1NJIW

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1njiW00
3CMEV 3G6EV 1YITV 1VQPV 1S72V 5DM6V 1VQ4V 2QEXV 1QVGU 1JJ2U 1QVFU 1YJNV 1YJWV 1KC8W 1VQMV 3CCRV 4WF9V 1YI2V 1VQNV 3CXCU 1K8AW 1W2BU 2OTLV 1VQ6V 1YHQV 1VQ9V 4WFAV 3CMAV 3CCSV 1R73A 2D3OW 1VQLV 1K73W 4WFBV 1VQKV 3CCQV 3CC7V 2QA4V 3CCUV 1K9MW 3CPWU 1YJ9V 3CCVV 1VQOV 3CC4V 3CD6V 1N8RW 1VQ5V 1VQ7V 3I56V 3CCLV 4WCEV 2OTJV 1Q7YW 3G71V 3OW2U 1YIJV 1Q82W 1KD1W 1VQ8V 3I55V 3CCEV 3CCJV 1NJIW 1KQSU 3G4SV 1Q81W 1M90W 3CCMV 1Q86W 3CC2V 1M1KW
chains in the Genus database with same CATH superfamily
3JARB 2KSDA 1TGOA 2YEVB 1K3EA 3JD0A 4J41A 1NKDA 1G4YB 4DRXB 2MK3A 2IJKA 5IJ9B 1OJHA 2DMXA 2H94A 4RUEA 1IZ3A 4E2LA 1SQQH 4IYHA 4DV6O 3QG5A 5LMUO 1BE3H 3N2GA 2YIDA 4JI6O 3K9SA 4EEQA 4BAYA 4B3SB 2Q67A 4XDLA 3H1KH 2GHYA 5EBWC 4YJ2A 5IWAB 3ETGA 1P84F 1IX9A 5HFMA 5B1BC 3ABKB 2CAZC 3BCCH 3R65A 3ETDA 2EIKB 3CRCA 3SR2C 1R1BA 1AB3A 2ZE6A 1YI2V 1KP3A 4O2BB 4K0KB 4DR2O 1TUBB 2PYLA 2CTQA 2DQ0A 5HFLA 4DW0A 5J2TB 4B3RO 2QR4A 5GONB 4LF6O 2KG7A 1R6TA 2YDEA 1ZLZA 1YVWA 1NTMH 4JZGA 3MAQA 1QU7A 5CA1B 4MVMA 2Q0AA 4GLXA 4H37A 2QSAA 4GCZA 4ZHQB 2EZOA 1Q6IA 1QCEA 3L71H 1FJGB 1N0NA 5GTHZ 4LF7O 4FM0A 1YXBA 1FXKB 1ZTEA 3G67A 1XI1A 3SYQA 3DC6A 1YTFD 4DR3B 2JJ2G 5JVDA 1M5IA 4JI4O 1QQCA 4X1YB 5D5QA 5L3FA 5LHHA 2PI4A 3H9VA 2AGAA 4ZI7B 3ZCCA 3GWKC 3D36A 5L3BA 4B3MO 2YIBD 2Q73A 1L1FA 3CE2A 2W0XA 3ABLC 3AK1A 2PYJA 3K5OA 1H2GA 2ITDC 5JJNB 3A0HZ 1M9NA 1AVMA 1LNQA 4LNUA 1F7YA 2ODMA 2OCCC 4TQFA 4UCVA 1I08A 4UVCA 1NBMG 3U11A 4JZ2A 5EC1C 3U0ZA 3OW2U 4TV9A 1IXMA 3CCEV 4W4LA 2UUCB 3G4SV 1S3JA 2HR3A 4O4JA 4LNUB 5H5NA 3K9AA 3ZHTA 4TV8A 1JJ2U 1U96A 3KZIZ 4LFBO 5JH7A 4DO2A 1SETA 1NVPD 4DV2O 1OCRB 4EFEA 4UFZA 2ZDIC 5K1PA 4U3FH 4FLTA 1SS3A 3K06A 3E86A 4FK5C 4UCRA 2EIJB 1Q7YW 2F4VB 1M93A 2UUAO 4DV4O 1RP3B 3K03A 4O4JB 2RQ6A 2IW5A 4KFMA 4JI0O 2QEXV 5CA3A 3CEIA 5EIBD 3OTOO 1HDJA 3K3WA 1F4MA 4LR3A 2X6BA 2KB1A 3BA8A 3ZHQA 3HR0A 4JAUA 1N4CA 4KL1A 1MOFA 1SQBH 2OT5A 2ZINA 2NR5A 4NXMB 1Y76B 4FVMA 2IU0A 2YXLA 4U3JA 5CN0A 4D6TH 1PP9H 3RT3C 2AW9A 5KHGA 3E22B 5JQGA 3PJSK 4MTFA 1PKXA 2EBOA 2JEXA 3ABMB 3FFQA 5E79Z 3C3SA 4B7KA 3OAAG 2OTJV 4LF4O 3HKDA 4LWSA 3KKYA 4A5UB 1M90W 1S72V 4GZRB 2N74A 3MHSC 5B1OA 1FFTB 5JQGB 5EC2C 2B1IA 4HNAB 1P49A 2ARHA 2ZCEA 3C90A 3UCSC 4DUYB 2IH1C 4LF8O 5CBGA 2ETNA 3SYPA 1Z5VA 2JGDB 1FXHA 3THOA 2UXBB 3L72H 2Q7GA 2B5UA 3ZN0A 4LCUC 1DLBA 1OZ0A 2VS0A 2CK3G 4NTYA 4NTXA 4RQEA 2ZM6O 2HP8A 3JALB 4YY3O 1EN4A 1JA8A 4QGPA 3HKBA 5FNVB 1GN6A 1ZL8B 1KMIZ 3BABA 2ZQMA 3K59A 4PI2A 4PDMA 4JI7O 5L3DA 4FLUA 5IYZA 3HB3B 3D3IA 1BHAA 2XAJA 3P3PA 4X1IB 3ASNB 1OV9A 5EIBC 4JYCA 4PHZA 3SJBC 1OHHG 4O2AA 1Y66A 3BA9A 4JAVA 1URFA 2W6IG 2GUZB 3GWOA 3RFRA 5IY5B 3FD9A 2WLHA 3FYEB 3BVOA 4P9PA 1VQ5V 3HKEA 1Q43A 3AG1C 1K7DA 3WB1A 2HLDG 2EIMB 4Q20A 1P7BA 1QLNA 1WB8A 2Y69C 4OXSA 3M99B 4NVPA 5DM6V 1FAFA 1K97A 4CC6A 3ZHRA 1WA8B 1ZWIC 1AR5A 4LFCO 3JATB 4GT1A 4HBNA 1IBKB 3IC7A 5GW7A 5BXZA 3TXSA 4OPAA 3SPHA 3RBZA 4DR4B 4I0XB 5LL6Y 1KQSU 3SYOA 4U7NA 4XDJA 2QGNA 2WLNA 1V54B 5J2UA 5KUKA 4QJFB 4YIOA 3UO3A 1XHZA 1SZTA 4J7JA 2YI8A 3RYFA 4DV5B 4I50B 3A0BZ 3B8MA 3WB0A 1THZA 2QM4A 1I7FA 3UT5A 5B3SB 1A32A 1KD1W 2WAMA 1JX9A 5LP6A 3OGCC 1TVKA 2P06A 5LYJA 4O4IA 3ZRVA 1NTZH 1BGYH 1GMGA 3B2EE 4PELA 4FZ0A 2LFSA 4J10A 1XQ8A 3FAVB 4LP8A 1YF2A 1K34A 4FLZA 1G8MA 2DYSC 3OTOB 2BOCC 1BHBA 4IIJA 2QWNB 2Q69A 3LSQA 4B3SO 3EHBB 2NNUA 1AROP 3JASA 5KX5A 2DYRB 3K04A 5IWAO 1SA0A 1WPXA 2AZ0A 1VF6C 3T4DA 2F23A 3ZN1A 3JAWA 1PV0A 4I9WA 4BIUA 4LC1A 4X88A 2W6JG 4FMTA 1JOYA 3T1HB 4D7TA 1NVPB 1Y67A 3B77A 3WU2Z 3JASB 1N32B 3A2FA 3SGIA 4K0KO 4UCUA 3ZMSA 1AI7A 1R3KC 4FPPA 3JAWB 2ILMA 4R8CA 4PV1B 3B4SA 1PL4A 3F7VC 2X0LA 2IM9A 5CB4A 5DECA 3GVMA 5LGNA 3T1YB 1Y6XA 4G27B 4JASA 1NR1A 2ZR2A 2R9RB 3FB7C 2GBOA 4CH5A 4ZIBA 2Z3YA 3ZMVA 1NH2B 3ZHUA 4DR7B 3K08A 4R50A 4AQYB 1HNXB 2IJJA 1LUWA 3UM7A 4FFKA 3KCYA 2Q7HA 3IFXA 1FJGO 4JF3A 1PNMA 4K8XA 4WFAV 1VMGA 1K5QA 3ZHSA 5B66Z 3G6BA 3FX7A 2HVJC 1I94B 3OFNG 1XDCA 5EK0A 4DR3O 1PM9A 2ATKC 4CC5A 4WBNA 1BQ0A 1N36B 5LXTB 3O9OA 5EZYA 1FS0G 3H01A 2KKWA 1VQLV 2H8PC 2LGQA 3CCQV 4AILC 5H6RA 4ASUG 1DTOA 2UXXA 1RPOA 3WFVA 1XL6A 3U10A 3EXAA 1AI4A 2CDYA 3ASOB 5C93A 2LGWA 3ZHVA 1PPJH 5E1AC 1KC8W 4LBEC 2GTAA 2FMLA 4JI3B 2VWKA 2ZNJA 5FLXN 3T4ZA 2UUBB 2WLIB 3P32A 2UUCO 2QWOB 1GN2A 1UPGA 3AEIA 1S5JA 3B8NA 3MHHC 4AI8A 5IYDO 5H6QA 1YDXA 1RFYA 4PDVA 4EKWA 4LFCB 4HAMA 2BSKA 1S76D 1GM7A 1JFFB 3CC2V 1CEZA 1FFXB 4O4LA 3B09A 5IDJA 4MS2A 2YSUB 4X66B 4DV7B 3JARA 2QWRB 2R9AA 1B04A 2Q7EA 2PUSA 1MABG 4RO2A 4FIPC 2F4VO 2E3CA 3ZRXA 4DRXA 3CB2A 5IJ9A 2JIZG 1F23A 1T5EA 2QKAA 4DV3B 3ZS8C 5LOVB 2ZE5A 1BCCH 4UCOA 4PA7A 2JVDA 3STLC 2H3OA 4JGSA 1RM1C 1XILA 2ZR3A 4UVBA 1H8HG 4NXMO 2F1MA 3LDCA 4NKGB 2X7RB 2GV9A 4PD4F 1DGSA 4H44B 3E83A 3QO7A 3JD3A 3WG7C 1QR9A 3D36C 1PD3A 4FLVA 3FB8C 4BR6A 1Y4MA 2Z5UA 3CCRV 5LHIA 1W2BU 1GK9A 5JJEB 2X6CA 3BY6A 3F5TA 2WSSG 3KCXA 3DGEA 4JI8B 4XBFA 5TISZ 1COWG 4O2BA 4GX2A 2XAFA 5L3EA 1OCOB 1TUBA 2RNBA 4MVQA 1Q82W 4CS2A 5J2TA 5GONA 1JJOA 1K4CC 1WPBA 1K73W 4LH7A 4DUYO 5LHGA 4MT8A 4JTDB 2UXBO 2HG5C 1P4RA 3AG2C 5CA1A 3L73H 2V1DA 3F5WC 3K79A 1RPRA 4ZBMA 1KP2A 4G28B 4ZHQA 3OR6C 4EB6B 1W59A 1M4UA 2ZIOA 1FXKA 2WLMA 1AJQA 2O57A 1MA1A 4Z2WA 4UB6Z 2A7WA 2HEPA 1AR4A 1QVFU 2AXTZ 2A0LA 4F4LA 2PI5A 