1NJZA

Cytosine-thymine mismatch at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njzA01
3UQ2A 3MBYA 3EYZA 3D0PA 7ICEA 1WSHA 1XHZA 3Q8RB 4YCXA 1RDCA 3NH1A 4DTPA 5J2PA 4O3NA 5CYQA 1TL1A 4O5CA 3MAQA 1L3TA 2HHXA 3DOLA 5KFVA 5KRSA 3UXNA 1XHXA 4IDKA 5J0YA 3TAFA 5KFOA 1B92A 1U04A 1QLNA 2YNHA 3PR4A 2X78A 4CJ3A 3O4QA 1SV5A 4K4IA 4QWCA 1IXRA 1NOYA 3V1RA 4FLVA 4QZ8A 5C5JA 3ISBA 2FMQA 8ICCA 4YR3A 5K14A 1NOZA 4M9NA 4CERA 4FS1A 3SV4A 3RWUA 4FK4A 3OYAA 3RJEA 2HNDA 4R8UA 4CJQA 4BGDA 3G0ZA 4ICLA 3KHLA 1I3AA 1ZQVA 4Z6CA 3RJKA 5DDMA 4CF9A 4DSKA 1RBUA 2HHTA 4O5BA 3L2VA 2FMPA 4JK1A 5CR0A 1JN3A 2VG7A 1S0VA 2FPMA 2PFPA 3I8DA 3NDKA 1LWCA 1TK0A 1C0UA 4IFVA 2AGPA 1SKRA 1C0MA 2NRTA 4DF8A 1WSIA 2QKBA 1IO2A 4O5EA 2BR0A 2RN2A 3T1AA 3ZDBA 4ECUA 4I2EA 1RT6A 4MFFA 4GVMA 5HROA 3OYIA 5IIKA 4KHYA 4K4HA 8ICUA 3KHGA 4J9SA 4KI6A 2KN7A 4O5KA 5KFPA 4CFDA 2VA8A 4TUPA 1C1AA 3LPTA 3ZSZA 3G10A 3V9SA 1BPYA 3V72A 2P51A 4DFPA 9ICTA 7ICOA 3NE6A 4ECVA 3C94A 1DTTA 4MF8A 4C8KA 1B22A 1TAUA 4AHRA 4YG2A 3THVA 3G6YA 1YT3A 4FLXA 4DLGA 1ZBFA 2Z1GA 4YP3A 1BPZA 4EBEA 3VQEA 4FLUA 1VK0A 4Z4GA 4UBBA 4J2EA 1UT8A 2KZZA 4M3ZA 3V6KA 2Z1JA 4QWEA 4DQSA 2DFHA 3FFIA 4DTOA 3QEAZ 4XIUA 4Y1CA 3OS2A 4F5QA 4O3PA 1IH7A 5J0XA 1RTDA 3RH5A 1ZQHA 3PVXA 1X9MA 4DG1A 7ICHA 5KFFA 5TZVA 8ICVA 5L1LA 4E1MA 1HYZA 3N4MB 3K5MA 2F1HA 5HRSA 3OYLA 7ICLA 4ID5A 3M8SA 1JLEA 1FXXA 1ZQJA 1YTAA 9ICKA 1LWFA 4CJPA 1A5VA 1TVAA 3NGDA 2OPQA 3I0RA 4PGQA 1ZQBA 1HYVA 9ICLA 1JXLA 4HVJA 4IQUA 1BIUA 4RPXA 2C2RA 5L1KA 2IHMA 3AO3A 2MUTB 2R8JA 4CFAA 5CA7A 3NF7A 1ZQXA 4RW4A 5J2FA 2FBVA 2IAJA 1NJYA 2E6LA 4NXZA 2EHGA 7ICFA 3MECA 2YKNA 3OYFA 3AV9A 2ZUDA 1RPLA 4JWNA 4M9JA 3PO4A 4YMOA 3QEBZ 2PI4A 3NH2A 3VQQA 3E2EA 3QETA 3KKSA 4F2SA 1I39A 4CK3A 8ICEA 3K75D 1VRUA 4UQGA 3HPGA 4DTMA 5J2GA 4CHYA 4CJFA 4I2BA 2C28A 1ZQMA 3KK1A 1NK5A 4TURA 2PZSA 4NCAA 5L1IA 5EWGA 3SQ1A 4YFKA 3OS0A 2ZQBA 4OKKA 5T7BA 8ICWA 2ZUBA 