1NJZA

Cytosine-thymine mismatch at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njzA01
5EOZA 4XQ8A 2ZJAA 3OJSA 1V9PA 3G6YA 2OYQA 4R65A 4CJEA 2PFPA 2DFFA 2G8FA 3KLIA 3KLGA 4QW9A 1D5AA 4J9PA 4F4ZA 4BE2A 4FLXA 2JZBA 2BCRA 5HLFA 5F9NA 5J0XA 4J2BA 4RQ7A 4J9NA 4EEYA 3RB3A 3WNFA 4E1MA 4EBEA 4HVJA 4RQ4A 3I0SA 7ICEA 4IQTA 3BQ0A 1XSLA 1IKWA 1XO1A 2J6SA 2HNZA 2X6SA 5K14A 3SI6A 4O9MA 4W5NA 1QSYA 3H4DA 4MFAA 3UXOA 4J9LA 4R64A 4CESA 3TAMA 4MQ3A 2KN7A 3VQ8A 1S6PA 1X9WA 4C8LA 2J6TA 1RT2A 3C1ZA 5J2IA 2X78A 4CJUA 1ZQUA 1MU2A 1ZQIA 2DFLA 1W0HA 2W42A 4KHUA 2BHNA 4QZGA 3LK9A 2VA8A 1UA1A 3DRPA 3OYNA 1ZQRA 4RQ5A 3LP3A 4OPKA 4LY7A 1RT3A 4YMOA 4FK0A 3AVIA 2BGGA 3D0PA 2PXIA 4YR3A 3RH5A 4DL4A 3DOLA 4LH4A 9ICSA 4C8MA 4KHWA 4DQQA 2Y1JA 4QWEA 2FPLA 2OZMA 3NF8A 4IRKA 1UOCA 2G8IA 3RH6A 5DLGA 3UQ0A 1U9LA 4I29A 4KLIA 4DSEA 2KTQA 4DL7A 1KVAA 5KG7A 2VG5A 3LWLA 7ICOA 1MC8A 3GILA 4O55A 3ZT2A 1BCOA 3O3HA 5C5JA 2FMQA 1EP4A 2XHBA 3RRGA 1SKRA 4JWNA 2PI4A 4OKJA 2D0CA 3RMCA 1ZETA 1LAWA 3AVLA 8ICRA 1G15A 5DBCA 4AHUA 1BPXA 1QTMA 3AVJA 1FK9A 3EYZA 2GWSA 4E89A 3JSMA 4M42A 2IDOA 1RBTA 4O5EA 3O3FA 3H40A 4QZBA 4KLHA 3C6UA 4GVMA 1C1AA 1ZQWA 4HUFA 4XRHA 3Q8QB 1JMSA 4W5OA 4B9SA 1C7YA 4OVLA 4BGDA 1Z25A 3G10A 2E6MA 1XU4A 4FJXA 4I2QA 8ICAA 3V6HA 4CGIA 5JS1A 5J29A 4CJ3A 4LZDA 4NCAA 2Y1IA 2P5OA 4E1NA 4TSXA 1Z3EB 1EXNA 3EPIA 4RNMA 1WNSA 1NKCA 8ICXA 4DTRA 2XCAA 8ICKA 3UPQA 3SJJA 2R8IA 3OSPA 2IOCA 4YFUA 4Y1CA 3RJFA 1ZQMA 3KLHA 4M3RA 4I2FA 3ZDEA 1ZQGA 1YT3A 3AVFA 2DFHA 1HYZA 4YVZA 3UXNA 4BWMA 4NM1A 2AJQA 1ZBHA 4RQ8A 3KKRA 9ICMA 4RT2A 1VSFA 3IRXA 3OYDA 4CEFA 4DL3A 1J9AA 5KFGA 9ICIA 1WCNA 3MEGA 3M8QA 4JS5A 1SKSA 3ZT1A 2PI5A 1QQCA 2XY7A 3I8DA 4EZ9A 4F50A 3ZSYA 7ICQA 4PHPA 3O4NA 1SKWA 4ECTA 1N6QA 4M3YA 3K57A 2R8JA 2FBTA 5CR0A 1UWBA 4CERA 4HCCA 3KHLA 2OZSA 5F9LA 4DS4A 1ZQSA 1HYVA 5KI6A 2JEJA 3SUQA 1FKOA 4M9JA 1AROP 4O3QA 1BIUA 1IXRA 4GXIA 2O4GA 3P5JA 4M9HA 5EWGA 4CJTA 4FZXC 3SPZA 4PGQA 4LH5A 4EYIB 1XSPA 4F4WA 4I9LA 4CEQA 4CK2A 1HQEA 1Z26A 3AA2A 2ZUBA 3AU6A 2ZE2A 3ZSVA 1Q9YA 8ICMA 4DSIA 5DK5A 9ICEA 1IKVA 5IIJA 2F1IA 1CZBA 9ICOA 4Z4CA 2Z1JA 1S1VA 4TURA 4EYHB 4O3NA 3V7KA 2HHWA 3MEDA 3AVGA 1K6YA 3S3MA 5KFRA 5IILA 2MUTA 3MECA 1U04A 1WLJA 4Q5VA 3C2MA 1L3SA 9ICKA 4Q8FA 4IQVA 1WAFA 3V7JA 2NRWA 1WN7A 4AHVA 2YHAA 3ASMA 4O5CA 1J5OA 4KFBA 3M9MB 4AHRA 1RBRA 2ZD1A 2I9GA 1RT4A 4FK4A 3VQAA 3K5LA 5E41A 2E4LA 3F9KA 2IHMA 1QSSA 3AU2A 4I2HA 5JS2A 1S0MA 3AVKA 3LPTA 3S3OA 1D8YA 4NLNA 1TL1A 1EKEA 3NF7A 4HHTA 4GC6A 3T5HA 3RR8A 4UQGA 1HNIA 4CEAA 5TZVA 3B6OA 2R8GA 7ICMA 3VQQA 1DTQA 5KFKA 4N56A 1Q9XA 3Q8MA 9ICUA 3T19A 4YD2A 5J0PA 2NUBA 5C24A 3V7LA 1LW2A 4RW8A 1BVSA 3MDCA 8ICBA 2A1RA 4XA5A 3PUFA 4OKEA 1VSMA 4YD1A 3E01A 2YKNA 3RMAA 4QZEA 3C6TA 2KZZA 2PY5A 4PGXA 4FM1A 4DFPA 5DB8A 4DTMA 3QETA 4QWDA 3SUNA 3OYFA 2EX3A 1IG9A 2O4IA 2OPQA 3DLGA 4CJQA 4Q0BA 5KFLA 4YP3A 4FJ7A 2LYHA 2DFEA 1ZQTA 8ICHA 1ZQZA 3KK1A 3EW9A 4RUAA 1LB2B 2D0AA 3D45A 4R8UA 1L5UA 2W9AA 1RNHA 3BJYA 4O0JA 3UXPA 3LANA 4FM0A 3SQ2A 5DBBA 1Z00A 4GLXA 2F1JA 4FS1A 1HUOA 3B6PA 5IIMA 4NYNA 3IS9A 5T7BA 4M6WA 1S0VA 1ZBLA 4KREA 2KFNA 2HW3A 1H38A 3DYAA 4KITB 3GFKB 3QLHA 4FK2A 5HNKA 4M0AA 4O0IA 1TAQA 4W5QA 4CF0A 4ED3A 4DL5A 3CYMA 9ICRA 3ZSXA 4KKOA 4Z6DA 4LSNA 4B9MA 2ETJA 3B0YA 4BE0A 4YCXA 4TQSA 4B9TA 2IC3A 5EU7A 3RMDA 3OS1A 5KFYA 4N76A 3PW2A 5KT4A 4FYDA 4OPJA 3PX0A 2XY8A 3HP9A 2BANA 3TANA 1MQ3A 5J2CA 4DL6A 4I2GA 1HUZA 3V81A 3K75D 5DQGA 1NK4A 3VN5A 4FM2A 4UAYA 1QE1A 5IIIA 2GUIA 3EWAA 2XC9A 4I2CA 4C8OA 8ICWA 1LAVA 1ZQXA 2DPJA 5HHIA 4DLGA 4YXJA 1RTIA 4CECA 3NTUA 3V1OA 8ICPA 4G1QA 5KG3A 3A2FA 5L9XA 4N41A 4KRFA 1BPEA 3L3VA 4UAZA 5KG4A 5FRNA 3TWHA 4FXDA 1CLQA 3RJHA 4TUPA 5KFZA 9ICCA 4RW9A 3K5MA 1RYSA 2P1JA 7ICVA 4UB2A 1A76A 3V9XA 4FLVA 4N47A 3PW7A 5CZ2A 4CFCA 5C42A 3RR7A 1RPLA 2JEFA 2NRXA 3MXIA 1LWCA 4CHZA 3C23A 2ASJA 4IQUA 5KG6A 3DLKA 2ATLA 1XC9A 3AVCA 4M04A 2PFQA 3ZSRA 3RB4A 3RJKA 3HVTA 3NGYA 5HROA 3TAQA 3OYGA 1B9DA 5CJ7A 2GV9A 5CYQA 3ETLA 5FRMA 4RQ1A 3AA5X 4C8KA 3PR4A 4RW4A 8ICUA 3Q8RB 3MBYA 4O3SA 1TK5A 3H08A 4PWDA 3TAFA 3GV7B 4ELVA 5I3UA 3AVMA 1X9SA 4M41A 4DSJA 2HNDA 4CGHA 3AO3A 4F3TA 5KFQA 1QHTA 1I3AA 4G3IA 5HMLA 3B0XA 3AV9A 5DB7A 1D9DA 3PW4A 1ZQQA 4YN4A 5KFTA 2C22A 1C0UA 4FJ9A 2YNGA 4FW1A 4DFJA 4ED8A 5KTQA 4KLTA 1F21A 4OLAA 4ECSA 1A5WA 3LALA 4PHEA 5J0WA 3GIKA 2UVVA 3NF9A 3MGIA 4CJWA 4DO9A 3LP1A 3OGUA 2FPKA 5SZTA 1ZQJA 2VA2A 2JZBB 3QZ8A 2HMIA 2J6UA 5CZ1A 1QS4A 4RQ0A 3KD1E 4QZ9A 2W9BA 4AILC 3RJIA 4KB0A 5CY4A 5KT3A 2IAJA 4CF2A 3T3FA 2D5RA 4N5SA 2P5GA 4GXJA 1RYRA 4O5KA 4ECZA 2VG7A 4RPYA 5KFJA 5DG8A 4QZCA 1S1WA 4YQWA 7ICGA 3RBDA 4CCHA 3EPGA 4IKFA 3AVBA 3HPHA 4CEOA 4DSLA 4KHQA 3L2UA 2V4QA 4BXOB 3P83D 2FC0A 5L1KA 1X2IA 2F1HA 1JLGA 4CEDA 2F8SA 2JGUA 1D9FA 3H8WA 4YG2A 4QZIA 3ZSWA 2AU0A 2V4RA 1TL3A 4RU9A 4CK3A 3VQEA 5BOMA 4B9UA 3QEAZ 1S76D 2AGOA 4PPXA 3LP0A 4BACA 5KFNA 3VQPA 3Q8PB 4I28A 4M47A 4ID1A 4I9QA 4DF8A 3KIOA 3NH0A 2A1JA 4GC7A 3AVAA 4K4GA 1TKXA 1GOBA 1KLMA 4O3RA 4QZFA 1ZQKA 2XY6A 3LDSA 1NOMA 5KG2A 8ICZA 4FJJA 