2Q9LA 4DK0A 2DWEC 4YHHB 1H2LA 4WFBV 4X1YA 2YXHA 2A79B 1SQVH 3CRQA 4PA4A 4DUZB 4ZI7A 3BPZA 1FD9A 2A9HA 3I55V 2GTSA 3J81N 4P2ZA 4WFEA 1SF9A 4I4TB 2CH7B 2DWDC 1VQNV 1NR7A 2YC0A 3E2EA 2CTPA 2P6JA 3H1JH 2LW1A 1U97A 3JAKB 1WB7A 1M57C 3GB7C 3FB6C 3CC4V 5B1AC 3SPJA 4UV9A 2E74B 1ZSPA 3QVNA 1KECA 1YIJV 3Q4HB 5L3CA 1BQZA 2N05A 3J7AU 2P4VA 3DC5A 1N34B 5FPOA 3W7XA 1IBKO 5KHKA 2BOBC 2WA4A 3X2QC 4DR4O 3IJ4A 1OCZC 4Z1VA 5KA5A 3RYHB 4WCEV 3JSLA 4U7OA 3AG7A 4YJ3B 3K0GA 3E35A 1HNWB 5BR8B 1R6KA 1NI8A 2YS8A 4DW1A 3VQVA 5CBHA 2P67A 2FYUH 4WFGA 3CRAA 4DV5O 4NTWA 4J11A 4TUYB 2D3OW 4QIWF 3CRMA 3DSQA 3MD0A 4CH3A 4YXWG 1VQ7V 5IJ0B 4OGQB 3W7SA 4QPJA 1S5LZ 1I5YA 1Y76A 1BT8A 4O4HB 5B1BB 4JI5B 1EM1A 3ML0A 2A3QA 2DJVA 2VQEB 4PA9A 2YI9A 3E22A 5KHHA 5DN6G 2WLLB 5F2VO 1FXVA 5D5PA 3CCLV 1BSMA 3UQ8A 3MDSA 2IH3C 3OM3B 1HW7A 3JAMN 3JCUZ 4GYCB 3VOUA 4EFBA 1N33B 1NS1A 3T1HO 4Q6GA 4ZKIA 3TCUA 1N32O 4HNAA 3K0DA 2G38A 1SQFA 5KHIA 2JGDA 1SERA 4FM2A 2PGGA 2XTAA 3H1IH 4OX9B 3T1YO 3G6EV 4KHPB 4TWKA 3ZRSA 4NR1A 3RVYA 1L0NH 2CE4A 2DE0X 3RWRD 4GX0A 3JALA 3E8HA 4DR7O 4H0LB 5FNVA 5BY1A 1MG1A 4PI0A 4AQYO 1HNXO 4UCSA 1ZL8A 3ETEA 3CS5A 1SKVA 2ITCC 1NQTA 4DR1B 3AG3C 1H2MA 5JCOA 1DF4A 2E5LB 1NT2B 3OUFA 4X1IA 3OMIB 2M7WA 1FYJA 2HJFC 1YJWV 1I94O 2WLKA 5LP6C 4NB5A 3ABLB 5KAFZ 2XHBA 2DQ3A 4CH4A 2ZE7A 3QNEA 4X20B 3T2MA 1WAZA 4FJCC 2UXNA 4P30A 2ZT9B 1X59A 2GUZA 4MTXA 2ZXWC 3DXRA 4UB8Z 3SYAA 1N36O 3RW0A 2JEUA 2OCCB 3RYIB 4FFBB 4E4EA 1QHTA 1H38A 3RN4A 2ZDIA 5LA6A 1JVMA 1CP9A 2JS3A 2UXDB 4X1KB 1WA8A 3VBBA 3DXRB 1GO3F 4QNHB 1N8RW 3JATA 1RSOB 4X64B 1XREA 1ROPA 4JYBA 4JYAB 2EILC 1M56C 4JI3O 2QKSA 3LNNA 3O65A 4I0XA 5LA6B 2JGUA 2HHHB 1QBZA 2UUBO 1KKCA 1SQPH 4DR6B 4HYOA 2E75B 5BZBA 1YZBA 4I55B 1SESA 4X62B 1Y74B 1IDSA 5IT9N 2CGNA 4WFHA 2QA4V 1JMKC 3CJHB 1NZ6A 3OT7A 1VQOV 1SZXA 5B1NA 4X66O 4I50A 4DV7O 5K1XA 2BE3A 3R66A 3AG4C 3N2KB 2YIBA 2X6AA 3E89A 5EYPB 1YTFB 5L3GA 4DV3O 3FAVA 4GX5A 5EBMC 5LGTA 3K5MA 3P30A 1GM9A 1FPOA 3OD4A 4PDRA 1H2SB 1SRYA 1S77D 3H1LH 2ZE8A 1XNQB 1BL8A 3APOA 4DXWA 1AI6A 4FLYA 1GRJA 1XMQB 1VIBA 4JI8O 3AK2A 2JS5A 4HZ3A 4ABMA 4IGGA 1VQ6V 1V55C 3OTFA 5BMVB 1ENVA 4JTAB 2IJIA 1IVSA 1LR1A 1WP8A 1J95A 4RWUA 4JI2B 1AJNA 2EX3A 3BRCA 3HKCB 3ZEDA 4J9YB 3RYCB 3W7TA 2Y4UA 3CXCU 2K9PA 3ZBHA 1AR1B 3A8TA 1QLEC 2RDCA 1EZJA 3AK3A 3LUTB 4F6RB 2ADPA 1XHXA 1I0HA 3QO8A 3WB2A 3FYIB 2AHZA 1XMOB 1Z5WA 4YHHO 1MNGA 1VQPV 4JTCB 5J9PC 2JK5C 2OIEA 3AG1B 2P22C 4DUZO 4X65B 4X9QA 2N04A 5LXTA 4NXNB 2Y69B 4PJ0Z 2LQTA 2JRIA 2NN4A 4RQFA 5ITZB 1B3QA 2YICA 2IBZH 3JYCA 1CXZB 5CA0B 1PNLA 3ABKC 1B06A 2L6LA 2RCVA 5KAIZ 1ZUQA 4CBCA 1KUQA 1F4NA 2EIKC 4PA3A 2RMKB 2WLIA 2XT9A 4I7ZB 1N34O 1MSDA 1H2KA 4MVOA 3CMEV 4MTGA 1JFFA 4DV0B 1US6A 1FFXA 2OTLV 1AJPA 1QR8A 1HR0B 1Q90D 1E1QG 2WWWA 4J80A 4IT5A 2BTQB 1HNWO 5IYCO 4QE7A 1EN6A 4IHJB 4PDLA 5BR8O 2WA3A 2F93B 2PTMA 3ZJZA 4LFAB 2R70A 2Y48A 1O9HA 1XOUA 3IC9A 4LF5B 2DYSB 4Z1MG 1YITV 5JWPA 1FXKC 3ICXA 4JV5B 5LOVA 3L70H 4MVZA 1XL4A 2YIAA 2MW2B 4UVAA 4JI5O 2XAQA 4K3AA 2QE7G 2GSMB 2YXYA 3SJCC 4TOIA 3LSSA 3P3NA 2VQEO 2L35A 1VQ4V 3BFRA 3D3QA 4TSFG 3CCSV 1WP7A 4IL6Z 3SDLA 2LFRA 4B3TB 3CX5F 2FKXA 1AILA 2QTSA 5B5EZ 1N33O 3M8AA 3ZRWB 3K57A 4DV1B 1H2NA 2A06H 4LF9B 3M7MX 5FPRA 3H1HH 2CGOA 1L8DA 3SPCA 1UJWB 4CS4A 1IBMB 3VQYA 1TA8A 4OX9O 4R7CA 4ZOLB 4KHPO 3T1CA 3C3TA 3VQXA 2HFEC 3HPLC 4EB6A 1OCRC 4TT3G 1F51A 3F7YC 3JCZA 5LGUA 3UO2A 1FKAO 1GH6A 1K92A 1YEWA 3JD1A 4OPHA 3TJTA 4RUFA 4FLWA 2EIJC 4LH6A 4DR1O 1BZKA 1J5EB 3IGAC 3FB5C 4AHCA 1AP5A 2E5LO 1Q6HA 2NLJC 3ZMUA 3N2GB 4H33A 2OYQA 2F95B 1GN3A 2DN9A 3W7UA 1JQ0A 3L74H 3L75H 4YJ2B 4MW8A 1EFRG 1SQXH 4I4TA 2CH7A 1XNRB 2XNDG 3CC7V 1K9MW 2CTWA 3JAKA 2EJRA 2Y0IA 3OMAB 2ZKOA 1SC5B 2R72A 3CCJV 1ORQC 3LDDA 2UXDO 1EBOA 3ABMC 2QTOA 3Q4HA 5KMGA 3QF7A 3B40A 1PL0A 4DR5B 2KG7B 3BEHA 4X64O 1DK1A 3OE7G 1G6UA 4JYAO 4FM1A 2HHHO 3IAYA 4DR6O 3N27A 5LMNB 4GX1A 3RYHA 4GKJB 4X89A 1HWYA 2VRZA 4X62O 4YJ3A 5KMGB 2ZIMA 3SPIA 2XASA 1ZAUA 1VQ9V 3OEEG 1IBLB 1W0KG 1VQKV 3TETA 1YCIA 3BHPA 4TUYA 3CP1A 2DOSA 4JI1B 2FL4A 1RM1B 3UKMA 5H2FZ 2DW4A 2Q0OC 5DEDA 1L0LH 1NJIW 4K35A 2VQFB 5A9GA 2W0FC 4BIZA 5JVDB 1Q86W 1VEWA 3I5DA 1LUVA 1GAXA 5IJ0A 4QE9A 5JCOC 3WG7B 1UFIA 1GKFA 4O4HA 3ASNC 5C8YA 2HKOA 2FTKA 1WLEA 3RGBA 2CUGA 1VP7A 1I5XA 2WLLA 4MVSA 3K58A 3CWBH 2XAHA 4KP4A 3BAAA 2GDSA 2ZNIA 2UXCB 5IY5C 1XNQO 2AZ2A 2UU9B 5C8YB 3TK1A 2HVKC 3CXHF 2EIMC 3TXQA 3OMNB 3RVZA 3SJQC 5KLVH 4TV9B 2OIGA 1XMQO 1JR9A 2XOKG 4GKKB 1W0JG 2B9ZA 3AG2B 3KG2A 4MVRA 4TV8B 2V4DA 1HNZB 4J42A 5A2QN 5JH7B 5IE9A 2PF4E 5KUMA 4WF9V 2AHYA 2P7TC 4CZZA 2V7QG 2Y4TA 1NH2D 3S3WA 4JI2O 1NTKH 2P90A 1MZFA 2EINC 1V54C 4KXRA 3I56V 3OUSA 4G2KA 1K5SA 3OGIB 2Q68A 2LP7A 1XBLA 4CS3A 3CYOA 2Y0PA 1H8EG 4W4KA 3LDEA 1MSWD 4DV6B 3STZC 3K5LA 2F66C 5LMUB 5B3SC 4JI6B 4DK1A 1AP6A 4RAIA 1XMOO 1JPXA 4F6EA 2OWOA 2YUAA 4U3JB 4X20A 1VQ8V 4BIOA 4X65O 1KBHA 1QNMA 4K8ZA 1M57B 1VF7A 5B1AB 4NXNO 3RYIA 1EN5A 4ICGA 5CBFA 4FFBA 1VF5B 1YHQV 3CMAV 1KB9F 4UV8A 2QM7A 2R9IA 4WFFA 4H13B 3HKDB 4LWSB 2DYRC 2QWPB 1YJ9V 2M6YA 4X1KA 5KHJA 4DR2B 4YIPA 2Z0AA 3L9DA 3X2QB 4J7KA 1Q81W 1RSOA 4B3RB 4LF6B 1OCZB 3QTCA 3S3XA 4MTOA 4I5SA 2OCHA 4UCTA 5CMUA 1EZVH 1R3LC 3JD2A 4JPRA 4MSWC 1N0JA 1WN7A 2XUMA 5EBLC 4XDKA 1TUEB 5FL7G 1Q8IA 4I55A 4X8AA 4C7UA 1Y74A 3CJHA 4DV0O 1OCCC 4LF7B 3EFFK 