1NJZA

Cytosine-thymine mismatch at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njzA01
3I0SA 1WCLA 4XUSA 1WLJA 3WNGA 3L2WA 3E01A 1U48A 4PUOA 2FPMA 3RTVA 4CJVA 4F91B 5DGAA 2DY4A 4CHOA 1B9DA 3RJFA 3QE9Y 5FDLA 2FLNA 1TV9A 4RW4A 4L8RB 2F1IA 3PW5A 1EXQA 2HHWA 1BISA 2FMPA 3MAQA 3VQAA 3T19A 1GOBA 3VQ5A 2VG6A 4KLLA 1I3AA 5I42A 4GXIA 4IQTA 2NRXA 4DQSA 1X1PA 4NLKA 2YKMA 1FKPA 5KFKA 5KFRA 4MFCA 4K4GA 3GIKA 4ECWA 1JL2A 4FLTA 4DTOA 1JL1A 2PYJA 4GXKA 1ZQQA 4KLSA 3OYJA 4HUGA 8ICAA 9ICPA 3RB3A 4NLGA 2AU0A 3AVMA 1EX4A 2P6RA 1S6PA 4MEXA 4KHWA 3K5MA 3ZD9A 2DPJA 1DTTA 3OJUA 8ICIA 4CGFA 2H5XA 4I7FA 5J0WA 4RNNA 1N6QA 4UB2A 2YHBA 4YP3A 3C94A 4M41A 2UVWA 3RRGA 1ASUA 2WOMA 4KHYA 1RT1A 4LD0A 3HSTB 1RBRA 1WNSA 3NCIA 4JWMA 8ICTA 3TABA 1KRPA 1A5WA 3AA2A 5CJ7A 2D5RA 4QWEA 5KG6A 5IILA 5HRNA 3TAEA 4RUCA 4I2AA 2IHMA 3V81A 1G15A 4NYNA 4O5EA 3DLBA 1KVCA 2X78A 1QS4A 2UVUA 1LW2A 3K5OA 1TK5A 3K58A 5KGWA 1RILA 1XSPA 1JLEA 1ZBLA 5KT6A 1Q8IA 5KFTA 3QIPA 4UB3A 2R8GA 2HVIA 4F92B 2BPFA 3MR6A 3ZSZA 3C1YA 3EPGA 4KLMA 2DPIA 4N56A 2OZMA 5BOMA 5DBCA 3GIIA 1YTAA 4QCLA 3U3GA 4I2IA 3VA3A 1SKWA 5HMMA 3VQ4A 4W5OA 4YG2A 3SQ4A 9ICAA 4CF0A 4KHNA 4FM1A 1YTUA 3UPQA 3MDCA 3ZT2A 2HW3A 4K8ZA 4FLWA 3LDSA 4FJ5A 5HRRA 1T8EA 4CGIA 9ICKA 4CFCA 4C8MA 2ZUDA 4IQUA 4KV8A 5J2DA 4FZZA 4ECSA 4M9NA 4YQWA 3DLEA 4FO6A 3RB0A 3IRXA 2R8IA 5KT2A 1RTJA 4ELUA 5SWMA 3RB6A 1C0UA 3UXOA 4QOZB 5DG7A 5HHIA 2OPQA 3VA0A 4J9PA 7ICKA 3CQ8A 4F4ZA 4H8KA 4FW1A 1X9SA 4EBCA 5J0SA 2W9AA 3RBDA 4M47A 1O1WA 1VRTA 1BPBA 4LZGA 4ED2A 4RUAA 4CEQA 2KW4A 4PPXA 4YXMA 1L3UA 1J5OA 4FK4A 2KFNA 1XHZA 4CJFA 4CK2A 3RH6A 2HHXA 1TKXA 2A1RA 1VSKA 5F9LA 1JKHA 9ICLA 2GUIA 4KREA 1R0AA 5KFYA 1HQUA 4CIGA 1JXBA 5KRSA 4JS4A 1TL1A 2HNZA 3HW8A 3VQEA 4J9OA 4KMUA 1RTHA 3UXNA 2JZBA 4I2PA 1U47A 4AHUA 4Q44A 1HYVA 5J0OA 1RTDA 4DU4A 4M04A 4K4IA 3OHAA 1X9MA 4O5KA 3B6PA 4IDKA 8ICLA 2VG7A 3PO4A 4CGHA 3GV5B 2HNDA 1UOCA 3RJEA 1D8YA 1RT4A 4CJ3A 3V4IA 3SUNA 2FBYA 4KLFA 4NYFA 9ICCA 3TR8A 2J6UA 5CY4A 4M3ZA 4BXOA 5J2BA 2C2EA 4CERA 4N41A 1B22A 5DB7A 3HX0A 2VA3A 3L2RA 2MAXA 3VQ9A 4KLJA 3C95A 1HMVA 3DYAA 7ICLA 4R8UB 4E7IA 3RAXA 4RZRA 1ASVA 4M6WB 1CZ9A 4KHUA 1S77D 1SUQA 3NF8A 1S0NA 4I28A 5KI6A 3TAMA 4K8XA 4OPJA 3FFIA 5KFFA 4O0JA 3RJJA 4O3PA 4M9LA 1VK0A 1MSWD 1ZQEA 4F5QA 3V6DA 1ZBUA 4CFAA 4DL2A 1LWCA 2NRZA 3KHRA 1VSEA 4CEOA 1BL3A 1RYRA 3Q8MA 3OYHA 4W5NA 4CEFA 5J2PA 5J2KA 5KFOA 4NXZA 1S9EA 3EYZA 3AO2A 1BCMA 3D45A 3QEXA 4B9LA 3H4DA 4AHRA 3P1GA 4QZAA 3IM1A 1J9AA 2IBKA 4DL6A 3AVCA 3T5LA 4F3TA 4J9LA 3AV9A 5IIJA 5KFVA 1D9DA 3I8DA 4KRFA 3V9ZA 9ICNA 2XRIA 1JLBA 3Q8SB 2YHAA 3H4BA 2OPSA 3PY8A 2BCQA 1HYSA 1ZQCA 3O4NA 4KHSA 1QSSA 4KTWA 2LYHA 5CA7A 3CM6A 1IXRA 2ISPA 4J9MA 4WE1A 4TQSA 1HNVA 3C2MA 5DB6A 1Q9XA 5IIMA 3HPHA 4I2BA 4DF8A 4N76A 3ZSVA 2RDJA 1DTQA 4FW2A 4R64A 5KTQA 1VSMA 1NKCA 3KK3A 3S3NA 4ECQA 3EY1A 2P66A 3OYNA 4KLUA 9ICJA 4NCBA 1WSFA 2ETJA 4HVJA 2R8KA 1C7YA 3HWTA 4ECZA 7ICVA 2D0BA 3OS2A 4E3SA 1ITGA 4EZ6A 9ICRA 4IFVA 4Z6FA 5DG8A 1RDCA 3OYMA 3S3OA 5KT4A 5KFSA 1Z00B 3MFIA 4KKOA 2G8KA 3T3FA 3SPZA 2IHNA 1HPZA 4B9NA 4LY7A 2W9BB 4RT2A 5KFMA 8ICEA 2C2RA 3PUFA 1LW0A 1WN7A 2BQRA 3ZCMA 4FYDA 3V72A 5DB8A 2RPIA 3HP9A 4YMNA 1JX4A 3THVA 3DM2A 4F4WA 2R8HA 4J9KA 3KK2A 5HLFA 4HCCA 3M8RA 3MBYA 2G8HA 2XO7A 5FRNA 3TQ1A 4Q45A 1IKWA 4Q5VA 4DEZA 4RW8A 2BE2A 4JV0A 2KZ3A 3VQ6A 4TQRA 8ICXA 1B9FA 5CWRA 1SKRA 2ZJ8A 4KN4A 3M9MB 2C28A 3H8SA 3QLHA 3HK2A 9ICBA 4AHVA 2ZTEA 7ICMA 4ED1A 1NK8A 3DRRA 5L1JA 2P51A 1Q9YA 3LALA 3MGIA 1ZQVA 4R5PA 3ETLA 4DO9A 5J0YA 2G8IA 2A1JB 4EZ9A 1F21A 2ZTDA 1K6YA 1UT8A 1AROP 1UAXA 4BE0A 3AVIA 4CF8A 1EXNA 3RAQA 2YNGA 3RJKA 2PXIA 3L3UA 1IG9A 4UQGA 1VSDA 3JPRA 1CXUA 4CJLA 3MXMA 4O3SA 9ICUA 2GBZA 4FJNA 1QQCA 4DLEA 1S10A 2GV9A 2BGGA 3MGHA 1KTQA 4QZ9A 3DLKA 1S9GA 3ALYA 2LSNA 3CFPA 4MFFA 1MU2A 2X6NA 4N5SA 4RNMA 1KFSA 3SPYA 4DQIA 1C1CA 3RMCA 1HRHA 4RQ2A 4BE2A 4RW6A 2ZUCA 4YFKA 3DMJA 3TAPA 4Y1DA 2NUBA 1C6VA 4IRCA 5JS2A 3WNFA 4CF1A 3PW2A 2XY6A 4MQ3A 2BPCA 2RDIA 4I29A 1RBVA 4DFKA 2V4QA 4I27A 2V4RA 3Q8KA 1S5JA 8ICHA 2HMIA 4YNQA 3B0XA 1BVSA 3O3HA 3DRSA 3GFKB 1ZYQA 5HP1A 3RWUA 5KG5A 5L1LA 4M0AA 2XCAA 2Y1IA 1NOYA 3QETA 4FJLA 3V7KA 4OJRA 1X9WA 3DLGA 4CJPA 1QTMA 4FLVA 1C1BA 5HROA 3HO1A 4B3OA 1VSIA 4DQPA 4O3QA 5KG3A 3PX4A 1XC9A 2HHUA 3PW4A 3RBEA 3C6TA 2KZMA 1BIUA 9ICEA 2OYQA 4F4YA 3U6FA 1JLGA 4R8UA 4OKEA 1CUKA 1VSHA 3MEDA 5C24A 4DF4A 1DLOA 4DTPA 7ICEA 1VSJA 4KHQA 4CHZA 3GILA 3HT3A 4E89A 3CG7A 4UB5A 4O44A 2G8VA 4XQ8A 2R8JA 3ULDA 1SL0A 2BCSA 1K1QA 5T7BA 1S9FA 4JV2A 1BQNA 5J2FA 4Z6CA 2FBTA 5C25A 4JWNA 5CP2A 4ECXA 3E2EA 1ZQJA 3VN5A 2BANA 4HTUA 3V6KA 5J1EA 2V9WA 3QNNA 4DU1A 4DSFA 3AA5X 5TZVA 1S76D 3HM9A 3TAFA 4GC6A 3KTQA 5CZ2A 3EW9A 3QESA 4ID5A 4MEYA 3U3YA 3NF9A 4IRDA 2YNIA 2XC9A 5DDYA 1ZBIA 3S9HA 4CJQA 5EWGA 2VWJA 3D0PA 2P6UA 4E7LA 3V1QA 4KB1A 2Z1GA 1B43A 3O3FA 4J9NA 1ZQAA 2OWOA 4O3OA 9ICVA 2FBVA 3QZ7A 4KLEA 2BGWA 2ZUBA 5KT5A 1UWBA 4O9MA 3PMLA 4CEEA 1LWFA 1C0TA 3DLRA 4O4GA 9ICWA 4DS5A 3ZDBA 3JPNA 4ECUA 1ZBHA 3AU6A 4FK0A 1RT3A 4QZIA 4DWIA 