2WONA 4DQSA 4TUQA 4R63A 1D8LA 2IGIA 4Z6FA 1NJYA 3U6FA 4XUSA 3LAMA 3PX4A 3NF6A 4QWAA 2KQ2A 5J2KA 3OYHA 5J2NA 2G8KA 5HMMA 1U48A 5KGXA 3NGDA 2PYLA 4KO0A 4JS4A 3MFHA 3BDPA 4J9SA 5J0YA 5KFCA 4ZTFA 3Q8KA 1J54A 3NH1A 4OJRA 3VQ7A 5DQHA 3T5KA 9ICBA 1TAUA 4C8NA 3HM9A 1T4GA 5HP4A 2KZ3A 4CJ4A 9ICGA 2YHBA 2XY5A 4RQ2A 4E19A 2PZSA 1BCMA 3QIOA 4M3UA 4DTNA 2BCVA 3VA3A 2OA8A 2HHQA 4DQRA 3PR5B 3M8SA 4F91B 4FS2A 4CJSA 1BI4A 2RKIA 1FXXA 1ZQVA 1C1CA 1RBSA 3HP6A 2QXFA 2C28A 5L1IA 3Q8LA 4KLLA 8ICYA 4FJNA 4JV0A 3RRHA 3O4QA 3TR8A 3AVHA 3HXMA 5KFDA 9ICWA 1S5JA 4J2EA 8ICVA 4NM2A 5CYMA 3IG1A 3JPTA 1DTTA 4PGYA 2XGQA 3VQ4A 2WOMA 5J1EA 3OYEA 4F4YA 3HSTB 4QAGA 3DRSA 2QK9A 2AQ4A 2OPPA 9ICQA 4E7HA 4JUZA 4HUGA 4KLEA 5BOLA 3UQ2A 3AO4A 3GIMA 4B3OA 1MQ2A 4F5NA 1L3VA 1JX4A 2BDPA 3MR5A 3MXMA 2XCPA 4Z4IA 5D3GA 4P4PA 3ZT0A 1LW0A 4YR0A 3V4IA 3OS0A 4IFYA 1IH7A 2AGPA 4F93B 3BQ1A 1RDCA 5KRSA 3SV4A 4IG0A 5L1LA 4O3OA 2RN2A 3DLHA 3OYMA 3ZDCA 3T5JA 4RT3A 5SWMA 3KK2A 3QEXA 4FZYA 3JPNA 3AO1A 4F4KA 2FPMA 4KLDA 3HW8A 1RTHA 3H7IA 2C2RA 3THVA 1XHXA 5DG7A 3G6XA 4E7KA 1IKYA 4CIEA 4M45A 1T05A 3V1QA 1C0TA 3LP2A 4H4MA 4DSFA 3HK2A 3L3UA 3MXJA 3KHRA 3KLFA 3K5NA 7ICJA 4FCYA 3PMLA 3M9OB 1C6VA 3HL8A 2R8KA 1IM4A 3ISBA 4IRDA 4AHSA 4ECXA 8ICOA 5HHHA 3CFPA 4ECWA 9ICTA 1ZQBA 1JLAA 4ELUA 4DTPA 3MABA 3C95A 3KD5E 7ICUA 1XS9D 5D49A 4EP4A 5KFSA 5KT6A 3G6VA 1RT7A 8ICGA 4DMNA 3TARA 1N56A 4FW2A 4KHSA 4ED7A 8ICEA 4FLYA 4FJIA 4KLUA 1YVUA 2R7YA 1ZQYA 4Q45A 8ICTA 5D4BA 4CFBA 5KFVA 5IIOA 2FLPA 4LVSA 4MFCA 2HHVA 7ICKA 1ZQFA 5DMRA 2C2EA 2ZUCA 5L1JA 4AH9A 3KK3A 4FZZA 3V9UA 3AO2A 2W8KA 3LZIA 5KFBA 4KLGA 5IIKA 1RDBA 2XO7A 3DI6A 3N97B 2FBVA 5CA7A 1JLEA 2Z1HA 4BDZA 4M6WB 4IG3A 3NCIA 3QERA 9ICNA 1IO2A 3AA4A 4PH5A 3NE6A 4Z0UA 4OGEA 4CJVA 4FJ8A 1C1BA 3OHAA 4ED2A 5HRSA 3DLBA 3HX0A 4PHAA 1Q8IA 2ZUDA 4KLQA 3OYJA 5KG1A 1IKXA 3NFAA 3WNHA 4IRCA 1JLBA 4M3WA 5JUMA 3QESA 1RT6A 4K8ZA 3HT3A 2W9CB 4O4GA 2ZTCA 1TV6A 4RNOA 8ICFA 1WSJA 4DTJA 3LPUA 3SUOA 3VQ6A 2G8HA 1T03A 8ICCA 4MF8A 5J2PA 2QKBA 3VQCA 4BWJA 3OYIA 7ICNA 2VG6A 3JPRA 3TAPA 1T7PA 4B8AB 2FBXA 4KB1A 5HRPA 1VSEA 4RW7A 3Q8SB 4MEYA 5J2MA 4OLBA 4EP5A 3QEIA 3JPOA 3CFRA 2IHNA 1JIHA 3U3GA 3SUPA 3C1YA 1B22A 2UVUA 4DQIA 1NOZA 2D0BA 1N5YA 4RQ3A 2HHXA 3IHQB 5DBAA 3KHGA 3TFSA 4K8XA 3AA3A 4I2AA 3L2VA 5IINA 7ICPA 3NGIA 1U49A 3NGZA 1ASVA 2DTUA 2M9NA 5DDYA 5KFOA 4ZH4A 1FKPA 2PFNA 4RPZA 1UAXA 1MSWD 1HJRA 4I2PA 2ZTDA 1KSPA 3QE9Y 2ITGA 1RBUA 1W9HA 3ISCA 3LAKA 4EZ6A 4NLKA 3NH2A 3L8BA 4J9RA 3H8JA 1UT5A 4CGJA 3LDAA 4M3ZA 4CFAA 1SL2A 2A1SA 2Q0ZX 3OVNA 4P4OA 9ICPA 2ZQBA 4DL2A 1S0NA 5KFUA 2VA3A 4ECUA 4CF8A 4KHNA 9ICVA 4DTXA 2W9CA 1NJZA 7ICLA 3JPSA 1NJWA 2F8TA 1SUQA 4F2SA 2VWKA 4CHQA 4TUSA 4M9LA 4QOZB 2BPCA 3TABA 1JLCA 1Z00B 4Z6CA 3ZD9A 4EBCA 1JLQA 1VSHA 1RT5A 4B9LA 3PVXA 4MFBA 4KLSA 4QCLA 3KTQA 4FLWA 3QEWA 3MGHA 3FFIA 1L3TA 4M9NA 3V1RA 3WNEA 1SZPA 4P4MA 3S9HA 5EWEA 3QZ7A 3RJGA 4M3TA 1S6QA 4KAZA 4Z4HA 3K58A 2XGPA 1SL0A 4TQRA 1PZNA 3QNNA 4F3OA 4F5PA 4ECYA 7ICIA 4MEXA 3RAQA 2W9BB 1J53A 4PA1A 5KFFA 4CHYA 2MUTB 1KCFA 3U3YA 2P51A 3ISNC 4AHCA 4Q43A 3NBPA 4DU1A 4IBNA 3QO9A 1VSKA 1RILA 4Z6EA 4E7IA 1CZ9A 4KI6A 1T3NA 4CJRA 4BDPA 3L2QA 1HNVA 4F5OA 1EX4A 2HB5A 4AHTA 4CIFA 5KFAA 5KG5A 2IMWP 1KFTA 1BPYA 9ICJA 1DOQA 5D46A 4ECQA 3QEVA 5C25A 5J0SA 4FJGA 3GIIA 1TV9A 1NK8A 4DEZA 1JLFA 3DLEA 5J2GA 3K5OA 5J0UA 3OJUA 4ELTA 2BQUA 4IQWA 4CHOA 3M9NB 3AVNA 3RAXA 1UT8A 2B21A 3KHHA 2HHTA 2HVIA 5DG9A 3ZDBA 2F96A 3V6DA 2FLNA 3SCXA 5FROA 2IBKA 3DOKA 5J2BA 3EY1A 2G8WA 1XSNA 1ZQCA 3HO1A 3VQ5A 4QZAA 3PW0A 4J9KA 2P66A 1S77D 7ICSA 3V6JA 3VQBA 1S0OA 3WNGA 8ICNA 3OY9A 3ITHA 1COOA 3C21A 3PV8A 4UB1A 3C5GA 4E3SA 1TVRA 3C5FA 1BPZA 8ICLA 2MAXA 1JL1A 5KFPA 3RJEA 3PW5A 4DOAA 4P2HA 4GW6A 4LD0A 4RNNA 4FJLA 3AO5A 3CM5A 2JEIA 1LWFA 3SQ1A 3DMJA 1ZQLA 1RDAA 1BQMA 4XIUA 2PFOA 1C0MA 2YNHA 5J2HA 1S9GA 4DF4A 3IM1A 1BGXT 3ZDAA 1BISA 1REVA 1U47A 1WSFA 1KLNA 8ICQA 3CG7A 3SPYA 2RDJA 4KPYA 5HBMA 1Y97A 3RB6A 3ZT3A 4DFMA 1JXBA 3N4MB 1A77A 4Q44A 1YTAA 4OGCA 5FDLA 3C2LA 1XHZA 4I2JA 4JWMA 3HVRA 4DWIA 5DKWA 2X74A 5KFEA 2NRZA 3GV5B 4QWCA 3VQDA 4OKKA 4ED6A 3MEEA 5DQIA 1S1XA 3H4BA 4RUCA 1K1QA 1NK7A 4UBBA 1S9FA 1N48A 4CJLA 4IDKA 7ICFA 2ASDA 1HJPA 4H4OA 2IA6A 2RPIA 4ZHRA 3JPPA 3OYKA 2YNFA 1BPDA 4NCGA 3P1GA 1ZQEA 3HYFA 2BCUA 1HMVA 1HPZA 3V9SA 5KG0A 4RW6A 3MR6A 2W8LA 1VSLA 4B9NA 4B8CA 1RZTA 3SNNA 2V9WA 1BPBA 3ZT4A 2KW4A 2FBYA 1RXVA 1BI4B 1EETA 4FVMA 3IAYA 4DTOA 5CP2A 5KRTA 2PYJA 3KLEA 2BQRA 3TI0A 2AGQA 4O5BA 1TKDA 2AQ0A 4DS5A 3SQ4A 3SV3A 1TK8A 2HHUA 1UA0A 1CEZA 7ICRA 3M8PA 3CM6A 4DG1A 2HVHA 3ZSQA 4X5VA 4LSLA 3RWUA 1TKZA 3FDSA 4K4HA 4NY8A 1ZBFA 3LWMA 1S1TA 4IFVA 3V9WA 3HJFA 3VQ9A 2JEGA 3AUOA 1RTJA 5J2AA 1ZQDA 4E7JA 3FYHA 2NRVA 4KMUA 4LZGA 4Z4EA 3L2WA 3MDAA 2DY4A 4UAWA 1S10A 4IR9A 5J0OA 2ATQA 1XWLA 4CE9A 1ITGA 2BCQA 1VSJA 2H5XA 5KFHA 4FJHA 2X6NA 3RBEA 5KT7A 1KEJA 2A1JB 2BPGA 5HP1A 1TK0A 4CHNA 2FMSA 4WE1A 3OYLA 4CFDA 2WTFA 4BDYA 4KN4A 4B08A 5CB1A 4HUEA 5KFIA 4YMNA 1TGOA 2ALZA 3RMBA 4JV2A 4DQPA 2I1QA 4IR1A 9ICFA 