4KRFA 1ZQKA 2LYHA 1S9FA 4RT3A 4I2GA 5KFWA 4MEYA 1VSEA 5DB8A 5DG7A 4FJ8A 2HW3A 1GOBA 3NGIA 1ZYQA 4H8KA 4RZRA 2BQRA 4O55A 3OVNA 5J0WA 1S1VA 2XY5A 1JXEA 3V1QA 5KG3A 4DQRA 8ICXA 4LZDA 3PMNA 3IG1A 1UT5A 1QSYA 1IKWA 3C23A 5KFDA 5DQIA 4DL7A 3RJHA 4I9QA 2OPPA 4ED6A 2BPGA 4EP4A 4F50A 3AO2A 4KTWA 3HP9A 3HWTA 4IQVA 1KLNA 3V9UA 3EZ5A 3SQ2A 1S9EA 4B9SA 3HXMA 4FM2A 2D5RA 1RCHA 2ASJA 1D9DA 1N56A 1KTQA 2A1SA 3AVHA 4DQIA 1J54A 3AU2A 1WCNA 1WCLA 4CGJA 3B0XA 2FBYA 4Q5VA 4OLAA 1WSFA 2FBTA 2PFOA 2W8LA 4DSEA 1B9DA 4FJJA 5KFJA 1L5UA 1S77D 4KHUA 1CZ9A 9ICEA 3H7IA 3S3NA 4GW6A 3M9MB 4ZTFA 1JL1A 4DL4A 4F8RA 4JLHA 1TKTA 4CE9A 2P5OA 9ICPA 1KVBA 2BCQA 3BJYA 3DM2A 4FJGA 4FYDA 3TANA 1S0MA 3HO1A 3VQ5A 2B21A 4RU9A 3RB0A 4Q0BA 3ZSYA 8ICGA 4QWAA 1HRHA 4RPYA 1HNVA 1K1QA 1LAVA 5L9XA 5C42A 4FK2A 1ZQOA 3KJVA 4I29A 3TARA 5IILA 4C8OA 2W9CA 8ICQA 3OS1A 5FRNA 2XY7A 4FJNA 3SQ0A 3LWLA 4FW1A 5JUMA 2XHBA 5F9LA 4DLEA 3L2WA 3SUPA 7ICGA 3SZ2A 2ISPA 3I0SA 3E01A 2YNIA 3CFOA 4FZXC 3RJFA 5J0SA 1BPDA 1ASWA 1ZQFA 3MFIA 3JPPA 1J53A 3UXPA 4NYFA 4FJ9A 3OHAA 4IR9A 3H08A 3NF6A 4HUEA 3V9ZA 3QEPA 1HYSA 1SKWA 4M3RA 2MAXA 5DBCA 1SKSA 4KREA 2JGUA 1U4BA 4DS5A 1MSWD 4F3OA 3SPZA 2IBKA 2VG5A 4BXOA 3P1GA 4W5QA 3O3GA 9ICOA 5BOMA 1JLQA 2W42A 4W5RA 4KLOA 1U47A 2FLLA 1QS4A 1ZQNA 2YV0X 3P5JA 1WN7A 3NTUA 1NJWA 3DYAA 4C8MA 4R8UB 4JRQA 2RF2A 2NRVA 3GV5B 4I2QA 4QOZB 4KMUA 4E19A 4RQ7A 4LD0A 4CFCA 4KAZA 1RILA 4B9UA 4NLZA 2YHBA 1NK9A 2X6SA 2HHSA 1EP4A 3H40A 4CJTA 3PW0A 1AROP 4KHQA 2XO7A 2Y1IA 4CHZA 2O4GA 4NY8A 4LZGA 4O0JA 4Z6DA 3CQ8A 4UBCA 3RBDA 1YTUA 1NKEA 4GC7A 5SWMA 4YD2A 5CZ1A 2HVHA 2IS3A 1SL1A 2DFEA 3HX0A 3CYMA 1MQ3A 4B9LA 2F96A 4KLTA 3V7KA 1A5XA 2FPKA 4M41A 4B9MA 3CM5A 1RBVA 8ICHA 2AU0A 4CEAA 4ECQA 4Z4EA 1S0OA 1KCFA 2DTUA 4ED7A 1FK9A 4Q8EA 4DMNA 5HMMA 3MABA 1RYSA 1JKHA 4QCLA 4B3OA 3S3OA 5DLFA 3RH4A 5DQGA 3KLEA 2ZUCA 4ECTA 4FLZA 2BGWA 2E6MA 1NOMA 3GILA 1Z26A 2R8IA 4OKJA 