1NJSA

Human gar tfase in complex with hydrolyzed form of 10-trifluoroacetyl-5,10-dideaza-acyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design, Synthesis, Evaluation, and Crystal Structure of a Potent Inhibitor of Human GAR Tfase: 10-(Trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic Acid
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phosphoribosylglycinamide formyltransferase
total genus 64
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1njsA00
3TQQA 1CDEA 2FMTA 3LOUA 3KCQA 4QPCA 3N0VA 3Q0IA 3OBIA 4EW3A 1RC0A 1JKXA 1ZLXA 1RBQA 1RBYA 1CDDA 1MEJA 4TTSA 4EW2A 3TQRA 4ZZ0A 4YFVA 3AUFA 1MEOA 4R8VA 4PZUA 1GARA 5J63A 4YFYA 4DS3A 4Q12A 4ZYXA 4ZYWA 1YRWA 4ZYUA 1ZGHA 4ZYYA 5CJJA 1RBZA 3GARA 4ZZ3A 1FMTA 2GARA 3AV3A 1MENA 3DCJA 4ZZ2A 3R8XA 1C2TA 1C3EA 3DA8A 4TT8A 4TS4A 4ZYVA 2BW0A 1RC1A 2BLNA 4QPDA 4ZYZA 3W7BA 4EW1A 4ZYTA 1RBMA 1S3IA 1ZLYA 5J9FA 3O1LA 4ZZ1A 4S1NA 2YWRA 4IQFA 2CFIA 1GRCA 4NV1A 3NRBA 3P9XA 1NJSA
chains in the Genus database with same CATH superfamily
4PX9A 3MJTA 3L46A 2G4LA 4LXTA 4QXQA 3ZWDA 3GN2A 2ZXEA 1QYXA 4RHCA 1OF1A 4B7CA 3FOEC 1NR5A 4ENPA 4D8TA 2AV6A 1QP0A 3WLPA 4JNCA 4MV6A 1DAIA 1MEOA 2IJGX 3I2FA 3I6MA 4I1OA 2IOHA 3W7BA 2H0RA 3G89A 4BGEA 4UD6A 3DZCA 1ZH4A 2NADA 3KKKA 3NOQA 3S3TA 1V8FA 2GPJA 4N18A 2QJTA 1MAAA 3I2GA 2XZLA 5JXHA 1JQ5A 1J8VA 2Z2ZA 4M86A 1KDTA 1U98A 4RK0A 1PSDA 1G2OA 1SVOA 1TIBA 1YNOA 3C5HA 3NTQA 3HNRA 4RHYA 3QW2A 4X7RA 5TQ0B 4BMSA 4RTNA 1VHDA 1D9ZA 4EQZA 5IJ0A 1Z29A 3E23A 5AW4A 1V41E 5L4NA 3OE7D 2RE8A 1KYTA 3EFOA 3WOVA 2JCXA 1MAUA 1UZUA 3WYGA 3NHBA 2XI4A 2V7VA 3GXBA 4UDOA 3D6MA 4PYOA 3HGMA 2ADFA 3RQSA 5JIBA 4UPEA 3RIXA 4A6DA 1P1HA 4JWTA 3OIYA 1U2GC 1ZMXA 3PQ4A 4V39A 4YJ3B 4MICA 2HJVA 5I7VA 3WK8A 1MA3A 4I5EA 1N7GA 1L8XA 2JKZA 2Q6LA 2Z98A 4NF2A 4CR6A 2WTEA 3DLAA 2BGIA 3GX1A 4GECA 4HDCA 2Q4OA 4MOWA 4N7RA 4WLFA 5AJYA 4Q1CA 2JH9A 4BVLA 4CNQA 5KUTA 3ADCA 1R9JA 4CV2A 4FLMA 1V5EA 2ZBEA 3EQ6A 5B53A 1PK9A 2WJJA 3UHPA 1UMCB 2NQ2C 1NQUA 2IXGA 3F1KA 2NTYC 4NNOA 2YIDA 3TJZA 4WDQA 3PXAA 4OHRA 5D6OA 2VTBB 3HS3A 2CNBA 3W5JA 3SR3A 1ZSNA 4BKPA 4BTVA 4OUDA 3X2EA 3N86A 4MDEA 3PDHA 2JFFA 4KNVA 1QLJA 3DZFA 4YX9A 4ZV4A 1JA1A 2F59A 1KJWA 2I9KA 3EIQA 2EFGA 1CHNA 3K1TA 2ZIAA 4RS4A 3VSAA 5C5CA 3EULA 2SCUB 3RS7A 1JTEA 2C2YA 2Z83A 5EG5A 2D5IA 1VKJA 1T2AA 2CE2X 5CNIA 3T54A 3LC7O 1SG6A 4BX9A 4C9BA 4E4TA 3TRKA 1JSXA 1ISGA 1JYFA 2CHUA 2WKWA 4FFRA 1AS0A 2OPBA 3L8EA 3O9VA 3SKYA 2BFBA 2I6UA 5KYTA 4EB6B 4W5NA 5E9WA 3TSOA 5IBQA 4B4DA 1JEYB 3KYDB 5AVVA 1N8KA 3EAFA 2EBWA 1PJSA 3O4FA 4OXIA 5GONA 2Q1UA 5K3EA 4RPKA 2P67A 1SZPA 2Y1EA 1MJGM 3LT4A 4J2TA 4PPQA 3OLCX 2YXLA 1USIA 3W2EA 3P52A 4EZEA 1U8XX 1GARA 4KB5A 2FPIB 3DR5A 4MS4B 1QNFA 4R0VA 3H1GA 4M3NA 2HA7A 1BX3A 4HB4A 1I33A 4L9AA 4OSOA 2CNKA 2Q4EA 4AY5A 4K9KA 2BEJA 2ZJ4A 3A1EA 4WGGA 4ZU1X 4EF4A 1T8TA 3SC2B 2G1KA 3TDNA 5DSZA 2HNAA 3VBCA 2O23A 1E3JA 4EGFA 3KQHA 1FLVA 3P0RA 4RFLA 5E6SB 3IDFA 3Q7RA 4RKYA 3AUAA 1GZ5A 4IKEA 1CIJA 4XYMA 3C41J 2O8EA 1O58A 3H5WA 3O31A 1NJSA 3VPFA 2NU6B 4BRWA 4KWHA 1Q22A 3Q11A 3CB2A 4MTCA 3WKBA 1FUEA 1ZK1A 2SBTA 4Y1RA 5K0LA 3FCYA 3WZ2A 3AF2A 2D1QA 3O03A 1N3LA 4GZ6A 2PMDA 4OKSA 4KDFA 2BCEA 1J70A 4M9CA 3U26A 1ZN2A 4C3VA 4P86A 2XTAA 1LEHA 1G1MA 1SQ5A 2REXB 4C43A 2FW8A 3WWOA 2FVYA 5HUQA 3UAZA 2ISCA 3ZZ1A 1T4BA 2VZEA 1K6EA 3MPOA 4QUEA 3KT0A 3ZI4A 3ODPA 4B2IA 5LQMA 4TKLA 1T5TA 3DVAB 3RC9A 4WBNF 3JAKB 3GIWA 1NN3A 4LOIA 1PR6A 5AM0A 5DW0A 1X7HA 5EIWA 2CHFA 2XQKA 3LKVA 4MQEA 4NC9A 5BN3B 4CEJA 3B8EA 2BM0A 3P4YA 5LLSA 2UUBB 3DE6X 5CFMA 1ECLA 1U5CA 3CPEA 5D7NA 3R3UA 1HL3A 1T26A 2VHVA 3U4MA 2IPMA 2HU2A 3WSWA 3WLTA 2C29D 3I9NA 3C1TA 3IQXA 4UUPA 4EJSB 1EVEA 4TL8A 3TCKA 4DTCA 2R97A 5EMHA 5AJWA 3UEOA 1RI3A 1E3LA 2JF0A 2PS3A 3M6FA 4Y18A 1SCUB 3TOXA 1MRSA 1RZ3A 4L5CA 4LXGA 4ZAGA 4EKYA 2ACEA 2QP9X 2RJOA 2O07A 3TQSA 3VYTB 2O8CA 4JB0A 3S2IA 3EOZA 3WXMA 5JADA 1JSZA 3G5MA 1ZIPA 5F2OA 4DXAA 3EXEB 2YWHA 5JJBA 4IS2A 1RWKA 3CB4A 4MB0A 3T8YA 3FCEA 3ZYCA 1XPJA 4F3KA 1PF7E 1Y37A 3M9LA 4B6GA 4DLBA 4D9MA 4TYNA 3P32A 4PO8A 4HYTA 2VHEA 4LI3X 4RZXA 1PV1A 2FPRA 1P3JA 3I62A 4KFCA 5JZ9A 1RIIA 3BWMA 4KQ6A 1AKNA 3KXKA 1RKVA 1N2CE 2EKDA 3FB1A 5K2OA 1EFRA 1SZCA 2FFAA 4WERA 2ZI4A 3EA4A 2HU7A 1COZA 5EE9A 1JG1A 5TGDA 3V8MA 1U9ZA 1TGVA 4YQFA 7MDHA 5FOVA 5BR7A 5MHTA 3A1UA 3OFND 1U8UA 1C4KA 1NVUQ 5E3IA 5HUHA 2QRVB 2ONKA 1G8FA 1JDZA 1N9KA 1ENYA 2GERA 4G5GA 3TUJC 1IY2A 5DTMA 1G66A 1XFDA 2GZAA 2PMCA 3KOWA 1TVKB 5GVRA 4OA8A 3HU3A 3N59A 4P4NA 3G68A 4DMMA 5K0BA 5CFLA 2B1IA 3QKSB 5DYYA 4NENA 4ENRA 1OXSC 4ESHA 1NF8A 2VXBA 1ZK3A 2PVPA 3UV7A 1EEHA 1BIFA 2RHWA 3M2TA 1HBJA 2ODPA 2QTLA 2Z6UA 3F8WA 4JA0A 4NOKA 3EVGA 2GAFA 4DCJA 4ZODA 5DNWA 1VHWA 1EWYA 3HL4A 2O8DB 1T13A 1HDCA 4Y2UA 4BVAA 3C5EA 2SKEA 4DV4B 1B0PA 3HYRA 3IV6A 3ZBTA 1YQTA 1D07A 1NQTA 1RRVA 2VQDA 5FOTA 3VR5H 5TMPA 3AVXA 1A4XA 5T8KA 1CJVC 3BJZA 3DTVA 3PNVA 3PT9A 3IQHX 4FCWA 5TQ2A 1BDIA 2ZJ2A 1M5UA 4HVCA 1ESZA 5D87A 2QRJA 4LDAA 4BAZA 1U0SY 4IGAA 3HO8A 9GPBA 1DO2A 5TV2A 4FMCB 2EHDA 4E5NA 5JJCA 1TZJA 3ONWA 2YJ6A 1U7HA 3IP3A 3KRTA 1ZMBA 1SCAA 