3HKBB 1HR0O 4JAAA 5JJJB 1Q3EA 3N2KA 5IYZB 1JCHA 4LFAO 1Z2GA 5EYPA 3E8FA 4JI4B 3CPWU 3CD6V 4LF5O 1S0VA 5AG2A 1K4DC 2Q6AA 3ABUA 4JV5O 1KU9A 4B3MB 1M1KW 4O2AB 1Q6UA 1XEQA 3PN1A 1GM8A 4MVUA 3HKEB 3SYCA 2KQXA 1PNKA 4J7ZA 1TAEA 3CCVV 2VWJA 3SJAC 4PA6A 3CRRA 2EINB 4GUNA 3QO5A 4BW9A 2PY5A 3JD4A 4B3TO 1CPYA 4JYYA 4L8JA 3ASOC 3W7WA 3G80A 4LFBB 4UXNA 5BMVA 1E1RG 4DV1O 1D2DA 4DV2B 4LF9O 2BTOA 3OR7C 5J2UB 1R3IC 1X4TA 4DYLA 2PZSA 1Q5OA 4N21A 1QVGU 1IBMO 2UUAB 4CH6A 3AG3B 4DV4B 1K8AW 3HKCA 3VQWA 3NXSA 1IXBA 1SQGA 4N23A 3RYFB 3RYCA 1WNSA 4JI0B 2Q4PA 3UT5B 5LP6B 4KUMA 4F6RA 1TVKB 5LYJB 4O4IB 1B6QA 2FB5A 4MW3A 3J80N 1J5EO 2ZXWB 2WPDG 1VQMV 4IYIA 4D7SA 1MMMA 3DTUB 2E76B 4UUJC 4IIJB 4P9OA 2IJHA 2B1GA 2P4KA 2QKCA 3JSNA 1ZX3A 5KX5B 3LSUA 5GTIZ 2BCCH 5IYBO 1SA0B 5LBQA 2RJZA 3CCUV 3E8GA 5ITZA 1XNRO 4LF4B 2Q8VA 4B7EA 1WJZA 2QJ1A 5H9CA 1OCCB 4TQDA 4FZ1A 5CA0A 4FLXA 2EILB 1M56B 2LJ2A 1KKDA 3K5NA 3ZIAG 1GTOA 4I9QA 4LF8B 1HP8A 1XUQA 4J9ZB 4DR5O 3ZMZA 5CB4B 1OCOC 2D2CB 5KA6A 2IU3A 3E8BA 3FKSG 2ZM6B 3AG4B 4YY3B 1D5AA 5LMNO 2HJDA 1GN4A 3A0RA 4GKJO 2XAGA 1AI5A 1E79G 2BTQA 3CHXA 3OEHG 1MZEA 2QM8A 4JI7B 4IHJA 1K33A 2JDIG 3ZMTA 1IBLO 4JI1O 1KYOF 1R73A 2QWQB 3CSXA 3ABTA 2P5OA 2VQFO 2ADQB 1NU1H 2LW7A 3ZX6A 4WBNB 2F43G 3D8CA 1VF6A 2WLJA 1R6NA 5EZYB 1R3JC 1O9GA 1DF5A 2CTRA 1S5HC 1YJNV 1BS3A 3SPGA 2C2AA 1BMFG 3APQA 4BW5A 2EJ7A 4B08A 2Q5ZA 1P7GA 3TGUH 3LNMB 4NYKA 2UXCO 1V55B 1G1XB 2UU9O 3EVKA 4L87A 2RN9A 2EULA 3CCMV 4QPKA 3ZRWA 2ZD9A 2YEVA 3NR7A 2LO1A 3ETQA 1YSCA 4GKKO 2K1EA 4R6ZA 2JJ1G 2EZPA 1HNZO 2BSKB 1D5NA 1VARA 2QDOA 3G71V 1V9PA 4O4LB 1QLEB 4ZOLA 4BWAA 1IURA
chains in the Genus database with same CATH topology
3ZMSA 1AI7A 1R3KC 2YEVB 4FPPA 1K3EA 3JD0A 4QE9A 4R8CA 1H38A 2ZDIA 1NKDA 3WG7B 3F7VC 1G4YB 2X0LA 1GKFA 1JVMA 1CP9A 5LGNA 4G27B 3ASNC 2HKOA 2FTKA 1NR1A 4JASA 2ZR2A 3VBBA 1WLEA 1GO3F 2R9RB 3FB7C 2MK3A 2IJKA 4QNHB 2H94A 1N8RW 4RUEA 2Z3YA 1I5XA 3ZMVA 1NH2B 4E2LA 3K08A 4R50A 2WLLA 2IJJA 4MVSA 1ROPA 4JYBA 3UM7A 2XAHA 2EILC 1M56C 2QKSA 4KP4A 1QBZA 5IY5C 4BAYA 3IFXA 2Q67A 4HYOA 4JF3A 5BZBA 1PNMA 4XDLA 2GHYA 3TK1A 2HVKC 4WFAV 1K5QA 2EIMC 1SESA 3OMNB 5EBWC 3RVZA 3SJQC 4WFHA 2HVJC 3ETGA 2QA4V 5HFMA 1VQOV 5B1BC 3OFNG 5EK0A 5B1NA 2XOKG 3ABKB 2ATKC 1W0JG 3AG2B 3KG2A 3ETDA 3R65A 4MVRA 3AG4C 2EIKB 2X6AA 3E89A 5KUMA 4WF9V 1YI2V 1FS0G 2AHYA 2P7TC 1KP3A 3H01A 4CZZA 2V7QG 1NH2D 1VQLV 2H8PC 1YTFB 3CCQV 2P90A 5L3GA 2EINC 5H6RA 1V54C 2DQ0A 4ASUG 5HFLA 1DTOA 2UXXA 3I56V 3OUSA 1RPOA 3WFVA 1XL6A 4G2KA 1K5SA 4GX5A 1AI4A 2Q68A 2LP7A 3ASOB 5EBMC 5C93A 3CYOA 5LGTA 1H8EG 3P30A 1GM9A 5E1AC 3LDEA 1MSWD 1KC8W 4MVMA 4PDRA 4LBEC 4H37A 3STZC 5B3SC 4GCZA 4RAIA 1SRYA 3T4ZA 2WLIB 2EZOA 3P32A 1QCEA 1S77D 1JPXA 3AEIA 3B8NA 1FXKB 3MHHC 5IYDO 5H6QA 4PDVA 1BL8A 4EKWA 1VQ8V 4DXWA 1AI6A 4HAMA 3SYQA 1S76D 1GM7A 3CC2V 1CEZA 1YTFD 1M57B 2JJ2G 5B1AB 4MS2A 5IDJA 2YSUB 4HZ3A 5CBFA 2PI4A 5L3FA 5LHHA 1YHQV 1VQ6V 1V55C 3CMAV 1MABG 4RO2A 4FIPC 4UV8A 2QM7A 1ENVA 3ZCCA 4JTAB 2IJIA 2R9IA 4WFFA 3D36A 5L3BA 2DYRC 1YJ9V 1J95A 3ZRXA 1L1FA 2JIZG 1F23A 1AJNA 3ABLC 3X2QB 1Q81W 1H2GA 2ITDC 1OCZB 4J9YB 4PA7A 3STLC 4MTOA 4I5SA 3W7TA 4JGSA 1M9NA 1LNQA 1RM1C 5CMUA 2ZR3A 1R3LC 4UVBA 3CXCU 1H8HG 3JD2A 2OCCC 1AR1B 4JPRA 4MSWC 3LDCA 1QLEC 5EBLC 2X7RB 1EZJA 4XDKA 3LUTB 1TUEB 4UVCA 5FL7G 4X8AA 3E83A 1NBMG 3QO8A 3QO7A 3JD3A 3WG7C 1QR9A 5EC1C 3OW2U 1IXMA 3FYIB 2AHZA 1PD3A 3CCEV 3FB8C 1OCCC 3G4SV 3EFFK 1S3JA 2HR3A 1Y4MA 1VQPV 4JTCB 3K9AA 1JJ2U 2Z5UA 2JK5C 5J9PC 3CCRV 3AG1B 5LHIA 1W2BU 1GK9A 4DO2A 1SETA 2X6CA 3BY6A 1NVPD 1JCHA 2WSSG 3DGEA 1OCRB 4XBFA 2Y69B 1COWG 2ZDIC 4GX2A 3K06A 3E8FA 3CPWU 3CD6V 2XAFA 5L3EA 1OCOB 3E86A 4FK5C 2EIJB 1Q7YW 1S0VA 4RQFA 1K4DC 4MVQA 1Q82W 2Q6AA 1K4CC 3ABUA 3K03A 1K73W 2IW5A 4KFMA 1M1KW 3JYCA 2QEXV 5CA3A 5LHGA 4MT8A 3K3WA 4JTDB 1PNLA 3ABKC 1F4MA 2X6BA 2HG5C 2KB1A 1P4RA 1GM8A 3AG2C 4MVUA 4CBCA 2V1DA 3F5WC 3SYCA 1F4NA 4JAUA 1PNKA 2EIKC 3K79A 1RPRA 3CCVV 1MOFA 2OT5A 4ZBMA 4PA3A 1KP2A 4G28B 3OR6C 2WLIA 1FXKA 2WLMA 4MVOA 1AJQA 4PA6A 2IU0A 2EINB 3QO5A 5CN0A 3CMEV 3JD4A 4MTGA 1QVFU 1CPYA 2A0LA 4F4LA 2PI5A 2OTLV 2DWEC 1AJPA 1QR8A 1E1QG 3ASOC 3PJSK 3W7WA 4WFBV 2WWWA 4MTFA 1PKXA 2A79B 2EBOA 2JEXA 3ABMB 5IYCO 4PA4A 4QE7A 4PDLA 4UXNA 1E1RG 3OAAG 2OTJV 3OR7C 1R3IC 2A9HA 3ZJZA 3I55V 2Y48A 1M90W 4P2ZA 2DYSB 4WFEA 4Z1MG 1YITV 1S72V 4N21A 3MHSC 5B1OA 1QVGU 1FXKC 1FFTB 3AG3B 2DWDC 1VQNV 1NR7A 1K8AW 5EC2C 4MVZA 3NXSA 2B1IA 4N23A 3E2EA 1XL4A 2IH1C 2P6JA 4UVAA 5CBGA 3SYPA 1FXHA 1M57C 3GB7C 3FB6C 3CC4V 5B1AC 3SPJA 4UV9A 4KUMA 2XAQA 1KECA 2B5UA 3ZN0A 2QE7G 2GSMB 1YIJV 4LCUC 1DLBA 1OZ0A 3LSSA 2CK3G 5L3CA 1B6QA 4MW3A 4RQEA 1VQ4V 2ZXWB 2WPDG 3W7XA 1VQMV 3DTUB 4TSFG 3CCSV 2ZQMA 2BOBC 2LFRA 3X2QC 4PDMA 4UUJC 5L3DA 4P9OA 2IJHA 1OCZC 5KA5A 2B1GA 3HB3B 3D3IA 4WCEV 1BHAA 2XAJA 4U7OA 3K0GA 3E35A 5IYBO 3ASNB 3ZRWB 5LBQA 3CCUV 3E8GA 4JYCA 1R6KA 5CBHA 2P67A 4WFGA 1OHHG 5H9CA 1Y66A 3SPCA 1OCCB 2D3OW 1UJWB 4JAVA 2W6IG 3GWOA 2EILB 1M56B 4QIWF 5IY5B 2WLHA 3FYEB 1KKDA 3MD0A 4P9PA 1VQ5V 4YXWG 4R7CA 3ZIAG 1GTOA 1VQ7V 3T1CA 3AG1C 1K7DA 2HLDG 2EIMB 4Q20A 2HFEC 3HPLC 1P7BA 3W7SA 1OCRC 4TT3G 1F51A 1QLNA 4QPJA 3F7YC 2Y69C 3JCZA 1I5YA 3M99B 4J9ZB 4OXSA 5LGUA 5DM6V 1K92A 5B1BB 3JD1A 3ZMZA 4RUFA 1K97A 1OCOC 3ML0A 2EIJC 5KA6A 2IU3A 1ZWIC 4PA9A 3E8BA 3FKSG 