3PO5A 2VANA 4F4XA 4CF9A 3K59A 3QNOA 1ZQHA 5HRNA 4NYFA 1A5VA 5KFXA 5J2EA 3MR3A 5J2JA 2BCSA 3SYZA 9ICLA 1LV5A 4YNQA 4FO6A 5J2FA 3HPOA 3PX6A 3GIJA 4KTZA 2P6RA 1ZBUA 1ZQNA 3KJVA 2YV0X 2ASLA 2FMPA 4J9MA 2B4JA 5DDMA 1ZQAA 4PUOA 4GMJB 4ICLA 3GQCA 4KLJA 1QSLA 1A5XA 3SI8A 5DLFA 5J2DA 4O3PA 4J9OA 1RXWA 2BR0A 1RBVA 4DOBA 4DFKA 3VA0A 5DB6A 8ICIA 3ZSZA 1KFSA 3DLRA 1RT1A 2KZMA 1GOCA 3OS2A 1BIZA 1WSEA 4CK1A 4KLMA 4JRPA 1JKHA 3TAGA 3ORYA 4ED0A 3PMNA 3ZDDA 3ULDA 4DU4A 4YR2A 4NXZA 2UVRA 4FJKA 3ZCMA 1TVAA 4PQUA 1KVBA 4I2DA 3CFOA 4KLOA 4JV1A 1VRTA 2OWOA 9ICHA 3LZJA 4ED1A 1U4BA 3QEBZ 1B43A 2KFZA 4UB4A 4F5RA 4HYKA 1X1PA 1KFDA 2BPFA 5CHGA 1R0AA 4RZRA 4Z4GA 1VSIA 3MAQA 4FLTA 4F5QA 3RJJA 4I27A 4CEZA 4RQ6A 9ICAA 3C2KA 4KI4A 2FLLA 2QKKA 4NLGA 1QLNA 1JL2A 3L2RA 2VWJA 3CQ8A 1HYSA 4Q8EA 4R5PA 5J2QA 1B92A 1NKEA 4CEBA 4KLFA 3O3GA 4JLHA 3NDKA 4NLZA 1ZYQA 1L3UA 4YFKA 2R8HA 3ISDA 2EHGA 4CEEA 5DGBA 1ZJMA 1NK5A 1BQNA 3BGRA 4ECVA 1O1WA 2LSNA 3RTVA 5J0QA 3SZ2A 3I0RA 3C94A 3M8RA 1NOYA 3V6KA 1RTDA 3SQ0A 1CUKA 2DPIA 3GV8B 3NAEA 5KFMA 5KFWA 5J0RA 2G8VA 1ZBIA 2ZJ5A 4I2EA 4Z4FA 4F2RA 3NHGA 2ZTEA 1S9EA 4CIGA 3ZD8A 1WSIA 3ZSOA 5DB9A 8ICSA 4M9GA 2ISPA 2Z1IA 4CF1A 5EWFA 1ASUA 4KV8A 1JXLA 1ZJNA 2IS3A 3TAEA 1NKBA 2RF2A 4YMMA 3RH4A 5KGWA 1CXUA 1DLOA 3ALYA 4CGGA 3JYTA 4ZTJA 1ZQPA 4E0DA 1JXEA 4W5TA 4NCBA 3OHBA 3TFRA 2BGWA 1LWEA 4W5RA 2JLEA 1TFRA 1WSGA 1WCLA 3OYBA 3PY8A 4KN7A 4QZ8A 2RDIA 3HWTA 4CGFA 3QINA 1KDHA 3MR2A 1B9FA 1BL3A 3PNCA 4DSKA 1SV5A 3OSNA 4O44A 3UIQA 4L8RB 4KHYA 3JPQA 2B6AA 3V9ZA 4F92B 3S3NA 5CWRA 4UB3A 4FBUA 4H8KA 1VRUA 1NK0A 5J0TA 2HNYA 4CJKA 4RG8A 5I42A 1YTUA 4JRQA 1NK6A 1DGSA 4CHPA 2P6UA 1VSDA 3E2EA 4J2DA 4FBTA 2I5JA 4EBDA 1WSHA 1NJXA 1ZQOA 1RDDA 4BE1A 4KTWA 3V72A 2NRTA 1K1SA 2GBZA 3RB0A 4HTUA 2XRIA 4DLEA 1S1UA 2W9MA 1VK0A 4UBCA 3T5LA 1EXQA 4CJ5A 3H8SA 4MFFA 1JN3A 2BKEA 4FLZA 4UB5A 2G8UA 4DOCA 1BHLA 5DGAA 1CXQA 4JK1A 4MF2A 4FLUA 4FJ5A 3F73A 4ECRA 4QW8A 7ICTA 3MFIA 1XI1A 4ID5A 1NK9A 3QEPA 3G0ZA 1I39A 2Z1GA 4I7FA 4Y1DA 1RCHA 5HRRA 2C2DA 4KTQA 2BQ3A 2UVWA 4I2IA 1HRHA 2OPSA 4QZDA 2Q3SA 3KKSA 3BQ2A 2ISOA 7ICHA 1KRPA 4I2BA 4F8RA 3DRRA 1WAJA 3DM2A 8ICJA 5KT2A 4CJPA 3OYAA 1U45A 4J9QA 3EZ5A 4CJFA 1GOAA 1X9MA 4HCBA 1Y88A 3BQTA 1KVCA 3HPGA 4K4IA 2YKMA 4RPXA 1S97A 1KTQA 4QWBA 4DU3A 4BXOA 4CGDA 2YNIA 2E6LA 4B9VA 1SL1A 5BPCA 4PY5A 2BE2A 4J2AA 4M2YA 2HHSA 1ASWA 3K4GA 1HQUA 5KT5A 4M3XA 3GDXA 2B5JA 3OYCA 4FJMA 4DTSA 2ZJ8A 4R8UB 4QZHA 4GXKA 3PO4A 4DTUA 3QIPA 4YXMA 3TQ1A 1TKTA 4PHDA 3T1AA 4R66A 1T8EA 9ICXA 3K2PA 4E7LA 2OPRA
chains in the Genus database with same CATH superfamily
3J80U 1VHXA 4XQ8A 5D8HB 4OHXA 3OJSA 3G6YA 4R65A 4U95A 2PFPA 4CJEA 2G8FA 3KLIA 2I7NA 2D41A 1D5AA 4J9PA 4HKQA 1PIEA 1FRKA 2KE7A 5HLFA 5F9NA 5J0XA 4TN2A 3M6ZA 2WC9A 4J9NA 4O23A 5DS7A 4EEYA 1U1LA 2UUAF 4EBEA 3D6FB 1KAXA 3I0SA 3B78A 3KDOA 4CYUA 3GFXA 2IVMA 2AWZA 1XO1A 1JLCB 4WQ4C 1C0UB 2VJ4A 4CRXA 4USAA 1YZ6A 1QSYA 3TZZA 3UXOA 4R64A 3CC7N 3EWGA 2MB0B 3NMUA 3AOBA 1JCEA 4EWTA 2IOFA 1X9WA 3KJFB 2J6TA 3QUQA 2V2KA 1GQEA 4FF4A 4ZLLA 2KIWA 3R5BA 4QYZJ 2P9CA 2KT3A 5H9FK 2C42A 1NGEA 1W0HA 3S41A 1Y64A 4BR0A 2KD1A 4NLYA 1ZD3A 2QSFA 1RT3A 4H0VB 3LVVA 3NL0A 3AVIA 2FTRA 3LDPA 2PXIA 3C16B 3A5OC 3TJAA 3SQIA 1ACMB 2CWKA 3DOLA 2IJFA 4XH1A 3TTFA 2R7RA 1ZA2B 4EAHD 4M63C 3PKMA 2Q31A 1UOCA 3B4DA 3NBPB 3K5PA 3RH6A 3CJKB 1GXUA 2G2ZA 3FMWA 2KTQA 4DL7A 3U27A 3DDKA 1WC4A 3ILLA 4HT5A 2HHHK 3LWLA 7ICOA 3Q2TC 5ALLA 7AT1B 3O9QA 1HNXK 4M95A 4CBUA 1FW6A 2FMQA 1RU2A 1CJUA 2RLTA 1UJ6A 5K9FA 2F8KA 3CCVS 4H5RA 4L75A 1ZETA 3U4LA 2PSZA 3AVLA 4ZPCA 4M42A 4C8YA 2IDOA 2PMWA 4LBHA 4O5EA 2RHQB 1K9MT 3SJHA 2ZH9A 1XERA 4L73A 3H7HB 4KLHA 2H3GX 3MOZA 1ZQWA 3GP9A 1RLDA 5LMUF 2CADA 4W5OA 2P9GA 5BR9A 4LVNP 3NASA 2NPFA 3PDNA 4F02A 1Z25A 3KD3A 3HVTB 4EK2A 4LFAK 4CJ7A 2WVBA 3L4BC 3CJ9A 2OEHA 4PL1A 2XEXA 3D4JA 2Y1IA 2EKYA 1ICEB 2E2OA 1Z3EB 4WF9Q 4RNMA 1IR2A 1NKCA 4DXLA 5ALZA 4DTRA 2IHR1 2G1HA 2AXTU 4F36A 2G2YA 2WFAA 2IOCA 3N4QA 2CQHA 3LPEA 3KLEB 4Y1CA 5AQMA 2DGQA 3K17A 3BF1A 1I1GA 2KN4A 2VC0A 1ZQGA 1YT3A 4IDKB 4DV3K 1L8OA 2QMXA 4M5IA 4YVZA 3UXNA 4NM1A 1ZBHA 4JAXA 1VSFA 1N5QA 4CEFA 4ZVSB 1MWQA 3VETA 1UVLA 4ZVRB 4TYBA 1BA1A 4JS5A 3E3XA 1M90T 3ZT1A 3VVTA 2JFKA 1VK8A 2BKNA 2Z2MA 4AD6A 3ZSYA 2CH5A 1F0MA 2KVCA 5BR8F 4ECTA 3CD5A 3K57A 2R8JA 5IOLA 4MLHA 4KHPF 1NGHA 2DRBA 4CERA 3MMAA 3I87A 1HQ2A 3KHLA 3Q89A 1NM1A 4Y2UA 4JB8B 1DY3A 2P9KB 4RU2A 1ZQSA 2G07A 1HYVA 5KI6A 4GKJJ 5F8GA 2AYMA 1FKOA 3NWRA 1JCFA 4M9JA 1WF1A 4O3QA 1BIUA 2V34A 1IXRA 4F0HA 4I0WA 2GVDB 2OFHX 2BUPA 1JALA 1YJTA 1RXOB 3ICXA 1W2IA 1OPZA 3TUJC 1FO4A 1Q3UA 4A2AA 1Z26A 2RS8A 3CPWM 2YTCA 1Q9YA 2KVIA 3WU2U 5F3XB 1OH5A 4B3SF 1IKVA 2M4MA 1UW9A 4IG0B 4JI4F 3W2VA 1AW0A 1U2CA 2F1IA 4Z4CA 1WKKA 4EYHB 4JKAA 4P0QA 3V7KA 3NVYA 4K4TA 2YNIB 2DNYA 2BJ8A 2YX7A 2V8PA 3AVGA 5KFRA 3MECA 4NRUA 2V6AA 3DNCA 1L3SA 2JZ5A 1N33K 1RE1B 2CFXA 1N33F 2VUGA 2ZUGA 1Y5NB 1IBLF 1WAFA 3V7JA 2NRWA 2JR5A 2FQQB 1WN7A 1KQSR 2YHAA 3ASMA 4JKEA 1T03B 1YTYA 4HACB 1M5OC 4NXMF 2HSEB 1APSA 2LECA 