3SS9X 3R5SA 4N5DA 4WBNB 3LX8A 1JEQA 1TTPB 2HLDA 3DAYA 3PNLA 4GPEA 4MR9A 3QPCA 3K2EA 4ATNA 4G5XA 4PHCA 1ZD1A 3BN3A 1QYDA 4LV6A 1JLMA 4S2EA 2GPAA 4AWXA 1CULC 2IP2A 2QROA 3OLXA 4QVKA 4BP1A 5KOIA 1SXGA 2C99A 2Q0QA 1FS5A 2AXPA 3ENKA 3V97A 2ZK7A 1QQTA 3ZWCA 2XT6A 3KL2A 4DSTA 2WHXA 4EKNB 1EUCA 1ZD3A 2CDCA 2VXCA 5F1KA 4QT4A 2PZEA 3FPLA 1XZKA 2B94A 4IVRA 4LDQA 1ISPA 4XFKA 4P31A 1ZONA 1OZGA 4H15A 3MWFA 2IIPA 4RMHA 2I65A 4RUKA 4XR4A 2WYHA 1Z08A 5F51A 1ZEJA 1DO8A 2ZYAA 1C9YA 5H9VA 2VR1A 4EABA 4BLUA 2HI0A 5CT5A 3MWEB 4D3XA 1I6KA 1UEJA 2Q4RA 3OE7A 3VVCA 2QAGA 2DY1A 1E1RA 2OXIA 1MHTA 3C8DA 1TLLA 3P5BA 2AQIA 1BHO1 1MQAA 4MINA 3U3RA 1G59A 1HR0B 1G41A 3OAAA 3QX8A 3CUVA 2I6FA 2G80A 3ZEAA 3E0XA 3IR7A 4FHCA 3OZWA 5P21A 1SQFA 4BWVA 4ZDKA 4NS4A 1M6HA 2QORA 1KJ8A 2Z57A 4RDHA 4PSCA 1GZUA 1AURA 1JKXA 3NGXA 5FO1A 1U1EA 3D6JA 3NHMA 3C87A 1OI2A 2FI1A 1DQSA 3K6JA 1V9CA 1H4TA 3ZD9A 5B2ZA 3SWWA 3W3AH 4D9FA 5ECDA 13PKA 2I8LA 1JG4A 2CNOA 3I12A 4IV5A 5DI3A 5KAPA 4MYHA 4IRUB 3U48A 2GARA 4MMYB 4YT8A 4V0SA 3PNBA 3I30X 2P8SA 1KQOA 4S1VA 4LYDA 3AP3A 5LXTF 1G4HA 1R74A 2ZIUB 3GVCA 2ZTHA 3QUSA 4C07A 1LVGA 4NH4A 4RIEA 3SAJA 1ESEA 4Y6PA 5B7QA 4MV4A 3UBMA 3JV7A 4NZOA 4EITA 1OB5A 2J46A 4JENA 5AKYA 2MIIA 4L2IB 5DU2A 4F5ZA 4KWIA 2R6HA 3CRMA 3Q15C 2IYWA 3OPMA 1Q0PA 2B6HA 4DCOA 5BT9A 5BW4A 3RUPA 3SVTA 1WP9A 1XK6A 4ZCRA 1JQJC 1X8XA 3GFFA 5L3SB 1G9TA 4LZZA 5GAJA 1JAZA 2W6MA 1K7FB 4IXNA 1ETHA 1XT6A 3S2FA 4B09A 5JEDA 1KO8A 1XN4A 3MMNA 1E99A 1F8FA 3OZUA 4O4JB 3D4PA 4YGXB 3IBGA 1ORWA 5IARA 1HDGO 3THXA 4CMHA 1KDZA 5B6JA 3H5AA 2R44A 1HNNA 1NW9B 1Y3CE 2B25A 4IOJA 5LYYA 3WB0A 4AF6A 4FGUA 1E9FA 4WY8A 4EFMA 3T3OA 3NUQA 2BJHA 1P1IA 3D43A 5A7GA 1ESNA 5DN6A 5CX4A 3U4CA 3R6DA 4IHJF 4DR1B 4Z9FA 4G9BA 4GC9A 4BPBA 4U02A 4TXLA 3VGJA 3DNFA 5BN5A 1JP7A 2EG9A 4PZ0A 3I83A 4RAOA 2Z0MA 3GPCA 4ALJA 1UIRA 4RLHA 5IZCA 1UWCA 3ZHQA 2QZZA 3RRXA 3REFA 2RH8A 1KFJB 1GEEA 3QVGB 4TS1A 1FFHA 2RAUA 2YN4A 5ICCA 5EJAA 2FWBA 1XP5A 3A1WA 5JNUA 4K1LA 1VL2A 3W6PA 3DVAA 4PLFA 4HS4A 1IUPA 3AEKA 1N32B 4RPJA 1FMJA 2CE7A 2HK7A 2ZYGA 2N75A 4JBWA 1I7QB 3NAZA 1GVNB 3VYRB 3RU2A 2J7PA 4JU9A 4EMUA 5CIWA 5BW5A 2AFHE 2ZM5A 2CLKB 4Y67A 1UC4B 1ZNXA 4CLXA 2FW6A 3GA7A 3Q7EA 1RYEA 2CDNA 3GF4A 4FYMA 2A0WA 3LPNA 3OOYA 4GR9A 3K2IA 1Q0SA 4J0IA 3W9SA 1YVPA 1P4GA 3L82B 1FVHA 4FBLA 3ROEA 1KPHA 2XYHA 3PFIA 3IV9A 4P3NA 2PKXA 1GDDA 1Q83A 1OMOA 4IIHA 4DVJA 1VLMA 3NP9A 1YZHA 1TYZA 2W43A 3N5CA 2B83A 4EHNA 1J0AA 5LMUB 4QYMA 1O9HA 4AIRA 3JQPA 1XVIA 4CCSA 1QO0A 4MRSA 3R75A 1X86B 4Q3BA 2DPHA 1NMYA 1EWTA 1K2VN 4JHLA 3IKLA 4KGZA 4NDNE 4DQDA 1RM3A 3AZPA 1SURA 1U4NA 1JA9A 2QAIA 3K0SA 4B3GA 1GZVA 4CMBA 3G0IA 1BG6A 2PLFA 5D1NA 4CKEA 4U5QA 1Y1SA 2W0MA 3FMIA 5JD3A 3UAXA 4XLLA 1XMIA 1NDQA 1S3SA 3IBTA 2IPLA 4Y1GA 1DBPA 2B7BA 2V55B 4V0LA 5JANA 3H5VA 5BY2A 4MRMA 3WX0A 2X0RA 2GCPA 4G4GA 4PLZA 4XIIA 3J81k 3C6QA 2C77A 4RHXA 4UAJA 1HMYA 5G1NA 3TI7A 2RAPA 3OQVA 4EEZA 3RF7A 2R85A 2V96A 2J5QA 1DC5A 2JBHA 1QV9A 2OL4A 1T1EA 3IMFA 4DHEA 2DP4E 3I9V6 4HX2A 4RQAA 4BV9A 3BDAA 3H9GA 4CDGA 4V0QA 3VNQA 1MG5A 2FW0A 5F3RA 4YALA 4R1OA 4V3BA 1YCFA 3K9QO 2EGHA 4HDRA 2F8MA 4BQSA 1CUDA 3ZDBA 3HKBB 2ZJ5A 3SFZA 2RGEA 2ZSAA 3GZNB 4G9GA 1VFNA 2XY4A 4P4LA 1KIFA 1TXGA 2B92A 5L3VA 1FF9A 2VH5R 4CIVA 5JAIA 4XJSA 4PU0A 1QDEA 2FP4B 5EJEA 2XKKA 1U7WA 1XLVA 5TT1A 4UARA 4A0RA 2IYAA 1ORIA 3PQ2A 4IIJA 4PS1A 1YGYA 4KR0A 3GJ7A 2A5JA 2I2FA 2AOVA 3OQPA 5JASA 3IMKA 5L3RA 3FF1A 3L3BA 1VIVA 3N87A 4GRDA 1JEAA 1BMQA 4FHDA 2Y1XA 4MLDA 3EZ2A 3QG1A 1PZGA 2NUPB 3MAAC 3QQ5A 5G0TA 2IH5A 3QKWA 4ZA2A 5IVDA 3ZWBA 1LB1B 2WJIA 1OTXA 4WNIA 4CMGA 3QUBA 2AJLI 4K46A 1G2QA 2Z5GA 2OECA 3G1UA 2J7KA 4AMGA 4PS0A 2Q6TA 4ZT5A 4P9NA 1CRZA 1RAEA 2I22A 2ZCUA 2OXCA 5H8WA 4LRWA 3A58B 2XDAA 2A3RA 1WWKA 1R66A 3N7TA 2PS9A 4UNIA 5CT6A 1T9BA 1DQYA 2Z58A 5ADUS 4ZCQA 1E2GA 4PZ9A 1B8NA 3I58A 4ZQFA 4BO2A 4ZDJA 1KEUA 3MJFA 1T4MA 4O6VA 2VJLA 3O5AA 2AB0A 1UC5B 2C94A 3E35A 3KPVA 2DF8A 3R8FA 4GGMX 1WZ2A 4ARBA 4L7QA 2G3YA 3TIFA 3AHFA 4EMSA 4GZLA 4Z0PA 3NPAA 5L3SA 3KZOA 4EFDA 1L7PA 1D8AA 1TCBA 1XKXA 3NUGA 3WWYA 4QBFA 3A1DA 2AQ8A 3TR5A 1N6NA 1S2GA 2AOWA 2QM8A 4FZRA 1AZTA 4C14A 2W2LA 3R3HA 1D2RA 4KYUA 3T6KA 1CJUC 3RVNA 4K6MA 2B0JA 3EC1A 3JZFA 4BQEA 4B3BA 4ADSG 3TMYA 2O20A 2GBFA 3T4UA 1V16A 3FZEA 3ZBPA 5CDHA 1Y6GA 4RD2A 2W2LD 4BUJA 1Z4QA 1Z6QA 3GFRA 4MQEB 2AUTA 3HCBA 3N8NA 2FUEA 3UUFA 4QYTA 4OQ4A 3KTOA 5HIMA 3M1IA 5DBGA 5JDCC 1PJ8A 2ES4A 3QMPA 2A88A 1ZWLA 3LQ4A 2R1UA 1PZFA 3C3DA 5DFAA 1V71A 1I4WA 3MELA 4REQA 2A59A 3R7WB 2FMTA 3HI4A 1J97A 4P0PB 2Q4BA 3OEEA 4IIVA 2JLBA 2BM1A 2D7CA 3MJCA 1RWPA 5FA8A 4TLEA 3F49S 3VNAA 1IBMB 1XDBA 3VH2A 3GH3A 1IBLB 1RJDA 4WH0A 1OZFA 3WIBA 2ZUEA 3NWJA 5EJ6A 2VDPB 4TRRA 3V7YA 3RSZA 1MOQA 2X8AA 2AC4A 4DRZA 1FMTA 2RCNA 4WNYA 4CKEB 3ZYZA 4JLJA 1N5LA 2HM7A 5EMLA 3B38A 3DKIA 4BJ6A 4GL4A 5ARBA 1RHQA 2K2WA 5FUVA 5KJ1A 1CZKA 2VJKA 2IYLD 4LISA 3TGWA 2YR0A 3X1XA 1DRWA 3A1SA 2UXDB 1FMLA 1GN8A 5ITWA 1E2FA 2B20A 2B4AA 1FYDA 5KREA 1O6BA 4KYIB 5EKUA 5CNKA 4R68A 1RABA 3DM9B 3U3XA 2ZRKA 2XOEA 1Z5WA 3CH4B 1I7DA 4JS0A 1ZZEA 1Y3DE 3UPUA 2XMSA 