3AG4B 4GT1A 5DN6G 3A0RA 2WLLB 3FB5C 3IGAC 3IC7A 1FXVA 5GW7A 2NLJC 2XAGA 3CCLV 1AI5A 1E79G 3RBZA 3SPHA 3ZMUA 3OEHG 4H33A 2QM8A 1KQSU 2IH3C 3OM3B 3SYOA 4U7NA 4XDJA 1K33A 3W7UA 2WLNA 1V54B 1JQ0A 2JDIG 3ZMTA 4QJFB 5KUKA 3VOUA 4MW8A 1EFRG 1R73A 4ZKIA 1SZTA 2XNDG 3ABTA 3TCUA 3CC7V 3K0DA 1K9MW 2EJRA 3B8MA 3OMAB 1THZA 2F43G 1KD1W 5B3SB 1SERA 3CCJV 1ORQC 2WLJA 2WAMA 1JX9A 3LDDA 1R6NA 3OGCC 1R3JC 3G6EV 1EBOA 3ABMC 3ZRVA 1DF5A 2QTOA 1S5HC 4TWKA 1YJNV 3SPGA 2C2AA 3ZRSA 1GMGA 3RVYA 4PELA 4GX0A 2LFSA 3E8HA 1PL0A 4LP8A 3BEHA 1BMFG 1MG1A 4BW5A 1K34A 1G8MA 3OE7G 2DYSC 3ETEA 2BOCC 2ITCC 3LNMB 1BHBA 1NQTA 3AG3C 2Q69A 3LSQA 1V55B 3EHBB 4GX1A 4L87A 2NNUA 1AROP 3CCMV 1DF4A 4X89A 1HWYA 2DYRB 4QPKA 3OUFA 3K04A 3OMIB 2M7WA 2ZD9A 2HJFC 3ZRWA 1YJWV 1WPXA 3SPIA 2XASA 3T4DA 2YEVA 2WLKA 3ZN1A 1VQ9V 3ABLB 3OEEG 2DQ3A 4I9WA 4BIUA 1W0KG 1YSCA 4LC1A 3TETA 2K1EA 1VQKV 3QNEA 4R6ZA 2W6JG 4X88A 2JJ1G 4FJCC 3CP1A 4FMTA 2UXNA 4P30A 3T2MA 1JOYA 2EZPA 4MTXA 1RM1B 3UKMA 2ZXWC 1NVPB 3SYAA 3RW0A 3G71V 2JEUA 2OCCB 3B77A 2DW4A 1NJIW 1QLEB 2W0FC 4BIZA 1Q86W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME V;  3G6E V;  1YIT V;  1VQP V;  1S72 V;  5DM6 V;  1VQ4 V;  2QEX V;  1QVG U;  1JJ2 U;  1QVF U;  1YJN V;  1YJW V;  1KC8 W;  1VQM V;  3CCR V;  4WF9 V;  1YI2 V;  1VQN V;  3CXC U;  1K8A W;  1W2B U;  2OTL V;  1VQ6 V;  1YHQ V;  1VQ9 V;  4WFA V;  3CMA V;  3CCS V;  1R73 A;  2D3O W;  1VQL V;  1K73 W;  4WFB V;  1VQK V;  3CCQ V;  3CC7 V;  2QA4 V;  3CCU V;  1K9M W;  3CPW U;  1YJ9 V;  3CCV V;  1VQO V;  3CC4 V;  3CD6 V;  1N8R W;  1VQ5 V;  1VQ7 V;  3I56 V;  3CCL V;  4WCE V;  2OTJ V;  1Q7Y W;  3G71 V;  3OW2 U;  1YIJ V;  1Q82 W;  1KD1 W;  1VQ8 V;  3I55 V;  3CCE V;  3CCJ V;  1NJI W;  1KQS U;  3G4S V;  1Q81 W;  1M90 W;  3CCM V;  1Q86 W;  3CC2 V;  1M1K W; 
#chains in the Genus database with same CATH topology
 3JAR B;  2KSD A;  1TGO A;  2YEV B;  1K3E A;  3JD0 A;  4J41 A;  1NKD A;  1G4Y B;  4DRX B;  2MK3 A;  2IJK A;  5IJ9 B;  1OJH A;  2DMX A;  2H94 A;  4RUE A;  1IZ3 A;  4E2L A;  1SQQ H;  4IYH A;  4DV6 O;  3QG5 A;  5LMU O;  1BE3 H;  3N2G A;  2YID A;  4JI6 O;  3K9S A;  4EEQ A;  4BAY A;  4B3S B;  2Q67 A;  4XDL A;  3H1K H;  2GHY A;  5EBW C;  4YJ2 A;  5IWA B;  3ETG A;  1P84 F;  1IX9 A;  5HFM A;  5B1B C;  3ABK B;  2CAZ C;  3BCC H;  3R65 A;  3ETD A;  2EIK B;  3CRC A;  3SR2 C;  1R1B A;  1AB3 A;  2ZE6 A;  1YI2 V;  1KP3 A;  4O2B B;  4K0K B;  4DR2 O;  1TUB B;  2PYL A;  2CTQ A;  2DQ0 A;  5HFL A;  4DW0 A;  5J2T B;  4B3R O;  2QR4 A;  5GON B;  4LF6 O;  2KG7 A;  1R6T A;  2YDE A;  1ZLZ A;  1YVW A;  1NTM H;  4JZG A;  3MAQ A;  1QU7 A;  5CA1 B;  4MVM A;  2Q0A A;  4GLX A;  4H37 A;  2QSA A;  4GCZ A;  4ZHQ B;  2EZO A;  1Q6I A;  1QCE A;  3L71 H;  1FJG B;  1N0N A;  5GTH Z;  4LF7 O;  4FM0 A;  1YXB A;  1FXK B;  1ZTE A;  3G67 A;  1XI1 A;  3SYQ A;  3DC6 A;  1YTF D;  4DR3 B;  2JJ2 G;  5JVD A;  1M5I A;  4JI4 O;  1QQC A;  4X1Y B;  5D5Q A;  5L3F A;  5LHH A;  2PI4 A;  3H9V A;  2AGA A;  4ZI7 B;  3ZCC A;  3GWK C;  3D36 A;  5L3B A;  4B3M O;  2YIB D;  2Q73 A;  1L1F A;  3CE2 A;  2W0X A;  3ABL C;  3AK1 A;  2PYJ A;  3K5O A;  1H2G A;  2ITD C;  5JJN B;  3A0H Z;  1M9N A;  1AVM A;  1LNQ A;  4LNU A;  1F7Y A;  2ODM A;  2OCC C;  4TQF A;  4UCV A;  1I08 A;  4UVC A;  1NBM G;  3U11 A;  4JZ2 A;  5EC1 C;  3U0Z A;  3OW2 U;  4TV9 A;  1IXM A;  3CCE V;  4W4L A;  2UUC B;  3G4S V;  1S3J A;  2HR3 A;  4O4J A;  4LNU B;  5H5N A;  3K9A A;  3ZHT A;  4TV8 A;  1JJ2 U;  1U96 A;  3KZI Z;  4LFB O;  5JH7 A;  4DO2 A;  1SET A;  1NVP D;  4DV2 O;  1OCR B;  4EFE A;  4UFZ A;  2ZDI C;  5K1P A;  4U3F H;  4FLT A;  1SS3 A;  3K06 A;  3E86 A;  4FK5 C;  4UCR A;  2EIJ B;  1Q7Y W;  2F4V B;  1M93 A;  2UUA O;  4DV4 O;  1RP3 B;  3K03 A;  4O4J B;  2RQ6 A;  2IW5 A;  4KFM A;  4JI0 O;  2QEX V;  5CA3 A;  3CEI A;  5EIB D;  3OTO O;  1HDJ A;  3K3W A;  1F4M A;  4LR3 A;  2X6B A;  2KB1 A;  3BA8 A;  3ZHQ A;  3HR0 A;  4JAU A;  1N4C A;  4KL1 A;  1MOF A;  1SQB H;  2OT5 A;  2ZIN A;  2NR5 A;  4NXM B;  1Y76 B;  4FVM A;  2IU0 A;  2YXL A;  4U3J A;  5CN0 A;  4D6T H;  1PP9 H;  3RT3 C;  2AW9 A;  5KHG A;  3E22 B;  5JQG A;  3PJS K;  4MTF A;  1PKX A;  2EBO A;  2JEX A;  3ABM B;  3FFQ A;  5E79 Z;  3C3S A;  4B7K A;  3OAA G;  2OTJ V;  4LF4 O;  3HKD A;  4LWS A;  3KKY A;  4A5U B;  1M90 W;  1S72 V;  4GZR B;  2N74 A;  3MHS C;  5B1O A;  1FFT B;  5JQG B;  5EC2 C;  2B1I A;  4HNA B;  1P49 A;  2ARH A;  2ZCE A;  3C90 A;  3UCS C;  4DUY B;  2IH1 C;  4LF8 O;  5CBG A;  2ETN A;  3SYP A;  1Z5V A;  2JGD B;  1FXH A;  3THO A;  2UXB B;  3L72 H;  2Q7G A;  2B5U A;  3ZN0 A;  4LCU C;  1DLB A;  1OZ0 A;  2VS0 A;  2CK3 G;  4NTY A;  4NTX A;  4RQE A;  2ZM6 O;  2HP8 A;  3JAL B;  4YY3 O;  1EN4 A;  1JA8 A;  4QGP A;  3HKB A;  5FNV B;  1GN6 A;  1ZL8 B;  1KMI Z;  3BAB A;  2ZQM A;  3K59 A;  4PI2 A;  4PDM A;  4JI7 O;  5L3D A;  4FLU A;  5IYZ A;  3HB3 B;  3D3I A;  1BHA A;  2XAJ A;  3P3P A;  4X1I B;  3ASN B;  1OV9 A;  5EIB C;  4JYC A;  4PHZ A;  3SJB C;  1OHH G;  4O2A A;  1Y66 A;  3BA9 A;  4JAV A;  1URF A;  2W6I G;  2GUZ B;  3GWO A;  3RFR A;  5IY5 B;  3FD9 A;  2WLH A;  3FYE B;  3BVO A;  4P9P A;  1VQ5 V;  3HKE A;  1Q43 A;  3AG1 C;  1K7D A;  3WB1 A;  2HLD G;  2EIM B;  4Q20 A;  1P7B A;  1QLN A;  1WB8 A;  2Y69 C;  4OXS A;  3M99 B;  4NVP A;  5DM6 V;  