA 4LF9B 4RWUA 3OW2U 1JOYA 3APOA 4OPAA 2X0LA 2ZXWC 3QTCA 1B6QA 2P4KA 5B5EZ 4MVSA 3CEIA 2YIAA 2DE0X 5EBMC 4ZHQA 2D3OW 3HKCB 1OCCB 4IYHA 3T1YO 1J95A 2UXNA 5JVDA 2ARHA 4JYYA 5BXZA 1MSDA 4O4JA 4U3FH 4NTXA 3RYCB 1IDSA 1K8AW 3E8GA 4IL6Z 1KBHA 2BSKB 3C3SA 3FB8C 3ZMZA 4TV8B 4DV3O 4I55A 5EIBC 2CTPA 5BMVA 1PP9H 4JI0B 2AZ2A 1FKAO 3CYOA 1HP8A 4PA4A 4JI4O 1H2LA 2EJRA 4H37A 2JIZG 2FKXA 2VQFO 5B3SB 4X66B 2RQ6A 2RJZA 5LXTB 3W7XA 2R70A 2HHHB 1NZ6A 5FPRA 4I0XA 3OR7C 1FFXB 4QE7A 4JAUA 3DSQA 4PDLA 4TQDA 4X9QA 4CC5A 5IJ0A 3OGIB 3SJBC 1BHBA 4X65B 3OE7G 4X88A 2A3QA 3JALA 5LMNB 4Z2WA 4JI1B 1MOFA 2YXLA 2QKAA 2YDEA 4B3MO 1GAXA 1FXHA 3ASNC 4FLZA 3ZRXA 1GM7A 1RM1C 4PDMA 5LMNO 3FYEB 1K73W 3JSLA 2ZD9A 4JASA 2MK3A 4UUJC 1Y74A 1M56C 3CSXA 4DR5B 2QSAA 3MHHC 3QO8A 4CC6A 1TA8A 1KB9F 1CP9A 1XUQA 5FPOA 3ETDA 3SYQA 3RYCA 2UU9O 4GKKO 4E2LA 2AGAA 3JD1A 4C7UA 3ZIAG 1QU7A 1RPOA 1SC5B 2IH1C 3JAWB 4H13B 1G4YB 3J80N 3H01A 1PM9A 4UCTA 2HVKC 5EK0A 5JJJB 5F2VO 2Y69C 3FAVB 4DXWA 3OM3B 2F23A 4JPRA 3N2KA 2KB1A 2YC0A 2F43G 4MVOA 2P22C 3AG4B 2KKWA 1P49A 3IGAC 1XNQB 3FB7C 4DK1A 4ZI7B 4DR1B 1IZ3A 1KKCA 1QVFU 1YDXA 2B1GA 3W7TA 4CS3A 2XHBA 1Q5OA 2EJ7A 3AK3A 2LW1A 3T4DA 3JAKA 3CCQV 5LMUO 2EIJC 1IBMB 2OTLV 3ABKC 4O4JB 1VQLV 3EXAA 1JMKC 4PDRA 4XBFA 3DC5A 4Q6GA 2DYRB 2UUCO 4PA3A 1PV0A 2EZPA 1VF6C 3OMAB 2X6BA 1V55B 3I55V 4J42A 3ZS8C 2QTOA 4N21A 3ZN1A 4DV4B 4PJ0Z 2DQ0A 3SYOA 1XQ8A 3I5DA 4ZIBA 4YJ2A 2OT5A 1G1XB 2RCVA 1SF9A 1SQQH 1URFA 4JYAB 1F7YA 3QF7A 1ZUQA 4ASUG 4FJCC 1QR8A 1VMGA 1CPYA 4WFAV 2QR4A 2QE7G 2H94A 2UUAB 4NXMB 1BZKA 3B40A 3HR0A 4WBNB 4WF9V 1M9NA 1BT8A 1BMFG 3CCLV 4GLXA 1XOUA 3LDDA 1HNZB 4YHHO 4RQEA 3CRCA 2HJDA 1DTOA 3LSUA 5EC2C 4BAYA 2BTQB 4O4IB 4X89A 1D5AA 4CH5A 3T1CA 3KG2A 1QVGU 3S3XA 2PI5A 4HNAB 4H0LB 4G28B 3ICXA 5C93A 4LC1A 5KMGB 3H1KH 2VQEO 4LF5O 1R3KC 3ABLB 1EM1A 2ETNA 1OV9A 3CCVV 2EBOA 4YJ3A 3SPHA 3A0BZ 2BOCC 3P30A 3SYCA 5CN0A 3ZEDA 5LOVB 1VEWA 4F4LA 5KHHA 3OT7A 4DV5B 1E1QG 3ZHSA 2DMXA 2JGUA 2XAHA 4DR7O 4GT1A 1BQZA 1NH2B 2PY5A 1N33B 1P7BA 3MHSC 2HVJC 3ZMSA 4DR3B 3LSSA 3Q4HB 2RN9A 2BTQA 4XDKA 1M57B 1QR9A 1OJHA 3AG1B 5IJ0B 4U7NA 2QWRB 2AHYA 1XMQO 2ZE8A 4FM1A 5JQGB 4LF7O 1E79G 4KXRA 1NU1H 1M93A 5IYDO 4TV8A 2DYSB 5HFMA 3TXSA 3LSQA 2PI4A 1I94O 3ZHTA 4JI3O 1VIBA 5LL6Y 3C3TA 1DF5A 5ITZB 1XHZA 3S3WA 1WA8A 3BRCA 2ZDIA 3LNMB 3W7SA 1N8RW 2F4VB 2PTMA 4LNUA 1K3EA 2Q5ZA 5EYPB 4D6TH 2BTOA 2ZR2A 1XL6A 1IXMA 1BL8A 3G80A 3D36C 5KHKA 3FB6C 4YIPA 4JV5B 5LP6B 1SRYA 2EIJB 1LR1A 5L3BA 5ITZA 1BHAA 2B1IA 4BW9A 1WPXA 3RBZA 4BR6A 2H3OA 2XTAA 1KQSU 2B5UA 2A79B 1VF7A 2BSKA 5J2UB 1TUBA 5FLXN 4DUZO 4DW1A 3G71V 1M57C 2X6AA 4X1YB 3MD0A 4HBNA 1XNRO 5AG2A 1YI2V 4JI5B 2M7WA 1SESA 1T5EA 3TETA 1H38A 4B3RO 3ZHUA 5K1PA 4UVBA 3JAKB 1WLEA 3D8CA 3I56V 4DO2A 1THZA 1GO3F 4GX2A 1H2MA 2JJ2G 4I55B 3ABTA 5DM6V 4RO2A 1D5NA 4K35A 4GX1A 2R9RB 1N33O 4NTYA 1W0JG 4BWAA 1R73A 4PA9A 2ZINA 1SQPH 1JQ0A 1AP6A 2JGDA 3E35A 4G2KA 5C8YA 4YXWG 4CH4A 3K5NA 1NH2D 3CHXA 2JK5C 1Z5VA 2UXBO 2EULA 1S5HC 3BVOA 1W59A 3CS5A 4JI8O 2CAZC 2Y48A 1XI1A 1NTZH 2IBZH 1MSWD 4X20A 2E76B 4D7TA 2ZM6O 3B09A 2EILC 2PF4E 2LQTA 2WPDG 4UVCA 4H44B 1I0HA 2O57A 3ABMC 4I50B 1U97A 2PYJA 4FK5C 3Q4HA 1VQ4V 3A2FA 4WFEA 3K0DA 5TISZ 2QM4A 3X2QC 2Q7HA 2XUMA 3SYAA 4GZRB 4LH7A 4UB8Z 1QBZA 1R3LC 3QO5A 1R6NA 1BGYH 3CPWU 1QLNA 2ADPA 1Q6IA 1XL4A 4KFMA 2EIMC 2ZKOA 3HKDA 3JD2A 2ZT9B 1CEZA 4X1IB 5BR8B 1IBLB 5IWAB 1VF6A 3M99B 3X2QB 1PD3A 4LNUB 1LUVA 3VQXA 4DV1B 2UUBO 2A9HA 3JCUZ 2GUZA 2KSDA 2Q6AA 3A8TA 4DV7O 5KHJA 2ATKC 3CB2A 3N2GA 5LA6A 2HLDG 1Q3EA 2QKCA 2V1DA 2Y0IA 3UT5B 2Q73A 4JI1O 3RGBA 4IT5A 1HDJA 3FKSG 4A5UB 2IM9A 1Q90D 5IY5B 2PZSA 2OCCC 3B2EE 5CA1B 1YITV 1N36B 4GYCB 3CCUV 4LFAO 4FMTA 2HHHO 5H6QA 5KUMA 3G67A 2E74B 4X64B 3QVNA 3K57A 1H8EG 3CC4V 5EZYB 1NVPB 3UKMA 2XNDG 1W2BU 4RAIA 1N36O 3WB1A 5H2FZ 1OZ0A 2OCHA 2XOKG 5H9CA 1N4CA 5IY5C 4ZOLB 3K08A 3JAWA 3F7YC 3FB5C 3A0HZ 1VQOV 3O65A 1GH6A 2RMKB 5EYPA 5LOVA 3FX7A 4DRXB 3ABLC 1XBLA 2Q8VA 3CRRA 3LDCA 1BQ0A 2Y4UA 3T1YB 1WP8A 4Q20A 3C90A 4PA7A 2ZE6A 2EINB 4X66O 1S72V 1EBOA 1K4CC 4I9WA 5D5PA 3EHBB 4LBEC 2IU0A 5DECA 4LP8A 3KCXA 4LF6B 2NLJC 4KP4A 4DV3B 3BA8A 4I4TB 1SETA 4DYLA 2UXDB 4PHZA 3HKEB 3WB2A 2CGNA 3FAVA 1ZTEA 4NB5A 4MVRA 2DYSC 1YJNV 5GONA 3EFFK 4J7JA 3R65A 2PYLA 1Y4MA 2Z0AA 5KUKA 4OPHA 3ZMTA 3ETGA 3CCJV 5HFLA 4L8JA 1R3JC 1VQMV 1NR1A 1QHTA 2Q7EA 4X62B 1R6KA 4EFEA 1KP3A 3CRQA 3OTOO 3ZMUA 1K9MW 2QWOB 4LF5B 4WFHA 3R66A 1IX9A 4DR5O 4DR6O 1FYJA 4E4EA 1SKVA 3JD0A 4EB6B 3UO3A 2P6JA 4UV8A 4DK0A 5KLVH 4CBCA 2CUGA 4JYCA 1X59A 2W0FC 2FB5A 2Z3YA 5JJEB 4DV7B 3RYIA 4JI6O 1I08A 4FZ1A 4DRXA 4B3MB 4FFBA 1JA8A 2JDIG 3ASOC 1GTOA 3ZN0A 4WFFA 1D2DA 4P2ZA 2BCCH 4X20B 2HP8A 4X1YA 4UXNA 1NVPD 2UUCB 2FMLA 3L75H 1P4RA 4RUEA 3JASB 1J5EB 4FLVA 2FL4A 3ZMVA 5KHGA 1XMQB 1FAFA 3N2GB 4UCUA 3K9AA 3W7UA 5FNVB 3G4SV 1VQ8V 3K3WA 1J5EO 4GKJB 4W4KA 3RT3C 1YVWA 3SPCA 4DV6O 2Y69B 1SQVH 4B7EA 4ZKIA 1JJOA 4X1IA 1US6A 2ZXWB 3UQ8A 1I94B 3APQA 