4RLQA 3NWEA 1GQQA 4CTMA 4YT2A 3DFMA 3DMNA 4NARA 2EIXA 1YZTA 2IUUA 1WBDA 5TNXA 3L4EA 2H4HA 1VBMA 1Q1AA 1FRVA 3B89A 1RC8A 3MJDA 2DRIA 4LS3A 1H5UA 5GADl 1KFEB 1VE6A 4R05A 3CRZA 1N5JA 1YL6A 2HF2A 2VDWB 5FBLB 3ZZNA 4C22A 4KQ1A 1GPKA 4ME6A 5KQGA 4G86A 2QZPA 3GDWA 2H17A 1H4SA 2MDTA 3O8CA 4IQGA 3VO9A 1LI4A 1HT3A 3KT3A 5I8WA 5JS2A 2KM1A 3CF4G 3WL8A 2H5EA 2GVZC 4H9GA 3QX7A 3L0ZA 3PGJA 1G2PA 4MQUA 4CU2A 5FL7A 4K40A 1V1RA 1U2QA 1UAGA 2QTRA 2QUHA 3HJBA 3OJCA 4RE5A 4M0LA 4TKVB 3ZC3A 2A1IA 2ZBQA 5LOVF 1CY4A 4Y6GB 2QZ4A 3DEAA 3IPCA 1NUAA 5KYWA 3JYQA 3G0OA 4NWIA 1U7UA 2BZSA 4JH0A 2NU7B 5E1MA 5JSYA 5HM6A 5I7UA 2PN1A 2BR5A 3WLFA 5LQDA 1U8ZA 1TI7A 4KAAA 1UJ5A 2EP7A 4QFMA 3H9CA 2QM3A 2X2EA 3NBUA 1B4DA 3T7CA 3UQZA 4FOOA 4M8NE 2ZIVB 1Y7PA 4N5MA 4Q18A 4DM7A 1RYNA 4KC0A 2AX3A 1CUZA 4W8OA 4KXUA 3BRWA 1JJVA 4G5YA 4GZ3A 1HTWA 5E4FA 4JI2B 4DUPA 3S8YA 2P2LA 1NI4A 2JGFA 4RVNA 5HKAA 2GGSA 4F60A 1WTAA 2VUSA 4B74A 6ADHA 1DX4A 2BKEA 3B1FA 4XRRA 3TINA 1X1AA 3MRTA 5C5IA 2RBEA 5C8XA 1Z4KA 3K5PA 1HTTA 1R4MB 3BHNA 1QGAA 2VTVA 1XCGB 2B8EA 3MGCA 4XOUA 4L1KA 3HJFA 2GHIA 1ISJA 3F78A 4EQ6A 3E9YA 5LZ5A 4J7CA 2XE8A 5AVYA 1ZJ5A 3S1SA 3W9BA 2HQSA 4I55A 1BWPA 1JW9B 3NCTA 4P7KA 4UUQA 3KR1A 1JNYA 1TE2A 5CA1B 5SYNA 5ITZA 3FPAA 5FWXA 3ES9A 4WI1A 4F46A 2XZDA 1GT6A 3BD7A 3PRKE 1W88A 3AIMA 4N82A 2P65A 4IGEA 1XAHA 1JR3D 2HEGA 1ACMA 1U9YA 1K27A 2V7XA 3A06A 4LVCA 1QRRA 1HDEA 3AR6A 4OHCA 1DIRA 2DB3A 1B23P 1L5FA 3B7GA 3H8VA 3ONFA 5JU6A 3ZJVA 3C15C 2AKEA 3GUVA 4WZ6A 3PNSA 1CUCA 2YBEA 2XCRB 1A72A 3V33A 4JVOA 2ZAGA 4LJ9A 1DOHA 4LRYA 4HTFB 4K9MA 1BD4A 3G85A 3KVYA 5GZ1A 3CE6A 1X94A 3KWMA 1TM2A 4ZREA 5GGXA 3D4LA 2WABA 1KXZA 1J5XA 4YHBA 2IXFA 2FP4A 1D8TA 3PUVA 4A0HA 4WKNA 2XZPA 3PUXA 4DQUA 1YB2A 4U5XA 5K8JB 5IM4A 4AM8A 1GKUB 3B60A 1WEHA 5EEHA 3TQQA 4FQ5A 2XNCA 1AOXA 2QSJA 4UC0A 2VJYA 2X4DA 1XZAA 3PQ7A 2HA5A 3RRZA 3WKDA 3DL0A 2P27A 4L07A 1AK1A 4H27A 3BERA 4AURA 2P2SA 3PNMA 1U8TA 4R5HA 2NVUB 3EGVA 5B5SA 4X60A 4C4ZA 1QGYA 2O5VA 3AEYA 5KU1A 5JEEA 4XSVA 1QIMA 2X5OA 2PMKA 1L5KA 4EPRA 1NNEA 1Y3AA 2BMAA 5CEFA 1JFFA 5FI5A 3ZGNA 2ZROA 2QPTA 3BWEA 1G9XA 3X1JA 4OQNA 4ZAZA 2RBGA 4XX0B 5CRIA 5TT0A 3VKWA 4V1CA 2IGTA 4CLOB 1XL0A 2JBAB 2XWPA 4FUTA 5HTKA 4D74A 1L3CA 3LQ2A 4RAQA 3HUDA 1P5HA 2BHRA 4ZPJA 3ZX5A 2JFWA 2WAAA 3CVVA 4OTZA 3N2EA 2JAPA 2EKBA 2GHRA 5GOTA 3VSDA 3L1UA 2HEIA 3TVTA 1RLTA 2YIVX 3SLKA 3ADDA 2AJDA 3JD2A 4U3JA 4HV4A 1M5TA 2WU0A 2QVYX 4BASA 1F3OA 3ZWVA 1SVIA 1TA9A 2GCOB 3DZJA 4FKZA 5TS3A 1KVSA 5TMBA 3KYCA 2HFKA 5CT8A 1L7RA 1E1QA 2GBIA 3V7UA 5D5QA 3OTGA 4HLDA 8ABPA 2R47A 3Q6NA 3NJRA 1NV8A 1XQVA 5FHQA 1U0EA 2ZUDA 1YQEA 3TXYA 1FPQA 1U2ZA 5LP6A 4HWTA 3V8RA 5DNVA 3VH4A 1X3LA 1EZ4A 4F86A 3B85A 3GJ6A 1VKZA 4M9XA 3Q1LA 4DBVO 4G0UA 1FUYB 2DWOA 5LZ2A 4QJ4A 2PQMA 2XTNA 5I7AA 5IM5A 3QEAZ 5DNAA 1Y1PA 4TXMA 3FNBA 2XUIA 4WEQA 1PV4A 2WSBA 2QVCA 1QE5A 2GX6A 4PWZA 5IFLA 4EFLA 2HMSA 1TKAA 1SFRA 1N5RA 4MKGA 2I4OA 3ACBA 4K6CA 1A5SB 2E87A 1ADCA 3MW8A 3CVYA 4KFSA 2PG3A 3BRSA 3PV0A 5IP5A 4OK3A 5DNUA 1U11A 4XEUA 2GVDC 1CS0B 3RIHA 2BFPA 2G72A 1SD5A 1W4LA 2OKCA 3D2LA 3EXHC 3EZXA 1SH7A 1DBSA 3NT5A 4D6XA 2ACWA 2ZRPA 1GSHA 1MGOA 4O4IB 4M9SA 4A15A 5D5HA 5J23A 2FCAA 3JYHA 5AJZA 4OJMX 4UQOA 4UDYX 2A3NA 2R8YA 3A11A 4CQJA 3RC8A 3AQIA 3F4KA 1V1RB 1U6JA 2DUNA 5EZ6B 3RV3A 2AGVA 3OKAA 4U8GA 1MFZA 4NECA 4JELA 3THXB 1LH0A 3PC2A 1AMUA 2IGBA 3L6EA 4FJ1A 1RXEA 4BVBA 2YKGA 4N3AA 1GEGA 2HH9A 4RK4A 4BGUA 1DKUA 5EMKA 3VDRA 4PR3A 2VP3A 1V7CA 3NAGA 4PRLA 3HCWA 1X87A 2J3EA 4QXOA 4JYMA 4GU5A 4W5JA 1E2QA 4MSUA 3ODGA 3RYCB 5K3AA 5J47A 5EWMB 2EBHX 1EVIA 3W7AA 1JLLB 4ZRMA 1AUXA 5TXGA 5AFSA 1G5FA 3N3AC 3ADKA 3N2YA 1H69A 4MV8A 1LW6E 1TZKA 1S0UA 3OSUA 2Z3ZA 3KUCA 4OY3A 4R8VA 4F3CA 5HF8A 2ZKIA 4GDFA 3RH0A 5KVQA 3QBJA 1HETA 3M83A 2GB4A 2AEJA 1DIAA 1CNFA 1XL1A 2GD6A 2J0VA 1KO7A 2WIGA 4HUQB 1Q1QA 1WS6A 4MWDA 1VB5A 3IQWA 4MROA 2C4HA 5HVNA 4I4CA 5HDBB 3TXXA 5K0CA 1C50A 4C7OB 4KQGA 3NVDA 1Y1LA 2RG1A 3AOEC 3GFSA 3C7AA 2ECOA 3LA6A 2FWRA 4Z0NA 3WGOA 1E1RD 1JKJA 1XGKA 1WZUA 1OUMA 1LX6A 3PJGA 1Z7BA 2CNLA 2OHVA 1CUHA 2QW1A 5CK4A 3S5UA 1SUAA 2ZOSA 3HEMA 2O05A 1Y5MA 2WFLA 1YJ5A 2WIJA 4Q16A 4Z86A 2DR0A 4RACA 2OY0A 1LNZA 3CUSA 1YUMA 2WSMA 2X8LA 3CCFA 4HDNB 3FWHA 4M6WA 4W1SA 1P2VA 1RWVA 3ZY6A 4BNDB 5HXAA 1SCNE 3EUWA 1WXEA 1SKAA 4P38A 1SVNA 3TDMA 3K8ZA 4GOMD 4JT2A 1G8HA 2OORC 1QVAA 3JXEA 3QQPA 5JZSA 1AKEA 1EFPB 2I2XB 3C6YA 2UV8A 3EVCA 3EGWA 5JCJD 1JB9A 5AVXA 3RUHA 3D64A 3SOZA 1HNXB 1T9GR 2A58A 2ISQA 2DJ5A 3OE5A 4JU8A 5KOJA 2QJOA 2Y6UA 3CIOA 4UDNA 4ZCSA 3ZW9A 3HXOA 2LTAA 3GRRA 3I34X 4PYJA 2YVUA 4PVCA 3ZIDA 3E3AA 2DQ4A 4MS4A 4C21A 3AI7A 4RCVA 3U16A 1LSUA 3FKJA 3L6BA 3DCNA 4HDKA 4ZVVA 3ER9A 3IXMA 2R751 3PPVA 5DMHA 1R88A 1Y7TA 5KHOC 2HR1A 4LK2A 4ALMA 5HRCA 1KY5A 4DQVA 3FNGA 4QUGA 4TTRA 2IX3A 1ILWA 4JJIA 4H59A 4JQOA 2FEOA 3LBHA 1DBVO 4ZQHA 2V7BA 2GBGA 4HQ0A 4ZP1A 3W79A 4D99A 1YA4A 3E8SA 2OYSA 3GMIA 2FSUA 2OBLA 1AHNA 4L0QA 4UTOA 1CJSA 1RAAA 1TB4A 4HC4A 2ZT6A 3M6LA 2GZ3A 2NNWB 2RK6A 1GGFA 4PRYA 2VJMA 7YASA 1DQPA 5HKLA 3ZDFA 1UBUS 3F71A 3EEBA 4UBIA 4G24A 2AEMA 4G97A 1JFSA 