1FAF A;  1K97 A;  4CC6 A;  3ZHR A;  1WA8 B;  1ZWI C;  1AR5 A;  4LFC O;  3JAT B;  4GT1 A;  4HBN A;  1IBK B;  3IC7 A;  5GW7 A;  5BXZ A;  3TXS A;  4OPA A;  3SPH A;  3RBZ A;  4DR4 B;  4I0X B;  5LL6 Y;  1KQS U;  3SYO A;  4U7N A;  4XDJ A;  2QGN A;  2WLN A;  1V54 B;  5J2U A;  5KUK A;  4QJF B;  4YIO A;  3UO3 A;  1XHZ A;  1SZT A;  4J7J A;  2YI8 A;  3RYF A;  4DV5 B;  4I50 B;  3A0B Z;  3B8M A;  3WB0 A;  1THZ A;  2QM4 A;  1I7F A;  3UT5 A;  5B3S B;  1A32 A;  1KD1 W;  2WAM A;  1JX9 A;  5LP6 A;  3OGC C;  1TVK A;  2P06 A;  5LYJ A;  4O4I A;  3ZRV A;  1NTZ H;  1BGY H;  1GMG A;  3B2E E;  4PEL A;  4FZ0 A;  2LFS A;  4J10 A;  1XQ8 A;  3FAV B;  4LP8 A;  1YF2 A;  1K34 A;  4FLZ A;  1G8M A;  2DYS C;  3OTO B;  2BOC C;  1BHB A;  4IIJ A;  2QWN B;  2Q69 A;  3LSQ A;  4B3S O;  3EHB B;  2NNU A;  1ARO P;  3JAS A;  5KX5 A;  2DYR B;  3K04 A;  5IWA O;  1SA0 A;  1WPX A;  2AZ0 A;  1VF6 C;  3T4D A;  2F23 A;  3ZN1 A;  3JAW A;  1PV0 A;  4I9W A;  4BIU A;  4LC1 A;  4X88 A;  2W6J G;  4FMT A;  1JOY A;  3T1H B;  4D7T A;  1NVP B;  1Y67 A;  3B77 A;  3WU2 Z;  3JAS B;  1N32 B;  3A2F A;  3SGI A;  4K0K O;  4UCU A;  3ZMS A;  1AI7 A;  1R3K C;  4FPP A;  3JAW B;  2ILM A;  4R8C A;  4PV1 B;  3B4S A;  1PL4 A;  3F7V C;  2X0L A;  2IM9 A;  5CB4 A;  5DEC A;  3GVM A;  5LGN A;  3T1Y B;  1Y6X A;  4G27 B;  4JAS A;  1NR1 A;  2ZR2 A;  2R9R B;  3FB7 C;  2GBO A;  4CH5 A;  4ZIB A;  2Z3Y A;  3ZMV A;  1NH2 B;  3ZHU A;  4DR7 B;  3K08 A;  4R50 A;  4AQY B;  1HNX B;  2IJJ A;  1LUW A;  3UM7 A;  4FFK A;  3KCY A;  2Q7H A;  3IFX A;  1FJG O;  4JF3 A;  1PNM A;  4K8X A;  4WFA V;  1VMG A;  1K5Q A;  3ZHS A;  5B66 Z;  3G6B A;  3FX7 A;  2HVJ C;  1I94 B;  3OFN G;  1XDC A;  5EK0 A;  4DR3 O;  1PM9 A;  2ATK C;  4CC5 A;  4WBN A;  1BQ0 A;  1N36 B;  5LXT B;  3O9O A;  5EZY A;  1FS0 G;  3H01 A;  2KKW A;  1VQL V;  2H8P C;  2LGQ A;  3CCQ V;  4AIL C;  5H6R A;  4ASU G;  1DTO A;  2UXX A;  1RPO A;  3WFV A;  1XL6 A;  3U10 A;  3EXA A;  1AI4 A;  2CDY A;  3ASO B;  5C93 A;  2LGW A;  3ZHV A;  1PPJ H;  5E1A C;  1KC8 W;  4LBE C;  2GTA A;  2FML A;  4JI3 B;  2VWK A;  2ZNJ A;  5FLX N;  3T4Z A;  2UUB B;  2WLI B;  3P32 A;  2UUC O;  2QWO B;  1GN2 A;  1UPG A;  3AEI A;  1S5J A;  3B8N A;  3MHH C;  4AI8 A;  5IYD O;  5H6Q A;  1YDX A;  1RFY A;  4PDV A;  4EKW A;  4LFC B;  4HAM A;  2BSK A;  1S76 D;  1GM7 A;  1JFF B;  3CC2 V;  1CEZ A;  1FFX B;  4O4L A;  3B09 A;  5IDJ A;  4MS2 A;  2YSU B;  4X66 B;  4DV7 B;  3JAR A;  2QWR B;  2R9A A;  1B04 A;  2Q7E A;  2PUS A;  1MAB G;  4RO2 A;  4FIP C;  2F4V O;  2E3C A;  3ZRX A;  4DRX A;  3CB2 A;  5IJ9 A;  2JIZ G;  1F23 A;  1T5E A;  2QKA A;  4DV3 B;  3ZS8 C;  5LOV B;  2ZE5 A;  1BCC H;  4UCO A;  4PA7 A;  2JVD A;  3STL C;  2H3O A;  4JGS A;  1RM1 C;  1XIL A;  2ZR3 A;  4UVB A;  1H8H G;  4NXM O;  2F1M A;  3LDC A;  4NKG B;  2X7R B;  2GV9 A;  4PD4 F;  1DGS A;  4H44 B;  3E83 A;  3QO7 A;  3JD3 A;  3WG7 C;  1QR9 A;  3D36 C;  1PD3 A;  4FLV A;  3FB8 C;  4BR6 A;  1Y4M A;  2Z5U A;  3CCR V;  5LHI A;  1W2B U;  1GK9 A;  5JJE B;  2X6C A;  3BY6 A;  3F5T A;  2WSS G;  3KCX A;  3DGE A;  4JI8 B;  4XBF A;  5TIS Z;  1COW G;  4O2B A;  4GX2 A;  2XAF A;  5L3E A;  1OCO B;  1TUB A;  2RNB A;  4MVQ A;  1Q82 W;  4CS2 A;  5J2T A;  5GON A;  1JJO A;  1K4C C;  1WPB A;  1K73 W;  4LH7 A;  4DUY O;  5LHG A;  4MT8 A;  4JTD B;  2UXB O;  2HG5 C;  1P4R A;  3AG2 C;  5CA1 A;  3L73 H;  2V1D A;  3F5W C;  3K79 A;  1RPR A;  4ZBM A;  1KP2 A;  4G28 B;  4ZHQ A;  3OR6 C;  4EB6 B;  1W59 A;  1M4U A;  2ZIO A;  1FXK A;  2WLM A;  1AJQ A;  2O57 A;  1MA1 A;  4Z2W A;  4UB6 Z;  2A7W A;  2HEP A;  1AR4 A;  1QVF U;  2AXT Z;  2A0L A;  4F4L A;  2PI5 A;  2Q9L A;  4DK0 A;  2DWE C;  4YHH B;  1H2L A;  4WFB V;  4X1Y A;  2YXH A;  2A79 B;  1SQV H;  3CRQ A;  4PA4 A;  4DUZ B;  4ZI7 A;  3BPZ A;  1FD9 A;  2A9H A;  3I55 V;  2GTS A;  3J81 N;  4P2Z A;  4WFE A;  1SF9 A;  4I4T B;  2CH7 B;  2DWD C;  1VQN V;  1NR7 A;  2YC0 A;  3E2E A;  2CTP A;  2P6J A;  3H1J H;  2LW1 A;  1U97 A;  3JAK B;  1WB7 A;  1M57 C;  3GB7 C;  3FB6 C;  3CC4 V;  5B1A C;  3SPJ A;  4UV9 A;  2E74 B;  1ZSP A;  3QVN A;  1KEC A;  1YIJ V;  3Q4H B;  5L3C A;  1BQZ A;  2N05 A;  3J7A U;  2P4V A;  3DC5 A;  1N34 B;  5FPO A;  3W7X A;  1IBK O;  5KHK A;  2BOB C;  2WA4 A;  3X2Q C;  4DR4 O;  3IJ4 A;  1OCZ C;  4Z1V A;  5KA5 A;  3RYH B;  4WCE V;  3JSL A;  4U7O A;  3AG7 A;  4YJ3 B;  3K0G A;  3E35 A;  1HNW B;  5BR8 B;  1R6K A;  1NI8 A;  2YS8 A;  4DW1 A;  3VQV A;  5CBH A;  2P67 A;  2FYU H;  4WFG A;  3CRA A;  4DV5 O;  4NTW A;  4J11 A;  4TUY B;  2D3O W;  4QIW F;  3CRM A;  3DSQ A;  3MD0 A;  4CH3 A;  4YXW G;  1VQ7 V;  5IJ0 B;  4OGQ B;  3W7S A;  4QPJ A;  1S5L Z;  1I5Y A;  1Y76 A;  1BT8 A;  4O4H B;  5B1B B;  4JI5 B;  1EM1 A;  3ML0 A;  2A3Q A;  2DJV A;  2VQE B;  4PA9 A;  2YI9 A;  3E22 A;  5KHH A;  5DN6 G;  2WLL B;  5F2V O;  1FXV A;  5D5P A;  3CCL V;  1BSM A;  3UQ8 A;  3MDS A;  2IH3 C;  3OM3 B;  1HW7 A;  3JAM N;  3JCU Z;  4GYC B;  3VOU A;  4EFB A;  1N33 B;  1NS1 A;  3T1H O;  4Q6G A;  4ZKI A;  3TCU A;  1N32 O;  4HNA A;  3K0D A;  2G38 A;  1SQF A;  5KHI A;  2JGD A;  1SER A;  4FM2 A;  2PGG A;  2XTA A;  3H1I H;  4OX9 B;  3T1Y O;  3G6E V;  4KHP B;  4TWK A;  3ZRS A;  4NR1 A;  3RVY A;  1L0N H;  2CE4 A;  2DE0 X;  3RWR D;  4GX0 A;  3JAL A;  3E8H A;  4DR7 O;  4H0L B;  5FNV