3RYHB 5L3FA 3CMEV 3K5LA 5B66Z 5LMUB 4DR7B 2YICA 3CE2A 1IBMO 2F1MA 1EFRG 2Q4PA 3JYCA 1XMOB 1XEQA 2JS3A 4BIOA 1HNXB 4NXNB 1DF4A 1Z2GA 1KKDA 1FD9A 3STLC 5IJ9B 1Y66A 3STZC 2WLLB 4P9OA 2HJFC 3K04A 1WN7A 5B1BB 2QWQB 5DEDA 5LA6B 4QE9A 2ODMA 1N34O 1P7GA 4MS2A 4LWSB 2WSSG 2KG7A 1HW7A 3F7VC 3CP1A 3RW0A 5IYZA 4K8XA 1L0LH 1GN6A 4TUYB 4AHCA 4FM0A 1ORQC 2ZIOA 5JVDB 5LGTA 2R72A 2OWOA 5H5NA 2CH7B 4JI7B 3E22B 5GTHZ 3H1JH 1QQCA 5JJNB 1WP7A 3SJAC 5EZYA 1P84F 4YJ3B 4BW5A 3ZBHA 1MZEA 1SQGA 4NVPA 3WG7B 2KQXA 3AG7A 4Z1MG 2H8PC 4DUYB 3ZRWA 4G27B 2DW4A 1Q6HA 3ABKB 1HNZO 3WU2Z 1M1KW 3ZHVA 1Y67A 5JH7B 1VQ7V 2CGOA 2VQFB 3BPZA 4P9PA 2WLNA 1AI5A 3ZHRA 1F4MA 2Q9LA 5CBFA 3K58A 4UCRA 3P32A 5CBGA 4JV5O 2VRZA 4GKJO 2XAGA 1YJ9V 2B9ZA 1V55C 5EBLC 3UO2A 4WBNA 4NXMO 1RM1B 1COWG 1A32A 1AI6A 3JATB 3P3NA 3E86A 1DLBA 1YIJV 4J80A 2Q67A 3BFRA 4B3TB 4DV1O 2WA3A 2PUSA 1H2NA 1RP3B 1PNKA 2N04A 3E8BA 5J2TA 4J41A 1FFXA 2P7TC 1HNXO 3OTFA 4QPJA 1PNMA 4DUYO 4UVAA 4HZ3A 5C8YB 1PL0A 1S0VA 1N32B 2QWNB 4FLXA 1GM9A 3TK1A 2K1EA 1JFFB 1CXZB 2M6YA 2CTWA 1JCHA 4OX9O 5KAIZ 2OIGA 4O4LA 1SS3A 3F5TA 1OCOB 4J7KA 1NTKH 1I5YA 2QJ1A 4LH6A 2IH3C 1B04A 3BEHA 1TUBB 3KCYA 3MDSA 3OMNB 3T2MA 4JI3B 3J7AU 2HFEC 1B3QA 1RPRA 3K03A 4FVMA 3U0ZA 4JZGA 4CH3A 4JI7O 4MVQA 2IU3A 1GKFA 3CJHB 4J7ZA 3EVKA 2P06A 5CA1A 3BCCH 3CRAA 2WLJA 4WFGA 5IDJA 1R1BA 1NKDA 1QLEB 1N32O 3A0RA 1EZJA 2C2AA 1S77D 2DQ3A 1V9PA 3PN1A 1XNQO 1RSOB 3JATA 3MAQA 2GDSA 3OGCC 1UPGA 3SPGA 4OX9B 3K0GA 4EKWA 1NJIW 3M7MX 2UXBB 2E5LB 5CBHA 4RUFA 1Q8IA 3RVYA 2IJIA 2WLHA 1SQXH 3CCMV 4XDLA 3SR2C 3ML0A 1F4NA 2A06H 5KA6A 1VQ5V 3FYIB 5GW7A 3HKEA 4FFKA 5FNVA 2JEXA 1RSOA 4DR4O 1AI7A 1X4TA 2Y4TA 2EIMB 2UXCB 2WLKA 4LF4B 5CA0B 2UUAO 5E79Z 2V7QG 1PNLA 4UB6Z 4BIZA 1OCCC 4TQFA 1YHQV 1TUEB 2YSUB 3UCSC 1XREA 2WLIB 4JI2O 1YTFD 3N27A 2W0XA 4R50A 1EN4A 2DYRC 4JYAO 4BIUA 2DJVA 1AJQA 2WAMA 5IYZB 3CJHA 4DR6B 3CCEV 1S5JA 3WB0A 2ILMA 4U3JA 1EN6A 5A9GA 2OYQA 1MZFA 1WJZA 4JI6B 1IBKO 4UCSA 2GTSA 1S3JA 4MVZA 2E3CA 5D5QA 2UXDO 2UXCO 1WB7A 2P90A 3U11A 4I9QA 3LNNA 3K06A 2D2CB 1YCIA 5CMUA 1AR1B 1ZX3A 3CXHF 3ZRWB 4O4IA 2CH7A 4MT8A 4LFBB 3JSNA 1LNQA 2EIKC 5LHGA 3UM7A 3ZHQA 4IHJA 4PD4F 3HPLC 1OCRB 3RWRD 4IGGA 1ZLZA 3AG1C 3VOUA 1OCZB 1WAZA 4U7OA 2F66C 4I50A 4B7KA 1UJWB 3DTUB 5IWAO 5CA0A 4GKKB 1VP7A 1IBKB 3BHPA 3CWBH 2HEPA 5A2QN 1UFIA 5L3EA 1V54C 2YIDA 5KX5A 3BAAA 3THOA 4ZI7A 3ZRVA 4NTWA 3ZJZA 2EILB 5K1XA 2OTJV 2JVDA 4X62O 4FM2A 1H8HG 1W0KG 5GONB 1JFFA 5JWPA 3IAYA 1FJGB 1FS0G 3ABMB 1K97A 3OR6C 3GVMA 1VQKV 1L0NH 5LXTA 1NTMH 3RYHA 4GX0A 1BE3H 5LP6C 2P5OA 1S76D 2LW7A 1IVSA 5IYBO 5BY1A 2IJHA 5GTIZ 4YY3B 4X65O 3ASNB 1R3IC 1OCZC 3SPIA 4LF6O 3AK2A 1XMOO 3JARB 1K7DA 1BCCH 3WFVA 2MW2B 1M90W 3AG4C 4NXNO 4B3RB 3QG5A 4P30A 1MNGA 2WLMA 1HNWB 2ADQB 4I4TA 2ZR3A 4NYKA 1H2KA 3IFXA 3L73H 2VWKA 3N2KB 3AG2C 5LP6A 2BE3A 2X6CA 1QLEC 2XT9A 1KC8W 4MTXA 2YXYA 3VQWA 3LUTB 4WFBV 1Q7YW 4PDVA 1AR4A 1PPJH 1MMMA 3H1IH 2V4DA 4PELA 2BOBC 5LYJA 2E75B 2QM8A 4J10A 3SJQC 2QEXV 4L87A 4MVUA 3RN4A 4YY3O 2F93B 2VQEB 2OCCB 2QWPB 3VQYA 4JAVA 1KD1W 3JD4A 2YUAA 4ABMA 4CS2A 5B3SC 1N0JA 2DN9A 2IJJA 1GM8A 3CXCU 2JS5A 4MW3A 1AI4A 4HYOA 3T1HB 4J9YB 4DV0B 2ITCC 5CB4B 2G38A 3JASA 2EZOA 4MW8A 1EZVH 5L3CA 2WLLA 1L8DA 3GWOA 2QA4V 4FPPA 3K5OA 2AXTZ 2F4VO 3E8HA 2DWEC 4JYBA 4KL1A 3T4ZA 4YIOA 1ZL8B 2N05A 2YEVB 5B1AB 1K34A 2A7WA 4K0KB 1PL4A 4EEQA 4DR2B 2QKSA 1K5SA 1Q6UA 3OD4A 4TT3G 1SA0B 2XASA 1K33A 3E2EA 2RNBA 4LF8O 3DC6A 1VARA 2QTSA 4X1KA 5LHHA 3RYFB 4QJFB 1KECA 3AG3B 2QGNA 1Y76A 3AK1A 3H1HH 3KKYA 4IIJA 3D3QA 4W4LA 4GX5A 1R6TA 3OTOB 1K4DC 3ASOB 4EFBA 1VQPV 5CA3A 3J81N 2YIBA 1KP2A 3SJCC 2ITDC 3HKBB 2EIKB 1F23A 2KG7B 3SDLA 1KU9A 1MG1A 1O9GA 3DXRA 4B3SO 2LGQA 3G6BA 4O2AA 3JALB 2QM7A 2WWWA 3CX5F 4TV9B 5LGNA 1RFYA 3E89A 5EC1C 3TJTA 1EN5A 1MA1A 2L35A 1AR5A 1HR0O 4GUNA 2GUZB 1XDCA 1BS3A 1KYOF 4GCZA 4IYIA 2K9PA 4J9ZB 3GWKC 1HR0B 4N23A 1M4UA 5LBQA 4UCVA 3HB3B 1YSCA 1TVKA 3IC7A 1JPXA 1Q82W 4LR3A 1GN3A 4JI4B 4O4HB 3QO7A 4F6RB 1ZWIC 1B06A 2VWJA 4JTDB 4DV6B 1OCOC 5KHIA 2AZ0A 3CMAV 1H2SB 5KMGA 1N34B 3CCSV 3HKCA 1Q43A 1FXVA 4HNAA 3AG3C 3CCRV 4JAAA 2YIBD 1L1FA 1OHHG 2JGDB 5B1BC 4LFCB 4CH6A 1U96A 3K5MA 3OUFA 1AILA 4NR1A 5E1AC 4LWSA 5EIBD 1GN4A 5J9PC 2EINC 4TUYA 4LFCO 3TGUH 4JF3A 3SPJA 3F5WC 3TXQA 2NN4A 1JJ2U 3QNEA 3RYFA 2Q7GA 1NR7A 1VQ9V 3RFRA 3ZX6A 5KAFZ 4FLUA 1Y76B 3H1LH 4LF7B 3ZRSA 4DR1O 2JEUA 1YJWV 3IC9A 3FFQA 2GV9A 3WG7C 3CC7V 5J2UA 4JI8B 3L72H 1XILA 4UV9A 4R6ZA
chains in the Genus database with same CATH topology