2PBLA 2WNIA 3GCGA 3IP5A 5UKDA 5A5EA 3IQZA 4AY2A 2V7TA 2P3QA 5EAIA 5T5QA 1Z8NA 2VJCA 3CWQA 4Q05A 3KDSE 3TOVA 3QPVA 3UWOA 2DU8A 1QS0B 2IIBA 1Z2OX 1VIYA 4C76A 3W5DA 3OPXA 1HRDA 4J3NA 2XNDA 1NVVR 5ULLA 3NDJA 2C3YA 4RKWA 3B7PA 1ZU4A 1UT6A 2C4MA 2H5IA 2NUAA 1Y9EA 3SS8A 2JHFA 4JKIA 5PNTA 1AS2A 4CFSA 1UJ6A 1E89A 4G84A 2DEUA 5FR1A 4ESOA 1J5EB 1NJ6A 3A04A 1BHQ1 4L0CA 2FWAA 4CE6A 2PUEA 5IF3A 3ZGVA 1DKQA 3DMPA 3V9PA 2VAPA 3RVOA 1Q0TA 1KAGA 2BHSA 2YY7A 2NQ8A 3MERA 4YPFA 3V4SA 3QVVA 3TZHA 3SEAA 3WGNA 4CKBB 1AO0A 1DAOA 1K5HA 1YRAA 5LC1A 1RRMA 4LW8A 2O5EA 3I8SA 4JT9A 1A9YA 1J23A 3DYVA 1S2DA 4G1EB 4KE8A 4M8IA 3WVNA 3UMSA 2WIKA 1OPRA 4OI1A 2GCOA 2FXVA 1VKNA 3NHZA 3L4BC 4HXFB 3SIPA 2HWYA 2NZJA 4DA8A 1Z35A 2EW8A 4C6HA 4F91B 2I1WA 2M6SA 4P4UA 3UMFA 3S68A 4X84A 3GYGA 1I2AA 1YDWA 3L0OA 4L08A 3NJ4A 4KR2A 3UJ8A 5E1BA 1HK7A 3UXMA 4D9HA 2ATXA 1QGDA 3EDOA 1QQ7A 3KCQA 4G4JA 1KVRA 2ZLBA 1P0FA 2IXAA 2EG5A 2XB4A 3JR7A 2BMFA 2QG4A 3O1HB 3KSAC 1UZNA 4X66B 4LHWA 4MR9B 2OBYA 1KI1A 4IWYA 4BY9E 3RYCA 4QWWA 2B69A 3D4BA 3F5QA 2BRUA 2ZBDA 3OPYA 3FKSD 4HI0E 3FBGA 3T1TA 4D9GA 4YRGA 2CYAA 2FG7C 4ZPXA 3KEGA 1YS1X 3QUTA 1N6PA 1LTHR 2OCGA 4FDAA 3C45A 3CA8A 4JUIA 4PHHA 3OCXA 4Y9SA 4C78A 2IDJA 1JWAB 2JGAA 2R66A 5FX2A 2APJA 2IYUA 2EXXA 3OJXA 1EDEA 2Z8ZA 3L43A 5FO0A 1KMNA 5LXTB 3V1KA 5IHXA 3BGIA 3LZCA 1RPJA 4DJAA 2XMZA 1V7QA 2O1EA 4TMYA 5ISMA 1VPVA 2HWWA 1K5DA 2P3SA 3AR4A 1P77A 3GEDA 3DD5A 4QELA 1G63A 4FFOA 3W05A 4D0LB 5CFZA 4I1RA 4YI3A 4JXZA 3G88A 2GD1O 2IXDA 2XXBA 2AYXA 1PJ3A 3OX1A 3THWA 1QCCA 2QM7A 1WZEA 1T36B 2B3DA 3STVA 1LS1A 5LIPA 3QHAA 1G7SA 5ALYA 3WJ2A 4H08A 2A5GA 5FL7D 3JRNA 1NPYA 3FUCA 3PJFA 4C4RA 5C1PA 2MMCA 3GCXA 4PONA 1E2HA 2R1VA 4CTJA 1ZKDA 3LPLA 4OHKA 4A5SA 2Q5HA 5FPYA 4DJDC 2CNWA 1FFAA 1S2OA 2HU5A 3OFJA 1L7MA 2OCBA 4HZUB 4LQCA 5ESDA 3ZBUA 3DULA 3SC6A 4TQAA 2IA5A 4H6PA 3TQTA 4B4UA 2PE5A 1JJBA 3R8CA 4D26A 4I4TB 3PUWA 4PXAA 5SZIA 3U7GA 3T5AA 5HZHA 3ZGZA 3IAM1 2FEWB 3T3IA 3AR2A 2ZB3A 4LBWA 3EOBI 5GONF 1YBAA 4FOTA 2NV2B 4R8LA 3RV4A 3RNLA 1NPDA 1R18A 4MGHA 4LJKA 4F85A 2IPAB 3O9MA 5IAAA 2IPNA 2QPAA 3NBFA 3Q9SA 2EQ5A 1DHRA 3HLKA 3U7EB 3BE6A 3Q5DA 2HJGA 3RG2A 4E03A 2DFTA 2C2BA 1RC1A 2YJ5A 5KKAA 1THZA 1GFSA 3PKJA 4PGGA 2PPVA 1LPAB 1JIUA 4FMBB 4G1CA 4WXMA 5FR2A 1ZW6A 4DA4A 1F3LA 3L7BA 4FP9A 1GFWA 1ECGA 1AHIA 1IMJA 2V7EA 1K66A 2WWTA 2ZUUA 4KZPA 1TPYA 3S2GA 1J2JA 2HIAA 3SS7X 1Y4SA 1USGA 3L6CA 1D0IA 2D54A 1DC3A 4OBEA 4NH0A 1XN1A 4RESA 5CLFA 2PUFA 2J5KA 1UKZA 3AYZB 1EGQA 2FDRA 1QG2A 4G56A 5K5EA 4V2IA 3VR5A 2JFHA 4WN9B 3NM4A 4LK3A 4ZFNA 1OWMA 1YS4A 2ZVDA 2G25A 4C20A 3F6CA 1JHMA 2WC1A 4YMSA 4A1FA 4D3YA 4HPXB 3IB6A 4C2TA 3W4IA 3HKCA 4RZHA 2XODA 2JD0A 2OM2A 3PI6A 4Y7CA 3WQRA 3L7NA 5EVJA 4ETMA 4OEHA 1PR9A 1UKYA 2E4VA 1T10A 1IVYA 3OIVA 4N0EA 3WFJA 3ZZUA 1GRNA 4E14A 4GOXA 3LWDA 5EIHA 1Q3HA 1OJ7A 4B3XA 2F8SA 1T1GA 4Z7QB 2PWYA 3KS9A 2GAIA 1L8OA 3DOEA 2IYNA 2C4TA 5I47A 3F46A 1X1TA 5DYGA 1JT9A 1RQXA 2H4XA 4QOEA 4DLTA 4EVRA 4XQGA 3DTNA 2W71A 3MCVA 1MKYA 3FGZA 5JNRA 3BG5A 3ETCA 5A7HA 3T5MA 5A4FS 4JBHA 4MYRA 5EXDA 3LLVA 4EW1A 2H6EA 4C88A 1N5OX 1ZD2P 1U7XA 1TM7E 3HXKA 4OHWA 2GXQA 3AM4A 4BNTA 4D3ZA 7REQA 5IJ0B 1SO8A 2W70A 3DMYA 1Y6RA 1QK4A 1CUAA 4G89A 2HQRA 1HG0A 1TLFA 4DF3A 3UV6A 5CITA 5IC4A 5JDIA 1GTSA 2NX2A 3GN1A 1DV1A 2BFFB 3IQGX 2OBBA 1B74A 3UM9A 5KNLA 5JTTA 4HQOA 1MC4A 5HHTA 4XWWA 2XQJA 2PMBA 2NU8B 1TAHA 3GJZA 4ZOLF 1FDTA 3A1FA 4OPMA 2FH5B 3BD6A 4JLSA 4BV2A 4QPJC 1FP1D 4MV9A 3CNHA 1BN7A 4QASA 2IHJA 5CAEA 2I1LA 2JIPA 4NESA 5HGXA 1P6XA 4B3TB 4QAQA 4I36A 2FN7A 2X7HA 1FFBA 4LXHA 3RTAA 3PFWO 1H6BA 3WV4A 3JAMA 2F7SA 3HRHA 4RNCA 4F21A 2QRZA 2MCFA 2EGUA 4BXOB 3M5DA 1OXUA 4V02A 1VPEA 4Q37A 3WLKX 1RE1A 1YC5A 2BZGA 3F6SA 3JYNA 2G70A 1J8QA 1PTJA 3BGSA 1GNQA 4I6GA 1CZHA 3W4KA 2CEKA 3DXXA 5JFOA 1XMXA 2RGXA 2VPTA 2YASA 4A0QA 1PK7A 4RJIA 2JAHA 3Q1KA 4OLHA 5IDYA 1FJGB 3U80A 2W2KB 4UHDA 1JQ3A 3K7EA 4IV0A 1NXSA 3KDAA 1EVLA 3Q8MA 4IH4A 1YV9A 2Y1FA 2WT4A 1YDFA 1CDOA 2HRCA 3A4NA 3ENWA 4UNSA 2Q4DA 3UZUA 4E13A 3KOUA 3NAMA 3JWJA 1AVTA 2WILA 4CQLA 3PT5A 1OV4A 2FR0A 2BMDA 2L19A 4NAHA 2ZM6B 2LUOA 5CTAA 2A0UA 4ABTA 3F7NA 1S1CA 1RLMA 3VNRA 3VR6H 5BOSB 1SG9A 3SF8B 3TQHA 4C06A 4EY5A 3E3OA 5EJ7A 3DEFA 2FLWA 3F74A 4RULA 3G2HA 2KX7A 4DJTA 5BYKA 1I0ZA 4YNBA 2ZE7A 1XNJA 4ZEXA 4NJEB 5JBIA 2VRCA 2IF2A 4RA6B 1NXPA 1KI6A 1WHSB 4H3KB 2DR3A 1ZUNB 4S0ZA 5E7IA 3FROA 1R0WA 3GHHA 5B3JA 3WWPA 2EKLA 5C0OE 1T1IA 4I8DA 3KJFA 2KBEA 4MUJA 3KG2A 2EQAA 3NORA 4OIMA 1MABB 1HQCA 3H4TA 4TROA 3RCBA 4QVIA 5GIOE 3QLVA 1W4BA 1FXWA 2BSXA 1FTGA 2V4UA 5FYDA 1VBNA 4HCJA 1SUCA 2H4FA 3LDUA 3GIDA 3TRIA 1QORA 3L05A 3PEVA 4TKUA 1FTYA 1M7GA 3K32A 3T7JA 3VZRA 4ZYLA 2BMVA 1PO7A 4L8YA 5EC8A 3TBKA 5D00A 3OQ6A 2EU8A 4PN3A 1O1YA 4Q6WA 2QEQA 3GEPA 4M7OA 3KEQA 5KOHA 2QVLA 2COKA 3OIGA 4DC1A 4KHPB 1OCEA 2JFUA 2V3VA 4IYRA 3RT7A 3I2KA 1EB9A 1F1JA 1GUZA 2CHQA 2IL1A 1KYQA 1UJCA 1VL0A 2A86A 3B9RA 3HY4A 3JAWA 1YWGO 4V0MA 3QBTA 5F9MA 3WDSA 3A37A 4BMPB 3ND9A 4JSTA 2HPZA 3LIIA 3L8GA 1QAMA 4W1RA 3ZV4A 2M1ZA 3FZNA 3MUEA 4LN1A 1XEFA 4UUNA 4X1KA 1VBFA 3GLFE 1DAGA 1QP8A 2X41A 