A;  5BY1 A;  1MG1 A;  4PI0 A;  4AQY O;  1HNX O;  4UCS A;  1ZL8 A;  3ETE A;  3CS5 A;  1SKV A;  2ITC C;  1NQT A;  4DR1 B;  3AG3 C;  1H2M A;  5JCO A;  1DF4 A;  2E5L B;  1NT2 B;  3OUF A;  4X1I A;  3OMI B;  2M7W A;  1FYJ A;  2HJF C;  1YJW V;  1I94 O;  2WLK A;  5LP6 C;  4NB5 A;  3ABL B;  5KAF Z;  2XHB A;  2DQ3 A;  4CH4 A;  2ZE7 A;  3QNE A;  4X20 B;  3T2M A;  1WAZ A;  4FJC C;  2UXN A;  4P30 A;  2ZT9 B;  1X59 A;  2GUZ A;  4MTX A;  2ZXW C;  3DXR A;  4UB8 Z;  3SYA A;  1N36 O;  3RW0 A;  2JEU A;  2OCC B;  3RYI B;  4FFB B;  4E4E A;  1QHT A;  1H38 A;  3RN4 A;  2ZDI A;  5LA6 A;  1JVM A;  1CP9 A;  2JS3 A;  2UXD B;  4X1K B;  1WA8 A;  3VBB A;  3DXR B;  1GO3 F;  4QNH B;  1N8R W;  3JAT A;  1RSO B;  4X64 B;  1XRE A;  1ROP A;  4JYB A;  4JYA B;  2EIL C;  1M56 C;  4JI3 O;  2QKS A;  3LNN A;  3O65 A;  4I0X A;  5LA6 B;  2JGU A;  2HHH B;  1QBZ A;  2UUB O;  1KKC A;  1SQP H;  4DR6 B;  4HYO A;  2E75 B;  5BZB A;  1YZB A;  4I55 B;  1SES A;  4X62 B;  1Y74 B;  1IDS A;  5IT9 N;  2CGN A;  4WFH A;  2QA4 V;  1JMK C;  3CJH B;  1NZ6 A;  3OT7 A;  1VQO V;  1SZX A;  5B1N A;  4X66 O;  4I50 A;  4DV7 O;  5K1X A;  2BE3 A;  3R66 A;  3AG4 C;  3N2K B;  2YIB A;  2X6A A;  3E89 A;  5EYP B;  1YTF B;  5L3G A;  4DV3 O;  3FAV A;  4GX5 A;  5EBM C;  5LGT A;  3K5M A;  3P30 A;  1GM9 A;  1FPO A;  3OD4 A;  4PDR A;  1H2S B;  1SRY A;  1S77 D;  3H1L H;  2ZE8 A;  1XNQ B;  1BL8 A;  3APO A;  4DXW A;  1AI6 A;  4FLY A;  1GRJ A;  1XMQ B;  1VIB A;  4JI8 O;  3AK2 A;  2JS5 A;  4HZ3 A;  4ABM A;  4IGG A;  1VQ6 V;  1V55 C;  3OTF A;  5BMV B;  1ENV A;  4JTA B;  2IJI A;  1IVS A;  1LR1 A;  1WP8 A;  1J95 A;  4RWU A;  4JI2 B;  1AJN A;  2EX3 A;  3BRC A;  3HKC B;  3ZED A;  4J9Y B;  3RYC B;  3W7T A;  2Y4U A;  3CXC U;  2K9P A;  3ZBH A;  1AR1 B;  3A8T A;  1QLE C;  2RDC A;  1EZJ A;  3AK3 A;  3LUT B;  4F6R B;  2ADP A;  1XHX A;  1I0H A;  3QO8 A;  3WB2 A;  3FYI B;  2AHZ A;  1XMO B;  1Z5W A;  4YHH O;  1MNG A;  1VQP V;  4JTC B;  5J9P C;  2JK5 C;  2OIE A;  3AG1 B;  2P22 C;  4DUZ O;  4X65 B;  4X9Q A;  2N04 A;  5LXT A;  4NXN B;  2Y69 B;  4PJ0 Z;  2LQT A;  2JRI A;  2NN4 A;  4RQF A;  5ITZ B;  1B3Q A;  2YIC A;  2IBZ H;  3JYC A;  1CXZ B;  5CA0 B;  1PNL A;  3ABK C;  1B06 A;  2L6L A;  2RCV A;  5KAI Z;  1ZUQ A;  4CBC A;  1KUQ A;  1F4N A;  2EIK C;  4PA3 A;  2RMK B;  2WLI A;  2XT9 A;  4I7Z B;  1N34 O;  1MSD A;  1H2K A;  4MVO A;  3CME V;  4MTG A;  1JFF A;  4DV0 B;  1US6 A;  1FFX A;  2OTL V;  1AJP A;  1QR8 A;  1HR0 B;  1Q90 D;  1E1Q G;  2WWW A;  4J80 A;  4IT5 A;  2BTQ B;  1HNW O;  5IYC O;  4QE7 A;  1EN6 A;  4IHJ B;  4PDL A;  5BR8 O;  2WA3 A;  2F93 B;  2PTM A;  3ZJZ A;  4LFA B;  2R70 A;  2Y48 A;  1O9H A;  1XOU A;  3IC9 A;  4LF5 B;  2DYS B;  4Z1M G;  1YIT V;  5JWP A;  1FXK C;  3ICX A;  4JV5 B;  5LOV A;  3L70 H;  4MVZ A;  1XL4 A;  2YIA A;  2MW2 B;  4UVA A;  4JI5 O;  2XAQ A;  4K3A A;  2QE7 G;  2GSM B;  2YXY A;  3SJC C;  4TOI A;  3LSS A;  3P3N A;  2VQE O;  2L35 A;  1VQ4 V;  3BFR A;  3D3Q A;  4TSF G;  3CCS V;  1WP7 A;  4IL6 Z;  3SDL A;  2LFR A;  4B3T B;  3CX5 F;  2FKX A;  1AIL A;  2QTS A;  5B5E Z;  1N33 O;  3M8A A;  3ZRW B;  3K57 A;  4DV1 B;  1H2N A;  2A06 H;  4LF9 B;  3M7M X;  5FPR A;  3H1H H;  2CGO A;  1L8D A;  3SPC A;  1UJW B;  4CS4 A;  1IBM B;  3VQY A;  1TA8 A;  4OX9 O;  4R7C A;  4ZOL B;  4KHP O;  3T1C A;  3C3T A;  3VQX A;  2HFE C;  3HPL C;  4EB6 A;  1OCR C;  4TT3 G;  1F51 A;  3F7Y C;  3JCZ A;  5LGU A;  3UO2 A;  1FKA O;  1GH6 A;  1K92 A;  1YEW A;  3JD1 A;  4OPH A;  3TJT A;  4RUF A;  4FLW A;  2EIJ C;  4LH6 A;  4DR1 O;  1BZK A;  1J5E B;  3IGA C;  3FB5 C;  4AHC A;  1AP5 A;  2E5L O;  1Q6H A;  2NLJ C;  3ZMU A;  3N2G B;  4H33 A;  2OYQ A;  2F95 B;  1GN3 A;  2DN9 A;  3W7U A;  1JQ0 A;  3L74 H;  3L75 H;  4YJ2 B;  4MW8 A;  1EFR G;  1SQX H;  4I4T A;  2CH7 A;  1XNR B;  2XND G;  3CC7 V;  1K9M W;  2CTW A;  3JAK A;  2EJR A;  2Y0I A;  3OMA B;  2ZKO A;  1SC5 B;  2R72 A;  3CCJ V;  1ORQ C;  3LDD A;  2UXD O;  1EBO A;  3ABM C;  2QTO A;  3Q4H A;  5KMG A;  3QF7 A;  3B40 A;  1PL0 A;  4DR5 B;  2KG7 B;  3BEH A;  4X64 O;  1DK1 A;  3OE7 G;  1G6U A;  4JYA O;  4FM1 A;  2HHH O;  3IAY A;  4DR6 O;  3N27 A;  5LMN B;  4GX1 A;  3RYH A;  4GKJ B;  4X89 A;  1HWY A;  2VRZ A;  4X62 O;  4YJ3 A;  5KMG B;  2ZIM A;  3SPI A;  2XAS A;  1ZAU A;  1VQ9 V;  3OEE G;  1IBL B;  1W0K G;  1VQK V;  3TET A;  1YCI A;  3BHP A;  4TUY A;  3CP1 A;  2DOS A;  4JI1 B;  2FL4 A;  1RM1 B;  3UKM A;  5H2F Z;  2DW4 A;  2Q0O C;  5DED A;  1L0L H;  1NJI W;  4K35 A;  2VQF B;  5A9G A;  2W0F C;  4BIZ A;  5JVD B;  1Q86 W;  1VEW A;  3I5D A;  1LUV A;  1GAX A;  5IJ0 A;  4QE9 A;  5JCO C;  3WG7 B;  1UFI A;  1GKF A;  4O4H A;  3ASN C;  5C8Y A;  2HKO A;  2FTK A;  1WLE A;  3RGB A;  2CUG A;  1VP7 A;  1I5X A;  2WLL A;  4MVS A;  3K58 A;  3CWB H;  2XAH A;  4KP4 A;  3BAA A;  2GDS A;  2ZNI A;  2UXC B;  5IY5 C;  1XNQ O;  2AZ2 A;  2UU9 B;  5C8Y B;  3TK1 A;  2HVK C;  3CXH F;  2EIM C;  3TXQ A;  3OMN B;  3RVZ A;  3SJQ C;  5KLV H;  4TV9 B;  2OIG A;  1XMQ O;  1JR9 A;  2XOK G;  4GKK B;  1W0J G;  2B9Z A;  3AG2 B;  3KG2 A;  4MVR A;  4TV8 B;  2V4D A;  1HNZ B;  4J42 A;  5A2Q N;  5JH7 B;  5IE9 A;  2PF4 E;  5KUM A;  4WF9 V;  2AHY A;  2P7T C;  4CZZ A;  2V7Q G;  2Y4T A;  1NH2 D;  3S3W A;  4JI2 O;  1NTK H;  2P90 A;  1MZF A;  2EIN C;  1V54 C;  