3OR7C 2WLHA 3CCMV 3M99B 4XDLA 3ML0A 1F4NA 1VQ5V 5KA6A 1Q81W 3X2QB 3FYIB 5GW7A 1PD3A 1JVMA 2YEVA 4QE7A 4JAUA 5DN6G 2JEXA 4PDLA 1M56B 3CC2V 2CK3G 1AI7A 3OAAG 2EIMB 1BHBA 2A9HA 2HG5C 2WLKA 3OE7G 4X88A 2Q6AA 3JD3A 4QIWF 1MOFA 2ATKC 1PNLA 2V7QG 4BIZA 2HLDG 1FXHA 1OCCC 3ASNC 4XDJA 1YHQV 1TUEB 3ZRXA 2YSUB 1YTFB 1GM7A 2V1DA 1RM1C 5B1AC 2HKOA 4PDMA 2WLIB 3FYEB 1YTFD 1K73W 3FKSG 1GMGA 2ZD9A 4JASA 1AROP 4R50A 5IY5B 2DYRC 2OCCC 2MK3A 4UUJC 4BIUA 1AJQA 2WAMA 4KUMA 1YITV 1M56C 2P67A 5LHIA 2LP7A 3CCEV 3CCUV 4FMTA 3MHHC 5H6QA 3QO8A 5KUMA 1CP9A 2FTKA 1MABG 3ETDA 3SYQA 1H8EG 3CC4V 1NVPB 3UKMA 2R9IA 2XNDG 4MTGA 4RAIA 4E2LA 1W2BU 1S3JA 4MVZA 1OZ0A 3JD1A 3ZIAG 4MTOA 3W7WA 2XOKG 1RPOA 2IH1C 2P90A 5H9CA 4MVMA 5IY5C 3K06A 1Q86W 3K08A 1G4YB 3H01A 3F7YC 2HVKC 5CMUA 2ZDIC 5EK0A 1AR1B 3FB5C 3ZRWB 1QCEA 1VQOV 2Y69C 4MT8A 2IW5A 4DXWA 3OM3B 4JPRA 2KB1A 3ABLC 2F43G 4MVOA 3AG4B 1LNQA 2Q68A 2EIKC 3IGAC 3LDCA 3FB7C 5EBWC 4Q20A 4PA7A 5L3DA 5LHGA 3LDEA 3UM7A 2GSMB 2EINB 1S72V 5FL7G 1QVFU 1EBOA 2B1GA 3HPLC 3W7TA 1OCRB 4RQFA 3PJSK 3OUSA 1K4CC 3B8NA 4WCEV 3T4DA 3AG1C 4I9WA 3VOUA 1OCZB 3CCQV 3EHBB 2EIJC 4LBEC 4U7OA 2IU0A 4LP8A 2OTLV 1UJWB 3DTUB 3ABKC 4X8AA 1V54B 1NBMG 2NLJC 4KP4A 1VQLV 1VQNV 4PA6A 1SETA 4PDRA 4XBFA 5L3EA 1V54C 2DYRB 4MVRA 4I5SA 4PA3A 3ZRVA 2EZPA 3ZJZA 2EILB 2DYSC 5LGUA 3OMAB 2X6BA 1V55B 2OTJV 1YJNV 1H8HG 3I55V 1W0KG 3EFFK 2QTOA 4N21A 3ZN1A 2DQ0A 3R65A 3SYOA 1Y4MA 2LFRA 1FS0G 3JCZA 4R7CA 3ABMB 1K97A 1K5QA 2UXXA 3OEHG 3OR6C 5KUKA 1VQKV 3ZMTA 3ETGA 3CCJV 5HFLA 4CZZA 1R3JC 1VQMV 1NR1A 2OT5A 1R6KA 1KP3A 3ZMUA 1K9MW 4ASUG 4FJCC 1QR8A 4WFHA 4GX0A 4OXSA 1E1RG 1I5XA 2WLIA 5B1NA 1CPYA 1S76D 3JD0A 5IYBO 4WFAV 2QE7G 2Z5UA 2P6JA 2IJHA 4UV8A 4ZBMA 3ASNB 2A0LA 2H94A 4CBCA 1H2GA 1R3IC 1OCZC 4JYCA 3SPIA 1VQ6V 2W0FC 2Z3YA 1K92A 4WF9V 1M9NA 1K7DA 1BMFG 3B8MA 3WFVA 3CCLV 1M90W 3AG4C 2ZQMA 2JDIG 3ASOC 4P30A 1GTOA 3ZN0A 4WFFA 4P2ZA 2WLMA 2LFSA 4UXNA 3LDDA 1JX9A 4H33A 1NVPD 1P4RA 5IYCO 4RQEA 2ZR3A 3VBBA 4RUEA 2NNUA 3IFXA 1DTOA 2X7RB 5EC2C 3AG2C 4BAYA 3SYPA 4QPKA 3D3IA 4QNHB 3ZMVA 2X6CA 1QLEC 4X89A 3T1CA 3KG2A 1KC8W 1ROPA 4MTXA 1QVGU 3K9AA 3W7UA 3G4SV 1VQ8V 2PI5A 3K3WA 3G6EV 3LUTB 4WFBV 1Q7YW 4PDVA 4G28B 3SPCA 1FXKB 5C93A 4LC1A 2Y69B 4MTFA 4PELA 2BOBC 2QM8A 1R3KC 4ZKIA 5KA5A 2ZXWB 3SJQC 2QEXV 3ABLB 4L87A 4MVUA 3CCVV 5L3FA 3OFNG 2EBOA 3ETEA 3CMEV 3SPHA 3OEEG 2IJKA 2BOCC 3P30A 4R8CA 3SYCA 5CN0A 1EFRG 4F4LA 1PKXA 2OCCB 3JYCA 4JAVA 1KD1W 1E1QG 3JD4A 1OCRC 4TSFG 3K79A 4LCUC 1DF4A 2XAHA 4GT1A 1KKDA 5B3SC 1NH2B 3RVZA 2IJJA 1GM8A 4HAMA 1P7BA 3STLC 3MHSC 1Y66A 2HVJC 3ZMSA 3CXCU 4FIPC 5B1OA 3STZC 4MW3A 1AI4A 3LSSA 2WLLB 4HYOA 4P9OA 2HJFC 3K04A 3B77A 1M57B 4J9YB 1QR9A 4XDKA 2ITCC 3AG1B 1GK9A 2EZOA 4MW8A 5B1BB 4U7NA 2AHYA 5L3CA 2WLLA 2W6IG 3E83A 4QE9A 1SERA 3BY6A 3TCUA 4MS2A 3D36A 3GWOA 1E79G 2WSSG 3F7VC 2QA4V 4FPPA 5IYDO 4JTAB 3CP1A 3RW0A 1AJNA 4JTCB 2DYSB 2XAQA 5HFMA 2Q69A 1ORQC 3LSQA 2PI4A 3E8HA 2DWEC 4JYBA 5LGTA 3T4ZA 3CD6V 3ABUA 2YEVB 5B1AB 1FXKC 1K34A 1AJPA 1HWYA 1DF5A 2AHZA 2QKSA 1K5SA 2ZDIA 4TT3G 3LNMB 3W7SA 5H6RA 2JJ1G 3ZCCA 1N8RW 2XASA 4MSWC 1K33A 3E2EA 1K3EA 4BW5A 2DWDC 4JGSA 1SZTA 5L3GA 3WG7B 5LHHA 4Z1MG 2ZR2A 2H8PC 4QJFB 1XL6A 1IXMA 1KECA 3ZRWA 4G27B 1BL8A 2DW4A 1FXKA 3ABKB 3AG3B 3FB6C 1M1KW 3DGEA 3AEIA 1SRYA 4TWKA 2EIJB 5L3BA 1BHAA 1VQ7V 2B1IA 1WPXA 3RBZA 4GX5A 4P9PA 2HR3A 2WLNA 1K4DC 3ASOB 1VQPV 1AI5A 1KQSU 5CA3A 1F4MA 1KP2A 2B5UA 5CBFA 2ITDC 2A79B 3P32A 5CBGA 1NQTA 2EIKB 3GB7C 2GHYA 1F23A 2XAGA 1YJ9V 3G71V 1MG1A 1M57C 1V55C 2X6AA 3NXSA 3MD0A 5EBLC 1RM1B 1YI2V 1COWG 1AI6A 2QM7A 3OMIB 2WWWA 3E86A 1DLBA 2M7WA 1SESA 1YIJV 5LGNA 3TETA 2Q67A 2W6JG 1F51A 3E89A 5EC1C 1H38A 4UVBA 1WLEA 1PNKA 3E8BA 4DO2A 1THZA 1GO3F 2XAJA 3I56V 4GX2A 5BZBA 2JJ2G 2P7TC 3ABTA 5DM6V 1ENVA 2XAFA 4GCZA 4RO2A 1FFTB 1G8MA 4QPJA 4J9ZB 3AG2B 1PNMA 4N23A 4GX1A 5LBQA 3E8FA 4UVAA 4HZ3A 3OW2U 2R9RB 3HB3B 1JOYA 1PL0A 1S0VA 1YSCA 2X0LA 1W0JG 1GM9A 1JPXA 2ZXWC 3IC7A 2K1EA 3TK1A 1Q82W 1B6QA 3QO7A 1R73A 4G2KA 3E35A 1ZWIC 4PA9A 1JQ0A 1JCHA 4YXWG 4MVSA 4JTDB 1OCOC 1NH2D 2JK5C 3CMAV 1S5HC 3CCSV 5EBMC 2D3OW 1FXVA 1OCCB 1OCOB 3AG3C 2Y48A 1I5YA 1J95A 2UXNA 2IH3C 3BEHA 3CCRV 1OHHG 1L1FA 1MSWD 5B1BC 3OMNB 3T2MA 3OUFA 5E1AC 1K8AW 2HFEC 2EILC 3E8GA 2WPDG 1RPRA 3K03A 4UVCA 5J9PC 2EINC 4MVQA 2IU3A 1GKFA 3ABMC 3FB8C 4JF3A 3ZMZA 3SPJA 3F5WC 4FK5C 1VQ4V 2WLJA 4WFGA 5IDJA 1JJ2U 3QNEA 4WFEA 1NR7A 1NKDA 1VQ9V 3K0DA 1QLEB 3X2QC 3A0RA 1EZJA 3SYAA 1QBZA 1R3LC 3CYOA 3QO5A 2C2AA 1S77D 2DQ3A 1R6NA 4PA4A 3ZRSA 2EJRA 4H37A 2JIZG 3CPWU 1QLNA 2JEUA 3OGCC 3SPGA 5B3SB 1XL4A 1YJWV 3K0GA 3WG7C 4EKWA 3CC7V 1NJIW 4KFMA 2EIMC 5CBHA 4RUFA 3JD2A 3W7XA 3RVYA 4UV9A 2IJIA 4R6ZA 1CEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 U;  2QEX V;  3CCR V;  1VQO V;  1YI2 V;  3CCQ V;  3CCV V;  2OTJ V;  3CCM V;  3CME V;  1YJN V;  1YHQ V;  4WFA V;  3I55 V;  1M1K W;  1Q82 W;  1VQ5 V;  1Q81 W;  2OTL V;  3CC4 V;  1YIJ V;  1VQ7 V;  1K8A W;  1R73 A;  1W2B U;  1K73 W;  1VQL V;  3CPW U;  1VQ6 V;  3CC2 V;  1VQK V;  1N8R W;  3I56 V;  1VQP V;  3CCJ V;  4WF9 V;  1YJW V;  1KC8 W;  1KQS U;  1KD1 W;  1VQN V;  1QVG U;  1VQM V;  1VQ8 V;  3CCL V;  3G4S V;  3CMA V;  1M90 W;  3CC7 V;  3G6E V;  2QA4 V;  1NJI W;  1YIT V;  1S72 V;  3CCS V;  4WFB V;  5DM6 V;  2D3O W;  1Q7Y W;  1Q86 W;  1QVF U;  1K9M W;  3CCE V;  3CCU V;  1YJ9 V;  3G71 V;  1JJ2 U;  1VQ4 V;  3CXC U;  4WCE V;  1VQ9 V;  3CD6 V; 