2DFHA 1T05A 1ZQYA 4ECTA 1ZQGA 3MXIA 3SYZA 3V7LA 4RQ7A 4MF8A 3V1OA 3N4MB 4B08A 1Z26A 4DU3A 1ZQWA 2BKEA 3JPPA 2W8KA 3SI8A 2IC3A 2NRVA 3ZDAA 4KLDA 3H8WA 2Z1IA 3CFRA 1LV5A 3KLHA 4W5RA 1VRUA 4H4MA 4CEBA 1CXQA 3KLEA 1ZQFA 1ZJNA 3G6VA 1C1AA 5BPCA 1U45A 2F8SA 5JS1A 4BE1A 1RT6A 4AHSA 4QZHA 4O3RA 1MQ2A 4YMMA 4E7KA 3Q8LA 4PHDA 8ICWA 2A1SA 1CZBA 4J2AA 1Z00A 3TI0A 2J6SA 5J2IA 1EKEA 8ICSA 1ZQZA 4GLXA 3MECA 4ED7A 4C8KA 3AVFA 4DL5A 1S0VA 4F4KA 5KFQA 2NRWA 1S1WA 1L3TA 4EP4A 4QW9A 3LWMA 2ZTCA 1TGOA 4FLXA 4AHCA 3SUQA 4M42A 1QLNA 3SUOA 5L1KA 3OYCA 1HYZA 4N47A 4KTZA 4B8CA 5IIKA 1S0OA 4Z4FA 1HQEA 2P5OA 1ZQKA 1A5XA 8ICQA 5IIOA 4DL4A 2Z1JA 2WONA 4UAWA 2XHBA 9ICMA 4DQQA 5KT7A 1TVAA 8ICGA 2BCRA 5DDMA 4Q43A 2KFZA 4KLIA 1BQMA 1NJYA 4B9SA 1XU4A 7ICIA 3AA3A 2G8FA 3GV7B 4KTQA 4IFYA 3NE6A 4M9HA 4YD1A 1JLCA 1JIHA 1TL3A 4FZYA 4Q0BA 3M8PA 4FLUA 4DTSA 5J2MA 3NHGA 3OHBA 3K59A 5KFPA 4ED8A 3TANA 3RH5A 2ASDA 3V9UA 3SQ2A 4RQ8A 4F8RA 4DSLA 4J2BA 1CEZA 1RT2A 4KLTA 2ZE2A 4DG1A 4O5CA 9ICQA 2D0AA 4IQVA 5KGXA 5EWFA 4YR0A 4QZCA 4DOAA 3NBPA 2PI4A 4EP5A 4RPYA 3NH0A 3T5KA 4LH5A 4AILC 4HUFA 4PGYA 8ICJA 3P83D 4CF2A 4JS5A 4DTRA 3Q8RB 2IAJA 1S97A 2MUTA 4CGJA 4CHQA 1XHXA 4W5QA 4CGDA 3LPUA 1TAQA 4FJMA 1N48A 4Y1CA 4DSIA 5F9NA 2VANA 4P2HA 3TWHA 2BR0A 4FZXC 3UIQA 3RR8A 4KI4A 3LP2A 4R65A 4YXJA 4FXDA 4I2HA 4CE9A 4Z0UA 1KVAA 2OZSA 5KG2A 4E7JA 4I2GA 3V9XA 1J54A 1T4GA 3H8JA 1FKOA 4FJ9A 1NK5A 4BWMA 2BQ3A 4QW8A 4GC7A 5J29A 4AH9A 3OS1A 2UVVA 3NH2A 1UA0A 2FPLA 2Y1JA 1KDHA 1WSHA 3JPSA 3OYGA 4TUQA 5KFNA 1U04A 4NM2A 3HYFA 4C8NA 3K4GA 1A5VA 4G3IA 9ICOA 3K5NA 4NM1A 3ISBA 3VQBA 3ZSOA 3NF6A 4CJWA 4UBBA 4CK1A 8ICFA 5KG0A 2DFEA 2IMWP 4IQWA 1L3VA 1LB2B 2DFFA 3AU2A 5C5JA 1RT5A 4DTNA 3V7JA 4OLAA 1IH7A 4JV1A 3NF7A 2XY5A 1TK0A 8ICPA 5DK5A 4YFUA 2AQ0A 1JLFA 5DQGA 5KFJA 1FK9A 4QAGA 2X6SA 4QZDA 2E6LA 4UB4A 4B9UA 7ICNA 1D8LA 2JEGA 2AJQA 4ZHRA 4QZEA 3G6XA 4BDPA 1J53A 3T5JA 4O3NA 2XY7A 2XY8A 3KLFA 3AVBA 3FDSA 4YN4A 3H7IA 5KFEA 2ATQA 3AVKA 3PMNA 1B92A 3OY9A 4BXOB 1BPZA 8ICRA 4M9GA 4CEZA 1RT7A 3SCXA 2NRTA 4C8LA 3HL8A 3KD1E 4FJ7A 4B8AB 2QKKA 3BGRA 2W9CB 2VA8A 2Q0ZX 3AVAA 1ZQXA 4E1MA 1TKTA 1N56A 4FBUA 4I2JA 4I2CA 1TAUA 4Z6DA 3DLHA 4RQ3A 3GDXA 4JRPA 2JZBB 3SUPA 4HYKA 5DMRA 4CHYA 3N97B 3KJVA 2W9BA 4FJHA 3NDKA 4R66A 4I9QA 1XS9D 1ZQDA 3UXPA 3QEBZ 2FLLA 4B9VA 5KG1A 5CZ1A 2VA2A 3SNNA 4ED6A 5SZTA 1RBSA 1U49A 2IS3A 4F50A 3OYKA 1JXEA 1I39A 1UT5A 5DB9A 3O4QA 3ORYA 1ZQSA 4DL3A 3ZSXA 9ICTA 4FJ8A 2F8TA 7ICHA 4KLQA 4QZBA 3OYBA 5DKWA 3DI6A 4LSLA 4IG3A 3LK9A 4DFMA 2FBXA 1QHTA 2Z1HA 2B4JA 4J9RA 3ZT3A 4CJRA 2BPGA 4B9TA 3ITHA 3JYTA 4JLHA 3SV3A 4FM0A 3NGYA 5D46A 2ALZA 3UQ0A 4RQ5A 3ZDCA 9ICGA 4XIUA 4GXJA 3ZSRA 2IA6A 4FCYA 2KQ2A 3NGIA 2IDOA 4PY5A 3ZSQA 4JUZA 1T7PA 3PV8A 2Q3SA 3PO5A 2PY5A 4PGQA 4C8OA 7ICQA 1KLNA 2UVRA 1IO2A 5KRTA 4B9MA 3JPTA 4YMOA 4YVZA 3VQ7A 1ZQUA 5KFWA 3QIOA 3K57A 1RDAA 2HNYA 4QWBA 3F73A 3KK1A 4GVMA 3BDPA 5DBAA 7ICFA 1MC8A 8ICVA 3G0ZA 4F4XA 4KN7A 3TFSA 1BGXT 3MABA 4CEDA 1BPDA 1SKSA 4Z4EA 3PW0A 4OVLA 5J2AA 5JUMA 5EOZA 3MDAA 3MR3A 1RXVA 3C2KA 5L1IA 4NLNA 4DFPA 5KFZA 5KFIA 2O4IA 4K4HA 3I0RA 4CFBA 1RBTA 4FVMA 4NCGA 3UQ2A 4KO0A 1BHLA 3LDAA 2HHVA 2RN2A 3IHQB 1EETA 4OLBA 3NH1A 2YKNA 4E19A 7ICJA 2PFOA 3LP0A 4O0IA 3JPOA 3BQ1A 3OYLA 1N5YA 3SZ2A 3SQ1A 1LAVA 4ECVA 4QZ8A 4HUEA 2BQUA 2F1HA 4J2DA 3B0YA 1NOMA 3QERA 5J2QA 2BCVA 1RNHA 3LP1A 2HHQA 3NTUA 1ZJMA 1QE1A 2RKIA 5J0TA 5IINA 2KTQA 3ZT1A 2PFPA 3BQTA 2ZQBA 4FJXA 3K5LA 4LZDA 1IM4A 2E6MA 3QINA 4UB1A 3GV8B 5KG7A 3JPQA 1RBUA 4Z4CA 2AQ4A 3PVXA 4M9JA 4M3UA 4M2YA 3HPOA 4DMNA 4QWCA 2OPPA 4UAZA 3EPIA 4YR2A 3DRPA 4FLYA 1LWEA 3DOKA 4DFJA 4RQ4A 1LAWA 4QZGA 3QO9A 1GOAA 5DQIA 3H40A 1NOZA 4P4MA 5J0UA 1RZTA 3ASMA 4RQ0A 9ICIA 4CCHA 3DOLA 1JLAA 4H4OA 4RW9A 1JLQA 5KG4A 4EBEA 8ICCA 4MFAA 1T03A 4ECRA 3OVNA 8ICNA 3C5FA 4JK1A 3IS9A 4KPYA 8ICKA 5HRPA 4ZH4A 4MF2A 4ED3A 3VQPA 4CIFA 3V9WA 3TAGA 4W5TA 1K1SA 4AHTA 3OYFA 2RF2A 4IKFA 2FC0A 3T5HA 2G8WA 3LANA 3RMBA 2OPRA 1ZQRA 2XGQA 3LZJA 1XO1A 1Z25A 5KFGA 2KZZA 3HXMA 2I9GA 3MEEA 3RJIA 7ICSA 4R63A 4I9LA 1XSNA 3L2VA 4OGEA 2W8LA 8ICZA 1ZQNA 3QEAZ 2G8UA 3M9NB 3C2LA 2B21A 3ISDA 1TKDA 4CFDA 1TKZA 3C21A 3BJYA 1HUOA 2I1QA 1NK7A 3M9OB 1TVRA 3L3VA 1KFDA 1A77A 4XA5A 3HPGA 3EZ5A 3PX0A 1DGSA 1U9LA 5CHGA 1S0MA 3MR2A 1NJWA 4CHNA 4PHEA 4RW7A 2ASLA 4DTMA 3IAYA 4I2EA 5EWEA 3AVJA 4HCBA 3RR7A 3F9KA 5D3GA 2J6TA 4O55A 4ED0A 2XCPA 1L3SA 4IBNA 1IKXA 2MUTB 5BOLA 1KEJA 1EP4A 4DTJA 4ZTJA 5J0PA 5J2GA 5KFXA 4P4PA 5J2EA 3TAQA 8ICUA 1WAFA 1W0HA 3A2FA 3T1AA 5HMLA 2GWSA 4ICLA 4ZTFA 3QEIA 9ICFA 2HVHA 5K14A 5DBBA 1Y88A 3H08A 1D9FA 4E7HA 4CF9A 5CYQA 2M9NA 1IKVA 4CEAA 2E4LA 2PFNA 3LP3A 4BDYA 1DOQA 3PR4A 4CJSA 3SJJA 2PI5A 5CR0A 1RDDA 5KT3A 2W9CA 2QK9A 5J0RA 1WSIA 1CLQA 4ECYA 1S1TA 1ZETA 4PWDA 3KHGA 2KN7A 3V1RA 5KFAA 2B6AA 7ICTA 3V9SA 4RPXA 1NK4A 3ZSYA 9ICXA 1NK9A 2ATLA 5HP4A 4FJJA 1WSGA 4PA1A 3OYDA 2PZSA 4EYIB 2QKBA 4NY8A 4IR9A 1SL1A 5KFHA 3IG1A 5KFDA 3SQ0A 5KFLA 1S1VA 3HVTA 1GOCA 2JEJA 1FXXA 2I5JA 5CB1A 2AGQA 1VSLA 2P5GA 4IRKA 3V6JA 2DTUA 