4DI6A 2RILA 1NG9A 2Q0RA 1IJFB 2ZBIA 3OUYA 4AHRA 4NWBA 2I9GA 1RT4A 4LF7F 2C2MB 3K5LA 3W66A 4FL9A 2ZM6K 2HAIA 4GVBA 1SZHA 3ZTSA 4ZVQB 3JS6A 3AVKA 3LPTA 3S3OA 4NLNA 2Y3YA 4DHYA 1EKEA 2AJ2A 4UARA 2WVEA 3QU5A 3DLJA 4CZIA 3TJ8A 2IOFK 3EGZA 4K50A 2CQDA 4DV6J 3B6OA 2VFRA 2CZ9A 3VQQA 1PK1A 1VI7A 3UD3P 3Q8MA 3OW2R 1RU1A 1FKPB 1VDHA 4X64J 1IG6A 2CPIA 1TYQA 4BQZA 1D09B 1S49A 1YJ9N 2RS2A 2E5SA 2GFFA 4B3RK 3DHXA 4U8VA 5ADZA 2HZAA 4DR2F 4PGXA 2VG6B 2JH7A 2QT7A 3ISZA 2K4IA 3H8MA 5LJVA 1KS2A 2HQDA 2UXDK 3CIPA 1VRTB 5KFLA 2UXDF 2EG1A 3LW5C 2LYHA 1IWGA 1XBWA 2UXBK 1ZQTA 3OPKA 3IG1B 1ZQZA 2LI6A 1PYTA 3KK1A 3L9ZA 2FJXA 2D0AA 3KKAA 3ENBA 2GQ2A 5KPZA 1EZZB 1GLCG 2KRBA 3I8BA 5AZJB 1JJ2R 5C2CA 3OT9A 2ASPA 3FR0A 2HCFA 4H0XB 1FWLA 3ZZ0A 3MN5A 4TU7A 5AICA 4H5WA 1Z00A 2CJQA 5LT5A 1VYAA 5A8RB 3ENVA 2EAPA 2O8EA 3IS9A 5T7BA 2CQ1A 3KLFB 4PQAA 4M5DA 1F9HA 3D1QA 4MK9A 1ZBLA 4DMZA 2UV8A 4ISGA 4KITB 3W2WB 1RGIA 4CNYA 4FK2A 1S72N 5HNKA 4UB6U 2K1RA 3LM9A 4BRIA 1IBKF 4JK9A 1IJEB 2DHAA 4DV7F 4ED3A 3LDQA 4DL5A 3VENA 1QAJA 3A0BU 2MZSA 2QJ3A 2F8LA 3QXGA 3KZXA 1BOTO 3MZIA 1PC5A 3B0YA 4JEPA 4BROA 4MK7A 3FC9A 4P7TA 3PRDA 4U8YA 2IC3A 3OXGA 1KLMB 4FYDA 2H48B 2Q3PA 3HP9A 1V4TA 4NA3A 4ZJOA 3QGHA 4PJ0U 3H0LB 4DL6A 2L9WA 2A6MA 3K75D 5B0BA 1IQTA 4HHUA 1UZDA 1RISA 2K06A 1I5OB 2ZBPA 2KG1A 2KVQE 2R7VA 5ALFA 5IS2A 5HHIA 4ZVFA 3T7ZA 3OFEA 2F65A 1M1KT 4WTYA 4B3SJ 4G1QA 5B08A 1RWUA 3A2FA 2VHGA 3L3VA 4LFCF 3KK2B 1B7YB 4UOCA 1TUVA 2ZOMA 3RJHA 4GY2B 3DEEA 5KFZA 4RW9A 2P1JA 1HBUA 1YX2A 4FLVA 1VQKS 1PYOB 1FDAA 3OL7A 3TA2A 1KP6A 1RPLA 4RKUC 4DDFA 3GONA 1QAYA 3SCIE 3MXIA 1NI3A 3WXJA 3CJSA 3LDOA 2GV1A 2RSQA 2ASJA 3FFIB 4H0OA 1VQ6N 4BC9A 2FC9A 4ZKAA 5F3ZA 2OYYA 2P9SA 2PFQA 3ZSRA 1DLOB 1RADB 4LF7J 3NGYA 3GTYX 4M7XA 4XPCA 4LF4F 3BF4A 2AHOB 3T6BA 2G13A 3AA5X 4IOAL 4QIFA 1XNQJ 3QFWA 3ET6B 3Q8RB 4O3SA 5L38A 2OEMA 3AAPA 5JVHQ 4GNIA 1WOSA 4UW9A 5AK5A 5F8IA 3AVMA 3D0GE 4M41A 4DSJA 2HNDA 4F3TA 2VB6A 5GVQA 2WRMA 3ZNJ1 3PW4A 4CZFA 3AN1A 4YN4A 5KFTA 4PKGA 2YNGA 4DFJA 4ED8A 3H59A 5KTQA 4K0KF 3C7NB 3VESA 1V3SA 1F21A 4ECSA 3LALA 4PHEA 1FHTA 4CI6A 2AP6A 4CJWA 3LP1A 1T0TV 3OGUA 2FPKA 1SC6A 1ZQJA 4ZVPB 1EKRA 3I33A 4DV2K 4DR1F 4BCAA 1FERA 1ZPVA 5L9NA 1PCAA 2XMAA 4N77A 2AJ0A 2B8PA 3LL3A 4KB0A 4CLWA 3GYXB 3TJ9A 3J7AN 4DV3J 2GS8A 1M1GA 2LA6A 3MAHA 4DR2J 3T3FA 4MAKA 3ZXWA 2D5RA 3W65A 4B1WB 4C0BA 3HD1A 1U25A 1RYRA 2CPJA 1Q0NA 4FP9A 4MIAA 5DG8A 4YQWA 7ICGA 3D0IE 3G71N 2AZ3A 5JTIA 2OM6A 2F5GA 4KHQA 1QQ7A 2BE9B 4BXOB 2MKSA 3VF0B 4NXNJ 3BEXA 2ALYB 2F1HA 4AM7A 3PSPA 1D9FA 2JGUA 4YG2A 1HNXF 3AB4B 4CK3A 3MMBB 4NMLA 5F2RA 3D9BA 2L08A 4B9UA 3CCJN 4DV4K 1FF2A 2AGOA 3LP0A 3MWBA 3CJ8A 4CH1A 3A3OB 2JJ4D 3SIPB 2D1CA 2QI2A 1X6IA 2W2QP 1X4CA 2MTLA 5CYMB 4M47A 1FNXH 4GC7A 4YOEA 1X42A 3LDNA 1JI7A 2IYGA 4LR8A 1XMOK 3LDSA 2WAQD 2V4JA 3CCES 1BMQB 2RRBA 3R9LA 3I56S 1BQNB 1FFWB 2QWMA 1LKZA 2KNJA 1WUDA 3TUZC 4GVLA 3HDSA 1C1BB 4XUSA 2NLXA 3MM8A 4QWAA 4X4VA 1PUZA 3GB0A 3WK5A 2G8KA 3CMQA 5KGXA 3E51A 3CC4N 4HTLA 1N33J 3RG6A 2LM4A 1WDDA 2HGNA 3OVBA 5KFCA 4ZPBA 1GX6A 1UEUA 1Z4NA 3EUB2 4X62F 3Q8KA 5DM6Q 2E7WA 3QIPB 4MKVA 1J54A 1HL6A 3BEGB 2UUBK 1UPHA 5DQHA 3ZZPA 2VFUA 2UUBF 2M88A 3T5KA 5J2PB 3UO0A 3F41A 9ICGA 2GGPA 2YHBA 3BS5B 2H3FA 3VVUA 1N36J 5IWAJ 1BCMA 2CZ4A 3S6JA 2FY8A 5AQRA 5DDQC 2EFVA 3C2PA 3L5KA 1NHUA 1ZS6A 3HF5A 3PR5B 4F91B 1U2VA 2UV8G 1MWKA 2XZWA 2P9SB 1BI4A 2YMPA 4DV0J 1ZQVA 3HP6A 3DU5A 4FJNA 1S8OA 1P8GA 1QVFM 3HXMA 1S5JA 1FRJA 4TY9A 2ZH1A 5AM4A 4ANDA 1Z4OA 1DTTA 2HOQA 3GSIA 2ZIVA 4EO8A 3MM5B 2BDUA 1Y3KA 3OYEA 4F4YA 3E9LA 4PPDA 2AQ4A 3AGRA 3R3TA 3EZUA 4E7HA 2WSCC 4HUGA 4HI1A 4KLEA 5BOLA 1ITPA 3GIMA 5SUHA 3CCMN 2ZF5O 1MQ2A 1L3VA 2QA4G 3KK3B 3MR5A 1GLLO 2XCPA 4OX6A 2GMJA 2GH1A 4IFYA 2AGPA 3UDEA 1S4FA 2UXBJ 1OY9A 1QAXA 1HR0J 5C25B 2RN2A 3DLHA 1KEKA 3T5JA 5SWMA 5AQHA 1AUSL 4FZYA 4NI2A 2XLKA 3JPNA 1DJ0A 4CLPA 5AZJA 2W1BA 2AEFA 2FVPA 1FDDA 2NXJA 4KLDA 1KW4A 4KKOB 4PXBA 2BTFA 3CJRA 3PTWA 1QJHA 4ZPTR 3Q7CA 1OWXA 1IKYA 3I5BA 4FSVA 3V1QA 2KHVA 5ETPA 2OXOA 4DSFA 1YRUA 4CQ1A 3EGVA 1X5SA 3K5NA 3KHRA 1HKAA 3BR8A 4DHVA 5HVGA 3KLFA 3TAMB 4FCYA 2ZJRL 4NXMK 3GE1A 3HL8A 3ISBA 4IRDA 2RJZA 4ZVOB 5AKGA 5D4NA 5AR0A 3AFGA 4WFYA 2XMMA 3MABA 4WWSA 3KD5E 3SSRA 5KFSA 5KT6A 4QJFB 1UJ5A 2VBWA 2RB7A 4PZOA 3WT0A 4NLOA 3KK1B 2KJ5A 1IKWB 3HHLA 4ED7A 3ZZOA 3S7RA 1CULB 5AFUH 5AQOA 2ZZMA 2R7YA 1OVYA 3WK6A 3HKZC 5A76A 5IIOA 1HBOB 2HHVA 5DMRA 2C2EA 3CJAA 1UL3A 3CJ1A 3CJ3A 2ZUCA 4AH9A 2JL9A 3S01A 1GLFO 3FZBA 5D15A 3V9UA 1YF5L 3HRDD 3LZIA 2IA0A 4KLGA 1FE4A 2XO7A 1HHQA 2DR9A 4CM2A 3HSCA 4ACOA 4FDFA 4RWXA 5GAEI 2Z1HA 4M6WB 4BDZA 1TELA 5HK4A 3NCIA 9ICNA 1IO2A 5G0RB 4DUZJ 4PH5A 3NE6A 3TADA 1HBMA 4CTAA 4QOTA 5LOQA 5HO4A 2RUGA 5HMXA 3HRGA 2EC2A 5HRSA 3CULA 4PHAA 2ZUDA 4LF6F 2F44A 3WNHA 3R2DJ 5JUMA 2DEIA 3QESA 2KLAA 3K7RA 3ZTRA 2XYHB 1NU0A 2E1AA 4WPAA 2BZ2A 2W9CB 4O4GA 5JMNA 3VZIA 2JOQA 4RNOA 2MLXA 2GA7A 3DDIA 3FBEA 1T9YA 5L46A 2HEKA 1WOOA 4CE6A 5L39A 4I2PB 1RWKB 1P9QC 4RJVA 4IOAQ 3EN9A 4DL0C 2F63A 1T03A 4MF8A 4YY3F 3LYSA 