2XWJI 3DSRA 3BIOA 1JQAA 4DC9A 1D9XA 3DHNA 3OFSA 4LYYA 5TPWA 1BXRA 4HLUA 5ER6A 1KAOA 4NR0A 3VU9B 3FETA 3ZHOA 4PYIA 1A8SA 4LE0A 3ZWWA 3WQBA 1P8JA 1A7AA 4IIDA 2GDJA 3OOJA 2XBMA 1RJGA 2Q0SA 4IIJB 1CUEA 1MORA 3I1YA 3AF5A 4FYKA 4G5FA 1O4VA 4R01A 3HJAA 1KQPA 3HP4A 3UMBA 2XUOA 2DFPA 2Y0EA 2VAVA 4MWCA 3SHQA 2H5JA 1OGYA 4KU4A 5I01A 2H7VA 1CQXA 1XRPA 2ZJOA 2PYDA 3PL1A 4ND1A 4EJMA 3OOEA 5EERA 3OKPA 5LQKA 1NUUA 5T64A 1JVBA 5K6RA 5FBRB 1NUHA 4IQFA 1VYUA 2V0CA 3LXRA 3OZRA 2HFJA 2EZ8A 2V6FA 2VS1A 2O7VA 2OQIA 4C05A 1L6IA 2G4CA 3FMPB 3GJ0A 1B6SA 3TNDA 3T94A 3PE3A 4JLWA 2UYCA 1KRXA 1E0AA 1N8TA 4X7MA 3VR3D 3PGXA 4LVOA 5AJXA 4Q3DA 1K8RA 1U3CA 4URZR 4P0QB 3A2KA 1XK7A 4XQ9A 3EFHA 2O54A 1A7KA 4B87A 1BQ4A 2JJ8A 2JI7A 4FEGA 4FYVA 1U2PA 4M9QA 4CUJA 2CF5A 4WZAB 3EQZA 4B3MB 4OAQA 2TMDA 3V4FA 1ORVA 2O0JA 1UBKS 1A27A 1L7VC 1DV2A 1TMGE 4I5DA 1L4LA 2R11A 1CUWA 5H16A 1L4FA 2JCYA 3X1DA 3B2NA 1A98A 5DYWA 4B6RA 4G8BA 2WJYA 3BB3A 1BCSA 4Q4CA 3DLHA 3RVLA 3MSXA 3Q10A 1B76A 3ETGA 1NXTA 3GRCA 1GYQA 2J5RA 5U1PA 4JVNA 4Q1BA 3DW1X 2ZIXA 2RJ3A 3TQIA 3VMFA 4MPDA 1LVUA 3NBZC 3KCNA 3PDIA 4AZVA 2WVHA 3L79A 1E0KA 2VTEA 3OQHA 3TSZA 1PUJA 2XYGA 2O5CA 4M98A 3E1GA 3CVJA 1GTVA 1JV2B 2WWYA 1GGVA 1BFKA 3WE7A 3UT5A 4AG6A 5H4GA 3ITNA 3DEHA 4BMDA 2R2AA 3PZRA 1U2DA 4XGIA 3NM6B 4CM4B 2YFHA 1UFOA 3L9XA 2WB4A 1YK0A 2ANBA 3AEQA 3CT4A 3D6TB 3I9MA 3KIPA 4ZOEA 5GY7A 3OPVA 5CXXA 1JS1X 5AWFC 4EY8A 3CNOA 2JGDA 1G38A 4TTSA 3BAZA 5HFJA 2QN6A 4LX0A 1MAVA 1Z47A 1SXJC 2HNBA 4U6SA 1MU0A 3O90A 1EM6A 1TO1E 3O0DA 1UUFA 2HWKA 3AFHA 2EIHA 1K63A 2WTMA 1CTQA 1H94A 3D6VA 5JNVA 2H57A 1KY4A 4IL5A 2XTZA 4RYLA 3QLEA 3W9YA 2QR5A 2LCQA 3RANA 2X0DA 1WY5A 4CMKA 1T8SA 3RC7A 2BIFA 4H7IA 4BFCA 3FFAA 4D02A 5KC9A 3QWBA 4Q4AB 4JZKA 5TSDA 1CR1A 1DI0A 4IJQA 1NUQA 3HXLA 3TCNA 3A14A 2AHOA 3IRVA 4E2FA 1WABA 2R9VA 5IAKA 5J4VA 1M76A 1XTKA 3A9CA 4M1WA 2F1IA 2W6ID 3LBNA 4TTTS 2UYHA 4AECA 4Q3LA 4BLOA 3IVRA 3OUZA 4DCNA 3UENA 5B55A 2XCUA 4PVDA 4C01A 1FS6A 1KO5A 4LZOA 2JGJA 3C5WP 4QYWA 4OMFG 1H2XA 2IZZA 1ZAKA 4DYVA 1V5GA 3EZ7A 1IB0A 2G76A 3P2EA 3UKJA 3V7WA 4DAEA 5ITSA 3AVWA 4Q03A 1E9CA 3H2HA 5CFNA 2RH4A 1EGHA 2IZ6A 2O2CA 3ILYA 1F0NA 4CV1A 4EO4A 4Z9YA 1U28C 1P44A 2O2HA 2EJUA 3A6FA 1L5LA 3D3KA 3ZNOA 3R6LA 2BFEA 3WGUA 2PMFA 2WWWA 3DO8A 1K8XB 1XU4A 4GRAA 4R98A 5KTRA 3MAJA 3NHLA 4MDYA 1L7EA 3DZIA 3EEOA 3OQBA 5TF4A 2E89A 5REQA 4B7ZA 3MOSA 4EPYA 3EQ8A 4WCVA 1UPCA 2IITA 3QJ5A 4OHFA 5FPKA 5KSOA 1KNXA 1Y8AA 1Z56C 1M8KA 3ZE6A 3R9WA 5EN4A 5FNVF 4NCHA 2I66A 4E2YA 2DAPA 3O2SB 3QU2A 5AHXA 1BXGA 1L7XA 1AC5A 1COWD 2RH5A 4A7PA 3AOGA 2WG0A 1I3OA 1PN3A 3P0HA 1Z68A 5EIAA 3SMVA 4C4PA 2P90A 2X4GA 1PTJC 2MJLA 4I14A 3NHJA 3IAS1 1XMJA 3S29A 2AOXA 4B6PA 4URFA 2WU4A 4EENA 1B0UA 2AZDA 3KV1A 4M9UA 3HCFA 2CJWA 3PFGA 3G82C 5FBQB 4XLZA 3QA9A 3ZWMA 3ZH2A 4QLOA 4WXRA 2QX6A 5HCUA 1OHHD 1U5BA 2AI3A 5K01A 2BGUA 5E6SA 3ESQA 2X6RA 2WQ6A 1POWA 2AMYA 1OLXA 1T5DX 2WAMA 5KVVA 1VSQA 4RLSA 4YH1A 3OFKA 5TEWA 3ABZA 3CNEA 3ZWKA 1P74A 3BL8A 2FMXA 3COWA 3I2JA 3NT2A 3QYAA 4KAJA 3VO1A 1ZHOA 3ZQ6A 2WKRA 4KKXB 3CLSC 2X1VA 1F4LA 4R1UA 4OYLA 1MH1A 1HE3A 1Y9ZA 2PGAA 2R86A 4UEWA 4TMVA 4QOFA 5C37A 4BX3A 2D74A 4JYCA 4WXEA 4MW0A 3VO2A 2FX5A 1TX4B 4CM9A 2AG1A 3GR6A 3V6MA 2P6UA 1XNGA 1IJBA 1CQJA 3VU3A 3IE2A 1R8JA 1SULA 4L8LA 5AXCA 5HIIA 3VHLB 3IOBA 3F3KA 1C0KA 3U9LA 3FGOA 2IEZA 2PS0A 2PLWA 2X8JA 4O4LA 1MV5A 4YY3B 2ZKLA 1VDMA 3BICA 3Q2IA 2RGYA 2QZSA 4N1AA 4ONEA 4GLBA 2VBCA 2FKNA 5DXAA 3UY4A 1YAJA 4L0MA 1Z4NA 3ANXA 5IABA 4G8DA 1LBQA 5IT9A 4E2ZA 2Y2UA 2VT7A 3UMCA 1X9HA 5A04A 3NQ41 3A9SA 1QONA 1IPHA 2DBRA 2X7JA 3F5FA 4W7IA 3ZS9A 1G19A 2PRSA 1ZCJA 3A3YA 4U2GA 2FDCA 5FKJA 1DBWA 1H2HA 2B0CA 1OWPA 2WFAA 5JSQA 3RFTA 4IGKA 5EFOA 5CDFA 3KX2A 4HAIA 1Q84A 4GLJA 2NYVA 1Z5UA 1NSTA 3LYLA 1KZ6A 1OFUX 3FZYA 1IN8A 4IDPA 3HPQA 2JANA 2OAQ1 1GPH1 1SVLA 2Z04A 3CX7A 3LS2A 4CFZA 5D2CA 4DLXA 3FPGA 4CF7A 4G0VA 3PVZA 3FCAA 3COVA 3OJLA 5AQEA 3NBKA 3ROZA 2BE7A 3VDNB 1Z6ZA 3AT1A 3QXHA 2WINI 4QGHA 2Q49A 4EDHA 4OL0A 1O8CA 1LCIA 1XZ8A 2HLHA 1NE7A 4CZ2A 1D6NA 5LMCA 5BNFA 4YCNA 3B6MA 3OPQA 2VH1A 1LKZA 4NS1A 2BLLA 1BCSB 4TMXA 4ZOAA 1BHJA 2BEUB 4LA4A 2R48A 1I2CA 3U7JA 2ZI7A 4KK3A 3HG7A 1T5HX 1DHTA 3DZ8A 1DDOA 3KQSA 2XCTB 3HKDA 3R0ZA 1X80B 4NLLA 4HWPA 2CZGA 3B48A 1JIQA 2CDRA 3CUYA 4IQ8A 4RHFA 1FQJA 5EQDA 1BE0A 3KR9A 1LLDA 2YV1A 3WLLA 1FFYA 3W3AA 4N41A 1LQ2A 2FW7A 2ILVA 3C6MA 2JI4A 1EXDA 5CPBA 10MHA 5MGBA 4E1VA 4DHWA 1YZKA 4YV1A 5KMGB 4HWSA 1W4CA 4DNQA 5H3CA 4EJSA 4YAUA 4RHUA 1DEAA 2IV3A 3L0YA 2C88A 1P4SA 4KXYA 3DL7A 3A6EA 1L5HB 2WNHA 3H99A 1G3MA 3ITDA 5TGZA 1CR4A 2BFCB 3OJEA 3ZUGA 4GDMA 1W581 3AUXA 3O75A 3R7WA 1S89A 2YXDA 3PK0A 5DULA 3GELA 4XW2A 2QL5A 1E94E 2DFNA 3HU2A 1JDBC 3CINA 4W6ZA 4WZZA 1OREA 2HRDA 1GFIA 1W85B 2NYAA 3GNQA 4IEFB 2C3UA 1JG7A 4OXKA 4GS5A 1XLTA 5F4ZA 3VR4D 4M53A 1E66A 1XDDA 1KI3A 3DDSA 2CN1A 4HQRA 2CFCA 2ZBGA 2WZBA 1PLLA 1E0DA 3COSA 3NHSA 4KBFA 4LKRA 1UM8A 1KWKA 2R7KA 3G2JA 2ZJ6A 1ZAYA 2QUBA 2FQ1A 1T6XA 1A04A 3Q7QA 4AO8A 2XA1A 1N6KA 2ZI5A 4QFDA 3TWOA 1OYWA 3K4QA 3KAPA 1OQAA 1PSWA 1NJ5A 2FRVA 4QPPA 3IQFA 3WB1A 