4KXR A;  3I56 V;  3OUS A;  4G2K A;  1K5S A;  3OGI B;  2Q68 A;  2LP7 A;  1XBL A;  4CS3 A;  3CYO A;  2Y0P A;  1H8E G;  4W4K A;  3LDE A;  1MSW D;  4DV6 B;  3STZ C;  3K5L A;  2F66 C;  5LMU B;  5B3S C;  4JI6 B;  4DK1 A;  1AP6 A;  4RAI A;  1XMO O;  1JPX A;  4F6E A;  2OWO A;  2YUA A;  4U3J B;  4X20 A;  1VQ8 V;  4BIO A;  4X65 O;  1KBH A;  1QNM A;  4K8Z A;  1M57 B;  1VF7 A;  5B1A B;  4NXN O;  3RYI A;  1EN5 A;  4ICG A;  5CBF A;  4FFB A;  1VF5 B;  1YHQ V;  3CMA V;  1KB9 F;  4UV8 A;  2QM7 A;  2R9I A;  4WFF A;  4H13 B;  3HKD B;  4LWS B;  2DYR C;  2QWP B;  1YJ9 V;  2M6Y A;  4X1K A;  5KHJ A;  4DR2 B;  4YIP A;  2Z0A A;  3L9D A;  3X2Q B;  4J7K A;  1Q81 W;  1RSO A;  4B3R B;  4LF6 B;  1OCZ B;  3QTC A;  3S3X A;  4MTO A;  4I5S A;  2OCH A;  4UCT A;  5CMU A;  1EZV H;  1R3L C;  3JD2 A;  4JPR A;  4MSW C;  1N0J A;  1WN7 A;  2XUM A;  5EBL C;  4XDK A;  1TUE B;  5FL7 G;  1Q8I A;  4I55 A;  4X8A A;  4C7U A;  1Y74 A;  3CJH A;  4DV0 O;  1OCC C;  4LF7 B;  3EFF K;  3HKB B;  1HR0 O;  4JAA A;  5JJJ B;  1Q3E A;  3N2K A;  5IYZ B;  1JCH A;  4LFA O;  1Z2G A;  5EYP A;  3E8F A;  4JI4 B;  3CPW U;  3CD6 V;  4LF5 O;  1S0V A;  5AG2 A;  1K4D C;  2Q6A A;  3ABU A;  4JV5 O;  1KU9 A;  4B3M B;  1M1K W;  4O2A B;  1Q6U A;  1XEQ A;  3PN1 A;  1GM8 A;  4MVU A;  3HKE B;  3SYC A;  2KQX A;  1PNK A;  4J7Z A;  1TAE A;  3CCV V;  2VWJ A;  3SJA C;  4PA6 A;  3CRR A;  2EIN B;  4GUN A;  3QO5 A;  4BW9 A;  2PY5 A;  3JD4 A;  4B3T O;  1CPY A;  4JYY A;  4L8J A;  3ASO C;  3W7W A;  3G80 A;  4LFB B;  4UXN A;  5BMV A;  1E1R G;  4DV1 O;  1D2D A;  4DV2 B;  4LF9 O;  2BTO A;  3OR7 C;  5J2U B;  1R3I C;  1X4T A;  4DYL A;  2PZS A;  1Q5O A;  4N21 A;  1QVG U;  1IBM O;  2UUA B;  4CH6 A;  3AG3 B;  4DV4 B;  1K8A W;  3HKC A;  3VQW A;  3NXS A;  1IXB A;  1SQG A;  4N23 A;  3RYF B;  3RYC A;  1WNS A;  4JI0 B;  2Q4P A;  3UT5 B;  5LP6 B;  4KUM A;  4F6R A;  1TVK B;  5LYJ B;  4O4I B;  1B6Q A;  2FB5 A;  4MW3 A;  3J80 N;  1J5E O;  2ZXW B;  2WPD G;  1VQM V;  4IYI A;  4D7S A;  1MMM A;  3DTU B;  2E76 B;  4UUJ C;  4IIJ B;  4P9O A;  2IJH A;  2B1G A;  2P4K A;  2QKC A;  3JSN A;  1ZX3 A;  5KX5 B;  3LSU A;  5GTI Z;  2BCC H;  5IYB O;  1SA0 B;  5LBQ A;  2RJZ A;  3CCU V;  3E8G A;  5ITZ A;  1XNR O;  4LF4 B;  2Q8V A;  4B7E A;  1WJZ A;  2QJ1 A;  5H9C A;  1OCC B;  4TQD A;  4FZ1 A;  5CA0 A;  4FLX A;  2EIL B;  1M56 B;  2LJ2 A;  1KKD A;  3K5N A;  3ZIA G;  1GTO A;  4I9Q A;  4LF8 B;  1HP8 A;  1XUQ A;  4J9Z B;  4DR5 O;  3ZMZ A;  5CB4 B;  1OCO C;  2D2C B;  5KA6 A;  2IU3 A;  3E8B A;  3FKS G;  2ZM6 B;  3AG4 B;  4YY3 B;  1D5A A;  5LMN O;  2HJD A;  1GN4 A;  3A0R A;  4GKJ O;  2XAG A;  1AI5 A;  1E79 G;  2BTQ A;  3CHX A;  3OEH G;  1MZE A;  2QM8 A;  4JI7 B;  4IHJ A;  1K33 A;  2JDI G;  3ZMT A;  1IBL O;  4JI1 O;  1KYO F;  1R73 A;  2QWQ B;  3CSX A;  3ABT A;  2P5O A;  2VQF O;  2ADQ B;  1NU1 H;  2LW7 A;  3ZX6 A;  4WBN B;  2F43 G;  3D8C A;  1VF6 A;  2WLJ A;  1R6N A;  5EZY B;  1R3J C;  1O9G A;  1DF5 A;  2CTR A;  1S5H C;  1YJN V;  1BS3 A;  3SPG A;  2C2A A;  1BMF G;  3APQ A;  4BW5 A;  2EJ7 A;  4B08 A;  2Q5Z A;  1P7G A;  3TGU H;  3LNM B;  4NYK A;  2UXC O;  1V55 B;  1G1X B;  2UU9 O;  3EVK A;  4L87 A;  2RN9 A;  2EUL A;  3CCM V;  4QPK A;  3ZRW A;  2ZD9 A;  2YEV A;  3NR7 A;  2LO1 A;  3ETQ A;  1YSC A;  4GKK O;  2K1E A;  4R6Z A;  2JJ1 G;  2EZP A;  1HNZ O;  2BSK B;  1D5N A;  1VAR A;  2QDO A;  3G71 V;  1V9P A;  4O4L B;  1QLE B;  4ZOL A;  4BWA A;  1IUR A; 
#chains in the Genus database with same CATH homology
 3ZMS A;  1AI7 A;  1R3K C;  2YEV B;  4FPP A;  1K3E A;  3JD0 A;  4QE9 A;  4R8C A;  1H38 A;  2ZDI A;  1NKD A;  3WG7 B;  3F7V C;  1G4Y B;  2X0L A;  1GKF A;  1JVM A;  1CP9 A;  5LGN A;  4G27 B;  3ASN C;  2HKO A;  2FTK A;  1NR1 A;  4JAS A;  2ZR2 A;  3VBB A;  1WLE A;  1GO3 F;  2R9R B;  3FB7 C;  2MK3 A;  2IJK A;  4QNH B;  2H94 A;  1N8R W;  4RUE A;  2Z3Y A;  1I5X A;  3ZMV A;  1NH2 B;  4E2L A;  3K08 A;  4R50 A;  2WLL A;  2IJJ A;  4MVS A;  1ROP A;  4JYB A;  3UM7 A;  2XAH A;  2EIL C;  1M56 C;  2QKS A;  4KP4 A;  1QBZ A;  5IY5 C;  4BAY A;  3IFX A;  2Q67 A;  4HYO A;  4JF3 A;  5BZB A;  1PNM A;  4XDL A;  2GHY A;  3TK1 A;  2HVK C;  4WFA V;  1K5Q A;  2EIM C;  1SES A;  3OMN B;  5EBW C;  3RVZ A;  3SJQ C;  4WFH A;  2HVJ C;  3ETG A;  2QA4 V;  5HFM A;  1VQO V;  5B1B C;  3OFN G;  5EK0 A;  5B1N A;  2XOK G;  3ABK B;  2ATK C;  1W0J G;  3AG2 B;  3KG2 A;  3ETD A;  3R65 A;  4MVR A;  3AG4 C;  2EIK B;  2X6A A;  3E89 A;  5KUM A;  4WF9 V;  1YI2 V;  1FS0 G;  2AHY A;  2P7T C;  1KP3 A;  3H01 A;  4CZZ A;  2V7Q G;  1NH2 D;  1VQL V;  2H8P C;  1YTF B;  3CCQ V;  2P90 A;  5L3G A;  2EIN C;  5H6R A;  1V54 C;  2DQ0 A;  4ASU G;  5HFL A;  1DTO A;  2UXX A;  3I56 V;  3OUS A;  1RPO A;  3WFV A;  1XL6 A;  4G2K A;  1K5S A;  4GX5 A;  1AI4 A;  2Q68 A;  2LP7 A;  3ASO B;  5EBM C;  5C93 A;  3CYO A;  5LGT A;  1H8E G;  3P30 A;  1GM9 A;  5E1A C;  3LDE A;  1MSW D;  1KC8 W;  4MVM A;  4PDR A;  4LBE C;  4H37 A;  3STZ C;  5B3S C;  4GCZ A;  4RAI A;  1SRY A;  3T4Z A;  2WLI B;  2EZO A;  3P32 A;  1QCE A;  1S77 D;  1JPX A;  3AEI A;  3B8N A;  1FXK B;  3MHH C;  5IYD O;  5H6Q A;  4PDV A;  1BL8 A;  4EKW A;  1VQ8 V;  4DXW A;  1AI6 A;  4HAM A;  3SYQ A;  1S76 D;  1GM7 A;  3CC2 V;  1CEZ A;  1YTF D;  1M57 B;  2JJ2 G;  5B1A B;  4MS2 A;  5IDJ A;  2YSU