2FMQA 4ELTA 4UAYA 3QEPA 2XGPA 1QSLA 2ISOA 1MQ3A 4EEYA 2YV0X 4OKJA 4M3WA 5DQHA 1TK8A 1RTIA 4FJKA 4QWAA 2ZD1A 2F1JA 1NK0A 4LVSA 2EX3A 3ZT4A 3NGZA 1RPLA 4EYHB 4F5NA 3RJGA 4CJEA 3LAMA 2JGUA 5J2CA 1Y97A 5D49A 4DL7A 1KFTA 4DTUA 3PR5B 2HHTA 1BPYA 3AO5A 2W42A 3RRHA 8ICBA 3KD5E 1YVUA 3L8BA 3VQCA 3AVNA 1BCOA 1REVA 4E0DA 1S1XA 5DLGA 3SI6A 7ICUA 3VQDA 1NKBA 1ZQHA 5C42A 1ZQIA 3M8SA 1JXLA 3QEVA 1L5UA 2W9MA 3FYHA 1VSFA 3OYAA 3NGDA 2PFQA 4LH4A 7ICOA 1XWLA 1WAJA 4Z6EA 1BI4A 3AO4A 3RMDA 3OS0A 3OSNA 4Q8FA 1H38A 5KFCA 4J9SA 2BHNA 3C1ZA 3ZDDA 4PHAA 3GIMA 2YNFA 2ZJAA 3OSPA 3KHHA 3HVRA 4RQ1A 3PX6A 4TSXA 3CYMA 4FLZA 2R7YA 1NJXA 3EWAA 4M3XA 4IR1A 1TV6A 3G6YA 5HBMA 5I3UA 4KLGA 3L2QA 2EHGA 2OA8A 4KLOA 4EBDA 4F93B 5FROA 4KLHA 4CHPA 1HJRA 4PQUA 5HRSA 4PH5A 1IKYA 5J2HA 3OYIA 3RB4A 1SL2A 1SZPA 4FJIA 4RNOA 2HHSA 3OJSA 3RMAA 4YD2A 2DFLA 3KKRA 2ITGA 3AUOA 1BI4B 4CGGA 4DSJA 1RDBA 3ISNC 3AVLA 1JMSA 4FJGA 4ID1A 4QWDA 4DQRA 4X5VA 1KSPA 1D5AA 3HJFA 3M8QA 3O3GA 4FM2A 4TUSA 2QXFA 1ZQTA 9ICHA 3KLIA 1ZBFA 3LPTA 3K2PA 4BDZA 3ZD8A 1BPXA 4CIEA 3B6OA 4M45A 4IG0A 1XSLA 9ICSA 3BQ2A 1UA1A 2FLPA 3WNEA 1KLMA 4Z4IA 2C2DA 5IIIA 4DSKA 4RT3A 4Z4GA 3MFHA 1ZQLA 1A76A 4XRHA 5DGBA 3RH4A 4CJUA 1QSYA 4MFBA 1ASWA 4RU9A 4O5BA 3K75D 4CJKA 3OYEA 4OKKA 2BDPA 2VG5A 2X74A 4Z4HA 1HJPA 1RCHA 5EU7A 1SV5A 1HUZA 1TFRA 3QNOA 3C5GA 3V6HA 3TFRA 4FK2A 4DS4A 7ICGA 4E1NA 4M6WA 1HNIA 3Q8QB 5CYMA 1WSJA 1ZQOA 4I2QA 3GIJA 4CECA 3NAEA 3ZDEA 3AO1A 2A1JA 3NFAA 4F5RA 4I2FA 1ZQMA 3JSMA 3CM5A 3GQCA 1PZNA 2IGIA 1BIZA 1RXWA 3KKSA 4DOBA 4BWJA 3PW7A 3AVGA 1S6QA 1WCNA 2JEFA 4M3TA 1C0MA 4DLGA 2O4GA 4GMJB 3KLGA 4HHTA 3MXJA 4OPKA 3PNCA 3LWLA 3KIOA 4F5PA 4OGCA 4DTXA 2HB5A 2BCUA 5L9XA 3Q8PB 1WSEA 3WNHA 1COOA 2ASJA 2C22A 4PHPA 2JEIA 1JN3A 4F2SA 4F3OA 2D0CA 3L2UA 5J2JA 4KB0A 4QZFA 2ZJ5A 4DOCA 3G10A 5DG9A 5KFUA 2F96A 4ELVA 4CK3A 2AGPA 1S1UA 1KCFA 8ICYA 4NCAA 2JLEA 4P4OA 1U4BA 3MR5A 4G1QA 3TARA 8ICMA 3OGUA 4BACA 4BGDA 1RYSA 4LSNA 3SV4A 2YNHA 4NLZA 2VWKA 4FS2A 4PGXA 5FRMA 1ZQBA 4FBTA 5HHHA 1BPEA 3MEGA 4DSEA 4KAZA 1Z3EB 4KI6A 3VQ8A 4CJTA 4F5OA 1T3NA 2WTFA 4RQ6A 3HP6A 5DLFA 4GW6A 3QZ8A 4KFBA 4Q8EA 3VQQA 7ICPA 5J0QA 4UBCA 1NKEA 4CJ5A 4YCXA 2FPKA 4J9QA 4JRQA 3RJHA 4I2DA 4F2RA 2IOCA 3ZT0A 2PYLA 3KHLA 4CESA 4J2EA 1X2IA 3AO3A 3BQ0A 5D4BA 2P1JA 5KFBA 3P5JA 3CFOA 2AGOA 4KITB 3S3MA 1KVBA 5HNKA 5J2NA 3LAKA 7ICRA 3AVHA 2FMSA 4TURA 3ISCA 4RPZA 3LZIA 4RG8A 4CJ4A 1NJZA 1V9PA 4M3YA 4YR3A 3C23A 4M3RA 1XI1A 1W9HA 3QEWA 4FS1A 8ICOA 1NK6A 5J0XA 4TUPA 3C6UA 1ZQPA 3ZSWA 2B5JA 1YT3A 3AA4A 5E41A
chains in the Genus database with same CATH superfamily
5HQ8A 5H1SV 3VGMA 3H3NO 1FJCA 3Q22A 4H5WA 2FPMA 3CD7A 3RTVA 3DRYA 4CJVA 1HNXF 4X2BA 1NAQA 2ZIWA 1GX5A 2FLNA 2RRAA 2ZDOA 4L8RB 1OH7A 3ZZUA 2YHYA 4EHUA 3T19A 1LKZA 4TY8A 5LL6Z 2VG6A 2IOFA 2ZH1A 4KLLA 1I3AA 4PRFA 4YHHK 2YPYA 5I42A 2HFZA 2NRXA 5ELZA 5JTIA 2QLFB 4ANDA 1T94A 3EZUA 1CBKA 5KFKA 3AL0B 1YDLA 3CEDA 3FM9A 2BZFA 1JL1A 1F44A 1WHXA 1P27B 3OL9A 5ETOA 2PSZA 1GK8A 1Z2ZA 1WHWA 8ICAA 3C6TB 2CWKA 4FPBA 4ILHA 3UCGA 2JH1A 3BSCA 5AZJA 1CLFA 1LWXA 3AVMA 4R0EA 1SIWB 2P6RA 1S6PA 4MEXA 4KHWA 5IOLA 3K5MA 4JI2F 3RU0A 2VQFK 2DPJA 1W97L 8ICIA 2EEYA 1QUPA 2YNGB 2DTJA 2MHNA 4YP3A 2LXUA 3TEGA 2BEFA 2L48A 2MLXA 2BE9B 3AHPA 3BPSP 5RUBA 2WAQF 3WX4A 1QZ5A 1JLCB 2KXHA 1H7WA 1TL5A 3OTOJ 2DB1A 8ICTA 1KXPA 4EMDA 3AA2A 2H3QA 2G2YA 3LUYA 4KT0C 2FY1A 1KL9A 2E1CA 4M5MA 2PDAA 1WI6A 1RT4B 2D5RA 4QWEA 1PJ7A 3MPVA 4U8VA 2WB1D 1NDPA 1KVCA 1GLFO 3NNAA 2AJFE 2UVUA 4NLDA 1LW2A 1T02A 1TK5A 1DLOB 1PC4A 1YI2S 3U26A 1JLEA 2Z57B 5A0YA 1Q8IA 5KFTA 2YBVA 1QVFR 3QIPA 3UDVA 2F4VJ 3CCUS 1J6ZA 2K8CB 4F92B 1S3XA 4H0TB 3C1YA 4NJ8A 4KLMA 2DPIA 4N56A 1U1KA 2H3IA 5E2QA 4DJBA 4ZLLA 2NZ4A 3ILOA 1S5ZA 3U3GA 4CVNE 3MM7A 2Q4TA 1T95A 5ETRA 3CJTA 4QYZK 4C6AA 3CERA 1FXLA 3AAWB 1NBWA 4Y2PA 2O5DA 5D0RA 4ZIVA 2EKNA 5A0LA 2HW3A 4UY85 3HHNB 3ZZPA 3LDSA 1YRUA 1T8EA 4A8EA 4CGIA 2HS3A 3D54A 1EKSA 4CFCA 4C3MA 4BS2A 3CNHA 5AKLA 2VBWA 2HZVA 3ZTRA 3MM5A 4FO6A 3RB0A 2HFSA 2R8IA 2IRUA 1RTJA 3GZ7A 3RB6A 1FXDA 5DG7A 4LF8J 1OPZA 3NS7B 4AD6A 2MKIA 3BBFA 5DJBA 3CJKA 3EZWA 7ICKA 2UU9K 1VQ7S 4OFZA 4F4ZA 4RW9B 4PJ0U 4FW1A 1X9SA 5J0SA 2W9AA 4MKAA 4PZNA 4M47A 4TY8B 2R18A 5A76A 3OUYA 1R7IA 4OZ1A 4I2QB 5F8IA 1X0FA 1MA7A 4CEQA 2KW4A 1FO4A 4PPXA 2IVYA 2E2PA 4FK4A 3D2QA 2DR7A 2KFNA 4QIFA 4CK2A 3RH6A 2GX9A 4U7CA 5K8OA 3ILIA 1O8BA 4C0BA 3J7YI 1N0UA 3W5XA 5LT5A 2HNZA 4JB8B 2FQQB 3VQEA 2XB2D 3VV2B 1FEZA 1JALA 4KMUA 1RTHA 1NGJA 3P4UB 2JZBA 1Y11A 2QLXA 4AHUA 3MPUB 5B8HA 4C98A 3VEVA 5FPDA 1RTDA 1Z2LA 4U7BA 4DU4A 4M04A 3H5YA 1UFLA 1X9MA 4O5KA 3B6PA 4MTPA 2EDUA 3C8YA 3AAQA 1XNRK 5A8KA 2IRXA 3FVYA 4KLFA 4ZS6A 4ZK7M 4NYFA 2LM4A 1ZRMA 4BXOA 3TRGA 2K4HA 2JHDA 3EDQB 1PBAA 2VA3A 3L2RA 2MAXA 2HK2A 2B6AB 4FF4A 1ASVA 4RCHA 4KHUA 1FJGK 1SUQA 3NF8A 3JTPA 5K20B 1K9MO 5KI6A 3TAMA 4K8XA 4OPJA 2BANB 2VJ5A 5KFFA 1WF1A 2I8EA 2C1EB 3QGPA 3OR2A 4O0JA 3QGGA 4O3PA 2BXJA 5HAOA 3NVZA 2AIRB 1ESVA 1GH8A 4CFAA 5AT1B 2NRZA 1JJ2M 3T9NA 1TMMA 2PMWA 2FD2A 3UQSA 2C3YA 1U0HB 