#chains in the Genus database with same CATH topology
 1XNR B;  3U10 A;  1O9H A;  2ZIM A;  1Q81 W;  3NR7 A;  1JVM A;  1ZL8 A;  2YEV A;  5DN6 G;  1M56 B;  3CC2 V;  2CK3 G;  2YXH A;  3OAA G;  3HKD B;  2HG5 C;  2Q0A A;  3JD3 A;  4J11 A;  4QIW F;  2DOS A;  2OIE A;  4DR4 B;  2YI8 A;  3K59 A;  4XDJ A;  4JI0 O;  1JR9 A;  1DK1 A;  1YTF B;  2EX3 A;  5B1A C;  2HKO A;  2LGW A;  1NS1 A;  3L71 H;  1GMG A;  2ZNI A;  1ARO P;  4IIJ B;  5CB4 A;  4KUM A;  2E5L O;  2P67 A;  5LHI A;  2FYU H;  2LP7 A;  4JI2 B;  3K9S A;  4JZ2 A;  2FTK A;  5IT9 N;  1MAB G;  4K3A A;  1YF2 A;  2R9I A;  4MTG A;  1NI8 A;  1SA0 A;  1Y6X A;  3ETQ A;  4ICG A;  4MTO A;  3W7W A;  4B08 A;  2UUB B;  1XHX A;  4LF4 O;  4MVM A;  1Q86 W;  2ZE7 A;  4Z1V A;  3VQV A;  4I0X B;  2ZDI C;  1QCE A;  3O9O A;  4FLT A;  2IW5 A;  4DV4 O;  2Q68 A;  5EBW C;  5L3D A;  3BA9 A;  3LDE A;  2L6L A;  2GSM B;  5FL7 G;  4IHJ B;  4RQF A;  3PJS K;  3OUS A;  4PI0 A;  4LFA B;  1YXB A;  3B8N A;  4WCE V;  1KUQ A;  1IUR A;  3H9V A;  4TV9 A;  4X8A A;  1V54 B;  1NBM G;  1GN2 A;  4O2A B;  3FD9 A;  1QNM A;  1VQN V;  4PA6 A;  2JRI A;  1FJG O;  4TOI A;  4O2B A;  4DV2 B;  4I5S A;  4DV0 O;  3BAB A;  5KX5 B;  5LGU A;  2LFR A;  3JCZ A;  4R7C A;  1K5Q A;  2UXX A;  3OEH G;  1WA8 B;  4CZZ A;  4FLW A;  4AQY O;  2NR5 A;  3L74 H;  4K8Z A;  2CTR A;  4OXS A;  1VF5 B;  1E1R G;  1G6U A;  4O2B B;  1I5X A;  2Q0O C;  2WLI A;  5B1N A;  2QDO A;  2Z5U A;  4ZBM A;  2A0L A;  5J2T B;  1H2G A;  2AW9 A;  4LF8 B;  1VQ6 V;  4AI8 A;  4DV5 O;  1K92 A;  3B8M A;  4KHP O;  2ZQM A;  1Y74 B;  2R9A A;  2LFS A;  3JAR A;  1JX9 A;  4H33 A;  5IYC O;  3VBB A;  2NNU A;  2Y0P A;  4ZOL A;  3KZI Z;  1S5L Z;  2X7R B;  2WA4 A;  3SYP A;  2ZNJ A;  4QPK A;  3JAM N;  3D3I A;  4QNH B;  4FFB B;  4LFB O;  1HNW O;  1GRJ A;  1I7F A;  1ROP A;  5JH7 A;  3G6E V;  4AQY B;  1AB3 A;  4DUZ B;  2GTA A;  3L9D A;  4D7S A;  1FXK B;  4X1K B;  2VS0 A;  4B3S B;  4O4L B;  1TAE A;  4MTF A;  1LUW A;  4FLY A;  5KA5 A;  5LYJ B;  4JI5 O;  3OFN G;  3ETE A;  4K0K O;  3OEE G;  1DGS A;  4O4H A;  2IJK A;  4F6R A;  4R8C A;  2YI9 A;  1SQF A;  1PKX A;  2F95 B;  4YJ2 B;  1SQB H;  1OCR C;  4TSF G;  3K79 A;  4LCU C;  1NT2 B;  3RVZ A;  1BSM A;  4HAM A;  2LO1 A;  4FIP C;  5B1O A;  3DXR B;  3L70 H;  4DV2 O;  2GBO A;  3B77 A;  2YS8 A;  5JQG A;  1GK9 A;  2W6I G;  3B4S A;  3E83 A;  1SER A;  2ZCE A;  3BY6 A;  3TCU A;  2CTQ A;  3D36 A;  1WPB A;  5IJ9 A;  3UT5 A;  3T1H O;  4ZHQ B;  4JTA B;  1AJN A;  4JTC B;  4NKG B;  2XAQ A;  2Q69 A;  3CD6 V;  4PV1 B;  2P4V A;  3ABU A;  1FXK C;  1AJP A;  1HWY A;  4EB6 A;  1TVK B;  2AHZ A;  1AVM A;  3M8A A;  5BR8 O;  1IBL O;  4CS4 A;  1N0N A;  5H6R A;  2JJ1 G;  3ZCC A;  5IE9 A;  1AP5 A;  4MSW C;  1WNS A;  1WB8 A;  2CE4 A;  2DWD C;  2N74 A;  5JCO A;  4JGS A;  1SZT A;  1M5I A;  5L3G A;  4DR2 O;  4LF9 O;  4DR3 O;  1FXK A;  3E22 A;  1ZSP A;  1ZAU A;  3DGE A;  3AEI A;  4TWK A;  2CDY A;  4PI2 A;  5BMV B;  2HR3 A;  4I7Z B;  4UFZ A;  3CRM A;  1Z5W A;  4OGQ B;  3SGI A;  3P3P A;  3HKB A;  1NQT A;  3GB7 C;  2GHY A;  4U3J B;  2LJ2 A;  2RDC A;  3NXS A;  4DW0 A;  5JCO C;  2PGG A;  3OMI B;  2ZM6 B;  1SZX A;  3IJ4 A;  4KHP B;  2W6J G;  1F51 A;  3RYI B;  1FPO A;  4FZ0 A;  4X64 O;  1YEW A;  4AIL C;  2XAJ A;  5BZB A;  2UU9 B;  4YHH B;  1KMI Z;  4UCO A;  1ENV A;  1YZB A;  2XAF A;  1IXB A;  1FFT B;  1G8M A;  4F6E A;  1TGO A;  4QGP A;  2ZE5 A;  3AG2 B;  4B3T O;  3E8F A;  4LF9 B;  4RWU A;  3OW2 U;  1JOY A;  3APO A;  4OPA A;  2X0L A;  2ZXW C;  3QTC A;  1B6Q A;  2P4K A;  5B5E Z;  4MVS A;  3CEI A;  2YIA A;  2DE0 X;  5EBM C;  4ZHQ A;  2D3O W;  3HKC B;  1OCC B;  4IYH A;  3T1Y O;  1J95 A;  2UXN A;  5JVD A;  2ARH A;  4JYY A;  5BXZ A;  1MSD A;  4O4J A;  4U3F H;  4NTX A;  3RYC B;  1IDS A;  1K8A W;  3E8G A;  4IL6 Z;  1KBH A;  2BSK B;  3C3S A;  3FB8 C;  3ZMZ A;  4TV8 B;  4DV3 O;  4I55 A;  5EIB C;  2CTP A;  5BMV A;  1PP9 H;  4JI0 B;  2AZ2 A;  1FKA O;  3CYO A;  1HP8 A;  4PA4 A;  4JI4 O;  1H2L A;  2EJR A;  4H37 A;  2JIZ G;  2FKX A;  2VQF O;  5B3S B;  4X66 B;  2RQ6 A;  2RJZ A;  5LXT B;  3W7X A;  2R70 A;  2HHH B;  1NZ6 A;  5FPR A;  4I0X A;  3OR7 C;  1FFX B;  4QE7 A;  4JAU A;  3DSQ A;  4PDL A;  4TQD A;  4X9Q A;  4CC5 A;  5IJ0 A;  3OGI B;  3SJB C;  1BHB A;  4X65 B;  3OE7 G;  4X88 A;  2A3Q A;  3JAL A;  5LMN B;  4Z2W A;  4JI1 B;  1MOF A;  2YXL A;  2QKA A;  2YDE A;  4B3M O;  1GAX A;  1FXH A;  3ASN C;  4FLZ A;  3ZRX A;  1GM7 A;  1RM1 C;  4PDM A;  5LMN O;  3FYE B;  1K73 W;  3JSL A;  2ZD9 A;  4JAS A;  2MK3 A;  4UUJ C;  1Y74 A;  1M56 C;  3CSX A;  4DR5 B;  2QSA A;  3MHH C;  3QO8 A;  4CC6 A;  1TA8 A;  1KB9 F;  1CP9 A;  1XUQ A;  5FPO A;  3ETD A;  3SYQ A;  3RYC A;  2UU9 O;  4GKK O;  4E2L A;  2AGA A;  3JD1 A;  4C7U A;  3ZIA G;  1QU7 A;  1RPO A;  1SC5 B;  2IH1 C;  3JAW B;  4H13 B;  1G4Y B;  3J80 N;  3H01 A;  1PM9 A;  4UCT A;  2HVK C;  5EK0 A;  5JJJ B;  5F2V