3CO9A 2QKBA 5LXRA 1E6YB 2QXLA 3VQCA 2VC1A 2HFVA 4I67A 4EIAA 1JK9B 4PXEA 2Q0UA 3JPRA 5ETKA 3CMEN 1T7PA 2J4RA 4XK8C 5HRPA 3M05A 3TEGA 2ZZNA 3MXHP 4RW7A 4K5SA 1DK3A 1DHMA 2A2DA 3GLJA 3QEIA 3H46O 1NGGA 3L0QA 1YK9A 3IMXA 3TWZA 2LA4A 3U3GA 2E8AA 4WIQA 2YKPA 4YB6A 1NOZA 2HHXA 3IHQB 5DBAA 3KHGA 4K8XA 4X64F 2I2YA 7ICPA 5KNIA 1DK2A 3SAGA 1S5ZA 2CKWA 3NGZA 4C0OC 3IXQA 2M9NA 3LO3A 5DDYA 2HBMA 1WKJA 4MT1A 2HBJA 1Y00A 4RPZA 3DOKB 5THWA 5M2UA 1B4FA 2UXCK 1JLEB 1HJRA 2AMCB 4DX6A 1OSCA 1D1UA 3O9RA 3QE9Y 4NLKA 2XIDA 5A8KA 3L8BA 3DYAB 4F4AA 3L4IA 3H8JA 4C11A 1UT5A 1ZM3A 4M3ZA 2QARA 3QATA 4BVOA 2HVZA 3QU2A 2Q0ZX 1VJ5A 1V3ZA 3KLGB 3F9MA 4UOGA 4IZ9A 2V51B 5LMUJ 2EWSA 3J7YP 3WXKA 1ZPWX 3M8YA 3THXA 3D28A 1HKGA 4CF8A 4X4NA 3OL6A 2PMZD 2X1GA 1NNDA 2BV3A 2LQ5A 3JPSA 2PFDA 1NJWA 5A8WA 3VGVA 2JLFA 2VWKA 4QOZB 2BPCA 3TABA 2OPSB 4Z6CA 4EBCA 1VSHA 1WOPA 1RT5A 4X65F 4MFBA 4DX8H 4BRQA 4KLSA 2G0JA 1WHVA 4WKRA 1DBDA 3OBWA 1YBUA 1L3TA 3FBBA 4NLRA 3BR9A 1SZPA 1O08A 3ILOA 4PR6A 3KFWX 2FI1A 5EWEA 4IL6U 4F25A 4IJNA 1SL0A 1NBEB 4MEXA 3RAQA 3AHPA 2W9BB 1J53A 2K4HA 2H5IB 5H1SV 5AHXA 3BYPA 4CHYA 4BVPA 1N32K 3UKUA 3OTBA 3NCRA 1GLEG 2LQJA 1UKUA 4Z2XA 4F0MA 1GLBG 1DGKN 2FDRA 4AHCA 5E0OA 2B6GA 4Q43A 1KC8O 4BR2A 3LPYA 3QO9A 4Z6EA 3DRXA 2YWGA 5CQGA 3T9NA 5AKXA 1NDCA 2EWHA 2P6TA 4K4XA 5AKHA 2J9CA 3MM8B 2IOHA 3O80A 1HNVA 1UVIA 1EX4A 2HB5A 4CIFA 2MEWA 5G0RA 2IMWP 1BPYA 1BDGA 3QT5A 5B7WA 2R7SA 1DOQA 4ECQA 4OJ6A 2QTDA 2YQ1A 2G0IA 1B70B 4X4SA 4X84A 4PKHA 2I1RA 2KIVA 3AVNA 3MDQA 1KVKA 3RAXA 1UT8A 3O5TB 4HH1A 2LMRA 4JKHA 4BGAA 4I56A 3KHHA 1EO1A 1WC3A 1LK5A 3OUYB 4KSEB 1SJRA 5DG9A 2ZE2B 3ZDBA 4ZJQA 1KN6A 2JX2A 3CJKA 3QT6A 3EDRB 2IRXA 3BBCA 4LF4J 4XO0A 4CO3A 2Y0SC 1SI9A 1URRA 4J9KA 3AD7C 3HMJG 3KG4A 1S77D 1LFWA 1K73T 5CE3A 2XS7A 3H20A 2G5HB 3HT0A 1S0OA 3H42A 1T95A 3OR2A 4JP8A 1COOA 2VODA 3CIMA 3DXKA 3IRWP 1YGYA 4E3SA 1FFUA 3DAWA 5C7PA 3F44A 4P2HA 2XBPA 3BY5A 4AYBC 1PG5B 4P6QA 2J9DE 3IO1A 3IBCB 2GVZB 3D6JA 2G1DA 2QL7B 2E7XA 2Q97A 2DKZA 4KV8B 1SQKA 4KPCA 1KLNA 4NLWA 8ICQA 1M5HA 2O5DA 3GYNA 1RHJB 3C66A 5I4MA 2ODGA 1FX2A 1Y97A 5ETRA 3ZT3A 1XMOF 1WC5A 4DFMA 2OPQB 1RAGB 4JI7J 2JHDA 1CJKA 3ALRA 4I2JA 4ZIWA 3UMGA 2CJAA 3LH2S 1RKIA 1CJUB 3HVRA 2KICA 2X74A 2NRZA 4I6MB 1TUWA 2WSFC 2GZOA 4QWCA 4HHJA 1AFJA 1Y7PA 4IOCL 1PKUA 1QQ5A 2HF4A 3H4BA 4ZOHC 1S22A 1S9FA 3ET6A 4ZP9A 4IDKA 5JU5A 1S48A 3G87A 3VAGA 4H4OA 3ISND 2F40A 3CCWA 4UASA 4ISEA 4ILRA 4RO0A 3OYKA 3W60A 5E3RA 1TFYA 2CNOB 2XNRA 3KKFA 2F3JA 5EVZA 4BRLA 2VQEK 1YZ7A 3UMBA 4OJHA 2V50A 3N6NA 2KKHA 3N7SC 4B9NA 1J5EK 1L7NA 3SNNA 1RB0A 4MYTA 2K4PA 2V9WA 3RVCA 2KW4A 3W5YA 1RXVA 1EETA 4FVMA 3CCUS 2G9OA 4USVA 4DTOA 5CP2A 2MZRA 5KRTA 3H6EA 3CJ5A 2A3ZA 3KLEA 3TI0A 4NI2B 4O5BA 5JVGL 1TKDA 1IJJA 2ZBQA 5C0YA 1X0PA 2HFZA 4BGBA 1UA0A 1MWMA 2DNNA 4C3KA 5BPLA 1XQSC 3A0HU 1C0GA 1EWQA 3RWUA 3HLUA 3QT7A 4NY8A 2K2PA 5ALNA 3W63A 4N8OA 3VWSA 3HJFA 1E4FT 1RTJA 3ADAC 3FYHA 1CBKA 3TSUA 4DUYJ 2DR8A 1RDRA 2KO1A 3MDAA 4OZ0A 4J90A 1VSJA 1AQ6A 3TACB 2W40A 1U8SA 2W7OA 5FJ4A 2E1MC 2BPGA 1TK0A 4CHNA 1U2RA 3OYLA 4TY8A 4CFDA 2WTFA 1X66A 4DR5J 2C3PA 1JKHB 1CJTA 5D6GA 2L3MA 3CHWA 4YMNA 3HHLC 1BWFO 1P90A 1Z05A 2F1FA 3GCXP 2I1QA 3M32A 4BG9A 1N5TA 1NGCA 5ETMA 3K59A 1ZQHA 4KH0B 1V97A 3CDEA 3UW1A 9ICLA 4MDAA 4FO6A 3NGRA 4K0KJ 3HPOA 4QBUA 5HATA 1B64A 4PUOA 1RAJA 1YSJA 4NLVA 4ICLA 3PJWA 5J2DA 2GMHA 4O3PA 3IGVA 4ZA1A 4J9OA 1Q7YO 4DOBA 2C3UA 4O4GB 2OPPB 4O3MA 3J7A1 1Z1BA 1S9EB 2KT2A 3M7DA 3FQLA 4JRPA 1JKHA 4ED0A 3QAUA 3PMNA 3ZDDA 4YR2A 3ZCMA 1TVAA 1BU6O 1KVBA 4F7VA 1S7HA 2EANA 3N6MA 4OI1A 3QQCD 3MHYA 4K4ZA 1ED1A 9ICHA 1VDVA 4IFYB 1UW4A 1YI2S 1KN5A 3N79A 1B43A 2KFZA 3WKEA 4F5RA 1ZH5A 4CZCA 2MU2A 4JOUA 2G2OA 3PSTA 1Z1ZA 3RJJA 4NL5A 4WQ5A 4CEZA 4RQ6A 2YMMA 3C2KA 2VJVA 2N3OA 2FVSA 2VQFJ 4NLGA 4R25A 3VZHA 4JKGA 2YNGB 3M8ZA 2P9PB 5ALYA 1B92A 1NKEA 4CEBA 4YFKA 2R8HA 2AP1A 2DGOA 2EHGA 1U2FA 4ZS6A 4FZVA 1NUEA 2JH3A 2Q43A 1T9XA 1HR0K 2OJ3A 4KHPJ 5BYRA 2RKIB 1Y5LB 4G1PA 2NQPA 2M52A 1XNRF 1F2GA 4HDGA 4DR6F 4DV2J 1E6VA 3MD3A 5CYJA 3KLHB 5CXTA 1U0HA 1NOYA 3V6KA 2NO5A 2DPIA 1C20A 2HRTA 3HJEA 5KFWA 2OTLN 1ZBIA 2F7VA 2L48A 1C0TB 4I2EA 3VHQA 4Z4FA 2OD4A 4CLFA 2F4VJ 1WSIA 4HI2A 3SBGA 2ISPA 1DKGD 3HHKA 4NLDA 4CF1A 3DLKB 1JXLA 2GUPA 1ZJNA 5GAHI 5M1OA 1OPIA 5KGWA 1PJ6A 2AYGA 3ENHA 1ZQPA 4E0DA 1IBMJ 1JXEA 2BJ7A 2YI1A 3OHBA 2PEBA 2JRSA 3R5JB 1IKVB 2DKOB 4X4TA 4O8KA 1ECWA 2BGWA 1LWEA 2M8DB 2Q1LA 2Y8YA 2YX1A 4XH5A 1HNIB 3PY8A 2MKKA 4CBWA 4KN7A 1RBOB 2RDIA 3HWTA 3OV7A 1YJ7A 2QGFB 4DUYF 4CGFA 2R7QA 4UUWA 4CLLA 3MR2A 1B9FA 1LWXA 5E26A 4O44A 3OSNA 1Q81O 3UIQA 2MQ8A 4H5NA 3JPQA 3QRQA 2B5JB 5CWRA 3JXUA 4FBUA 4H8KA 2HNYA 1VQ5S 1NK6A 3N7RC 4OJLA 1G4CA 3FCHA 4FBTA 2I5JA 2H4YB 4DUYK 3FSYA 4EBDA 4FWQA 1NJXA 1ZQOA 1RDDA 3HX9A 4KTWA 2BW7A 3RB0A 2EBGA 5EOYA 4OX9K 2W9MA 2K8CB 3VCDA 4ZOSA 2XYPB 4ZITA 4F3QA 4DOCA 1BHLA 2QA2A 3I5AA 3CCSS 1J97A 2YQEA 2XZDB 4ECRA 4QW8A 4ISFA 1C1CB 3ATUA 3MM5A 4CDGA 3G0ZA 2GOLA 3OFFA 2Z1GA 4U96A 2JV3A 2K8AA 4KTQA 1Q8LA 3TUIC 5KL1B 1HRHA 2PEHA 3KKSA 