4HQ6A 4PHFA 1NG9A 1ZGGA 2AR7A 2IIQA 4MV7A 3WQHA 3DS8A 4BQPA 5CH3A 2JCSA 1JG2A 1OR8A 2JDID 2VXYA 3ESRA 3OEWA 4PX3A 3W2GA 1U2DC 2RDMA 5EVCA 3F9RA 5L4LA 2NTVA 2A35A 2C8JA 5L3ZA 3ZKWB 4V0RA 5CLHA 5LQRA 3KQOA 1ND5A 1NP3A 1TECE 2J3JA 2YNMA 3PF8A 4JJ7A 5DHRA 3UJBA 2VAXA 1SC9A 4BYMA 1YJQA 2DQSA 7ABPA 1DFGA 3FE2A 3KU4A 2VRWA 5ETJA 2Y4NA 4RJ2A 3BKWA 5KJEA 3LE8A 5AXBA 5KOHB 2VQFB 2Q1TA 3C2QA 3IBFA 2XVAA 1M66A 3EVTA 3K3PA 2Q2NA 4WCDA 3CXRA 3EGDB 4KE6A 3UOWA 4Q9HA 1Y81A 3DO6A 3OFVA 2ADOA 3NC4A 1HWYA 3O91A 4AQDA 2AT1A 3H11A 4PTZA 3TM5A 1WV0A 1TA4A 2W22A 2ZIGA 2IEGA 2IYTA 4PWYA 3OCCA 3K70B 1EP2B 2WIFA 3L6RA 3DKPA 3WYAA 5C3MA 1D0SA 2KW5A 4NYJQ 3CTPA 1QK5A 3KPYA 3IDZA 4DV1B 3I28A 1WQ1R 4ND5A 1SKYE 4TSFD 4CMAA 2ZVPX 1J2RA 2WQZA 4H7EA 2XEDA 3PGVA 9ABPA 1UOOA 1A97A 1K3UB 3P5SA 4LFAB 4N5NA 2F3TA 5DT2A 2BD0A 1OASA 2AG6A 5DNDA 5BYAA 1ADYA 3T3NA 3QEBZ 1CQJB 2FE4A 1J5PA 3PEFA 4ZVLA 5BOSA 3L6UA 5AUQA 2J3KA 3O2NA 3D31A 2FMIA 1SCBA 1EVKA 3E61A 4HMQA 5TQJA 1RZRD 4C2UA 3AWIA 2AKYA 4D4JA 1Q1BA 1R8QA 3C97A 4G63A 1VI6A 3DEJA 4M0FA 3FFBA 3IEKA 4FCVA 4LVUA 2AS0A 2OO7A 1RCFA 3BFKA 1GQYA 3IA2A 3UBTA 1TCAA 4LXYA 1KZ4A 3BHJA 4X8OA 4HQKA 2IV7A 1WP4A 4B0OA 4EG7A 2UXCB 1KYXA 2IYQA 1AIPA 2Q3FA 3T41A 8ATCA 1GP2A 1P5FA 4ZV9A 5IKOA 1P80A 3GBPA 4YJFB 4NCBA 2IOQA 3KT6A 2BM9A 2GPYA 2H2AA 1PW7A 1CD5A 2QD2A 3VDMA 3MK31 2PJRA 5HA5A 4OQMA 5F7ZA 3EFEA 4G0OA 1NQAO 3S27A 5CB6A 4BBAA 1RW4A 1ZVVA 3H75A 1Y4UA 2BEKA 3LOUA 3PWKA 3NHYA 3O4JA 4Q4HA 1EDBA 1YQXA 3CJRA 5CPFA 3UAGA 3HUEA 4R4JA 4YR7A 2KBFA 3D4NA 3LQ1A 5AESA 4EI8A 5LQCA 1PWXA 2RB4A 5DRTA 4XIJA 4JCOA 4BNIA 1PG5A 2XRZA 1Z4MA 5IT0A 5CR9A 2DWUA 1YR2A 2HDOA 2R2GA 3LQRA 5IH7A 2IEIA 4K9DA 4M1MA 2JHCA 4ZMRA 3UGTA 1RIFA 1QJ4A 4H7JA 4TRJA 5BWCA 3U61B 4WIAA 1KP3A 4NDAA 3UWPA 5FWXB 3L7AA 5E4YA 3EFBA 2C7BA 1JDUA 4YECA 1GADO 1P31A 2BZ0A 2ONYA 3CF2A 4L8GA 4F5YA 1XPUA 3GG2A 1DC7A 2VOEA 3HKEB 1R7RA 2DUJA 2FPIA 2A7XA 3OKCA 1OB2A 3O9ZA 3KAQA 1OI4A 4F2PA 1V43A 1M67A 5D84A 3H9EO 3HYCA 3LVRE 4O2BB 4QZVA 1Y5LA 2QVXX 2X7XA 1E1CB 3GG9A 3IOEA 3K4PA 5GONB 3SQOA 4HS9A 1SUSA 3ROTA 2HKIA 4FONA 3TD6A 4S24A 3HH8A 1XQWA 5JSHA 5CHEA 1QU2A 2J85A 1IN1A 3V4LA 1EFKA 3IEPA 3S4YA 4BTLA 1NIPA 5DPMA 1GCAA 1P9RA 1TJ4A 3DV0A 3X44A 2CC2A 2NZWA 4LPSA 3T0IA 2C1XA 3IP7A 1GKLA 2JNWA 1GYRA 3QX3A 3FI9A 4KI7A 3OMWA 4JEMA 1ODJA 3E18A 1G6OA 4DGSA 1SBCA 3HCPA 5FUWA 3WMEA 4L28A 4PPFA 3DYBA 1XBTA 1L8AA 3O0TA 4LVNA 2NXNA 4PXYA 4DN6A 2Q9AA 1KQNA 2FZ5A 4GOND 1LI5A 2CXPA 2FJUA 1PT5A 1BVYF 3PFHA 3VC7A 1JZTA 2ATEA 1E3SA 4UE6A 3RROA 4AYWA 3U60B 2FW9A 2JGKA 2JIRA 1FQWA 4Z54A 4G4SO 1IBSA 2C83A 4NV0A 1G42A 2GF2A 2FE1A 2Z5LA 4FZJA 5KNDA 2PUGA 3HBNA 2AFIB 3SKVA 1N6HA 1S8NA 4IIUA 4AFNA 2ETVA 4LOAA 4AJ1A 1GG8A 1IHDA 1P5ZB 1P8AA 1K86A 3EJWA 2EYQA 3HYLA 4ENQA 1QUFA 4PFQA 2P1ZA 5LPNA 2XA9A 3C14C 1LTQA 3P2YA 1M8FA 4F06A 5FBVB 1T24A 2EATA 2O48X 1YR6A 3Q7IA 1DXHA 1M6VB 4JXXA 3U56A 3EPLA 1O97D 3ELBA 3ELWA 3ZU6A 4IMJB 1I4TD 4RZSA 4U7DA 3H4IA 1KL7A 3E7XA 4L9RA 4OXRA 3D0QA 4L4SA 3H7IA 1TPZA 3CG4A 2IZ0A 3EVZA 5JBNA 3GLHB 4URYR 2JBWA 2PH7A 4MRVA 1DKMA 4B5KA 3Q8WA 2R5WA 3P19A 1I32A 1MJHA 2WMNB 4TMFA 4EQ6B 2QN8A 2H92A 2YWCA 3D8UA 4G37A 4MK4A 5SV2A 3WNVA 4KODA 1ZIYA 2GK7A 5EQJB 3TOZA 2VL7A 5K4HA 4HWGA 5LQNA 3KB6A 5IULC 1BYIA 3K94A 3FR8A 3AY7A 4DR5B 2WB2A 2PVSA 1YZFA 4I4NA 1DC8A 2OO3A 3WDKA 4BP8A 1T3HA 1UWLA 1THGA 5H82A 4IF6A 3ND5A 1UFKA 4XYGA 4IV8A 3AH8A 2OT3B 2A1UA 5ALTA 3SM3A 1P60A 2EDAA 1MPXA 3JY6A 1Z0DA 1MH9A 2CCGA 4C4XA 2CUTA 3SHWA 5ANRB 1JALA 4ZANA 4JOBA 3A27A 1WSAA 2BRUC 5CLGA 4W5RA 2K7ZA 3DOHA 4HLNA 4UJ3A 3A6DA 4MPRA 2Y93A 3SYNA 4RW0A 3UJ9A 3DXFA 2R1VB 3O7WA 3EH1A 5CTJA 4NY1A 1H4QA 1N2ZA 3HBJA 1KQGA 3CEPB 4UVHA 2CJXA 3TB6A 3BF7A 5AKEA 2OV2A 1U81A 2H65A 2J09A 1B8OA 4U7WA 3HWRA 1P73A 1VKHA 1QOZA 1NXQA 1UDAA 1YZYA 1NQXA 3GMSA 4J03A 1I4DD 2E55A 4ER0A 2VPQA 1ZNZA 4FGWA 4INJA 2WY2D 8LDHA 3MB8A 5CW2A 1XPOA 3EF3A 3VFDA 5FI3A 3D7LA 1TYCA 1SRRA 2L0XA 1ZCBA 3FA2A 5H1YA 2XXAB 3C5CA 4ROTA 4KQMA 1YL5A 2HA4A 1W48A 3U1VA 3THSA 2VO1A 3THOA 4YUZA 1B14A 2H11A 3ET5A 2VEOA 5I7SA 6AT1A 4QOGA 4M4SA 4OHOA 3HE3A 4MUGA 4RDIA 3TLZA 4DLUA 2BTEA 3RIGA 5AI8A 4YT4A 2YWXA 1N92A 3AERA 4C5BA 1N2EA 4IHAA 3IIEA 5LNK6 3V4RA 4N54A 2AF3C 4D8WA 1W8IA 3TXAA 1YRYE 3LP6A 1UL1X 3ZXIA 4B8WA 5FUMA 4E5DA 4ZZ1A 4QBTA 1ZD9A 4CDRA 4F96A 4AZ3B 4MV1A 4GUAA 2CKDA 2X8WA 5JH7F 3LRXA 2XMPA 4QUAA 5CBPB 1R4NA 4HB3A 3W8NA 5K99A 3ANSA 3TAXA 4HZIA 3UCFA 3TDKA 1CLUA 1GPBA 5KYUB 1QXSA 1R12A 1OYYA 1WXGA 1YI1A 2AD5A 1V11A 3IP8A 4ZKEA 3ZHRA 1AGYA 2XMCA 3HPRA 1SD1A 4PC7A 5T4FA 3IP6A 2VYFA 3LFHA 2VK8A 4DG9A 1UFRA 3UB4A 1IZ7A 1ZGAA 2J32A 3QXCA 4HNHA 3B6ZA 4TL6A 4L8WB 2Q8QA 3NIGB 3HU1A 1QKKA 4MVJF 2XMQA 5DCLA 4MGEA 3B1YA 4E21A 3J81A 1MT0A 4X94A 1JBQA 4K1XA 1FRZA 3FHOA 4C6TA 3IHTA 3SHTA 1VE1A 1V47A 1CZOA 4LYHA 221PA 3OZXA 2BKUA 1T5BA 3PDUA 3EISA 4NENB 2W98A 5IAGA 5HPYB 4BV3A 3RS8A 1CE8B 3ZZ0A 4GO1A 1SQSA 3BZUA 3I6BA 5E0KB 3FCXA 2P30A 3MQFA 4DMUB 3HZZA 3MWDA 2B30A 2A5LA 3AJ9A 2WV7A 3ZJ5A 4Y9TA 4BZPA 4OQDA 1W87A 1OOEA 3V3TA 4BATA 2JCBA 1B3RA 1ZK0A 1B7GO 2AFVA 2WWIA 