O;  2Y69 C;  3FAV B;  4DXW A;  3OM3 B;  2F23 A;  4JPR A;  3N2K A;  2KB1 A;  2YC0 A;  2F43 G;  4MVO A;  2P22 C;  3AG4 B;  2KKW A;  1P49 A;  3IGA C;  1XNQ B;  3FB7 C;  4DK1 A;  4ZI7 B;  4DR1 B;  1IZ3 A;  1KKC A;  1QVF U;  1YDX A;  2B1G A;  3W7T A;  4CS3 A;  2XHB A;  1Q5O A;  2EJ7 A;  3AK3 A;  2LW1 A;  3T4D A;  3JAK A;  3CCQ V;  5LMU O;  2EIJ C;  1IBM B;  2OTL V;  3ABK C;  4O4J B;  1VQL V;  3EXA A;  1JMK C;  4PDR A;  4XBF A;  3DC5 A;  4Q6G A;  2DYR B;  2UUC O;  4PA3 A;  1PV0 A;  2EZP A;  1VF6 C;  3OMA B;  2X6B A;  1V55 B;  3I55 V;  4J42 A;  3ZS8 C;  2QTO A;  4N21 A;  3ZN1 A;  4DV4 B;  4PJ0 Z;  2DQ0 A;  3SYO A;  1XQ8 A;  3I5D A;  4ZIB A;  4YJ2 A;  2OT5 A;  1G1X B;  2RCV A;  1SF9 A;  1SQQ H;  1URF A;  4JYA B;  1F7Y A;  3QF7 A;  1ZUQ A;  4ASU G;  4FJC C;  1QR8 A;  1VMG A;  1CPY A;  4WFA V;  2QR4 A;  2QE7 G;  2H94 A;  2UUA B;  4NXM B;  1BZK A;  3B40 A;  3HR0 A;  4WBN B;  4WF9 V;  1M9N A;  1BT8 A;  1BMF G;  3CCL V;  4GLX A;  1XOU A;  3LDD A;  1HNZ B;  4YHH O;  4RQE A;  3CRC A;  2HJD A;  1DTO A;  3LSU A;  5EC2 C;  4BAY A;  2BTQ B;  4O4I B;  4X89 A;  1D5A A;  4CH5 A;  3T1C A;  3KG2 A;  1QVG U;  3S3X A;  2PI5 A;  4HNA B;  4H0L B;  4G28 B;  3ICX A;  5C93 A;  4LC1 A;  5KMG B;  3H1K H;  2VQE O;  4LF5 O;  1R3K C;  3ABL B;  1EM1 A;  2ETN A;  1OV9 A;  3CCV V;  2EBO A;  4YJ3 A;  3SPH A;  3A0B Z;  2BOC C;  3P30 A;  3SYC A;  5CN0 A;  3ZED A;  5LOV B;  1VEW A;  4F4L A;  5KHH A;  3OT7 A;  4DV5 B;  1E1Q G;  3ZHS A;  2DMX A;  2JGU A;  2XAH A;  4DR7 O;  4GT1 A;  1BQZ A;  1NH2 B;  2PY5 A;  1N33 B;  1P7B A;  3MHS C;  2HVJ C;  3ZMS A;  4DR3 B;  3LSS A;  3Q4H B;  2RN9 A;  2BTQ A;  4XDK A;  1M57 B;  1QR9 A;  1OJH A;  3AG1 B;  5IJ0 B;  4U7N A;  2QWR B;  2AHY A;  1XMQ O;  2ZE8 A;  4FM1 A;  5JQG B;  4LF7 O;  1E79 G;  4KXR A;  1NU1 H;  1M93 A;  5IYD O;  4TV8 A;  2DYS B;  5HFM A;  3TXS A;  3LSQ A;  2PI4 A;  1I94 O;  3ZHT A;  4JI3 O;  1VIB A;  5LL6 Y;  3C3T A;  1DF5 A;  5ITZ B;  1XHZ A;  3S3W A;  1WA8 A;  3BRC A;  2ZDI A;  3LNM B;  3W7S A;  1N8R W;  2F4V B;  2PTM A;  4LNU A;  1K3E A;  2Q5Z A;  5EYP B;  4D6T H;  2BTO A;  2ZR2 A;  1XL6 A;  1IXM A;  1BL8 A;  3G80 A;  3D36 C;  5KHK A;  3FB6 C;  4YIP A;  4JV5 B;  5LP6 B;  1SRY A;  2EIJ B;  1LR1 A;  5L3B A;  5ITZ A;  1BHA A;  2B1I A;  4BW9 A;  1WPX A;  3RBZ A;  4BR6 A;  2H3O A;  2XTA A;  1KQS U;  2B5U A;  2A79 B;  1VF7 A;  2BSK A;  5J2U B;  1TUB A;  5FLX N;  4DUZ O;  4DW1 A;  3G71 V;  1M57 C;  2X6A A;  4X1Y B;  3MD0 A;  4HBN A;  1XNR O;  5AG2 A;  1YI2 V;  4JI5 B;  2M7W A;  1SES A;  1T5E A;  3TET A;  1H38 A;  4B3R O;  3ZHU A;  5K1P A;  4UVB A;  3JAK B;  1WLE A;  3D8C A;  3I56 V;  4DO2 A;  1THZ A;  1GO3 F;  4GX2 A;  1H2M A;  2JJ2 G;  4I55 B;  3ABT A;  5DM6 V;  4RO2 A;  1D5N A;  4K35 A;  4GX1 A;  2R9R B;  1N33 O;  4NTY A;  1W0J G;  4BWA A;  1R73 A;  4PA9 A;  2ZIN A;  1SQP H;  1JQ0 A;  1AP6 A;  2JGD A;  3E35 A;  4G2K A;  5C8Y A;  4YXW G;  4CH4 A;  3K5N A;  1NH2 D;  3CHX A;  2JK5 C;  1Z5V A;  2UXB O;  2EUL A;  1S5H C;  3BVO A;  1W59 A;  3CS5 A;  4JI8 O;  2CAZ C;  2Y48 A;  1XI1 A;  1NTZ H;  2IBZ H;  1MSW D;  4X20 A;  2E76 B;  4D7T A;  2ZM6 O;  3B09 A;  2EIL C;  2PF4 E;  2LQT A;  2WPD G;  4UVC A;  4H44 B;  1I0H A;  2O57 A;  3ABM C;  4I50 B;  1U97 A;  2PYJ A;  4FK5 C;  3Q4H A;  1VQ4 V;  3A2F A;  4WFE A;  3K0D A;  5TIS Z;  2QM4 A;  3X2Q C;  2Q7H A;  2XUM A;  3SYA A;  4GZR B;  4LH7 A;  4UB8 Z;  1QBZ A;  1R3L C;  3QO5 A;  1R6N A;  1BGY H;  3CPW U;  1QLN A;  2ADP A;  1Q6I A;  1XL4 A;  4KFM A;  2EIM C;  2ZKO A;  3HKD A;  3JD2 A;  2ZT9 B;  1CEZ A;  4X1I B;  5BR8 B;  1IBL B;  5IWA B;  1VF6 A;  3M99 B;  3X2Q B;  1PD3 A;  4LNU B;  1LUV A;  3VQX A;  4DV1 B;  2UUB O;  2A9H A;  3JCU Z;  2GUZ A;  2KSD A;  2Q6A A;  3A8T A;  4DV7 O;  5KHJ A;  2ATK C;  3CB2 A;  3N2G A;  5LA6 A;  2HLD G;  1Q3E A;  2QKC A;  2V1D A;  2Y0I A;  3UT5 B;  2Q73 A;  4JI1 O;  3RGB A;  4IT5 A;  1HDJ A;  3FKS G;  4A5U B;  2IM9 A;  1Q90 D;  5IY5 B;  2PZS A;  2OCC C;  3B2E E;  5CA1 B;  1YIT V;  1N36 B;  4GYC B;  3CCU V;  4LFA O;  4FMT A;  2HHH O;  5H6Q A;  5KUM A;  3G67 A;  2E74 B;  4X64 B;  3QVN A;  3K57 A;  1H8E G;  3CC4 V;  5EZY B;  1NVP B;  3UKM A;  2XND G;  1W2B U;  4RAI A;  1N36 O;  3WB1 A;  5H2F Z;  1OZ0 A;  2OCH A;  2XOK G;  5H9C A;  1N4C A;  5IY5 C;  4ZOL B;  3K08 A;  3JAW A;  3F7Y C;  3FB5 C;  3A0H Z;  1VQO V;  3O65 A;  1GH6 A;  2RMK B;  5EYP A;  5LOV A;  3FX7 A;  4DRX B;  3ABL C;  1XBL A;  2Q8V A;  3CRR A;  3LDC A;  1BQ0 A;  2Y4U A;  3T1Y B;  1WP8 A;  4Q20 A;  3C90 A;  4PA7 A;  2ZE6 A;  2EIN B;  4X66 O;  1S72 V;  1EBO A;  1K4C C;  4I9W A;  5D5P A;  3EHB B;  4LBE C;  2IU0 A;  5DEC A;  4LP8 A;  3KCX A;  4LF6 B;  2NLJ C;  4KP4 A;  4DV3 B;  3BA8 A;  4I4T B;  1SET A;  4DYL A;  2UXD B;  4PHZ A;  3HKE B;  3WB2 A;  2CGN A;  3FAV A;  1ZTE A;  4NB5 A;  4MVR A;  2DYS C;  1YJN V;  5GON A;  3EFF K;  4J7J A;  3R65 A;  2PYL A;  1Y4M A;  2Z0A