4CEFA 1VQPS 3FC4A 1S6PB 2PMZC 1RSCA 1S9EA 3AO2A 4DFDA 2VD3A 2CQGA 4CYUB 1CS4A 1QTNB 2M2BA 4F3TA 1P9YA 2LQ8A 1ELOA 2AEFA 2C3PA 3AV9A 3KLGB 2HRTA 1XR6A 3V9ZA 4EELA 3IBWA 4DR6J 3GR1A 4OZLA 2YHAA 3H4BA 2OPSA 1VQ7N 1WACA 3M6VA 1ZQCA 4KHSA 1QSSA 2WAQD 2HBYB 3GJSB 2HVDA 3I4PA 4WIIA 1QAIA 3MX2A 2X3DA 2JHEA 4W92B 3ETOA 5D78A 4I2BA 1HBUA 4Y0WA 2QC3A 4JD2B 2OANA 4R64A 2NS1B 2W4PA 5JLHA 4IQMA 1LWEB 2P66A 4OZ2A 3I28A 1MN8A 1LEOA 2D0PA 2HF4A 5DM6Q 2LU2A 3HWTA 3HI9A 4C0ZA 7ICVA 4E3SA 3H5UA 5AIAA 2HOFA 4EZ6A 9ICRA 3CDUA 2ERRA 3MDQA 5DG8A 1X42A 1UCVA 2LU1A 9RUBA 5KT4A 1U0SA 1VRQC 3MFIA 3NS6A 3O8WA 2GX8A 1XMQK 3SPZA 2IHNA 3H6EA 2W9BB 2H4WB 3EE9A 3TEHB 2HOIA 4RT2A 1R8CA 5KFMA 8ICEA 4BCAA 2P9SB 1WN7A 2BQRA 1H0HB 2CJBA 4RW8B 4FYDA 3V72A 2RPIA 2YQ3A 2XVTA 1PO6A 3CO9A 3DM2A 4LJMA 4NI2B 4J9KA 1GFWB 2GQCA 5HLFA 4HCCA 3QT5A 4ZVGA 5FRNA 1KBRA 5AQNA 1K8KB 5DDOC 1PJ6A 1OIAA 4IFEA 3MAHA 2BE2A 4YS2A 1WORA 3VQ6A 1B9FA 5HOOA 1SKRA 2ZJ8A 3C66A 3A0BU 3FUYA 1YJ9S 9ICBA 3IN5A 1VQ5N 7ICMA 3A12A 1EZZB 2E8PA 1Q9YA 3MGIA 3QGIA 1ZQVA 2GMJA 3JAMY 4YOVA 3ETLA 3RG6A 2IC3B 3KWMA 4FSVA 4Q7AA 2NXEA 3ICXA 5H9EJ 4OZNA 4I6WA 2A1JB 1K6YA 1JUDA 3RSEB 2FYXA 1RHUB 1AROP 3O8MA 5CH7B 3AVIA 1WWUA 2KICA 1EXNA 4CI0B 3W9HA 1Q7LB 3RJKA 3H0LB 2HHHF 5T7LA 3CCWA 4J9UE 4ZCIA 3DDIA 4O3SA 4C97A 4Y2MA 4FJNA 1QQCA 4G65A 4BRMA 1S10A 3I4HX 2GV9A 2BGGA 3MGHA 3DLKA 2R7TA 5AJ3J 4HDHA 2ZH8A 3CFPA 4N5SA 3UVJA 2KJ9A 1N2XA 4RQ2A 2HSEB 4A8KA 3DMJA 3CCJN 2K89A 3EN9A 1SVDA 1ZD3A 2GHWA 5ALJA 1WSRA 1YIJN 2E2NA 4BC4A 1YUWA 3UCZP 2OO4A 5HN0A 2XY6A 2BPCA 3JSMB 1RBVA 3J7AP 3Q8KA 1TUWA 1T9TA 2F7VA 1FHTA 1ZYQA 2IHR1 2P9GA 3BBBA 3VC8A 3UPFA 3C6AA 4ES1A 5F8LA 3O80A 1GO3F 1HWKA 4ZLPA 3FZFA 2V4JA 4K42A 5C12A 3C28A 4OJRA 2O6KA 3HRDD 4FLVA 2ZH7A 5DETA 1FO1A 1XC9A 4AYBC 3C46A 3U6FA 2HGMA 1JLGA 2HLTA 2Y1LB 4FN5A 1CUKA 2WVEA 1YITS 1LQ9A 4DF4A 2A19A 2ZBPA 3ISZA 3EL2A 2G8VA 4XQ8A 2V8GA 4IOXA 3QNWB 1Y9OA 5T7BA 4NL9A 1RACB 2MJUA 2H3VA 4M5GA 4Z6CA 1R43A 4GKKK 3CT9A 3E2EA 1YJNN 4C1NK 2BANA 3V6KA 5J1EA 2HVEA 1RABB 1QVGM 5F0WA 4DSFA 1D09B 3M1FA 1S76D 2WW4A 5GAGU 3KTQA 4PPDA 1Q82O 4ID5A 4MEYA 2YNIA 1AUDA 3L9ZA 5DDYA 2XMJA 4BR4A 3S9HA 2VWJA 3D0PA 4C23A 3UD5A 2C2MB 2OCEA 1ZQAA 1S1TB 3MCAB 3T1YK 3VR1A 2LMIA 3QZ7A 4KH5A 3IDWA 5KT5A 4O9MA 3GE9A 3BREA 2QMWA 1ZBHA 1CG2A 1DQ9A 3A8EA 3L4PA 1ZQ1C 3B82A 2DFHA 1RTHB 2AYMA 2K8GA 2ZHAA 4E8UA 7AT1B 1WG5A 1SZHA 4MF8A 1ED1A 1DURA 1Z26A 1ZQWA 3SI8A 3H8WA 2WVBA 4K50A 3LVVA 1HNZF 1QHAA 5L8RC 4LF5F 1CJTA 1HI0P 1MLAA 2LYVA 2Z0GA 3OTEA 2ZOFA 4W5RA 4BRKA 5CD4H 2EAOA 3UKUB 1CXQA 3KLEA 3AA9A 4FYWB 3E58A 1L7PA 5BPLA 1RWWB 1RWXB 5BPCA 1U45A 4H4OB 5LMUK 3D2SA 1UETA 4QZHA 4YMMA 1RKJA 3PIOQ 1ATRA 8ICWA 2X1AA 5EVZA 5M1KA 1CZBA 4CZIA 1ECWA 1D0EA 8ICSA 3MECA 5D4NA 2OXOA 3Q83A 3AVFA 4CP5A 5LM7E 2RU3A 2MZRA 2J7UA 1C0TB 1S1WA 1L3TA 4EP4A 2CQ1A 4ZP8A 2ZTCA 5EE1A 4N47A 3CJ2A 5EX0A 5ALVA 4QS8A 2KHQA 2P5OA 1KQFB 3R9LA 2ODGA 2Z1JA 5ALKA 3RZAA 3OR2B 5HMXA 4UOHA 4AQYK 2PA3A 2I38A 2NZTA 2L08A 3T1HK 1SUQB 4C0OC 2W2QP 5E3QA 2VG6B 1NJYA 4DV3J 5KQDA 3D3CJ 3HD2A 3AA3A 1ICEB 5A2QU 3SK3A 2NYIA 3QFHA 3AODA 3NE6A 4M9HA 2PA8D 3AJDA 3L7UA 4BBYA 1JIHA 1ZXIA 5GAGP 4FZYA 3SMZA 2WCXA 2D41A 5D0GA 2LI6A 1VBZA 1X3NA 4FLUA 3NHGA 2HDOA 2DT9A 2GA7A 5K8MA 5KFPA 2V2KA 4FNIA 4RBTA 3TANA 3RH5A 2ASDA 2ZEJA 2E5LF 5CCLA 1GXTA 3TKAA 1HI8A 2Q66A 4O5CA 5HI7A 4IQVA 3BZCA 1N5VA 3IRWP 3I9V9 3O9QA 3NBPA 1L7MA 3IGVA 2PI4A 3W9JA 5AI8A 1FNOA 3T5KA 4HUFA 2E9ZA 1GTEA 3Q8RB 4WU2A 3B4MA 4IJNA 2CA9A 5LMNJ 5ALUA 2N82B 2H3GX 3CDEA 1N48A 1Q3VA 4DSIA 5F9NA 1WSVA 2MZ1A 2DNHA 1A6LA 4RPFA 2BR0A 1JMTA 2VFRA 3W3DA 1QAXA 4FZXC 3UIQA 4BJQA 3RR8A 3ENOA 4KI4A 3IBFB 4FXDA 4RUBA 4I2HA 1SQKA 3QBWA 4JI3K 4Z0UA 3IMXA 4RO0A 3QIDA 4LIRA 3ILJA 4I2GA 4EFHA 2J7KA 1SV0A 1FKOA 2B8PA 3GB0A 1YZ7A 2UYTA 3CCTA 2UVVA 3NVMA 4H5TA 3BEGB 3VF2A 3LDOA 2A0FB 5KFNA 1S72S 4WQ5A 3K4GA 4DV4F 9ICOA 1T6CA 3K5NA 4NM1A 2VG7B 2KHCA 3ZSOA 3NF6A 4CJWA 4UBBA 5KG0A 1HBNA 2L41A 2CJAA 3F44A 2DFEA 3OFEA 4IQWA 2DY9A 4MKBA 4EWTA 4AYBD 4B3MK 5LSOA 1LKYA 1H2TZ 2NR0A 2V8VA 1DBDA 1NSQA 4JV1A 3NF7A 2XY5A 2Q97A 2J9CA 2OD6A 5DK5A 2B43A 3G2XA 1W26A 5KFJA 2V5HG 3RFAA 3TU5A 2DUYA 4UB4A 3GWCA 2UUCF 1ZD4A 1WOSA 4P7VA 2JEGA 2AJQA 1CJVB 3CCVS 2A41A 2XY8A 3AVBA 3D1OA 4YN4A 1JWWA 2O8CA 3H7IA 3IV6A 3AVKA 4ZVFA 1BPZA 8ICRA 3QGHA 4CEZA 4UY8T 2QG9B 4W90B 2OFHX 3UNYA 3DOLB 1ZD5A 3KD1E 5GIPA 2I7PA 2DKXA 3KK7A 3BGRA 4X62F 2Q6BA 2DNKA 2Z56B 3P45B 3PYEA 2Q0ZX 3TUPA 3AVAA 1ZQXA 1TKTA 3R3TA 1XR7A 3GYXB 4Z6DA 3DLHA 4IJAA 3R1XA 5L46A 4CZHA 4RQ3A 4O44B 3VWSA 3CJ1A 2YY6A 2HG4A 2VU5A 3VMFB 1HNWJ 2U2FA 4YOUA 3TUIC 1O51A 1S1WB 4I9QA 2NRHA 3ALRA 2CUYA 5E3CA 3R5AA 1ZQDA 3UXPA 5AQLA 1KQKA 2O8DB 2YY3A 4B9VA 3NGUA 1TP7A 3OPKA 1WDTA 2VA2A 4KSEB 4KHPF 2XZWA 1FE0A 4OI3A 3VQSA 2HMIB 1JXEA 5AZIB 4A8SA 4UW2A 3IM8A 3IFEA 1IXKA 1AYEA 9ICTA 1N62A 4KLQA 4QZBA 3OYBA 5DKWA 2V6AA 3Q23A 4IG3A 3SMPA 1B0TA 1SJ4P 2Z1HA 1RISA 2EXUA 3ENWA 4CJRA 4X4PA 3NVWA 1DEJA 3FSXA 2GTDA 4B9TA 3WT0A 4JLHA 1WUUA 1XMOF 4FM0A 3GOIA 