3Q3CA 5T6BA 1NVVQ 1A5ZA 2D0OB 1HMPA 1CZLA 1PFYA 5IMBA 3A9TA 3T7SA 1NUSA 3TR0A 4ODIA 2ZSIA 1TKRA 4GQAA 4CIBA 3P26A 3AUSA 4YWHA 1M2WA 1Z0AA 4JI5B 2O3UA 4JODA 4PM4A 2NO6A 3G49A 3PICA 4X1IB 3IVGA 4FYJA 5H81A 1WVIA 2DCMA 1NSYA 3MYRA 2OTCA 3NI2A 4ZCLA 2VJMB 3VZBA 3ML1A 4M8SA 4NV3A 1UMCA 2O2YA 2XYPA 4BO4A 4KRFA 2W6NA 4PO1A 4R9VA 4MJ3A 4YDRA 1DB3A 4X6XA 1UK6A 2YMQA 5AI9A 3SCZA 4X8LA 5CMLA 3TFWA 3ZU5A 3U7FB 4EA6A 1TK2A 3BQNB 3IUMA 4HN9A 3NH9A 2WI8A 4WKCA 4DJ5X 3FOBA 1WPQA 2XCIA 3HQ4O 3MQ2A 4KN5A 3GK3A 4OYRA 4ERNA 1EK6A 1NZFA 4YAWA 5JY6A 2VDVE 1EB8A 5A4MS 2OOKA 1PV2A 1U99A 3I6ZA 5LKRA 3DE2X 3AB7A 1S2NA 1SBYA 3R1IA 3GLIA 1M6EX 1VL5A 2VP6A 5AOVA 3VR0A 4IYJA 2NIPA 4XDGA 3LZDA 2DECA 2Y0CA 1NR1A 1NYRA 2NSLA 3A6LA 3BORA 2D2EA 4KMRA 3SJUA 3L5OA 1OGJA 1YBVA 1NI3A 4YJ2F 4ZN6A 3TRFA 3KQLA 2IWRA 3VR2D 1E5VA 2Y27A 1E2KA 2QT1A 1NZJA 1N0HA 1QGZA 1TDJA 1YIOA 4KBGA 1JA0A 1WZCA 3T7TA 2NM0A 3P8ZA 1HDOA 4GPBA 4UHBA 4JB3A 3PIIA 4MVJP 5DLYA 2BFFA 4DNPA 4WJLA 1K88A 5B57C 1H9BA 4EB3A 1FUUA 1U31A 2PFSA 5A5FA 1KZ7B 1YB5A 2C5AA 2QTTA 2RB5A 4FM9A 4NG5A 1MLDA 3GI1A 5EJ8A 5KTPA 4RKEA 3WIUA 4YRDA 4J07A 2R8PA 4PRZA 4ALNA 3NETA 3T95A 4JI0B 4MULA 2C59A 2FRXA 2OXFA 4NZPA 1LSOA 2Q27A 3MWEA 1RU3A 3FYUB 2CWWA 1BHSA 4FZVA 4KXWA 1TQDA 2WWHA 4OSPA 3M82A 3KZNA 5G53C 2ZXFA 3PFCA 4CF6A 4E70A 3GLKA 1CYEA 4EAAA 4BGDA 4K26A 1QWSA 1E4EB 3X43A 2IC5A 4CLRB 4NOMA 5L3QB 1CIPA 4UASA 1XCBA 1NW3A 2XUDA 4KAXA 4R1LA 2LIVA 1WNTA 1N33B 1ITZA 1N2SA 1DKOA 3MAGA 1N2GA 3LL7A 3HRIA 3RUCA 4JJ4A 3VTZA 1MIOA 1S8OA 4AK9A 1RKUA 1E6UA 1H93A 2OG1A 3KQPA 4LYFA 5IJXA 3MCZA 1E77A 5AHKA 3V5NA 4RJTA 2J9FB 4CCYA 5U4XA 3G3EA 4RVCA 1XHFA 4LTMA 2QTNA 3LNCA 3FJOA 4WMLA 1W2HA 4BO1A 1KEKA 2WUFA 3CNNA 1YCHA 2HLDD 1NA5A 3H18A 3B3JA 4YJHB 4IIXA 2RGBA 2QX7A 5DRYA 4C1NA 1KVUA 2D8MA 5DHPA 1LDYA 2HCJB 3M70A 4ECEA 1USKA 1Y0BA 4NRDA 1GG2A 1PT7A 2QF7A 3HY6A 1OXMA 3GGCA 2EFCB 5HE8A 3V3KA 4C2AA 2X9NA 1G21E 1AXEA 4UPVA 1KTVA 2X58A 4L5JA 3F97A 5EL0A 3WLMA 5JW6A 1NE2A 1TVMA 3ABOB 4IKOA 1T6BY 1W5AA 2E1PA 5EJMA 5A6SB 2A4KA 4UZSA 5D6NA 4E1AA 4PAGA 3ZOZA 4W82A 4RK5A 4LTNA 1WXWA 4KZKA 4MW2A 1O0SA 3QMMA 3A4TA 2P4HX 2RGNC 5FLXA 3WK7A 1K7EB 3DFKA 2DE0X 1TEXA 4HSGA 3O93A 1FL9A 3BH0A 2VJOA 1UCFA 1VCIA 4X61A 1JECA 1I0IA 3ROGA 4N49A 3ZIAD 4PN7A 4YRKA 5JXGA 3ZVKA 3ZCTA 3SLGA 1PZXA 4CEIA 4J3JA 3ICPA 4EPVA 2ZAIA 3HNPA 2IV2X 2IY8A 1XWWA 1TL7C 3L49A 4TYPA 2UKDA 4OU5A 3GRVA 5DYTA 3MTQA 2F2TA 1WQ3A 2G0AA 3FTCA 2JFYA 3DT9A 3T0GA 2IEYA 3KE9A 4UHCA 4GXRA 2OD7A 3CH6A 3ZI7A 1NUTA 1SG0A 2Q1WA 2QTBA 1XHEA 3PDIB 1Y7IA 2Z4SA 3R0QA 1N2OA 1OT5A 4LRQA 4ZAFA 2R7LA 3TK1A 5LFAA 3I0NA 5DK6A 2ZS7A 5JXIA 5L6MB 1DLIA 3E22B 4HWOA 3K2BA 2FJ0A 1VLLA 1VJGA 2JFOA 1WUYA 1G5QA 2F1JA 3YASA 1O94C 2CXTA 2FKAA 3IUSA 1Y3BE 1DADA 4TUYF 2F55A 2FDXA 1DCMA 1BXGB 4RV4A 1QB8A 2QRLA 1F2DA 3UVEA 1OLSB 2PJUA 4GHWA 3N2LA 4RO0A 3QNUA 4DDUA 5LZ8A 3UK6A 4OI4A 3BOSA 2ZZKA 1TJ3A 4GZ5A 5K3DA 4B47A 4BEVA 5FTLA 5CVTA 2GOYA 3KZXA 4DRXB 1PYGA 2C5GA 2I55A 3N0WA 4RADA 1U6KA 1UEXC 3OX4A 4JYBA 4MUMA 4GSYA 2YOGA 2GCGA 1KDYA 3SEQA 1HZJA 3I5YA 1DJLA 4HWKA 4WADA 1LV8A 4XQEA 1M7HA 2ODBA 3IHLA 3IJ5A 3GPBA 4KR6A 1E1QD 2JLUA 2R62A 1REQB 3OC6A 4AP6A 4XAQA 2HX1A 1XQXA 2E85A 1U2SA 4OOFA 2DXIA 4KQJA 4K9NA 2Z3VA 1CF2O 4DIMA 3VR2A 3RSSA 3SYKA 2BT4A 3VJKA 1V8OA 5I4IA 1GAXA 1ODSA 1FZTA 2C2KA 1LPOA 2QMEA 2R3SA 2G9ZA 3ABRB 3CUEF 2V8BA 4QYXA 2NVUA 4LCBA 1VRCA 1Z75A 4DMKA 5IFKA 2HT6A 3QIAA 1IK4A 1C3XA 1EP3B 3LBFA 2ZUWA 3TJMA 2LIPA 4RS3A 4DBLE 4ZKDA 2DWCA 1SVUA 2WJHA 1ZEMA 2I67A 3C3JA 5DF1A 3F67A 4DSZA 1P1RA 3SVLA 4RY9A 1HKHA 3BIJA 2QUZA 4LE1A 2D1FA 3JSAA 4M1ZA 1G3QA 5BYJA 4LRSB 3RQIA 1E20A 1ONNA 2MSKA 1KSJA 2ODEA 2PD3A 1GLGA 1SUFA 1B2RA 1MTZA 4UHFA 3N39C 4DMRA 9MHTA 1F9AA 1RHRA 2J41A 2HJRA 3SQNA 4RTQA 1V4NA 4HEJA 8ADHA 1KXJA 1NBIA 2ZDQA 1OFUA 3WLIA 1WSBA 2EGGA 3DMTC 4F3YA 4F4DA 1H5QA 1FMFA 2G40A 3RJMA 4KVGA 1T9DA 4TLBA 2O2DA 3FGNA 4LJSA 1A5BB 1X1CA 3LVBA 2BE9A 3AW9A 2GPWA 4KUGA 3PQEA 4LSZA 1NJGA 3U4HA 1IUNA 3OP1A 1SGWA 3HDTA 3CZMA 5AHOA 4DREA 1RRCA 5KB3A 3B5IA 1YA8A 1GSIA 3G0GA 2VHXA 3CQ9A 1DIBA 1G18A 1AXGA 3V34A 2MINB 1TVCA 5FBWB 2R8XA 1Q74A 2LP4Y 4KRGA 1O96B 5FL3A 3H84A 5AIAA 3ESCA 4KGDA 2ST1A 3RFXA 2JLQA 4XIGS 4D82A 3ITKA 4EUSA 1GKKA 4H1TA 1GR1A 4YJGB 2E4UA 5EY5B 2D0DA 1CPYA 3IHKA 4WL0A 1ZN7A 3EZFA 4B84A 3IDSA 2HPVA 5ALGA 2EDCA 1N2HA 1MABA 3AFMA 2FEMA 2PO5A 4FD2A 3LWZA 1M1NA 2H07A 3JPWA 3L77A 4B2LA 1WJGA 3QU7A 1GCIA 3NHAA 4BMXA 5C1OA 4Y30A 4DV7B 2EKQA 5CM9C 4EZBA 2ZITA 3ER6A 1OXKB 1XEXA 5BP7A 1M54A 4CLEA 4QXPA 4EH1A 3EPRA 3G9ZA 5BWOA 3RBZA 2O8CB 1ZJ4A 1YRQA 2V3WA 4CF4A 4DDHA 1OIXA 2ZRDA 4IXMA 3AEZA 3DH0A 3WZMA 1NKTA 1D03A 3FG9A 1N2CB 5IKPA 4GQBA 4U9HS 3OVMA 2C9CA 1A9PA 2AW5A 1OI7A 1N57A 1HYQA 2H2DA 3DVSX 4PCAA 1VOTA 1N2IA 3FRHA 2HQ1A 4X5OA 3W5BA 1AKVA 1QZTA 1UM9A 4OUKX 4E51A 3JWGA 3BILA 3ROXA 1I7SB 1MO4A 4OBXA 2A9RA 4MW7A 2WYUA 4FOLA 2BFNA 1P6UA 5AW0A 1U5BB 1GA1A 3LGSA 3TSAA 3DOUA 3D2CA 4HNQA 3OZGA 1YZNA 2JAOA 4LQ4A 3QY0A 4J16A 4AKIA 4EPTA 3PFKA 1JDBB 1YJAA 1KEWA 5L3QA 3R5XA 3ZY3A 1QCZA 1FYFA 2R6GA 2H51A 2GBLA 3RK0A 