2DBBA 2YPYA 2P35A 3DM2A 5KT2A 4TLRA 1U45A 4FYWB 5BRHA 3EZ5A 5E3CA 1N0VC 2C2NA 1PJ5A 3UE5A 5EX0A 1FJGK 3U7JA 2YKMA 2ITMA 4LF2A 1S97A 1B0VA 2RE2A 3OHRA 4C3LA 4Y2CA 5LJWA 2HHSA 2ZIWB 1WELA 4M3XA 3GDXA 3ZEUB 3ZTQA 2RQCA 3GPAA 4IS7A 4FVCA 2M0GB 1TKTA 2HQ3A 4M5JA 4BRGA 4PHDA 3TP2A 4KGKA 2D0PA 4HHHA 4U6PA 2DO0A 2J9EA 2KM8C 2CIMA 3MTKA 2OPRA 5EOZA 2HHPA 2FF3B 3KMQA 1HPZB 4F04B 3D66A 4DUZK 2G5IB 2XULA 2OYQA 1YJ9S 2DFFA 1HBNA 4OYWA 2NXNA 4IFVB 4P2XA 3NGTA 5AKZA 1PVRA 3C15A 3OTOF 3P6YC 4FLXA 2BCRA 2HQIA 4NEYA 5EE1A 2W7PA 1VJWA 2HOEA 1KL9A 1F44A 1LKYA 3AQEA 2RUSA 4E1MA 1VQLN 5A0YA 4RQ4A 5IV3A 2D69A 4YHHF 4LRAA 6AT1B 2BOPA 5D4PA 4IQTA 3BQ0A 1XSLA 1WORA 1IKWA 4WF9L 2HMXA 3BSOA 5HN0A 4J9LA 1KHVA 3QO9B 1KNZA 3MN9A 2O3DA 2YWKA 3PXGa 3ENOA 1L7PA 2KXHA 1S6PA 2RMLA 3VCBA 3C1ZA 2R7WA 2WCXA 1OUQA 4JYAK 3EEQA 2CQPA 5DM7Q 3C0BA 3CF5Q 2BHNA 4QZGA 3LK9A 1F5AA 3DRPA 3HKZF 4I69A 1NLVA 2BABA 2ZFHA 3ZZZA 4YMOA 4L3QA 4FK0A 3NXZA 4F3MA 2O8CA 3RH5A 2FJBB 4GFJA 3T1HF 2M5YA 4PWWA 4TVAB 4DQQA 1CPZA 2Y1JA 2W2NP 4MIBA 2FPLA 3MM9A 1SAZA 4B3OB 4I6WA 3H25A 2G8IA 5LSLA 4DR3F 1RKJA 3MAAA 2F9TA 3SAHA 2VG5A 4WQ4A 2CWXA 5GAGU 4ZPWR 3GILA 1QM9A 4RBUA 3ZT2A 3O3HA 3CPEA 3CP8A 2KI2A 5C5JA 2WF7A 2A40A 4EFHA 4PYAA 2YJEA 1EP4A 2Z58B 1P27B 3ENQA 3QFUA 4JWNA 3OL9A 2PI4A 1ZAVA 2ZC4A 3A3NB 1KC8T 2MHNA 1V5IB 2OEKA 3WBZA 5DBCA 4YOUA 1FRXA 1XNQK 1FK9A 2GWSA 5GMDA 2YWWA 4NLBA 2DEJA 3NMRA 2F76X 2BRLA 2CNLB 2FHKA 2UXDJ 4JHDA 4USIA 1O5JA 2XSJB 1C7YA 1VQKN 4NLQA 3MM9B 2LHTA 3DDNA 4UW2A 9RUBA 1L7MA 1P8ZA 1TFWA 4PWUA 8ICAA 4WJ3B 4CGIA 4CJ3A 2P5OA 2NNWA 3MGJA 1XC3A 1BQXA 1VQ6S 2I9SA 1EXNA 1CJKB 1F6TA 1WEXA 8ICXA 2E8MA 2HRYA 4I6MA 1K8KB 4DR1J 5AI8A 1B99A 3D3BJ 1X8DA 4A8WA 3RJFA 3WDOA 1SV4A 4WK3A 3M1VB 1XR5A 3I4PA 2H3QA 2CXYA 1RTDB 1W26A 2X1AA 2ZIVB 1FXLA 3O6WA 2AJQA 3DRSB 4RT2A 4LF9F 1YG0A 4FWKA 4K43A 3MEGA 1KR4A 1SKSA 3TOQA 3MC1A 2CH6A 5CD4H 1QQCA 1RT2B 4AXJA 2W6KA 2AJ4A 2GJFA 4EZ9A 4F50A 1BG3A 5AQZA 7ICQA 4PHPA 1G3OA 4K2XA 3VAKA 4A61A 3DKDA 2KG5A 1N6QA 4M3YA 5J2MB 2FBTA 3F2DA 1UWBA 4IO1A 2P9NA 2POKA 3AY9A 4JYAF 4PL7A 5F9LA 5J1NA 4IH6A 3HFZB 3D2QA 2COLA 2JEJA 1IV8A 4XDDA 2RRNA 3MDFA 4GXIA 3G8QA 3U1LA 3P5JA 4CWBA 4M9HA 3AD8C 4OHYA 5EWGA 4FZXC 1G6BA 2EPIA 1CQMA 4LH5A 4EYIB 4I9LA 1HI1A 1HQEA 3CDUA 2HLTA 3N4PA 3QRRA 3AA2A 2ZUBA 5AQTA 1QE1B 1YJRA 3IWXA 3ZSVA 3IWNC 3FZ2A 2DNOA 3JYTB 2A18A 2HZCA 3VMFB 3D2SA 2IY5B 2WHOA 2DR5A 5HVHA 3QWPA 3MUTP 3DXMB 2XLJA 3AJDA 3G71S 2H3IA 2QFIA 5DO2A 2O8FB 4ES2A 1KD1T 4NMXA 2OUGA 4TURA 1S59A 3TPQA 2DH7A 5A0LA 2N3LA 3MEDA 3S3MA 5IILA 3UQSA 1U04A 2F8HA 2Y8WA 4Q5VA 2MKIA 4LF9K 2GHPA 1R0CB 3NOGA 4LF5J 2DGZA 3K1RB 2V68A 3TEHB 4UY8T 1NPRA 3W9IA 3ZZTA 5KQDA 3R7NB 4NCGB 5KAIU 5AQKA 2H65B 4BUGA 3CCVN 1Y3JA 3M9MB 2DIVA 4P0PB 5H9FJ 2ZD1A 4FK4A 3VTHA 1SXEA 4DZ6A 1IVZA 1OO0B 3NS1A 5IWAF 4CZKA 3PRVA 4TU9A 4LREA 3T1HJ 3OPXA 2OMLA 2IVFB 5BN8A 5E3PA 4JI6F 1UVMA 4NZ0A 4EUVA 4CM0A 5HLFB 3RR8A 1HNIA 4CD1A 4C98A 1WI6A 3OQ2A 1R7IA 2DGUA 4DV0F 2R8GA 1DTQA 2P9UA 1UETA 1NSAA 9ICUA 1DTTB 4H5VA 1NGAA 3T19A 1MN7A 3CC4S 4YD2A 5J0PA 3O9TA 2NUBA 5C24A 3ZETB 1XMBA 1AA1B 3HHDA 4RW8A 4ANEA 2QX0A 3MDCA 1HD0A 2GELA 8ICBA 4NA1A 2A1RA 2LXUA 2NCKL 4OKEA 1VSMA 1NWKA 4OI4A 3G4SN 5BYQA 4USJC 1FX4A 4JI0K 3QGGA 4QZEA 3C6TA 3O3LA 4CO2A 4K0KK 5DB8A 4DTMA 4QWDA 4GKKJ 1EQ0A 1Q79A 1TL4A 2OPQA 2YX8A 2FZGB 4CJQA 4MKYA 4AM6A 2DTJA 2VGMA 4V19J 3AD9C 5AI5A 1OY8A 3M6UA 4B3RJ 3I28A 2RQ5A 1VJQA 4NASA 4RW9B 2RU3A 3GJQB 4O0JA 3UXPA 4IDHA 4FM0A 3SQ2A 2Y9TA 5DBBA 1T3QA 4GLXA 2Q6BA 4FS1A 4WFAQ 2YY3A 1Q86T 2VIHA 5IIMA 3G2XA 2P9PA 4MK8A 3NG8A 1YHQS 5JVHL 1NPPA 5M1QA 2B4UA 1RJJA 1ZXIA 3HZ6A 4C7ZA 3U1MA 3WIUA 2IVNA 2CPEA 4BC4A 1CJVB 3GFKB 1X40A 3UN5A 5TKWA 2VD3A 4LQ3A 4M0AA 2E9ZA 2BJDA 1TAQA 1XQIA 1FI4A 3AOAA 4W5QA 1WHXA 9ICRA 2QLTA 2VICA 2H4WB 4KKOA 2F4FA 3T79A 3P96A 3QU9A 3EUNA 2MXYA 1ZOLA 1IN0A 4JI8F 5DM7L 1VRUB 4HR2A 3OS1A 2KP7A 5KFYA 3PW2A 5KT4A 1T3OA 2CPXA 4OPJA 3PX0A 2XY8A 2BANA 3TANA 1QH9A 5IT9Y 4KFBB 3BB5A 5DQGA 3VN5A 4JYAJ 1QE1A 3C7NA 2DRAA 2QEXS 2KKPA 2XC9A 4A4JA 2GUIA 3Q83A 2G09A 2E2QA 4DLGA 1UP1A 4CECA 3NTUA 3V1OA 8ICPA 5KG3A 3M7VA 4DUZF 1B0XA 2VIXA 2IBOA 2CNNB 1RYUA 4UAZA 5FRNA 2O8FA 1MN8A 2BM0A 2NV3A 4TUPA 1G2EA 4UZCA 4K59A 1RYSA 3D2FA 2ASYA 2BEFA 2DNZA 3PW7A 3D5MA 1T9WA 3TZXA 3A5MC 2R2RA 1FDBA 2HSZA 3H98A 2NRXA 5EX5A 2QWPA 3R7SB 4CIOA 3C23A 3A8IA 1GK8A 2HLUA 3K89A 4NO7A 2IDEA 4K4WA 2ZIXA 4ZN3A 3ENWA 2EFQA 5GMKa 3HM8A 2WF8A 5AKIA 1W2BM 4NWIA 5D0HA 3CDWA 1B9DA 5CYQA 2GV9A 3ETLA 3DLGB 4MHVA 3DXKB 4C8KA 3PR4A 4RW4A 4G1QB 1VISA 3MBYA 2HK3A 1TK5A 4ID8A 3G25A 5LSRA 4PWDA 4L76A 1SQGA 5I3UA 2CQ4A 4IQXA 3CIZA 3CJBA 3AO3A 5KFQA 4TY8B 5AM3A 4ILMA 1NGFA 4IKAA 4G3IA 5DB7A 2YB1A 4URSA 4A8EA 2C22A 1C0UA 1N62A 4FW1A 4HVZA 3AGKA 3NGKA 2JVRA 4W92B 1F2HA 4KLTA 1XR7A 2WB4A 3IR7B 4OLAA 1X4GA 5DM6L 2UVVA 5A2QO 4PPZA 5JJBA 5IC6B 1GMWD 3A8JA 4I68A 4BC5A 2HRUA 2NZTA 4KY3A 2J6UA 2PO4A 3PACA 4BRHA 4OJ5A 2HIQA 4KX3A 1RAAB 2LEPA 3P4IA 1YQHA 4H4OB 1VC0A 1PAEX 2KXFA 1R8CA 2P5GA 4GXJA 