4RQ5A 5HQMA 4XIUA 3SCIE 2Z2LA 1T03B 2OPQB 5GTHU 4P2SA 4B3MF 3NGIA 1Y5NB 3ZSQA 1JCGA 3D0GE 1OVQA 2RQ5A 2PY5A 2MLYA 4PGQA 2A1BA 3F56A 3TOQA 4QS7A 2IM0A 2BTFA 3G4SN 4PR6A 1WKJA 3K57A 1Y64A 2KG5A 3SLCA 4A2AA 1L8OA 1FNMA 2HURA 4UQTA 2RDDA 5GAEP 4NEZA 3G0ZA 4NMXA 5CABA 3TFSA 3ISND 1H1VA 2EG2A 4CEDA 1SV4A 3MMAB 3V2UC 2F8KA 3DGPB 3ETRA 3HHDA 3MDAA 3MR3A 3LGHA 3UM9A 2N1RA 4LVOP 4CD1A 1KS2A 5KFIA 4K4HA 2LQBA 2IJRA 3DDNA 4FVMA 4KO0A 2ZWOA 3S41A 1AQ6A 3W2VA 2ZUAA 3OXLA 2J8AA 4DX6A 2W2OP 5ALFA 4A8OA 1HFEL 4X4RA 1ZTWA 1LAVA 1WC6A 3JSBA 4Y2JA 1SJ1A 4HUEA 4IOAL 4NRTA 1V3RA 1NOMA 3E01B 5GADI 3QERA 1HW8A 5JU5A 2BCVA 3UFCX 1ACMB 1R6YA 3K1RB 2JWLA 4F9OA 1QE1A 3KUHA 2D1CA 3OL7A 2KTQA 1TU0B 3ZT1A 2PFPA 3BQTA 4HI2A 4LFCF 3WXIA 4LZDA 3CD6S 4IWVA 1RTIB 1MWQA 2HBMA 3GV8B 3JPQA 4Z4CA 2AQ4A 2E8OA 4LF2A 1O6XA 1NH7A 3HPOA 4H4KC 4DMNA 3D6RA 1HKAA 2EZZA 2DR5A 2Y0SC 3EPIA 5IM0A 3L4QA 1J27A 1LAWA 3Q0AA 3E8OA 3OW2M 2I7NA 5FIIA 4OZ3A 3QO9A 3BQ7A 5DQIA 4H4MB 1NMNA 3W1YC 4Y65A 2C42A 3ASMA 4EGLA 1ZA2B 1DHMA 2HOEA 3DOLA 1JLAA 1E4FT 4FWMA 1IV0A 4PKHA 4LJXA 5AQPA 5KG4A 3F2DA 2YH0A 2K3KA 3K7RA 4ZOHC 2CNLB 4JKGA 4OJ1A 4MFAA 1EETB 3IS9A 2KJ8A 2KOBA 1VCTA 4KPYA 1X4EA 1R8PA 1RBLA 5E3RA 5IXUA 4JI4K 3I6PA 1AXQA 3TAGA 4W5TA 4MT1A 2YVSA 4AHTA 1WC0A 2RF2A 2VOOA 2VQEJ 2FJVA 3HILA 3RMBA 1V3SA 2GJFA 3CCES 4K59A 2DEIA 3O1BA 4PL8A 1JI7A 1EQMA 1XO1A 4ZVSB 1MNEA 1Z25A 3H98A 5KFGA 1YBUA 3MURP 4NOHA 3WKCA 1RAIB 2F8LA 1NGFA 3MEEA 4CRXA 1LW0B 7ICSA 3DV9A 3MM8A 2DRDA 2NSCA 5J1NA 4YEAA 5AM4A 3BS7A 3MCNA 1BMQB 1VAZA 4JYAF 1U2VA 8ICZA 1B0PA 1PJ5A 1ZQNA 2A6AA 3SBMA 3DLLQ 3M9NB 3M05A 2DNZA 4TKTA 3VCDA 4TU8A 2KVIA 2LCWA 1SJQA 3MR7A 3N01A 4CFDA 1UAWA 1TKZA 4MO5A 1TVRA 3CJSA 1A77A 3CETA 1NRKA 2KI2A 1U9LA 5LJWA 5C25B 1B64A 3KNGA 3SAFA 3N4QA 5L38A 5CHGA 1S0MA 4CO3A 1ZM3A 1QVFM 2RE1A 3IAYA 4I2EA 3R5JB 3OBIA 2CGLA 2FC8A 2PO4A 1T9XA 3F9KA 1ZPVA 4OL8A 1L3SA 1B70B 4U8YA 3DHXA 3S8SA 3JB9k 2DWQA 2KSOA 4DL0C 2CZVC 4ZTJA 5J0PA 5J2GA 3UNGC 4P4PA 8ICUA 1WC4A 2YJEA 3C65A 2WSFC 3A2FA 3ZZ0A 3O4WA 2F40A 5IS2A 4ZTFA 2FGCA 3QU9A 2HVHA 5K14A 2OEHA 1D9FA 2W11A 4E7HA 2J9DE 2F8EX 1RCXB 2M9NA 3E9OA 2UXDF 2PFNA 4BDYA 3PR4A 2HQFA 4YY3F 1RDDA 3BKUA 2BZ2A 3DU5A 2QK9A 2IRYA 1YJVA 2QKQA 4ECYA 4LF4K 4HT5A 4CF3A 1S1TA 4UY8O 2UXCK 3VGVA 4LF5K 3W5ZA 4GO7X 3JXOA 3QAUA 1X4AA 2B6AA 2EQYA 7ICTA 3V9SA 1NK4A 3DC2A 1TQLA 2LKYA 2KL8A 2ASOA 5HP4A 2ZJQL 3ENHA 5DDQC 2QKBA 1S59A 1NDLA 5KFDA 1NM1A 3OLAA 5DS7A 4ZPDA 2WUSA 2H4YB 3HVTA 3DRXA 1M1HA 2QB0A 2K4PA 3ZZYA 4A62A 1QH9A 1VSLA 4MLHA 3EJMA 4IRKA 2XGPA 2QL7B 1FKPB 3U7JA 4ILGB 4EEYA 1CULA 3ZZTA 5DQHA 1TK8A 2WOMB 2V0NA 4FJKA 4K5SA 1JCEA 4YB1P 2ZD1A 1NK0A 1QCKA 4FP9A 3ZT4A 3NGZA 1RPLA 3FGUA 1VQ4N 4CI6A 1VLOA 4UAUA 3M3ZA 1HHQA 1QZ6A 1Y97A 1FKOB 2IM2A 3NKYA 2G4BA 4DTUA 3PR5B 1BPYA 1RT6B 2W42A 3HVAA 4NWIA 4R5PB 3J81Y 2RF2B 3OTCA 3CWJA 3FRYA 2UXBF 2OMOA 4JV5F 4EU0A 5EE0A 1YQHA 2VKRA 1FT8A 3JS6A 2H3ZA 7ICUA 2QWLA 1Y0HA 1HLUA 1L5UA 1GX6A 3VGUA 2LEBA 1VSFA 4ZVQB 3HOSA 7ICOA 3LGNA 1BI4A 3RMDA 1VJ5A 4HHHA 3AA8A 1CC7A 3GTYX 3QFUA 2BHNA 3C1ZA 3CJBA 2YQEA 1G2EA 5CRXA 3WEEB 3NBPB 1YXQA 2UUAJ 1E4GT 3F2BA 3UVJB 2Z7JA 3HVRA 2E1AA 3CYMA 1R8AA 1NZPA 4LF4F 3EWAA 1RAAB 4M3XA 1T44A 2E1FA 2EFPA 2YKMB 1MWZA 1SS6A 3W60A 1X0PA 3L2QA 2FJ6A 4OJLA 3HZEA 2EHGA 1HLWA 1ZH5A 4EBDA 5FROA 4KLHA 2YTCA 4PQUA 2DK2A 4YHHF 4ENOA 1RG6A 1IKYA 1SC4B 3TADC 5J2HA 3BSNA 1SL2A 4A8MP 4GY2B 2HHSA 2RHQB 4YD2A 1S6UA 2X3GA 3FBFA 3G82B 2ITGA 2Q0RA 1ZBTA 2GVDA 1DRGA 2KRBA 1M5VC 5F41A 1MG7A 4DSJA 3I5CA 1F1BB 3ISNC 4FJGA 2RP5A 3BF4A 4ID1A 4QWDA 3Q89A 4X4UA 4DQRA 3HJFA 3O3GA 4FM2A 2M0GB 4NX9A 3HOTA 8AT1B 2F4FA 2E5IA 1ZBFA 3LPTA 2ZWHA 3S6JA 5CYMB 1SV0C 3QU5A 4CIEA 1VI7A 3J80Y 2HI0A 2HMPA 2Y9TA 1UA1A 2FLPA 3VGKA 1KLMA 4Z4IA 2L3MA 3UN5A 2GEMA 3MC1A 4DSKA 4RT3A 2B6GA 3GBTA 5CZVA 3CCJS 5G5HA 3MPYA 4PABA 1L7OA 2AHOB 3O1LA 2YNHB 1ASWA 1CC8A 1LWCB 2CYYA 2YWWA 4NXMF 5M1NA 2YPZA 1H2UX 2WB1C 4JI6K 2ZM6K 3TA1A 2FY8A 3PYFA 2E8AA 2MQLA 2ZXHA 2EZXA 2BDPA 1RCHA 4XH5A 4C11B 5IT4A 4V19J 3M32A 3J81O 3H90A 3P49B 1BC6A 2WTUA 1VDHA 2OPPB 3FJ2A 2A42A 3TA2A 1K0VA 3W2WB 5HMZA 2ZFHA 5F0UA 3DLGB 1H72C 3L3FX 3NFAA 3MPDA 1UTAA 4F5RA 3UE5A 4I2FA 4CNZA 3JSMA 1FEEA 1F9EB 1PZNA 1V38A 1VQ6S 1BIZA 1RXWA 4DOBA 3AFGA 4L3QA 4IZ9A 3MCSA 3J7AN 2Q1LA 2EAMA 1S6QA 2KKHA 2JEFA 3FZLA 2O4GA 3FZMA 4JD2A 4KGVB 3MXJA 3LDQA 1KP6A 4QIWC 1VQLN 1HWIA 1VJQA 4DXLA 4F5PA 3QSIA 2IYIA 5BR8F 5AM0A 3H25A 3LP2B 4CT9A 2ASJA 3Q8YA 4ZMMA 3G6ES 4BG8A 4LF5J 4DV3K 1JN3A 2F7TA 4F3OA 1K0TA 2M88A 2P9PA 1KW4A 3O9RA 4QU7A 1IWAA 1V5IB 1FW6A 4KB0A 4W4MA 1FCAA 2ZJ5A 5LJ3Y 4DOCA 4DR2F 4WXOA 1RWPB 3GU0A 3J7ZT 2D3O1 2BJ8A 2E66A 4ELVA 2F96A 1S1UA 1WBBA 2FVSA 2DHXA 4NCAA 5ALHA 2D9OA 3MR5A 2JLFA 4WFAQ 1G1XA 2ZJPL 1AZSA 2HQGA 4BACA 1RYSA 2CQHA 2YNHA 5K9FA 1MMNA 4CDGA 2YKAA 4DX5A 2VWKA 5FRMA 1ZQBA 4FBTA 5HHHA 4F26A 2XMKA 3IFRA 3F0NA 3CF5Q 3CE8A 1Y7PA 2OPRB 4KAZA 4KI6A 5ALRA 2XZDB 4CJTA 4Y34A 4F5OA 3QB0A 5AKJA 3EXCX 3KJVB 3HP6A 1XQIA 5L9NA 7ICPA 2GHPA 4U7UD 1NKEA 2FPKA 4JRQA 