B;  4HZ3 A;  5CBF A;  2PI4 A;  5L3F A;  5LHH A;  1YHQ V;  1VQ6 V;  1V55 C;  3CMA V;  1MAB G;  4RO2 A;  4FIP C;  4UV8 A;  2QM7 A;  1ENV A;  3ZCC A;  4JTA B;  2IJI A;  2R9I A;  4WFF A;  3D36 A;  5L3B A;  2DYR C;  1YJ9 V;  1J95 A;  3ZRX A;  1L1F A;  2JIZ G;  1F23 A;  1AJN A;  3ABL C;  3X2Q B;  1Q81 W;  1H2G A;  2ITD C;  1OCZ B;  4J9Y B;  4PA7 A;  3STL C;  4MTO A;  4I5S A;  3W7T A;  4JGS A;  1M9N A;  1LNQ A;  1RM1 C;  5CMU A;  2ZR3 A;  1R3L C;  4UVB A;  3CXC U;  1H8H G;  3JD2 A;  2OCC C;  1AR1 B;  4JPR A;  4MSW C;  3LDC A;  1QLE C;  5EBL C;  2X7R B;  1EZJ A;  4XDK A;  3LUT B;  1TUE B;  4UVC A;  5FL7 G;  4X8A A;  3E83 A;  1NBM G;  3QO8 A;  3QO7 A;  3JD3 A;  3WG7 C;  1QR9 A;  5EC1 C;  3OW2 U;  1IXM A;  3FYI B;  2AHZ A;  1PD3 A;  3CCE V;  3FB8 C;  1OCC C;  3G4S V;  3EFF K;  1S3J A;  2HR3 A;  1Y4M A;  1VQP V;  4JTC B;  3K9A A;  1JJ2 U;  2Z5U A;  2JK5 C;  5J9P C;  3CCR V;  3AG1 B;  5LHI A;  1W2B U;  1GK9 A;  4DO2 A;  1SET A;  2X6C A;  3BY6 A;  1NVP D;  1JCH A;  2WSS G;  3DGE A;  1OCR B;  4XBF A;  2Y69 B;  1COW G;  2ZDI C;  4GX2 A;  3K06 A;  3E8F A;  3CPW U;  3CD6 V;  2XAF A;  5L3E A;  1OCO B;  3E86 A;  4FK5 C;  2EIJ B;  1Q7Y W;  1S0V A;  4RQF A;  1K4D C;  4MVQ A;  1Q82 W;  2Q6A A;  1K4C C;  3ABU A;  3K03 A;  1K73 W;  2IW5 A;  4KFM A;  1M1K W;  3JYC A;  2QEX V;  5CA3 A;  5LHG A;  4MT8 A;  3K3W A;  4JTD B;  1PNL A;  3ABK C;  1F4M A;  2X6B A;  2HG5 C;  2KB1 A;  1P4R A;  1GM8 A;  3AG2 C;  4MVU A;  4CBC A;  2V1D A;  3F5W C;  3SYC A;  1F4N A;  4JAU A;  1PNK A;  2EIK C;  3K79 A;  1RPR A;  3CCV V;  1MOF A;  2OT5 A;  4ZBM A;  4PA3 A;  1KP2 A;  4G28 B;  3OR6 C;  2WLI A;  1FXK A;  2WLM A;  4MVO A;  1AJQ A;  4PA6 A;  2IU0 A;  2EIN B;  3QO5 A;  5CN0 A;  3CME V;  3JD4 A;  4MTG A;  1QVF U;  1CPY A;  2A0L A;  4F4L A;  2PI5 A;  2OTL V;  2DWE C;  1AJP A;  1QR8 A;  1E1Q G;  3ASO C;  3PJS K;  3W7W A;  4WFB V;  2WWW A;  4MTF A;  1PKX A;  2A79 B;  2EBO A;  2JEX A;  3ABM B;  5IYC O;  4PA4 A;  4QE7 A;  4PDL A;  4UXN A;  1E1R G;  3OAA G;  2OTJ V;  3OR7 C;  1R3I C;  2A9H A;  3ZJZ A;  3I55 V;  2Y48 A;  1M90 W;  4P2Z A;  2DYS B;  4WFE A;  4Z1M G;  1YIT V;  1S72 V;  4N21 A;  3MHS C;  5B1O A;  1QVG U;  1FXK C;  1FFT B;  3AG3 B;  2DWD C;  1VQN V;  1NR7 A;  1K8A W;  5EC2 C;  4MVZ A;  3NXS A;  2B1I A;  4N23 A;  3E2E A;  1XL4 A;  2IH1 C;  2P6J A;  4UVA A;  5CBG A;  3SYP A;  1FXH A;  1M57 C;  3GB7 C;  3FB6 C;  3CC4 V;  5B1A C;  3SPJ A;  4UV9 A;  4KUM A;  2XAQ A;  1KEC A;  2B5U A;  3ZN0 A;  2QE7 G;  2GSM B;  1YIJ V;  4LCU C;  1DLB A;  1OZ0 A;  3LSS A;  2CK3 G;  5L3C A;  1B6Q A;  4MW3 A;  4RQE A;  1VQ4 V;  2ZXW B;  2WPD G;  3W7X A;  1VQM V;  3DTU B;  4TSF G;  3CCS V;  2ZQM A;  2BOB C;  2LFR A;  3X2Q C;  4PDM A;  4UUJ C;  5L3D A;  4P9O A;  2IJH A;  1OCZ C;  5KA5 A;  2B1G A;  3HB3 B;  3D3I A;  4WCE V;  1BHA A;  2XAJ A;  4U7O A;  3K0G A;  3E35 A;  5IYB O;  3ASN B;  3ZRW B;  5LBQ A;  3CCU V;  3E8G A;  4JYC A;  1R6K A;  5CBH A;  2P67 A;  4WFG A;  1OHH G;  5H9C A;  1Y66 A;  3SPC A;  1OCC B;  2D3O W;  1UJW B;  4JAV A;  2W6I G;  3GWO A;  2EIL B;  1M56 B;  4QIW F;  5IY5 B;  2WLH A;  3FYE B;  1KKD A;  3MD0 A;  4P9P A;  1VQ5 V;  4YXW G;  4R7C A;  3ZIA G;  1GTO A;  1VQ7 V;  3T1C A;  3AG1 C;  1K7D A;  2HLD G;  2EIM B;  4Q20 A;  2HFE C;  3HPL C;  1P7B A;  3W7S A;  1OCR C;  4TT3 G;  1F51 A;  1QLN A;  4QPJ A;  3F7Y C;  2Y69 C;  3JCZ A;  1I5Y A;  3M99 B;  4J9Z B;  4OXS A;  5LGU A;  5DM6 V;  1K92 A;  5B1B B;  3JD1 A;  3ZMZ A;  4RUF A;  1K97 A;  1OCO C;  3ML0 A;  2EIJ C;  5KA6 A;  2IU3 A;  1ZWI C;  4PA9 A;  3E8B A;  3FKS G;  3AG4 B;  4GT1 A;  5DN6 G;  3A0R A;  2WLL B;  3FB5 C;  3IGA C;  3IC7 A;  1FXV A;  5GW7 A;  2NLJ C;  2XAG A;  3CCL V;  1AI5 A;  1E79 G;  3RBZ A;  3SPH A;  3ZMU A;  3OEH G;  4H33 A;  2QM8 A;  1KQS U;  2IH3 C;  3OM3 B;  3SYO A;  4U7N A;  4XDJ A;  1K33 A;  3W7U A;  2WLN A;  1V54 B;  1JQ0 A;  2JDI G;  3ZMT A;  4QJF B;  5KUK A;  3VOU A;  4MW8 A;  1EFR G;  1R73 A;  4ZKI A;  1SZT A;  2XND G;  3ABT A;  3TCU A;  3CC7 V;  3K0D A;  1K9M W;  2EJR A;  3B8M A;  3OMA B;  1THZ A;  2F43 G;  1KD1 W;  5B3S B;  1SER A;  3CCJ V;  1ORQ C;  2WLJ A;  2WAM A;  1JX9 A;  3LDD A;  1R6N A;  3OGC C;  1R3J C;  3G6E V;  1EBO A;  3ABM C;  3ZRV A;  1DF5 A;  2QTO A;  1S5H C;  4TWK A;  1YJN V;  3SPG A;  2C2A A;  3ZRS A;  1GMG A;  3RVY A;  4PEL A;  4GX0 A;  2LFS A;  3E8H A;  1PL0 A;  4LP8 A;  3BEH A;  1BMF G;  1MG1 A;  4BW5 A;  1K34 A;  1G8M A;  3OE7 G;  2DYS C;  3ETE A;  2BOC C;  2ITC C;  3LNM B;  1BHB A;  1NQT A;  3AG3 C;  2Q69 A;  3LSQ A;  1V55 B;  3EHB B;  4GX1 A;  4L87 A;  2NNU A;  1ARO P;  3CCM V;  1DF4 A;  4X89 A;  1HWY A;  2DYR B;  4QPK A;  3OUF A;  3K04 A;  3OMI B;  2M7W A;  2ZD9 A;  2HJF C;  3ZRW A;  1YJW V;  1WPX A;  3SPI A;  2XAS A;  3T4D A;  2YEV A;  2WLK A;  3ZN1 A;  1VQ9 V;  3ABL B;  3OEE G;  2DQ3 A;  4I9W A;  4BIU A;  1W0K G;  1YSC A;  4LC1 A;  3TET A;  2K1E A;  1VQK V;  3QNE A;  4R6Z A;  2W6J G;  4X88 A;  2JJ1 G;  4FJC C;  3CP1 A;  4FMT A;  2UXN A;  4P30 A;  3T2M A;  1JOY A;  2EZP A;  4MTX A;  1RM1 B;  3UKM A;  2ZXW C;  1NVP B;  3SYA A;  3RW0 A;  3G71 V;  2JEU A;  2OCC B;  3B77 A;  2DW4 A;  1NJI W;  1QLE B;  2W0F C;  4BIZ A;  1Q86 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...