2IM1A 4WYWA 3DHWC 2J7WA 4O5KA 1PSDA 2VJUA 5KFJA 4YOTA 1T11A 4QZCA 2NYIA 4Y2JA 2BZFA 1YJWS 2ZXHA 3VF2A 1SGGA 1VQOS 3EPGA 1H2UX 3AVBA 4OI6A 2AKWB 3PEJA 5FLXU 2AIRB 4QU6A 5H1SQ 1I94F 3P83D 2F4VF 1X2IA 1UEKA 1VQPS 4V1Ak 1JLGA 4CEDA 3UCZP 1LOUA 4KGZB 1Q86O 3R5GA 5B09A 4QZIA 1CVJA 2AU0A 2V4RA 3KJVB 1S76D 2E20A 2ZH3A 3FEZA 5KFNA 4ZCKA 4CZLA 4ID1A 4LVOP 3I4HX 1RLCL 2KOBA 3HHEA 2VQFK 4JI8J 2BVZA 4K4GA 3AJ2A 3D2EA 1U1QA 1GOBA 4MN4C 4CZHA 2VPZB 1RHKB 2XY6A 2V8DA 5KG2A 8ICZA 4FJJA 5IM0B 4OYPA 4R63A 4U9RA 3U6FA 1ZZFA 2D1KA 1ATNA 3NF6A 3W0LA 5IT9O 1A0PA 3OYHA 2B43A 2MRLA 4UAVA 2LVWA 3MEDB 4J9UE 3NGDA 3TQEA 2DVIA 2PYLA 4UTGA 2ZWOA 5ALSA 3SSQA 5J0YA 4ZTFA 4URQU 3GFHA 1YITS 4DU8A 2LP4A 2E2NA 4LRDA 1U6BA 1T6DA 3H1VX 3FCVA 4KBIA 9ICBA 1OH6A 4B1VA 1T4GA 1T94A 5AM2A 1SIZA 5AE3A 2D9OA 4JD2A 2QA4N 1LNQA 4M3UA 1RAHB 1VC6A 2HHQA 2AYEA 2FJVA 3CCRS 2LQ8A 5DZ6A 4DV5F 4IEEA 3RJMB 4LF4K 4GKJK 2WF6A 3BKUA 5HI7A 2DCUB 4JI1J 1C1CA 4NPOA 2C28A 3O08A 3RRHA 4LR7A 3TR8A 5AQJA 1XMQK 5KFDA 3I32A 2ZVIA 4J2EA 2IAJB 4WFNL 3OBYA 1TP7A 3M6VA 2ZG6A 4YMEA 1VHFA 5M2RA 1TV6B 4P10A 2W3SA 2N7YA 4QAGA 2OPPA 4JUZA 1W7AA 2CRXA 2I6WA 5E7OB 3NCPA 1RG6A 1LFPA 2IPOB 1SJFA 2I8EA 4JI0J 2UU9K 3OTCA 5AI0A 3OL8A 2NXCA 3J80O 2RVJA 3DOMB 3TA0A 3ZT0A 2E66A 1LW0A 3VEOA 5ETVA 4Y2VA 4HL9A 2Z2LA 2ES6A 3HOTA 2KKVA 2ZH6A 1AZSA 1RDCA 2RT3A 1VS3A 5KRSA 4IG0A 3SLCA 4UOFA 2WAQC 3SQGA 4X4QA 3ZDCA 1V5VA 3LDLA 4QJVA 2Y0BB 3KK2A 1DQAA 4F67A 1RTHA 2C2RA 1Y10A 5DG7A 3G6XA 5LL6Z 4CO0A 2HNZB 4E7KA 3OLAA 1RQLA 4PRFA 4ZLPA 2XMUA 3VAHA 4BRPA 4OZ5A 3PMLA 4FWMA 4LF6K 3AXMA 4JI2J 3M9OB 1C6VA 2DYAA 2R8KA 1R8BA 5HHHA 3TVYA 4DTPA 4Y34A 3MMCA 7ICUA 2E8NA 3NVZA 1QAIA 2WB1D 2MKHA 1IR1A 4OZJA 1OS5A 1RTIB 3G6VA 2LYBA 4FW2A 5KPTA 1IBKK 8ICEA 3EM1A 3B9JA 3MPWA 3RSEA 3UPFA 4KLUA 1YVUA 3M6KA 4Q45A 5KFVA 1ZQFA 3UDCA 2N7CA 3QBXA 4MIWA 3MI7X 1DAXA 4CT9A 3F56A 5AQSA 2X51A 3NOCA 4NLTA 5KFBA 4OYAA 1RDBA 3N97B 2R7OA 1UQVA 1JLEA 1K47A 2HVDA 4IG3A 1QZ5A 3AA4A 3DC2A 1NAQA 3MCOA 4Z0UA 2YX6A 4KJIA 2RD5C 3MMAB 5IXUA 4H03B 3OHAA 4JI6K 5KQ8A 1TL5A 4C0ZA 1WUUA 5AM1A 3OYJA 2MA1A 5KG1A 4BRNA 3WUHA 4EMDA 5DDPC 3KNAA 1NH7A 4K8ZA 4EFAC 1NNEA 4C97A 4C9DA 5AQNA 3CCUN 2ZTCA 1PJ7A 2XQCA 2YHXA 2CJBA 4FXWA 4CZGA 3KUEA 1WUAA 3FE1A 5JICA 4ZCLA 1N34K 1MA9B 2B3TB 5J8YC 3SDEB 7ICNA 4J9VA 1Q7LB 2CGLA 1HKCA 3IGNA 2FBXA 4PEOA 1JCGA 1LK7A 3M6XA 1VSEA 2DB1A 2DXFA 4KE5A 4MEYA 1HBMB 4RW4B 4OLBA 1ZBSA 4M8LA 4EP5A 3JPOA 3Q8UA 3CFRA 1JLFB 3TW0A 1JIHA 5K5MA 8ATCB 3MMBA 3WK7A 2FIUA 1B22A 2XTJP 4OD0A 1U6ZA 3G96A 3FRZA 5GAGI 5JMVA 1OQ6A 1CJTB 2CN1A 4UQTA 1OMSA 3CCTA 1NDKA 2DTUA 3W9HA 1KTVA 5B0GA 3E58A 4OV1A 2ZD1B 3UN3A 1CG2A 1UAXA 1KAZA 4I2PA 2ZTDA 1NH8A 1KSPA 2ZH2A 3IR6B 3NH2A 2HGLA 3H2UB 2E29A 2W01A 4H54A 1KBUA 3DOMA 1CLFA 1BHNA 1SL2A 2EI5A 2WMMA 3OVNA 1GO3F 2M2BA 2I6XA 7FDRA 1VAZA 4KB7A 2FVCA 5ALJA 3J8AA 3U8XA 5CRXA 5BRFA 2OP5A 1RQNA 1S79A 7ICLA 1VBKA 3M3ZA 2F8TA 4F2SA 2JFDA 1U1RA 1JLQA 3N5FA 3PVXA 2FVRA 4QCLA 2ZOFA 3EXCX 1ZD2P 2LCWA 1VIOA 1TYQB 1N5WA 4FLWA 2GHWA 2C2OB 2X1FA 3FFIA 4E8UA 4M9NA 3M8QB 2VFSA 1H6KX 3C6TB 4JI2F 3NRZA 4U67Q 3QZ7A 3RJGA 4DV1F 4M3TA 1CJVA 1S6QA 2EQYA 3MCMA 4Z4HA 1U1NA 1U2VB 3OR1A 3MCSA 4P7VA 4TQRA 1PZNA 1NRKA 1NSKL 2YCHA 2QARB 4F5PA 5GAHU 5BPNA 2BA9A 2CPZA 1KCFA 4LF5K 2LLZA 3PNIA 3M2RA 1EB0A 3G8TA 1NB2A 1Q46A 2EG2A 2P51A 1RAIB 3HOSA 1K73O 4CH7A 1NMNA 4MKAA 4DU1A 4JN4A 2PA3A 1I94K 5E33A 3MEGB 3D1OA 1S7IA 2FSNA 2YKNB 4O4RA 1T3NA 4MFBB 3V81B 2MDAA 3W2WA 1N8RO 1WC0A 3H5XA 1DRGA 4J7CA 3LA0A 4HLBA 4AHTA 3CJ4A 1IBMF 2CPDA 9ICJA 4YOVA 1DQ9A 3WC0A 1ZXOA 5D46A 5C25A 1WWUA 2QB1A 4FPRA 3KWGA 3MGVA 1TV9A 4LIRA 4DEZA 1GTHA 3K5OA 5J0UA 4MO5A 1GEHA 4ELTA 1FWKA 3R5AA 1RHMB 3A4TA 3CMES 4IUFA 2DJWA 4KH6A 4E2FB 1MA7A 2B21A 3R9KA 2HNYB 2M0NA 2HVIA 2OTLS 4FWLA 4NLSA 1GLAG 2F96A 2FLNA 3SCXA 3AMZA 2KDOA 4GRSA 3EY1A 5JVGQ 1QDUB 2G8WA 1XSNA 5AZIA 3HO1A 3SBTA 2Z2YB 3VQ5A 5AKYA 3PW0A 3OXLA 1YBTA 3RGIA 4K4UA 2P66A 3QU7A 3DV9A 1S5LU 1Q7YT 3V6JA 3NAIA 3PV8A 1LXJA 3QSYB 1S57A 3C5GA 2FY1A 1F5SA 2GO9A 8ICLA 1JL1A 2LYVA 3AT1B 1ZRNA 1GLJO 4OV6A 4NJ8A 3IP4B 4WBFA 1XMOJ 1X5PA 2JEIA 1LWFA 2R4FA 3PJ9A 4GKKF 2XI3A 4XIUA 2QN6B 1C0MA 5J2HA 3E8OA 4RNFA 3IM1A 3ZDAA 1REVA 1BXNA 2GQQA 3O4WA 1WSFA 3A8EA 5ALTA 4KPYA 5HBMA 4OJ1A 1CS4B 2ZWPA 3RB6A 1YRXA 2WVFA 1B3TA 4KH1B 4OYOA 1XK8A 5BXIA 4Q44A 5FDLA 4NZ7A 3OXFA 4JWMA 1FJGJ 1EP4B 3HKWA 3ULHA 3GV5B 3IA0A 4OJOA 2ZIWA 2VU5A 3MEEA 2EZZA 2PMZF 1RT7B 4RUCA 4EHUA 4NV0A 2QMUB 4CZJA 2ASDA 1HJPA 3MUVP 5D0RA 4B3TJ 1PBAA 2ROPA 4Y2QA 1UCVA 3V6DB 2WF9A 2YNFA 4MJKA 2DF4B 2F7TA 3P1GA 1SC1B 5T7LA 1W7WA 2CPFA 2DO4A 2JNJA 1KHWA 1HMVA 3VALA 1HPZA 3V9SA 5KG0A 4BG8A 3SMVA 2J5AA 2HMPA 1X3NA 2XNQA 3KUGA 2D3OR 3QGPA 3I96A 4DV5K 1SJ3P 4GV3A 1RWXB 1T9TA 1N4LA 3ZT4A 4CO5A 3JAMU 2FBYA 1Q18A 1QVGM 3H3OB 3OTOJ 4PCQA 1U6FA 2V7ZA 1IBMK 1IKXB 4LFBJ 1PK1B 2HNDB 3MEEB 4RR5A 3EJMA 4DU7A 3WXLA 3SV3A 1TK8A 3PYFA 3M8PA 2NXEA 2JLGA 2HVHA 4FYVB 3ZSQA 1TU0B 3IS9B 3FDSA 4K4HA 2GNKA 3L09A 4GO7X 4FYYB 1ZBFA 4ZP8A 3G82B 3CD0A 