3RJHA 4I2DA 2HMXA 2BKOA 2NSBA 2IOCA 4LF6K 2MHEA 3ZT0A 2PYLA 2VASA 3G8QA 5BYSA 1JB0C 1X2IA 4P0QB 3AO3A 2CPRA 5D4BA 2P1JA 1BQMB 4NA1A 1W25A 2I6XA 3KUEA 4KITB 2MRLA 5ETPA 1FK9B 5J2NA 2ZZTA 2CDQA 3TSPA 1G3OA 4NLTA 4BREA 5JVHL 5A8RA 4TURA 4JK9A 5HL7Q 4RPZA 1Q79A 1NJZA 2VC1A 1V9PA 4JOUA 2CNNB 2QFIA 3D0HE 1D8BA 3VPZA 4FOIA 5CZXA 2B56A 1XI1A 4OYPA 4HHJA 3MMVA 4MAKA 8ICOA 4G1QB 3D9BA 2FVRA 1NK6A 4DUZF 4TUPA 1Z05A 3C6UA 1MWMA 1T3OA 2CQ3A 4PL2A 2B5JA 4BQZA 1K47A 2WRMA 2KXNB 2YWFA 3I55N 1WCLA 3UMCA 2YKNB 4XTTA 4XUSA 2ILYA 3WNGA 4V19X 4HTLA 1HA1A 1U48A 1JJ2R 5EDWA 4DR4K 2W2PP 3OBWA 2F9WA 4UB8U 4F91B 3KG1A 2OH2A 1PGZA 3TA0A 2QA2A 2M3DA 1GLCG 5M1OA 1U6ZA 4OI6A 1U24A 2F1IA 2C3UA 1WWHA 3D66A 4OYOA 3O5BA 5G5GA 3E3XA 3VQAA 2ABYA 4JI1J 1GOBA 2KU7A 4BQLA 3J7A1 2QWMA 3CCQN 3IP4B 4TYBA 3LL3A 4CWBA 2UUCJ 3QMLA 4HWIA 4PG8A 2GJ2A 4IDHA 1JLBB 2VQEK 1X1PA 4I69A 4NLKA 4NLYA 1OQ3A 4MFCA 5KFRA 1Q0NA 4YB5A 2EK6A 1OPIA 4ECWA 3CCRN 4TY9A 3MOJB 3OYJA 5ADXA 3LQVA 1I6JA 1EX8A 2HGNA 3RB3A 3LH2S 1WJ9A 1VC6A 1NPKA 4Z7CA 3DXKB 3QUTA 4CD3A 2FXUA 2GMLA 3ZD9A 4CZGA 4X4SA 3K0JA 4C3LA 3IO1A 4I7FA 5J0WA 4BRPA 1GT8A 1WOOA 5CD4A 1VQMN 2QYCA 4JI7J 1KWMA 3L09A 1RT1A 1NJIT 2ZH5A 3CCSN 1LK7A 1XN9A 3M6KA 3C29A 3AJ1A 1A5WA 3MEKA 1F5SA 2WBNA 2K7JA 1G4CA 3KLEB 4C80A 1RGVA 3WZ0A 4DV7K 2DHGA 2ZIVB 1VQKS 3DLBA 1R27B 2KEYA 2X78A 2Z8QA 3IDHA 1RU1A 3K5OA 4CLZA 3OL8A 4DV0F 3K58A 3OTQA 2RVJA 1QJHA 5KGWA 4OMFG 1RM6C 1RJJA 4WF9Q 1ZBLA 2DKZA 4UB3A 1QVGR 4B1XB 2R8GA 1UVMA 3KKAA 3ZSZA 5F3XB 5AQJA 2UXDJ 4MIBA 2OZMA 5DZ7A 4I6MB 5DBCA 2O8EB 3GIIA 1PC5A 3DHWC 3UN2A 2BACA 3TZYA 3GZFA 1SKWA 5IC4B 2VYPA 3BGLA 9ICAA 3N79A 4FM1A 3CPEA 3HVWA 4B3OB 2A10A 3UPQA 3MDCA 1AA1B 1S49A 2QM1A 2E44A 3VCBA 2RD5C 4C8MA 4CE6A 4IQUA 4FZZA 5J2DA 1D1UA 1QAYA 1F2HA 4NLQA 3DLEA 1FI4A 2OPSB 3MUVP 3JQKA 5KT2A 5IWAK 4ELUA 1UVKA 3GIRA 4IOBA 1C0UA 4QOZB 1VQNN 3FFIB 5HHIA 4K25A 4OX7A 4A8WA 3EKUA 2VQEF 4FZLA 1IKWB 3TX8A 3RBDA 3E9LA 3C19A 3ULEB 4WFNL 2OHFA 4PG4A 1PYOB 1B3TA 4RUAA 2CGJA 1XIQA 4YXMA 4ZN3A 1J5OA 3IBCB 3PLAA 4K4TA 5EOYA 2ITMA 3NRZA 3HKZC 1Z1VA 3DDHA 4DQ8A 1S8OA 1FNXH 1R0AA 3MUMP 2XSJA 2KVQE 1B99A 3EGVA 1JXBA 4M5LA 5ALNA 2VC0A 4DMZA 3MM6A 1TL1A 1SAZA 2KYXA 4WFYA 2LQ5A 2Q0UA 4YB6A 1VQ9S 2CNKB 2P9IB 2WB1F 2DNNA 1HYVA 3CXCM 5J0OA 3SFGA 2YH1A 1QQNA 2PFUA 2GCFA 1ZZFA 4IDKA 3IWXA 2KXFA 3B6BA 3PEJA 1UOCA 4EIAA 1HNXJ 3CUNA 3SUNA 2FBYA 2GV1A 9ICCA 4K4UA 2YX7A 5CY4A 4M3ZA 4M1KA 1IBMF 4N41A 5DB7A 5K8PA 1T3VA 2V94A 7ICLA 4R8UB 3RAXA 3DU6A 1OUQA 1CZ9A 3THXB 3WC0A 2QWPA 4OYBA 3N4PA 3I5AA 1MWKA 3U9DA 4B1UB 3DXSX 1XNRJ 3T9ZA 5F8HA 5AFUA 4R79A 4M9LA 2KIVA 1MSWD 1JK9B 3ZZZA 1ZQEA 4F5QA 3BM7A 1Y00A 1KVKA 3N5FA 1HHTP 4CEOA 1BL3A 3J81U 1RYRA 3Q8MA 1U02A 2BBEA 5A2QO 3UCUP 4P10A 5J2PA 4K4VA 5KFOA 2W55A 3GCWP 2AP1A 4BRDA 1U1QA 3EYZA 4EK2A 1BCMA 3H8MA 2KP7A 3H4DA 3B9JA 2VFUA 2EBEA 3BH7B 3ZNJ1 2UUBF 1VIOA 4MH8A 2ZNYA 4J9LA 1HKCA 5J8YC 2DGQA 3VAFA 3SBGA 3G96A 3I8DA 5CAAA 4KRFA 9ICNA 3EGNA 4WJBA 3ETMA 4L3KA 3Q8SB 4N77A 5BREA 3SAHA 2YX6A 4CRJA 2RT3A 1ATSA 2KVSA 2GWKA 4IO1A 3EE3A 3CM6A 4OCZA 5H1SQ 4JI2J 4WE1A 3W7BA 2DIVA 3RVCA 2W2MP 2CG4A 1MROB 3HPHA 3ULHA 1DKGD 2CPXA 4N76A 4TN2A 5KAFU 2RDJA 5B09A 1I51B 4MK9A 3ENBA 4LF7K 2LYAA 7FD1A 1FE4A 3NOGA 2D7SA 1AUSL 1EB0A 4CZKA 2AEJA 1GEHA 4MIAA 1YHQS 3SCLE 9ICJA 1VHFA 2EI5A 5LMUJ 4HVJA 2R8KA 3BSOA 4ECZA 3CJ8A 3H59A 2IDLA 2BJ1A 4IEEA 2VPYB 2FZGB 2VJ4A 1QD1A 1FWLA 5AI0A 3PJ9A 4Z6FA 4YORA 3PNIA 3OYMA 5CCMA 3R1HA 2NO4A 3QRPA 4JI0J 1SV5B 1ZOTA 1RWUA 5CHIA 1HPZA 1N36F 2AJ1A 3GFZA 1PK1A 2C2RA 3PUFA 3ZCMA 4KHPJ 4LVNP 1DY3A 1KOOA 2GHVC 1A9NB 3TUZC 4BY9C 2XYGB 2R8HA 1XQSC 1BWFO 3KK2A 4DR7K 3M8RA 2G8HA 2XO7A 1OY9A 5ALWA 3I0RB 1IKWA 1Q82T 4DEZA 4CF5A 4QNLA 1RHQB 3EXYA 4CZLA 3CCMN 5CWRA 4NLRA 2V2VA 2DNYA 2C28A 3QLHA 4IFYB 2KYZA 3TTDA 2ZTEA 4F0MA 1NK8A 1RUSA 5E7OB 2ZIUB 2P51A 2D9PA 3FFKB 2G0AA 2KO1A 4R5PA 5EHHA 4DU7A 4KE5A 4PUOB 3M2VA 1OY6A 5AQIA 1MN7A 1UT8A 3LPYA 2B51A 3TZWA 1BQXA 4BE0A 2PC6A 5L1MA 4P73A 3RAQA 1NU4A 2LXFA 3L3UA 5BYQA 4OX9J 1CXUA 3H1VX 3I33A 4GKJJ 4F25A 3MXMA 4JI8K 2JRSA 2Z2YB 2GBZA 3N7RC 2ZJPQ 5J2MB 4QZ9A 1S9GA 1N34F 3FSYA 1ZPWX 4QIVA 2LSNA 4KRWA 5KOXA 2X6NA 3VQTA 3HM8A 1WF2A 3HHKA 3HSGA 4RNMA 4A8XA 1E6YB 1FTCA 4EUVA 1C1CA 1HRHA 3VOVA 4RW6A 2F3NA 2ZUCA 1YAGA 3TVZA 1JJ4A 5BN9A 4ZCLA 4Y1DA 2NUBA 2K2PA 3H0MB 4IRCA 5ALYA 3CC4N 2XULA 2C2OB 3ZO7A 5JS2A 2AT1B 5ETQA 5GAGI 1FJ7A 3D1QA 2FPHX 2RDIA 4I29A 4DFKA 3M2RB 2EVZA 1NGBA 4PWUA 5LMNF 8ICHA 1XEZA 1URJA 2HMIA 2YKOA 4OV6A 1JCFA 4YNQA 3KKFA 3O3HA 3DRSA 5AE2A 5L1LA 2XCAA 2XYHB 5A8KB 3QETA 4JHDB 1M6YA 1S12A 4WP3A 1Y10A 3CIPA 4FJLA 2NPIA 3V7KA 3ENAA 1V85A 4CJPA 4B3OA 4BRQA 1P9QC 3GSIA 4ES3A 2HRYA 1VSIA 3QNMA 4S0MA 4O3QA 5KG3A 4DQPA 4DV6F 2HHUA 5AE1A 1NLVA 2N4DA 2CPHA 2D3UA 3MEDA 4DU8A 5C24A 5AQMA 3GP9A 2KJWA 3HSDA 2KHDA 1VSJA 4YUDA 3M1YA 2OTJS 1H6KX 1UW9A 4LMZA 4AFFA 4UB5A 2BE2B 3UMBA 3ULDA 4ATNA 3G71S 5J2FA 4B3SF 3KLFB 4YMEA 3CCQS 5CP2A 2O8CB 4G9BA 2YHWA 2N7CA 4I56A 4XH1A 4E2FB 2UUTA 2NREA 4JKBA 3AA5X 