A;  5KUK A;  4OPH A;  3ZMT A;  3ETG A;  3CCJ V;  5HFL A;  4L8J A;  1R3J C;  1VQM V;  1NR1 A;  1QHT A;  2Q7E A;  4X62 B;  1R6K A;  4EFE A;  1KP3 A;  3CRQ A;  3OTO O;  3ZMU A;  1K9M W;  2QWO B;  4LF5 B;  4WFH A;  3R66 A;  1IX9 A;  4DR5 O;  4DR6 O;  1FYJ A;  4E4E A;  1SKV A;  3JD0 A;  4EB6 B;  3UO3 A;  2P6J A;  4UV8 A;  4DK0 A;  5KLV H;  4CBC A;  2CUG A;  4JYC A;  1X59 A;  2W0F C;  2FB5 A;  2Z3Y A;  5JJE B;  4DV7 B;  3RYI A;  4JI6 O;  1I08 A;  4FZ1 A;  4DRX A;  4B3M B;  4FFB A;  1JA8 A;  2JDI G;  3ASO C;  1GTO A;  3ZN0 A;  4WFF A;  1D2D A;  4P2Z A;  2BCC H;  4X20 B;  2HP8 A;  4X1Y A;  4UXN A;  1NVP D;  2UUC B;  2FML A;  3L75 H;  1P4R A;  4RUE A;  3JAS B;  1J5E B;  4FLV A;  2FL4 A;  3ZMV A;  5KHG A;  1XMQ B;  1FAF A;  3N2G B;  4UCU A;  3K9A A;  3W7U A;  5FNV B;  3G4S V;  1VQ8 V;  3K3W A;  1J5E O;  4GKJ B;  4W4K A;  3RT3 C;  1YVW A;  3SPC A;  4DV6 O;  2Y69 B;  1SQV H;  4B7E A;  4ZKI A;  1JJO A;  4X1I A;  1US6 A;  2ZXW B;  3UQ8 A;  1I94 B;  3APQ A;  3RYH B;  5L3F A;  3CME V;  3K5L A;  5B66 Z;  5LMU B;  4DR7 B;  2YIC A;  3CE2 A;  1IBM O;  2F1M A;  1EFR G;  2Q4P A;  3JYC A;  1XMO B;  1XEQ A;  2JS3 A;  4BIO A;  1HNX B;  4NXN B;  1DF4 A;  1Z2G A;  1KKD A;  1FD9 A;  3STL C;  5IJ9 B;  1Y66 A;  3STZ C;  2WLL B;  4P9O A;  2HJF C;  3K04 A;  1WN7 A;  5B1B B;  2QWQ B;  5DED A;  5LA6 B;  4QE9 A;  2ODM A;  1N34 O;  1P7G A;  4MS2 A;  4LWS B;  2WSS G;  2KG7 A;  1HW7 A;  3F7V C;  3CP1 A;  3RW0 A;  5IYZ A;  4K8X A;  1L0L H;  1GN6 A;  4TUY B;  4AHC A;  4FM0 A;  1ORQ C;  2ZIO A;  5JVD B;  5LGT A;  2R72 A;  2OWO A;  5H5N A;  2CH7 B;  4JI7 B;  3E22 B;  5GTH Z;  3H1J H;  1QQC A;  5JJN B;  1WP7 A;  3SJA C;  5EZY A;  1P84 F;  4YJ3 B;  4BW5 A;  3ZBH A;  1MZE A;  1SQG A;  4NVP A;  3WG7 B;  2KQX A;  3AG7 A;  4Z1M G;  2H8P C;  4DUY B;  3ZRW A;  4G27 B;  2DW4 A;  1Q6H A;  3ABK B;  1HNZ O;  3WU2 Z;  1M1K W;  3ZHV A;  1Y67 A;  5JH7 B;  1VQ7 V;  2CGO A;  2VQF B;  3BPZ A;  4P9P A;  2WLN A;  1AI5 A;  3ZHR A;  1F4M A;  2Q9L A;  5CBF A;  3K58 A;  4UCR A;  3P32 A;  5CBG A;  4JV5 O;  2VRZ A;  4GKJ O;  2XAG A;  1YJ9 V;  2B9Z A;  1V55 C;  5EBL C;  3UO2 A;  4WBN A;  4NXM O;  1RM1 B;  1COW G;  1A32 A;  1AI6 A;  3JAT B;  3P3N A;  3E86 A;  1DLB A;  1YIJ V;  4J80 A;  2Q67 A;  3BFR A;  4B3T B;  4DV1 O;  2WA3 A;  2PUS A;  1H2N A;  1RP3 B;  1PNK A;  2N04 A;  3E8B A;  5J2T A;  4J41 A;  1FFX A;  2P7T C;  1HNX O;  3OTF A;  4QPJ A;  1PNM A;  4DUY O;  4UVA A;  4HZ3 A;  5C8Y B;  1PL0 A;  1S0V A;  1N32 B;  2QWN B;  4FLX A;  1GM9 A;  3TK1 A;  2K1E A;  1JFF B;  1CXZ B;  2M6Y A;  2CTW A;  1JCH A;  4OX9 O;  5KAI Z;  2OIG A;  4O4L A;  1SS3 A;  3F5T A;  1OCO B;  4J7K A;  1NTK H;  1I5Y A;  2QJ1 A;  4LH6 A;  2IH3 C;  1B04 A;  3BEH A;  1TUB B;  3KCY A;  3MDS A;  3OMN B;  3T2M A;  4JI3 B;  3J7A U;  2HFE C;  1B3Q A;  1RPR A;  3K03 A;  4FVM A;  3U0Z A;  4JZG A;  4CH3 A;  4JI7 O;  4MVQ A;  2IU3 A;  1GKF A;  3CJH B;  4J7Z A;  3EVK A;  2P06 A;  5CA1 A;  3BCC H;  3CRA A;  2WLJ A;  4WFG A;  5IDJ A;  1R1B A;  1NKD A;  1QLE B;  1N32 O;  3A0R A;  1EZJ A;  2C2A A;  1S77 D;  2DQ3 A;  1V9P A;  3PN1 A;  1XNQ O;  1RSO B;  3JAT A;  3MAQ A;  2GDS A;  3OGC C;  1UPG A;  3SPG A;  4OX9 B;  3K0G A;  4EKW A;  1NJI W;  3M7M X;  2UXB B;  2E5L B;  5CBH A;  4RUF A;  1Q8I A;  3RVY A;  2IJI A;  2WLH A;  1SQX H;  3CCM V;  4XDL A;  3SR2 C;  3ML0 A;  1F4N A;  2A06 H;  5KA6 A;  1VQ5 V;  3FYI B;  5GW7 A;  3HKE A;  4FFK A;  5FNV A;  2JEX A;  1RSO A;  4DR4 O;  1AI7 A;  1X4T A;  2Y4T A;  2EIM B;  2UXC B;  2WLK A;  4LF4 B;  5CA0 B;  2UUA O;  5E79 Z;  2V7Q G;  1PNL A;  4UB6 Z;  4BIZ A;  1OCC C;  4TQF A;  1YHQ V;  1TUE B;  2YSU B;  3UCS C;  1XRE A;  2WLI B;  4JI2 O;  1YTF D;  3N27 A;  2W0X A;  4R50 A;  1EN4 A;  2DYR C;  4JYA O;  4BIU A;  2DJV A;  1AJQ A;  2WAM A;  5IYZ B;  3CJH A;  4DR6 B;  3CCE V;  1S5J A;  3WB0 A;  2ILM A;  4U3J A;  1EN6 A;  5A9G A;  2OYQ A;  1MZF A;  1WJZ A;  4JI6 B;  1IBK O;  4UCS A;  2GTS A;  1S3J A;  4MVZ A;  2E3C A;  5D5Q A;  2UXD O;  2UXC O;  1WB7 A;  2P90 A;  3U11 A;  4I9Q A;  3LNN A;  3K06 A;  2D2C B;  1YCI A;  5CMU A;  1AR1 B;  1ZX3 A;  3CXH F;  3ZRW B;  4O4I A;  2CH7 A;  4MT8 A;  4LFB B;  3JSN A;  1LNQ A;  2EIK C;  5LHG A;  3UM7 A;  3ZHQ A;  4IHJ A;  4PD4 F;  3HPL C;  1OCR B;  3RWR D;  4IGG A;  1ZLZ A;  3AG1 C;  3VOU A;  1OCZ B;  1WAZ A;  4U7O A;  2F66 C;  4I50 A;  4B7K A;  1UJW B;  3DTU B;  5IWA O;  5CA0 A;  4GKK B;  1VP7 A;  1IBK B;  3BHP A;  3CWB H;  2HEP A;  5A2Q N;  1UFI A;  5L3E A;  1V54 C;  2YID A;  5KX5 A;  3BAA A;  3THO A;  4ZI7 A;  3ZRV A;  4NTW A;  3ZJZ A;  2EIL B;  5K1X A;  2OTJ V;  2JVD A;  4X62 O;  4FM2 A;  1H8H G;  1W0K G;  5GON B;  1JFF A;  5JWP A;  3IAY A;  1FJG B;  1FS0 G;  3ABM B;  1K97 A;  3OR6 C;  3GVM A;  1VQK V;  1L0N H;  5LXT A;  1NTM H;  3RYH A;  4GX0 A;  1BE3 H;  5LP6 C;  2P5O A;  1S76 D;  2LW7 A;  1IVS A;  5IYB O;  5BY1 A;  2IJH A;  5GTI Z;  4YY3 