4OYIA 1MG7A 3G6ES 1VR6A 2KYZA 2G0CA 2JEGA 2OHFA 5J2AA 4E7JA 2NUHA 3I9ZA 4RLEA 1H2VZ 3K2YA 4UOHA 3O1WA 4Z4EA 3MMCB 2MQOA 4IR9A 4CE9A 3LP0B 3ZFVA 1HQUB 2GC8A 5KOWA 5F41A 2HWIA 2H5XA 3NMAA 3BSNA 4FJHA 3C14A 2DKXA 4M5NA 3UE2A 2LM1A 3GYGA 4WE1A 3VGLA 4WFZA 4BDYA 1RHQB 4B08A 4BRCA 3MURP 3GIRA 2K7JA 1BUPA 1R27B 5KFIA 3CETA 2ALZA 3RMBA 4JV2A 4DQPA 9ICFA 4I2QB 3TZWA 3PO5A 5LL6d 3KBBA 5GAGP 5HRNA 1VIXA 2DH9A 4JNEA 5BPMA 3EE8A 3MR3A 1WEYA 4BR5A 2BCSA 1HNWK 2O6KA 1GMWA 5J2FA 5AFUA 2BBEA 4FWSA 4NLPA 3TTDA 3HHLD 4J9MA 2B4JA 5AK3A 2YH0A 3B8AX 1ATSA 1A5XA 3SI8A 5DLFA 3EVWA 5AQVA 3SR6A 1JB0C 2BR0A 1RBVA 1N54B 1QCKA 4DFKA 5DB6A 2P5VA 3ZSZA 1KFSA 3DLRA 3QMLA 1R6YA 2KZMA 4Z7CA 2OGUA 1GOCA 2FJ6A 4WKYA 1BIZA 3LGHA 3DGPA 4ZPDA 5MLCV 3ULDA 4FWNA 4NXZA 2UVRA 4FJKA 4OYXA 4ZP7A 2E1CA 4K2JA 1G7CB 1FO1A 5T41A 2HFSA 4H4KC 2OWOA 3O8WA 5LSOA 1U4BA 1ILYA 3QEBZ 4UB4A 5HR6A 2BPFA 5CHGA 2E5LK 4RZRA 1VSIA 1P1LA 1TKTB 3RUBL 5KAKA 4LF9J 1RDFA 2QKKA 1HUXA 1QLNA 5DZ7A 5EDWA 2VWJA 2J76E 1M1HA 3OD2A 1RHUB 2W3RA 5J2QA 2CQIA 2ZH4A 1RAOA 3DJCA 1PC4A 3GU0A 4NLZA 3NDKA 1UVNA 5ETQA 3SEOA 2HK2A 4CEEA 5DGBA 1ZJMA 1TL1B 4ECVA 4C7YA 3WK9A 3GBTA 4TLQA 2LU1A 3SZ2A 1YWXA 1RK8A 2W2OP 3NNCA 3C6AA 3GG1A 4JMUA 5B8HA 4IOBA 1ULRA 4PYDA 1UTAA 1RTDA 2R2UA 3SQ0A 5J0RA 3OTEA 2XG8A 2ZJ5A 4EELA 3ILJA 4CIGA 4BC3A 3ZD8A 1X6JA 4PG5A 3ZSOA 1ATRA 5EWFA 1ASUA 2LYAA 2R2SA 2B8QA 3HSDA 3ONQA 3TAEA 1NKBA 3Q22A 5J2QB 3K0JA 1CXUA 4A8XA 3JYTA 4NCBA 4X64K 2V63A 2K8BB 4USWA 5J1PA 2CDQA 1UWBB 1D8ZA 3SQOP 2PMHA 2JLEA 1XMQJ 4ENOA 2R2TA 4EEKA 5A0YB 1KDHA 3I82A 1Q8KA 3PNCA 1SV5A 4L8RB 1NEEA 3QYPA 3DN9A 2NS1B 1TAMA 3B8HA 2RRDA 2H3VA 1VRUA 2NYHA 3BZKA 5J0TA 3ETRA 4RG8A 4X4RA 1VSDA 1QZ6A 3UB5A 2ZNZA 2ZIXB 4YDXA 3H1QA 4BE1A 3W2VB 2GBZA 1JNZB 1S1UA 1VK0A 4UBCA 1TL7B 4BRFA 4BY9C 3T5LA 1EXQA 4MFFA 2PFFB 1L7OA 4BC7A 4JK1A 4MF2A 3WQTA 2B51A 3I55N 7ICTA 4AUKA 1XI1A 3QJJA 4I7FA 5HRRA 4OZ1A 2UVWA 4NX9A 3P8BB 3BQ2A 4EO6A 5C15A 1KRPA 2K3IA 1YIJS 1CRXA 2I5HA 1HKBA 4B3MJ 2PT0A 4RQNA 1F3VA 5ALQA 2WONB 1RGVA 2VG5B 4W4MA 1Y88A 2UYTA 4HCBA 3UI3A 1NCLA 5FDLB 4C8ZA 3PM9A 2YB4A 2PE8A 5ALVA 5D3GB 4GMKA 4DPUA 1KTQA 4QWBA 4DU3A 2YNIA 2V8GA 2P9EA 3SCJE 1Z4UA 2BE2A 2YHWA 4OCZA 4J2AA 3K4GA 2E9TA 4KH4A 1XEZA 1VQYA 4WZQA 3OVAA 2ZJ8A 3PO4A 4DTUA 3QIPA 3CW2C 1RBAA 3TQ1A 2K4EA 5JRTA 4C4TA 1LWCB 1R6VA 5KPRA 2UUWA 1T8EA 3ULEA 9ICXA 1FESA 4LT6A 2DQNB 2O8BA 2OHDA 1SJQA 2YWEA 4USHA 2Q79A 2ZJAA 1WI8A 3JQKA 1V9PA 2AH5A 5DETA 2LU2A 4L74A 3KLGA 4QW9A 2J7UA 4AYBD 1X4FA 4F4ZA 5HL7Q 3KXDA 4DV4F 1M5VC 1VMBA 4RQ7A 1TL3B 5CD4A 5C12A 3RB3A 2QB0B 3MM7A 3WNFA 4OZNA 4USKA 3PIOQ 4PZVA 1XNRJ 1IQZA 2J0WA 4KO0B 2VONA 2ZDOA 1OYDA 4A5AA 5AJ3F 1NB7A 3E1YA 2J6SA 2HNZA 2X6SA 3N0VA 4O9MA 4FWPA 4YDUC 1BA0A 3H4DA 4MFAA 1REGX 4A47A 3EL2A 3NUQA 1G1XA 4BREA 3O9SA 1U09A 2MPUA 3UN2A 3TAMA 2DNMA 3VGKA 4H0PA 2KN7A 2DGWA 3M6WA 4C8LA 3R1LA 1F3FA 5GAHP 1VQ4N 1JJ4A 1HMVB 2X78A 4CJUA 2W25A 1ZQUA 4PG6A 1MU2A 1WYGA 2W42A 4BRMA 1XIQA 1ZQRA 2GLEA 2KHQA 2VJ5A 4RQ5A 3CMAS 1FRLA 3LP3A 1FWPA 4DQ8A 4OPKA 4LY7A 3UKUB 3DCAA 3MPUB 2KM8B 3A13A 4LH4A 3QMQA 9ICSA 1YLXA 2XWYA 4QWEA 2A1AA 4CF4A 1QQMA 3NF8A 4JKGB 2EXUA 4IRKA 1I6JA 2RHSB 3CWJA 2N1RA 2KU7A 3JXOA 3UQ0A 2V94A 5HAOA 3J7AP 1U9LA 4Y2YA 5EHHA 5KG7A 1IUJA 3IWLA 4OI3A 2YXLA 1MC8A 1RAEB 1BCOA 1QY7A 3BUZB 4NXNK 2MSTA 5HMZA 2GMLA 3M2UA 3RRGA 2BYCA 3SD7A 2QFJA 3BM7A 5E3AA 2OIHA 4E1JA 2GQCA 3Q86A 4LIWA 8ICRA 2CXEA 1G15A 4AHUA 2ZHOA 2XM3A 1QTMA 3AVJA 3JSMA 2FF6A 1RBTA 5AQIA 1WHWA 3R6LB 1CULA 1N8RT 1VCTA 5AI4A 3H40A 4QZBA 3C6UA 1SUQB 1Z2LA 3TYTA 4A8MP 2MMYA 1RWPB 4NLUA 3FC4A 4CO4A 5CZXA 4NLCA 2OLWA 4BGDA 2GIQA 3Q7BA 4CRJA 3D1HA 3G10A 4GVBB 1FJGF 4FJXA 3V6HA 1M1KO 5J29A 4NCAA 4LZDA 4E1NA 4OMFG 2FJDB 3J81O 1EHWA 5B0FA 4RQMA 2DXEA 2CJXB 1IWAA 3ENAA 3NKYA 1JLAB 5IV4A 5GINA 5E79U 8ICKA 3UPQA 3AA8A 2QE5A 2XO6A 4YFUA 1WD6A 2WBMA 2E8OA 3ZZYA 4P0QB 1ZQMA 4I6AA 4I2FA 3WX4A 3ZDEA 1RCXB 3MECB 4NL9C 1HYZA 5GAEP 2CA9A 4RW8B 3BS5A 2IRYA 1JJ2M 9ICMA 3IRXA 3OYDA 1IG8A 3VAMA 1N2XA 2FHOB 4L3KA 4CGZA 1J9AA 5KFGA 9ICIA 4JHDB 1WCNA 4PXDA 3ULEB 2DNKA 2VBYA 2GCFA 3M8QA 4DCCA 2W24A 4LJMA 4JKBA 2PI5A 4DR6K 2QWQA 3QNMA 2OMOA 5HMYA 2E44A 3FKBA 3M5RA 4AFFA 3W5XA 1UFLA 2YMQA 1SKWA 4DPYA 2ZHBA 2CGJA 1RBLA 1WC6A 4B02A 2ACMA 1NZBA 4CNZA 4WU2A 4HCCA 1XO0A 2ROGA 5B5EU 1WNEA 4ZVTB 4BBYA 3SUQA 1O8BA 2KJ9A 2O4GA 2P9UB 4CJTA 2WK4A 4PGQA 4CEQA 1VBZA 3ZETA 2AF6A 2IRUA 3M30A 5CH7B 5ELZA 4QR1A 2W41A 3LUYA 8ICMA 4DSIA 5DK5A 2XVTA 3RAMA 4V19X 3JAMO 3RZAA 3EMTA 3EVOA 3W61A 3CMAN 1R8HA 5IIJA 3M1YA 1VQ8S 3K9KA 1CZBA 4OJGA 2YHYA 2W54A 1S1VA 2ZGYA 5EE0A 2DNGA 3IV6A 1A6LA 4O3NA 3R5CA 1SB3C 4LFBK 1NGIA 2FHJA 3A5LC 3C2MA 1RDUA 2KK0A 4DR5F 2VKZG 5EE3A 5G5GA 4H0YB 5AQXA 3VV2B 4CDIA 5M1PA 2BW2A 3H8YA 1J5OA 4QR2A 4KFBA 2UUCF 1RBRA 2HWHA 4YUDA 3F9KA 4Y2RA 3CERA 2ACYA 2IHMA 3V4IB 1QSSA 2IIHA 3LOUA 3AU2A 5ALHA 5CR4A 4FZLA 4JKFA 4OLOA 2BM1A 5JS2A 4P52A 1S0MA 1D8YA 5HANA 4Y2SA 4FYXB 4WXWA 2F3NA 2GO8A 3AY0A 3NF7A 4HHTA 1M0SA 4GC6A 1TVRB 5AXMA 3T5HA 3HSJA 2G4BA