4BR5A 4GC6A 4BVPA 2OTLS 3QESA 2CJXB 3VEWA 4GKKF 3W9IA 4Y2SA 4IRDA 2XC9A 1U25A 5CXTA 2H5IB 1DK3A 4NPOA 2P6UA 1EQYA 3V1QA 5GAEU 2Z1GA 1B43A 3QATA 2I2YA 3DXMA 2OEMA 4KGZB 1SIZA 5KOWA 5H2FU 3I55S 2DKOB 1VQON 1UWBA 4O4GA 2YN4A 2XM3A 3IMQJ 4LQ3A 4ECUA 3D6TB 4QZIA 4GKKJ 2ASMA 4UOFA 1ZQGA 3IP0A 4FWRA 3V7LA 1F6TA 3OLBA 1WEZA 3V1OA 3N4MB 2D3OR 3JPPA 2G2OA 4Y2CA 5H9FJ 4EO6A 2LDIA 3ENVA 2DH7A 4CZMA 3DLJA 3M1VB 5KL1B 3C3LA 2CAJA 4OX6A 1LV5A 3TW0A 2YX4A 3HFKA 1PYTA 3PJXA 4CEBA 1FJEB 3ZZOA 3I1YA 2ZWPA 2ZH3A 3G6VA 4C9DA 3EGZA 1YZ6A 4M95A 1RT6A 1BWVA 5IT9U 1IQZA 2R2UA 4E7KA 5BPMA 3AEVA 4FYYB 5C42B 2ZOMA 3CJ5A 3GFXA 1N32F 1Z00A 1KQSR 2M8DB 3QBXA 3JQMA 1ZQZA 1KQGB 4GLXA 2HRUA 4RW7B 3FR0A 2DR8A 4C8KA 2F2AB 1C0GA 4DDFA 1VOMA 1V5VA 3BEXA 2AH5A 2NRWA 3ATVA 2DVIA 2XHWA 3SUQA 1KEKA 1QLNA 1HYZA 1IBMK 4KTZA 4B8CA 4WZQA 5IIKA 1N0VC 1RI7A 1S0OA 1UCNA 3MMBA 1TTHB 2QMXA 8ICQA 5IIOA 4DL4A 2CG8A 5AXKA 3VAGA 5AXNA 3PZPA 9ICMA 4DQQA 2B9WA 2QL5B 3HMJG 4PCQA 1BQNB 4Y28C 3ZFVA 4KX5A 2DEJA 4LIWA 2OLWA 2MZJA 2HQCA 4NL5A 3P39A 4BGBA 2P9LB 1BQMA 5A8WB 1FDDA 4AL7A 1DGKN 3PRDA 2EFGA 3GV7B 4KTQA 4IFYA 4JI1K 4M7YA 2QA4S 3AMZA 1JLCA 3TZZA 3PRVA 2PFFB 2HIQA 1RDWX 1CVJA 4Q0BA 2OEJA 4UF4A 4ZA1A 3M8PA 4KHRA 2KJ5A 3WX8A 1K8AT 2V50A 5J2MA 1XO0A 1H7XA 4BRFA 1TYQA 2ZJRQ 3MX5A 1FWPA 2B8QA 3QU7A 1X4FA 1VRUB 1YIJS 5BYRA 3B8AX 4RQ8A 2FTRA 1CEZA 1RT2A 2CDRB 1UVLA 2NYVA 2CPYA 2DCUB 4RU2A 5KGXA 5GIOA 5EWFA 2G2ZA 3D2EA 1NGHA 4DOAA 3M6XA 2OMLA 5BN8A 4FZNA 3MM9A 2BRKA 4P6QA 3PIPL 3CDWA 4RPYA 5ETTA 4AILC 1C20A 3HSZA 3P83D 4CF2A 4DTRA 2O8DA 4DCHA 1UVNA 2IVPA 1U1LA 4CGJA 3DRSB 2W01A 3GG1A 1V6HA 2GQQA 4XO0A 4LF7F 2F44A 2R2SA 1TR0A 5AR0A 5D77A 2NQPA 5IV4A 1LOTB 1VRTB 2VWBA 4D3HA 1DK2A 1WELA 3LP2A 4YXJA 4N7TA 2R7RA 3MN6A 2KLAA 3V4MA 1KVAA 3IAM9 2OZSA 3BO3A 4E7JA 2A6MA 1SQFA 5F0XA 1NK5A 2BQ3A 4LF6J 5J29A 4AH9A 4WTOB 1ZA1B 4I2PB 2HZCA 3F53A 4C7ZA 2Y1JA 4WKYA 1JJCB 4NM2A 3HYFA 4WFBL 3A3NB 1J2NA 3ISBA 5IQQA 3VQBA 2ES6A 8ICFA 1N33K 2IMWP 2JH7A 3BH6B 5AE3A 1DGJA 1LB2B 1Q5YA 3OPXA 3AU2A 4P52A 4QIWD 2E5JA 1XJWB 2FDNA 5DZ6A 1TK0A 8ICPA 4YFUA 4PKDB 1JLFA 1KKHA 2WFBA 2CZ4A 1FK9A 4RL1A 4IOAQ 3HJEA 1R3NA 4US9A 1D8LA 2DGZA 4A47A 1YJWS 4QZEA 4K2JA 2ZBIA 4DUZK 3VTHA 4DR2J 2XY7A 2F9JA 3KLFA 4K4XA 1SIJA 1JNZB 2IVOA 1R8BA 4Y6IA 2ATQA 1NDCA 3PMNA 2PD1A 1KD1T 1B92A 4ISEA 4WE1B 1GLDG 3AM9A 4M9GA 2UXBK 1RT7A 1KAXA 2NRTA 2A40A 5HP1B 3N7PD 2ASPA 5EE3A 3RYLA 2W9CB 2VFSA 2DF4B 4E1MA 4GRSA 4M5NA 4ANEA 1TAUA 3D6FB 2ZNZA 4BX9C 2JGAA 3R27A 2O01C 3SUPA 4WFNQ 4CHYA 4FPAA 3AN1A 4A8YA 5GADP 1SH2A 2U1AA 4RKUC 3GE1A 1S7HA 3OVBA 3FEZA 4L74A 2KT5A 3QEBZ 4Z7YA 5ETKA 5JMVA 1APSA 5CZ1A 3MXHP 1I94K 1WF0A 1RBSA 3D67A 1U49A 1EHWA 1DTQB 1KQQA 3IC1A 1O13A 3OYKA 4K41A 2JX2A 4A2BA 3BF1A 5DB9A 3IM9A 4Z2XA 3R1LA 3ORYA 5IFMA 1ZQSA 4DL3A 3ZSXA 4FJ8A 7ICHA 1R0BG 3DI6A 2VB6A 3OTDA 4KHPK 3EM1A 3PJWA 2MKJA 1PVQA 1RHRB 3WQPA 2FBXA 3CMAN 2B4JA 4QU6A 2HFVA 3GR0A 1V97A 2KK0A 4NLXA 4N8OA 1REGX 3FCWA 2EWSA 1VIXA 4JI8J 3SV3A 3VF4A 3CC2S 3NGYA 3HZ6A 3UQ0A 3ZDCA 2QN6B 4GXJA 3AQFA 5GADU 3ZSRA 4PY5A 2FB0A 5D4OA 2NLXA 3PV8A 2GOLA 1QDUB 2R7OA 1NZAA 2QW9A 3UB5A 4C8OA 7ICQA 2MQ8A 2UVRA 5KRTA 3SIPB 4B9MA 2HS0A 4CH0S 5KNIA 3JPTA 1HKBA 1Q4RA 5HVGA 3VQ7A 3QU2A 4U6PA 1U09A 3QIOA 1RDAA 3NAHA 4QWBA 3MD1A 2W41A 5CYJA 5J2NB 3IA0A 2DO4A 4GVMA 1XNRF 5DBAA 4MDAA 7ICFA 4IG0B 2KDOA 4KN7A 2ZF5O 1KOHA 1VMBA 2CRLA 3IBPA 5EOZA 4OHYA 4ZCMA 4AYBF 3J7YP 3NAIA 1Q81T 2VZ9A 4OQJA 4NLNA 4DFPA 1P1TA 3I0RA 4CFBA 1RBTA 4UB6U 3HI0A 3UQ2A 2OGUA 3NGRA 3HKZD 3N6MA 4OPAA 2BX6A 2GZOA 2RN2A 2MKHA 2YMPA 2W54A 4OLBA 3A1YG 4U67Q 3LP0A 3JPOA 1N5YA 2HOQA 3OYLA 2F1FA 2GQ2A 3SQ1A 4ECVA 2XMWA 4EO8A 4ILMA 3O5TB 4F36A 2BQUA 4XEIA 4J2DA 3T1YF 3MN9A 5EX5A 4BRIA 4A8FA 2N4CA 2RS8A 5GAHU 1I94F 2HHQA 1RT3B 2O67A 3BZQA 1ZJMA 4TYAA 2MSTA 3ET6B 5J0TA 5IINA 2OELA 4GVEA 4FJXA 3TZXA 2R7WA 3W62A 4URSA 2R7QA 4DPYA 3QINA 4UB1A 3ZTOA 2JC0A 3DKDA 2V8DA 4M5DA 4CQ1A 1URNA 2W7PA 1HARA 4DR2K 1WD6A 4QWCA 1OW5A 1KAZA 2CPJA 1Q16B 2MSNA 4JKAA 5B0AA 3DRPA 2E8MA 3MD3A 1LWEA 4DFJA 3H8YA 1WG1A 2Y9HA 4PZOA 2V2ZA 1HNZK 4NXNF 3J81j 2MGZA 3QWPA 5A8RB 2F3JA 3H40A 2Q3PA 2NXUA 1VQ5S 3PYGA 2PMZF 9ICIA 4J90A 4H4OA 3BR9A 4EFAC 3JYTB 4DV2K 1NZBA 4GNIA 3GFYA 3MWBA 4HDGA 2LECA 3RRKA 3GFHA 8ICCA 2KM8B 3MMCA 3T6JA 4DV5K 4LBPA 3C5FA 3M6WA 4QJFB 4B02A 4LR7A 2DGUA 8ICKA 4YB7A 5HRPA 4ZH4A 4ED3A 2V68A 4HL9A 4R0JA 5AK3A 3SAGA 2LEPA 3FQKA 4H0OA 3IUCA 4ZPAA 2RRDA 1M1KO 1QQ6A 1WEYA 3LANA 4OIXA 1HBMB 4DV2J 2KHOA 2Y0BB 2IJNA 3LZJA 1T3QA 2V9KA 4CO0A 3HXMA 2BW2A 3R5GA 2WZ1A 3RJIA 4NWBA 4O4RA 1HD1A 4FYXB 2CPDA 2RAQA 3VAMA 4L6V3 3U4LA 2G8UA 3OW2R 4B1ZA 4DR1J 3AQOA 2B21A 3GYNA 3Q7CA 4IUFA 2Z30B 2E5HA 3PKYA 1NK7A 1HUOA 1SI9A 4GVBB 1SKUB 2GH1A 3A4TA 3HDSA 2CXYA 1SJFA 1RAHB 2DHAA 2ZOGA 3AY9A 3H1QA 4LFBJ 1L3KA 3A8YA 3MR2A 4HHUA 1EP4B 1O08A 1VBYA 1HWJA 1P8ZA 5EWEA 1VK8A 5DO2A 3AVJA 2J4RA 4HCBA 5D3GA 5AQRA 1XERA 4TVAB 2J9EA 4X65F 2K3IA 5B0EA 4IBNA 4H4KA 1RTDB 3HTVA 2AV5A 2K7KA 4BRCA 3H45C 5J2EA 3TAQA 1VQYA 2GIRA 