B;  4X65 O;  3ASN B;  1R3I C;  1OCZ C;  3SPI A;  4LF6 O;  3AK2 A;  1XMO O;  3JAR B;  1K7D A;  1BCC H;  3WFV A;  2MW2 B;  1M90 W;  3AG4 C;  4NXN O;  4B3R B;  3QG5 A;  4P30 A;  1MNG A;  2WLM A;  1HNW B;  2ADQ B;  4I4T A;  2ZR3 A;  4NYK A;  1H2K A;  3IFX A;  3L73 H;  2VWK A;  3N2K B;  3AG2 C;  5LP6 A;  2BE3 A;  2X6C A;  1QLE C;  2XT9 A;  1KC8 W;  4MTX A;  2YXY A;  3VQW A;  3LUT B;  4WFB V;  1Q7Y W;  4PDV A;  1AR4 A;  1PPJ H;  1MMM A;  3H1I H;  2V4D A;  4PEL A;  2BOB C;  5LYJ A;  2E75 B;  2QM8 A;  4J10 A;  3SJQ C;  2QEX V;  4L87 A;  4MVU A;  3RN4 A;  4YY3 O;  2F93 B;  2VQE B;  2OCC B;  2QWP B;  3VQY A;  4JAV A;  1KD1 W;  3JD4 A;  2YUA A;  4ABM A;  4CS2 A;  5B3S C;  1N0J A;  2DN9 A;  2IJJ A;  1GM8 A;  3CXC U;  2JS5 A;  4MW3 A;  1AI4 A;  4HYO A;  3T1H B;  4J9Y B;  4DV0 B;  2ITC C;  5CB4 B;  2G38 A;  3JAS A;  2EZO A;  4MW8 A;  1EZV H;  5L3C A;  2WLL A;  1L8D A;  3GWO A;  2QA4 V;  4FPP A;  3K5O A;  2AXT Z;  2F4V O;  3E8H A;  2DWE C;  4JYB A;  4KL1 A;  3T4Z A;  4YIO A;  1ZL8 B;  2N05 A;  2YEV B;  5B1A B;  1K34 A;  2A7W A;  4K0K B;  1PL4 A;  4EEQ A;  4DR2 B;  2QKS A;  1K5S A;  1Q6U A;  3OD4 A;  4TT3 G;  1SA0 B;  2XAS A;  1K33 A;  3E2E A;  2RNB A;  4LF8 O;  3DC6 A;  1VAR A;  2QTS A;  4X1K A;  5LHH A;  3RYF B;  4QJF B;  1KEC A;  3AG3 B;  2QGN A;  1Y76 A;  3AK1 A;  3H1H H;  3KKY A;  4IIJ A;  3D3Q A;  4W4L A;  4GX5 A;  1R6T A;  3OTO B;  1K4D C;  3ASO B;  4EFB A;  1VQP V;  5CA3 A;  3J81 N;  2YIB A;  1KP2 A;  3SJC C;  2ITD C;  3HKB B;  2EIK B;  1F23 A;  2KG7 B;  3SDL A;  1KU9 A;  1MG1 A;  1O9G A;  3DXR A;  4B3S O;  2LGQ A;  3G6B A;  4O2A A;  3JAL B;  2QM7 A;  2WWW A;  3CX5 F;  4TV9 B;  5LGN A;  1RFY A;  3E89 A;  5EC1 C;  3TJT A;  1EN5 A;  1MA1 A;  2L35 A;  1AR5 A;  1HR0 O;  4GUN A;  2GUZ B;  1XDC A;  1BS3 A;  1KYO F;  4GCZ A;  4IYI A;  2K9P A;  4J9Z B;  3GWK C;  1HR0 B;  4N23 A;  1M4U A;  5LBQ A;  4UCV A;  3HB3 B;  1YSC A;  1TVK A;  3IC7 A;  1JPX A;  1Q82 W;  4LR3 A;  1GN3 A;  4JI4 B;  4O4H B;  3QO7 A;  4F6R B;  1ZWI C;  1B06 A;  2VWJ A;  4JTD B;  4DV6 B;  1OCO C;  5KHI A;  2AZ0 A;  3CMA V;  1H2S B;  5KMG A;  1N34 B;  3CCS V;  3HKC A;  1Q43 A;  1FXV A;  4HNA A;  3AG3 C;  3CCR V;  4JAA A;  2YIB D;  1L1F A;  1OHH G;  2JGD B;  5B1B C;  4LFC B;  4CH6 A;  1U96 A;  3K5M A;  3OUF A;  1AIL A;  4NR1 A;  5E1A C;  4LWS A;  5EIB D;  1GN4 A;  5J9P C;  2EIN C;  4TUY A;  4LFC O;  3TGU H;  4JF3 A;  3SPJ A;  3F5W C;  3TXQ A;  2NN4 A;  1JJ2 U;  3QNE A;  3RYF A;  2Q7G A;  1NR7 A;  1VQ9 V;  3RFR A;  3ZX6 A;  5KAF Z;  4FLU A;  1Y76 B;  3H1L H;  4LF7 B;  3ZRS A;  4DR1 O;  2JEU A;  1YJW V;  3IC9 A;  3FFQ A;  2GV9 A;  3WG7 C;  3CC7 V;  5J2U A;  4JI8 B;  3L72 H;  1XIL A;  4UV9 A;  4R6Z A; 
#chains in the Genus database with same CATH homology
 3OR7 C;  2WLH A;  3CCM V;  3M99 B;  4XDL A;  3ML0 A;  1F4N A;  1VQ5 V;  5KA6 A;  1Q81 W;  3X2Q B;  3FYI B;  5GW7 A;  1PD3 A;  1JVM A;  2YEV A;  4QE7 A;  4JAU A;  5DN6 G;  2JEX A;  4PDL A;  1M56 B;  3CC2 V;  2CK3 G;  1AI7 A;  3OAA G;  2EIM B;  1BHB A;  2A9H A;  2HG5 C;  2WLK A;  3OE7 G;  4X88 A;  2Q6A A;  3JD3 A;  4QIW F;  1MOF A;  2ATK C;  1PNL A;  2V7Q G;  4BIZ A;  2HLD G;  1FXH A;  1OCC C;  3ASN C;  4XDJ A;  1YHQ V;  1TUE B;  3ZRX A;  2YSU B;  1YTF B;  1GM7 A;  2V1D A;  1RM1 C;  5B1A C;  2HKO A;  4PDM A;  2WLI B;  3FYE B;  1YTF D;  1K73 W;  3FKS G;  1GMG A;  2ZD9 A;  4JAS A;  1ARO P;  4R50 A;  5IY5 B;  2DYR C;  2OCC C;  2MK3 A;  4UUJ C;  4BIU A;  1AJQ A;  2WAM A;  4KUM A;  1YIT V;  1M56 C;  2P67 A;  5LHI A;  2LP7 A;  3CCE V;  3CCU V;  4FMT A;  3MHH C;  5H6Q A;  3QO8 A;  5KUM A;  1CP9 A;  2FTK A;  1MAB G;  3ETD A;  3SYQ A;  1H8E G;  3CC4 V;  1NVP B;  3UKM A;  2R9I A;  2XND G;  4MTG A;  4RAI A;  4E2L A;  1W2B U;  1S3J A;  4MVZ A;  1OZ0 A;  3JD1 A;  3ZIA G;  4MTO A;  3W7W A;  2XOK G;  1RPO A;  2IH1 C;  2P90 A;  5H9C A;  4MVM A;  5IY5 C;  3K06 A;  1Q86 W;  3K08 A;  1G4Y B;  3H01 A;  3F7Y C;  2HVK C;  5CMU A;  2ZDI C;  5EK0 A;  1AR1 B;  3FB5 C;  3ZRW B;  1QCE A;  1VQO V;  2Y69 C;  4MT8 A;  2IW5 A;  4DXW A;  3OM3 B;  4JPR A;  2KB1 A;  3ABL C;  2F43 G;  4MVO A;  3AG4 B;  1LNQ A;  2Q68 A;  2EIK C;  3IGA C;  3LDC A;  3FB7 C;  5EBW C;  4Q20 A;  4PA7 A;  5L3D A;  5LHG A;  3LDE A;  3UM7 A;  2GSM B;  2EIN B;  1S72 V;  5FL7 G;  1QVF U;  1EBO A;  2B1G A;  3HPL C;  3W7T A;  1OCR B;  4RQF A;  3PJS K;  3OUS A;  1K4C C;  3B8N A;  4WCE V;  3T4D A;  3AG1 C;  4I9W A;  3VOU A;  1OCZ B;  3CCQ V;  3EHB B;  2EIJ C;  4LBE C;  4U7O A;  2IU0 A;  4LP8 A;  2OTL V;  1UJW B;  3DTU B;  3ABK C;  4X8A A;  1V54 B;  1NBM G;  2NLJ C;  4KP4 A;  1VQL V;  1VQN V;  4PA6 A;  1SET A;  4PDR A;  4XBF A;  5L3E A;  1V54 C;  2DYR B;  4MVR A;  4I5S A;  4PA3 A;  3ZRV A;  2EZP A;  3ZJZ A;  2EIL B;  2DYS C;  5LGU A;  3OMA B;  2X6B A;  1V55 B;  2OTJ V;  1YJN V;  1H8H G;  3I55 V;  1W0K G;  3EFF K;  2QTO A;  4N21 A;  3ZN1 A;  2DQ0 A;  3R65 A;  3SYO