1CNEA 3UJHA 4OV6B 4QDKA 3K73O 3FUWA 5T3UA 2LW7A 3UPDA 3QPWA 4QD3A 4RWZA 3PBKA 4XSGA 2R6JA 3Q2KA 3DF9A 5EEGA 2C2HA 1VYHA 3RLFA 3QSYA 1R37A 5JC1A 1IC6A 5CFQA 1P9WA 4P92A 5C31A 1V9LA 1GTRA 1SJ9A 3P97A 5AW5A 5HF5A 3QVWA 1SOWA 1O8BA 2PCJA 2VI5A 3AKEA 4M0DA 5DYIA 4GWKA 4A8JC 4AG5A 1IJKA 4N8SA 4DR3B 1WTCA 1N34B 2QKYA 2HSWA 2X6TA 3FOZA 1HE5A 4GOKA 4MDHA 4Z49A 1Y1TA 1G7TA 4XCVA 2CCJA 3A70A 3WYNA 2P75A 4YV0A 3GNTA 2VHZA 3FLBA 4D4IA 5LP6F 4FYIA 5AJUA 3ABQB 3I4FA 2YW9A 3H9QA 1CERA 1FP6A 2FJPA 2REQB 3A7DA 1GV0A 2A67A 2P2DA 2V45A 3LRPA 2JRLA 1K8QA 4Q9JA 4DANA 2P9GA 4FNOA 5FPSA 4KBYA 2X15A 1X8JA 2G9UA 4NCJA 3KE8A 3RC3A 1ZOIA 2WUWE 1H1TA 3OQJA 1JPJA 4DIFA 4FZ3A 5ICGA 3VYVA 4I4IA 4J0CA 4JBIA 2EX4A 4LZNA 1P4RA 2P9FA 3C5VA 4IDGA 4GXTA 4O25A 5EJ2A 5ELLA 1EESA 1MA0A 3RWOA 2IP4A 3WYCA 4EJ2A 1ZJYA 4LC9A 1Z5OA 2NO1A 1NM5C 4FX2A 4IG9A 3B5JA 2O7QA 5C7YA 1I51A 2P4EA 2Q5LA 3UANA 1IIRA 2BJWA 1JWBB 1IPEA 4MPPA 1RBYA 3DKKA 3AJEA 1W2WB 3D8HA 4C4SA 3G9TA 3A8TA 1IU9A 2P79A 2A4MA 1VA4A 1AQUA 1GUBA 4KGXA 4PTYA 4DR4B 4WLVA 8MHTA 1JLRA 1D09A 2LGJA 2LWIA 2RAVA 3EHDA 4ER7A 5KNDH 5AT1A 3PJRA 4HLCA 3HO1A 4AI6A 2GM9A 5CX1B 1ESCA 1QR2A 1WNFA 5CIQA 4I50B 1GGKA 4HRYA 4N6OA 4P3OA 4YMHA 3OP4A 1GIAA 1SXHA 5DMXA 3UT0A 4I2NA 5IVKA 2C3MA 1N2CA 2D2VA 2XYRA 4HYYA 1FQOA 2Z2JA 5A5VA 1XUOA 4ZGWA 1J0CA 1IZ9A 4P2BA 5K8CA 2F9LA 4K0KB 4F84A 3OQ1A 3IAFA 4UTZA 3AILA 4MZXA 3V8BA 4CMEA 3N05A 5LYJB 4P34A 2R8RA 4K3UA 3FDXA 4RNDB 4RETA 4WA7A 1AKQA 1Y82A 1FRNA 3PYLA 4YB8A 4ZYXA 5BSGA 4CKWA 3V80A 3GBVA 5KSPA 1SVWA 4YRLA 3UV3A 4FNMA 4DB2A 4Q9DA 2PR2A 4YJ3A 2VYNA 4BRSA 1NMZA 1ZH6A 1Z39A 4DCPA 4LF5B 4NHEA 4RY0A 2WUEA 2Y0PA 1MB9A 3PC8A 1Y6QA 3RREA 4GKKB 1OGIA 3P71T 4R41A 4TTAA 2VHUA 4O4LF 1R8YA 2CUZA 2A9FA 1X7XA 3VBEA 4OJTA 4YAKA 1EFDN 3ETJA 1M2VA 3CR7A 1ZK2A 3OPYI 4IVPA 4WBSA 1IY1A 1MNAA 3DM5A 1HE8B 1L5ZA 4TN1A 4MWEA 2WSSD 1P2TA 1CB7A 1MAWA 3W2HA 5IWAB 1R1DA 3ACCA 3GL9A 3KZVA 5SYMA 3SHOA 2QTGA 1HZZA 4B46A 5HZGA 1YS2X 4RELA 3REQA 4W5QA 2GTPA 1T5SA 2P5SA 3WK9A 1K4YA 1FLNA 4A3SA 4IQ4A 1M3SA 1MZVA 1QYCA 3FMGA 3EGEA 1TZMA 4K88A 4B7AA 3T7DA 1C0PA 4RF5A 3S7TA 3EG5A 2FPPA 3T15A 4BMVA 1LI7A 4UEKA 3RI3A 3AR5A 2PU5A 1JNXX 1XDGA 1I01A 4N0PA 4DUZB 2X0EA 1W7AA 4URWR 3GT7A 3PGA1 1SEPA 3N8DA 2X0JA 2XKBA 4MP8A 1JE0A 4ZAWA 1T36A 4JXKA 3ESDA 1MB0A 5CFRA 3RF6A 2BH2A 4LE2A 5BV1A 5B36A 4P3XA 1GO2A 3KV3O 3Q9UA 3UH1A 1ULHA 3VKHA 2N3ZA 4XASA 5J40A 1R5BA 2Q5JA 2VEDA 5C46F 2PQ6A 3VOBA 1U1DA 1BJKA 3QE2A 3GT3A 1LPMA 1RBZA 1W9HA 5LXTA 2Q2VA 1WB6A 5K05A 2C2GA 1BRMA 3Q7SA 3H0EA 5LDGA 5BN3A 5IYZB 1CF4A 1EJ0A 1N78A 3RYIB 5DBOA 5B12A 5ESWA 1HX7A 2JHAA 3GJ5A 4RVOA 2QGZA 4II3A 1IN4A 1UBLS 1W8DA 2V4MA 2YJNA 2ZULA 1I1HA 4ARZB 1KP9A 1UMBB 4BFVA 3GWGA 3LC1O 1KQFA 3MS4A 4HNUA 2O8BA 4L74A 4KIGA 2D4AA 2AFHB 3J7AC 4QVGA 4QJIA 3R5JA 2BZ1A 1G4AE 2EERA 2ZJ7A 3X3HA 2JZOA 5EGNA 1BX1A 4X8HA 1ODTC 1XNQB 2ATIA 1KDOA 1KRWA 5JS1A 5E8RA 3AP2A 3GJTA 2ON6A 2WYVA 2IEBA 5K0JA 3QKTA 1RFGE 2GEBA 4AO6A 5IN4A 2RI0A 2HA6A 4MRNA 2DFDA 3ESBA 4ND7A 4MKIA 2B7CA 5DT9A 1B73A 4G5HA 4F72A 2L18A 4L3WA 2BEVA 1JHUA 1RVDA 1V6CA 3D3NA 2X76A 1HE2A 1G17A 1T3LA 2DHQA 2ZIFA 9LDTA 1OW3B 1MV8A 5C7OO 3PQ6A 5IDWA 1H0RA 5JLJA 3IAEA 4FEYA 1LQUA 1F9EA 2WK1A 3H6KA 2ODAA 1C4XA 3TZEA 4JZYA 3OZAA 3I8OA 3W3AD 1YQWA 4TXHA 2HXGA 4BYGA 1E6CA 1CJMA 2FRDC 4FS3A 5ALEA 1URPA 2HL6A 4GKAA 4JBNA 1ZD8A 3VVLA 4E4RA 1QO0D 2XE4A 1J1UA 3OD5A 1E7WA 3G23A 2H8GA 4PSVA 1C0EA 3SJZA 3L4KA 4OLAA 3HSYA 2P69A 1WXIA 1F5NA 1ZSYA 1SCIA 3BAFA 3FYDA 4BE4A 4C0QC 1YU6A 3M6VA 3BE5A 1KFBB 1ULUA 3QPBA 4JJKA 2O57A 4DLAA 3HCEA 3CF6R 3MG9A 3T61A 5JSZB 4FQ8A 4YXFA 1AF7A 5LYJA 4PV7A 1Q7TA 2HLNA 2Q3DA 2QIOA 1JGTA 4HFJA 4QOIA 4WY5A 2C42A 1QV6A 4FT2A 4NJEA 4NPCA 5K7SA 1II0A 2ZSUA 3QXJA 4HEHA 2NO5A 1Z33A 1LLQA 1U94A 4R2HA 4D4KA 2H0QA 2Z8YA 1TMYA 5IVHA 4IEEA 1BD3A 1VSVA 1E9DA 1N8NA 4NMHA 4IIGA 3CUUA 2QU8A 1M72A 1E5LA 1QC5A 1Y4ZA 2VCYA 1W52X 4M88A 2PUJA 1W44A 4G65A 3SBOA 2XADA 3GZNA 3HN6A 3PQ5A 3SK0A 4G1MB 4OGKA 1TZCA 5CA0F 4QSMA 1U8YA 3EH2A 1JQDA 2BAGA 3TJRA 1UPAA 3HCNA 5TJHA 4ITVA 3CKLA 2MR6A 1QHEA 2IX9A 3WWZA 5EUMA 1KJNA 1OBHA 1A9XA 4KQFA 2OWEA 1MO6A 4FHGA 3PHLA 3TR6A 3WRWA 1O6CA 2BI8A 3KYJB 4S3MA 5FT9A 2FUG6 2QQ0A 4HEA6 4L6IA 2DZDA 4LY0A 2H5LA 1ZM7A 3E4DA 2ZWPA 4CDNA 4ZVMA 4GEKA 1N77A 4O2BA 1QMGA 3F6BX 3RHZA 4D80A 1DJNA 3LX5A 1N2BA 3PGMA 4TV8B 2WHYA 4KV9A 4KPUB 1CCWA 4PNZA 2XWQA 1WDKA 3S81A 2Q6IA 4R1MA 4WQMA 2P6PA 1YBHA 2PZLA 4FDUA 3L92A 4D9CA 3IVCA 3TIXB 3HKEA 3SIXA 1BU8A 3WYEA 2YL2A 2DUUA 1GRVA 2FPWA 4TLDA 1QK3A 1SQ6A 3LUJA 4FGJA 1KKUA 2REOA 4N5IX 4KOEC 1CUYA 1VXRA 5G3YA 3FRJA 2O2EA 4F1WA 2NTNA 4KRXA 2WUDA 1XVTA 3ZBQA 4ETIA 3VTAA 1ZBDA 5IWCA 1EUZA 1GZ4A 3AGPA 4IBOA 4JLDA 1P2BA 2D1RA 4P22A 2ZU0C 3ORSA 2O50A 4MO9A 2HIHA 3VU0A 2NQTA 4MLCA 4UFNA 4AZWA 5BQ3A 4GUDA 2YVLA 3PA8A 1JN0A 4PZAA 4FINA 2OZPA 4G5OA 3EXG2 4WZBB 3HFGA 3LCJA 5THKA 2IHYA 2PGNA 1USUA 3K35A 4HRVA 4ZGGA 1CR6A 1T6YA 3PXXA 1PJBA 4LJ5A 1M8PA 3R3ZA 3MLAA 4D8UA 1XZJA 4RH1A 2YV3A 1RR6A 2XRYA 3LECA 4HADA 2H1RA 3HN2A 3V8VA 1QG6A 1XI2A 4LOKA 1NHWA 1W76A 4I66A 2G9RA