1WAFA 1U2VB 2DIUA 1W0HA 3T1AA 4HH0A 2HHHK 2BJ3A 3OBYA 4ICLA 4A46A 3EVOA 3QEIA 5DBBA 2BUPA 5T14A 4CM0A 5BR8K 2E7XA 4CNQA 4EAHD 1DOQA 1UEKA 3KBBA 2PI5A 1U26A 1XNQJ 2DD8S 3HULA 5J0RA 1YRTA 1CLQA 5LY3A 3BN4A 4BR9A 5A8WA 4QS9A 4LRDA 2WVDA 5ALXA 4WKRA 3BKFA 3ZSYA 1N52B 1NK9A 2VJUA 3VZIA 4NASA 3L0QA 4FJJA 3GPAA 2D8CA 1WSGA 3ZTSA 4PA1A 4G1PA 4K4YA 4IR9A 2DRAA 1SL1A 5KFHA 2W6LA 1S1VA 1FRKA 1M90T 5GINA 4Y2VA 4KPCA 1RWKB 1Y4ZB 1FXXA 2I5JA 2UUBJ 3C7NB 3MAAA 2ZHOA 5LSLA 2AGQA 1N5XA 2XIDA 2GNKA 4KYZA 5AJ3F 2P6TA 2FMQA 3KXDA 4DPOA 3L7PA 2ISOA 3HHLD 1MQ3A 4WCEQ 4M3WA 1RTIA 1BU6O 3Q8UA 3CGIA 3G25A 3W2WA 3MOZA 2DRBA 2CADA 2K1RA 2O3DA 2YWHA 1F2GA 5EX3A 1U1RA 1YBTA 2IMOA 3MM9B 2APOA 1I94J 5HMWA 3LAMA 4L76A 2QX0A 4DL7A 1KFTA 2FSNA 4JKHA 2EANA 2VV5A 2HHTA 4IO9L 1FKAF 3AY0A 4OYZA 3AO5A 2XSJB 3WQTA 2ZJRL 8ICBA 3ID8A 4NZ0A 3KD5E 3L8BA 2MXYA 4Y2QA 4JI8F 1N88A 1NKBA 4ZIWA 4P74A 2FJWA 3IG1B 2AEMA 4LH4A 5HR7A 3P8BB 4USUA 3TJ9A 1YGYA 4M94A 4M63A 4JAXA 3DMJB 5KFCA 4J9SA 3R9PA 5HLFB 4WQ4A 3ZDDA 3WK4A 2Q36A 1HQEB 3GIMA 6FD1A 2XI2A 3E0FA 3OSPA 2J8SA 2R2RA 1V9OA 3QSYB 1OSCA 4RQ1A 3PX6A 2RHSB 4TSXA 1NJXA 1AW0A 2YWEA 2WMMA 1BO5O 1TV6A 2WBRA 4KLGA 4DUYF 4CM2A 4I68A 2EKYA 2MEWA 4CBWA 4KLOA 4JKCA 4CHPA 4ZPVR 4JI6J 3LM2A 4KC5A 1IR0A 4OLPA 4KB7A 3QUBA 3OYIA 3RB4A 3WXKA 2XLIA 1YG0A 1SZPA 3CMQA 4JI3J 4FJIA 3OJSA 3DWLA 3AUOA 4IO9Q 1IN0A 2NZCA 3UDLA 1WWVA 4CGGA 1RDBA 3N28A 1JMSA 4UASA 1KSPA 1IIPA 1PKUA 4NYOA 1XMQJ 5LMNK 1D5AA 5BXIA 4TUSA 3DRRB 5ETLA 1ZQTA 4I1TA 2AYBA 1LVHA 4AP9A 2MYFA 3SMVA 2A3ZA 1MROA 3THTA 2G9OA 3CULA 5C0YA 4UUXA 2IVMA 3ITHB 4IG0A 4ZVPB 4NLBA 4U67L 1XSLA 4Y2YA 3V5RA 1M1GA 2KB2A 3WNEA 2XICA 3KDOA 4AM7A 2QJ3A 1FFUA 4Z4GA 1TL4A 3R7BB 1Z6RA 1IKYB 4KMOB 1QSYA 4MFBA 2BM0A 1LFPA 1K44A 1WNEA 4NA2A 3K75D 2V34A 2KNJA 4ILLA 2PBDA 2P6SA 3SSSA 2IFXA 4OV1A 3MWTA 3CCZA 5EU7A 2OHDA 2WW8A 4NXMK 4Y2IA 4FK2A 4DS4A 4M6WA 1HNIA 4JI0F 4DR5F 3AOCA 5LSRA 3Q8QB 1V4SA 5HBMB 1ZQOA 3SFUA 3ZDEA 2RUGA 5AI6A 2GIFA 1YLXA 1OQ6A 4TXSA 1NGAA 4Y2RA 3AVGA 1MN9A 5D3GB 1WCNA 1SWVA 4DLGA 4GMJB 4FWQA 4LR8A 5AQUA 2FHMA 4DR3J 4FWSA 2BCUA 3VF6A 5E5NA 3DLKB 1FRMA 3EMTA 1VHIA 3D6MB 5AZIA 1UMJA 5ALOA 2D0CA 1FJGJ 2DNRA 3L2UA 5SUHA 1REVB 4JKEA 4QZFA 2QSWA 2GUPA 1QE1B 4WF9L 4CK3A 1H98A 2XMMA 1KCFA 2VG5B 1HNWK 3BO4A 4P71A 1U4BA 2R7XA 1A0OB 4GFJA 1K9MT 2QTDA 4USIA 3C15B 8ICMA 4HH1A 1RHMB 4LSNA 1X66A 3VVTA 3LDNA 4GV9A 1RT7B 3CC7N 4CIOA 3MEGA 1VC5A 1C4AA 4DSEA 3MK6A 3PXGa 4ISFA 3TQEA 3BBCA 1NGGA 2SXLA 2QMUB 1AFIA 5BPNA 1T3NA 2WTFA 4NYZA 4RQ6A 2ZIVA 1KTVA 1KHWA 2X1GA 1WBDA 2FE9A 4GW6A 3QZ8A 3EWGA 2LXIA 2YX1A 4DV4K 4UOGA 3KHLA 4CESA 4J2EA 2FJEB 1BDGA 3BQ0A 3U27A 4CLUA 5KFBA 3P5JA 2KHVA 2AGOA 3VGSA 4WFAL 2V8HA 1HBOB 2NRRA 1SXLA 5I3PA 5CA5A 4OYWA 1F5BA 2C2ZB 3CC2N 2OP5A 3AVHA 3CJAA 3CJ4A 4ISGA 3LZIA 2QWQA 2ZVIA 1XNQF 2E1PA 4OYIA 1LNQA 1WG8A 1W9HA 3KK1B 4H0XB 4FS1A 3UDCA 4W98A 4AM6A 4RNHA 1NU0A 4ETXA 3O2IA 3KDNA 3AB2B 4C4TA 3FKBA 1HQUB 4YOEA 1BWEA 3AA4A 4I6AA 2V7ZA 3DJCA 3HKWA 2YNFB 2QV6A 1WLJA 3E01A 3AGKA 2DR9A 3AXKA 4PUOA 3A0HU 2BABA 5AM1A 2AXTU 2DBBA 2RJZA 5DGAA 4XPCA 2DY4A 3RUBL 4CHOA 4X4NA 2GGPA 3RJFA 3QE9Y 5FLXU 4G6VB 4KGKA 1MW7A 2RH3A 4OHVA 3PW5A 4EI2A 2HHWA 4DR4F 4OHXA 5ETNA 3MAQA 4RW6B 1KHVA 1DQAA 5GAEI 2RSQA 2ZKUA 3VQ5A 4BRHA 3T1HJ 4LFBK 4IQTA 2K8AA 3QRQA 3D1HA 3UW1A 2YKMA 2EG1A 1FKPA 1MMLA 3GIKA 4FLTA 4DTOA 2W7OA 3HBTA 4GXKA 1ZQQA 4KLSA 4TLRA 4X66J 2CPFA 9ICPA 3QWUA 3G9CA 2AU0A 4OJHA 1S72N 1EX4A 5JRTA 2VQFJ 1N8RO 4HTJA 1DTTA 1S7IA 3OJUA 4CGFA 2H5XA 4RNNA 2B9YA 1U1PA 4UB2A 2YHBA 4GKJF 5THWA 2UVWA 3RRGA 4K0KK 1ASUA 5AKEA 4KHYA 4LD0A 1RBRA 1WNSA 4JKGB 1KRPA 3TABA 1KDNA 3M2UB 2V51B 2W40A 5HRNA 2OD4A 4ZP9A 1HYSB 4I2AA 1FDNA 2IHMA 4OPHA 3V81A 1G15A 4NYNA 4O5EA 2JFKA 2ZBQA 3TTFA 4NRUA 2QB1A 1RWOB 2ZH9A 2CQPA 2ZZMA 1RAEB 4F4AA 1RILA 1TUUA 1UZHA 4WWSA 1XSPA 2F4VK 1EIYB 1IG8A 3NMAA 2HVIA 2DGXA 2VCPA 2BPFA 3MR6A 4CO2A 1J97A 3D2FB 2Y0SF 1NNLA 4P72A 5BOMA 3K1ZA 1RA7A 1NXIA 1YTAA 3MM8B 3QXGA 2XWYA 1K5OA 3OA9A 3NS1A 3VQ4A 4H5RA 3WK8A 3OTOK 4J03A 4X4TA 2E1ZA 4ZP6A 4CO4A 1OMSA 4FJ5A 2G1HA 5HRRA 2Z2MA 3JAMO 2ZUDA 3WKDA 3HD1A 4KV8A 5AM2A 5ALSA 4ECSA 2B4VA 4M9NA 4YQWA 2EK1A 4MDBA 2DNLA 3IRXA 1T6DA 4FVCA 1H2VZ 1H74A 3RW6A 3KZBA 5SWMA 1TKTB 3UXOA 2OPQA 3VA0A 1VBKA 4B3RF 4J9PA 2HS4A 1KQSM 3NVVA 4KIAA 4LC9B 2QFJA 3CQ8A 4H8KA 2E9RX 2FVPA 4EBCA 1COKA 1GMUA 1BPBA 4DCCA 2EWHA 1NGEA 4ED2A 4NLVA 3OVAA 2QRRA 1RWMB 3IR7B 1L3UA 1XHZA 4CJFA 1RYUA 2RQMA 4YOWA 3CJ0A 2HHXA 1TKXA 2QXLA 2NLWA 3K9KA 2A1RA 1VSKA 3F5EA 4WJ3B 1JKHA 9ICLA 2GUIA 4IEIA 4PYDA 5KFYA 2COLA 2VF3A 3CQYA 4CIGA 1Q46A 2FVCA 2KG1A 2E9TA 1N32K 3I8BA 3AQEA 5KRSA 4JS4A 2VIXA 3BGOP 3GSDA 4Y0FA 3HW8A 3DCAA 1ZC6A 5IWAJ 3K89A 2DNOA 3UXNA 3HHLC 2L9DA 3WIVA 4MHVA 2J0XA 4Q44A 1FVQA 2VBXA 5ADZA 2YI1A 2HYIB 1HBNB 3J7Z5 1XNSA 1LWFB 4K4IA 3R6MA 8ICLA 2VG7A 3PO4A 4CGHA 3GV5B 2VL1A 2B7CB 2CVIA 3QYPA 4F3QA 1RT4A 1YJRA 2P9NB 5MLCQ 3KFWX 5G0RA 2RIJA 3WIUA 5GVQA 2J6UA 5KL8B 1B22A 4HI1A 3KK2B 1C1CB 3V81B 1FFVA 4KLJA 3DYAA 1HMVA 3C95A