A;  1Y4M A;  2LFR A;  1FS0 G;  3JCZ A;  4R7C A;  3ABM B;  1K97 A;  1K5Q A;  2UXX A;  3OEH G;  3OR6 C;  5KUK A;  1VQK V;  3ZMT A;  3ETG A;  3CCJ V;  5HFL A;  4CZZ A;  1R3J C;  1VQM V;  1NR1 A;  2OT5 A;  1R6K A;  1KP3 A;  3ZMU A;  1K9M W;  4ASU G;  4FJC C;  1QR8 A;  4WFH A;  4GX0 A;  4OXS A;  1E1R G;  1I5X A;  2WLI A;  5B1N A;  1CPY A;  1S76 D;  3JD0 A;  5IYB O;  4WFA V;  2QE7 G;  2Z5U A;  2P6J A;  2IJH A;  4UV8 A;  4ZBM A;  3ASN B;  2A0L A;  2H94 A;  4CBC A;  1H2G A;  1R3I C;  1OCZ C;  4JYC A;  3SPI A;  1VQ6 V;  2W0F C;  2Z3Y A;  1K92 A;  4WF9 V;  1M9N A;  1K7D A;  1BMF G;  3B8M A;  3WFV A;  3CCL V;  1M90 W;  3AG4 C;  2ZQM A;  2JDI G;  3ASO C;  4P30 A;  1GTO A;  3ZN0 A;  4WFF A;  4P2Z A;  2WLM A;  2LFS A;  4UXN A;  3LDD A;  1JX9 A;  4H33 A;  1NVP D;  1P4R A;  5IYC O;  4RQE A;  2ZR3 A;  3VBB A;  4RUE A;  2NNU A;  3IFX A;  1DTO A;  2X7R B;  5EC2 C;  3AG2 C;  4BAY A;  3SYP A;  4QPK A;  3D3I A;  4QNH B;  3ZMV A;  2X6C A;  1QLE C;  4X89 A;  3T1C A;  3KG2 A;  1KC8 W;  1ROP A;  4MTX A;  1QVG U;  3K9A A;  3W7U A;  3G4S V;  1VQ8 V;  2PI5 A;  3K3W A;  3G6E V;  3LUT B;  4WFB V;  1Q7Y W;  4PDV A;  4G28 B;  3SPC A;  1FXK B;  5C93 A;  4LC1 A;  2Y69 B;  4MTF A;  4PEL A;  2BOB C;  2QM8 A;  1R3K C;  4ZKI A;  5KA5 A;  2ZXW B;  3SJQ C;  2QEX V;  3ABL B;  4L87 A;  4MVU A;  3CCV V;  5L3F A;  3OFN G;  2EBO A;  3ETE A;  3CME V;  3SPH A;  3OEE G;  2IJK A;  2BOC C;  3P30 A;  4R8C A;  3SYC A;  5CN0 A;  1EFR G;  4F4L A;  1PKX A;  2OCC B;  3JYC A;  4JAV A;  1KD1 W;  1E1Q G;  3JD4 A;  1OCR C;  4TSF G;  3K79 A;  4LCU C;  1DF4 A;  2XAH A;  4GT1 A;  1KKD A;  5B3S C;  1NH2 B;  3RVZ A;  2IJJ A;  1GM8 A;  4HAM A;  1P7B A;  3STL C;  3MHS C;  1Y66 A;  2HVJ C;  3ZMS A;  3CXC U;  4FIP C;  5B1O A;  3STZ C;  4MW3 A;  1AI4 A;  3LSS A;  2WLL B;  4HYO A;  4P9O A;  2HJF C;  3K04 A;  3B77 A;  1M57 B;  4J9Y B;  1QR9 A;  4XDK A;  2ITC C;  3AG1 B;  1GK9 A;  2EZO A;  4MW8 A;  5B1B B;  4U7N A;  2AHY A;  5L3C A;  2WLL A;  2W6I G;  3E83 A;  4QE9 A;  1SER A;  3BY6 A;  3TCU A;  4MS2 A;  3D36 A;  3GWO A;  1E79 G;  2WSS G;  3F7V C;  2QA4 V;  4FPP A;  5IYD O;  4JTA B;  3CP1 A;  3RW0 A;  1AJN A;  4JTC B;  2DYS B;  2XAQ A;  5HFM A;  2Q69 A;  1ORQ C;  3LSQ A;  2PI4 A;  3E8H A;  2DWE C;  4JYB A;  5LGT A;  3T4Z A;  3CD6 V;  3ABU A;  2YEV B;  5B1A B;  1FXK C;  1K34 A;  1AJP A;  1HWY A;  1DF5 A;  2AHZ A;  2QKS A;  1K5S A;  2ZDI A;  4TT3 G;  3LNM B;  3W7S A;  5H6R A;  2JJ1 G;  3ZCC A;  1N8R W;  2XAS A;  4MSW C;  1K33 A;  3E2E A;  1K3E A;  4BW5 A;  2DWD C;  4JGS A;  1SZT A;  5L3G A;  3WG7 B;  5LHH A;  4Z1M G;  2ZR2 A;  2H8P C;  4QJF B;  1XL6 A;  1IXM A;  1KEC A;  3ZRW A;  4G27 B;  1BL8 A;  2DW4 A;  1FXK A;  3ABK B;  3AG3 B;  3FB6 C;  1M1K W;  3DGE A;  3AEI A;  1SRY A;  4TWK A;  2EIJ B;  5L3B A;  1BHA A;  1VQ7 V;  2B1I A;  1WPX A;  3RBZ A;  4GX5 A;  4P9P A;  2HR3 A;  2WLN A;  1K4D C;  3ASO B;  1VQP V;  1AI5 A;  1KQS U;  5CA3 A;  1F4M A;  1KP2 A;  2B5U A;  5CBF A;  2ITD C;  2A79 B;  3P32 A;  5CBG A;  1NQT A;  2EIK B;  3GB7 C;  2GHY A;  1F23 A;  2XAG A;  1YJ9 V;  3G71 V;  1MG1 A;  1M57 C;  1V55 C;  2X6A A;  3NXS A;  3MD0 A;  5EBL C;  1RM1 B;  1YI2 V;  1COW G;  1AI6 A;  2QM7 A;  3OMI B;  2WWW A;  3E86 A;  1DLB A;  2M7W A;  1SES A;  1YIJ V;  5LGN A;  3TET A;  2Q67 A;  2W6J G;  1F51 A;  3E89 A;  5EC1 C;  1H38 A;  4UVB A;  1WLE A;  1PNK A;  3E8B A;  4DO2 A;  1THZ A;  1GO3 F;  2XAJ A;  3I56 V;  4GX2 A;  5BZB A;  2JJ2 G;  2P7T C;  3ABT A;  5DM6 V;  1ENV A;  2XAF A;  4GCZ A;  4RO2 A;  1FFT B;  1G8M A;  4QPJ A;  4J9Z B;  3AG2 B;  1PNM A;  4N23 A;  4GX1 A;  5LBQ A;  3E8F A;  4UVA A;  4HZ3 A;  3OW2 U;  2R9R B;  3HB3 B;  1JOY A;  1PL0 A;  1S0V A;  1YSC A;  2X0L A;  1W0J G;  1GM9 A;  1JPX A;  2ZXW C;  3IC7 A;  2K1E A;  3TK1 A;  1Q82 W;  1B6Q A;  3QO7 A;  1R73 A;  4G2K A;  3E35 A;  1ZWI C;  4PA9 A;  1JQ0 A;  1JCH A;  4YXW G;  4MVS A;  4JTD B;  1OCO C;  1NH2 D;  2JK5 C;  3CMA V;  1S5H C;  3CCS V;  5EBM C;  2D3O W;  1FXV A;  1OCC B;  1OCO B;  3AG3 C;  2Y48 A;  1I5Y A;  1J95 A;  2UXN A;  2IH3 C;  3BEH A;  3CCR V;  1OHH G;  1L1F A;  1MSW D;  5B1B C;  3OMN B;  3T2M A;  3OUF A;  5E1A C;  1K8A W;  2HFE C;  2EIL C;  3E8G A;  2WPD G;  1RPR A;  3K03 A;  4UVC A;  5J9P C;  2EIN C;  4MVQ A;  2IU3 A;  1GKF A;  3ABM C;  3FB8 C;  4JF3 A;  3ZMZ A;  3SPJ A;  3F5W C;  4FK5 C;  1VQ4 V;  2WLJ A;  4WFG A;  5IDJ A;  1JJ2 U;  3QNE A;  4WFE A;  1NR7 A;  1NKD A;  1VQ9 V;  3K0D A;  1QLE B;  3X2Q C;  3A0R A;  1EZJ A;  3SYA A;  1QBZ A;  1R3L C;  3CYO A;  3QO5 A;  2C2A A;  1S77 D;  2DQ3 A;  1R6N A;  4PA4 A;  3ZRS A;  2EJR A;  4H37 A;  2JIZ G;  3CPW U;  1QLN A;  2JEU A;  3OGC C;  3SPG A;  5B3S B;  1XL4 A;  1YJW V;  3K0G A;  3WG7 C;  4EKW A;  3CC7 V;  1NJI W;  4KFM A;  2EIM C;  5CBH A;  4RUF A;  3JD2 A;  3W7X A;  3RVY A;  4UV9 A;  2IJI A;  4R6Z A;  1CEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...