4F2RA 2AGOA 1CEZA 3ZSQA 5KFZA 4OPKA 4J9RA 1BI4A 3F9KA 4M9HA 1ZQDA 2G8FA 1VSDA 5BOLA 4IG3A 3QNOA 3H8SA 2KQ2A 3AA2A 3H4DA 3NF8A 3PW4A 3SNNA 3LDAA 5HRRA 4KTQA 4DOCA 1RBSA 5KT2A 1WNSA 4M3UA 3MEEA 4N76A 8ICSA 1UOCA 1RXVA 7ICQA 4YXMA 2XY6A 3TAMA 3VA3A 4IQTA 3ULDA 3MR3A 8ICZA 1BGXT 2AJQA 3KLIA 1ZQIA 5CZ2A 2BDPA 2JEFA 4QAGA 4F5PA 4FS2A 2KZMA 1K6YA 3LAMA 2Q3SA 2O4IA 4M9LA 3AVLA 1X9SA 3QIOA 4PQUA 1EKEA 1ZETA 3B0YA 2OPSA 3MDCA 3GIMA 2I1QA 4DQQA 4AHUA 1BPEA 2V4RA 3PW5A 4YXJA 1NJZA 3ITHA 3LANA 3Q8PB 4F5RA 3RMBA 3F73A 1XU4A 4HCBA 1TV6A 4DTNA 3ZT4A 1Z00A 1DTQA 3HPHA 4PH5A 4XQ8A 4AHCA 4B9NA 4HUGA 3ISNC 2IDOA 4QZHA 4C8LA 3JPSA 3BQ1A 4CJUA 1TKZA 1DOQA 4L8RB 4J9PA 1S1TA 2VA2A 3VQ4A 4E0DA 4DFMA 3EPGA 5DBBA 4CEDA 4PHAA 4DSIA 1JLGA 1L3VA 1RDAA 3LZJA 1A77A 5KFSA 1FKPA 4UB2A 5J29A 3KTQA 7ICNA 3TI0A 8ICLA 3FYHA 3SV3A 4F4WA 2C2EA 3KD1E 1ZQGA 2BQUA 3CFRA 5KT3A 4DOBA 4M2YA 4CF1A 1Z25A 2BANA 4JV1A 2YNGA 4CJWA 3V81A 1CXQA 3WNEA 4NCGA 2VA3A 4FJ5A 5IINA 4O3RA 1ITGA 1ZQZA 4RG8A 1LV5A 3QESA 2GBZA 4FM0A 9ICSA 5JS2A 2XY8A 3DLRA 4B08A 3MR2A 4IG0A 3NBPA 4CIEA 7ICJA 4KV8A 1V9PA 1Y88A 4I9LA 4IQWA 3LP3A 3DRSA 1MU2A 1BCOA 1BISA 5D49A 3QE9Y 2JLEA 5DB9A 1JIHA 4GXIA 1T7PA 2AGQA 3QO9A 9ICCA 7ICIA 4KHNA 4CJEA 1VSHA 1W0HA 3QEXA 1R0AA 1S1WA 4B9TA 4E7LA 1C1CA 4RNOA 2BCSA 4Q45A 8ICYA 4CJVA 1RTHA 3JYTA 5KFBA 2M9NA 2ATLA 1IKYA 3RJGA 2PYJA 4LSNA 2PYLA 1MC8A 7ICSA 3EY1A 1U48A 3MFHA 2W9CB 3O3HA 2ITGA 2A1JA 3ZSRA 4J2DA 3TFSA 4TQRA 3ZD9A 3BGRA 4DSJA 2NRZA 2W9BA 8ICRA 5KFEA 4RT2A 1LAWA 4MFAA 3AVNA 4UAZA 5KFLA 4RQ1A 3QZ8A 5KFNA 2I5JA 4IR1A 2RDIA 1NJXA 2G8VA 5KG4A 4KB1A 5DLGA 1EXQA 1RTIA 4LVSA 3PV8A 9ICHA 4ECZA 3ZT0A 4YFUA 2X74A 3MEGA 4ED8A 5HHHA 4FK0A 3DLBA 1ZJMA 1EXNA 1W9HA 1MQ2A 4BE0A 4BXOB 2BCUA 9ICNA 5J2EA 1S1XA 1T3NA 1KVCA 4CHNA 1CUKA 4RPZA 1ZQQA 5E41A 2Y1JA 3TFRA 1S76D 3RB4A 3QEWA 4RQ6A 4TUSA 3O3FA 3RH6A 3ZT2A 4GLXA 2PFNA 3AVBA 1LWEA 3P83D 9ICGA 3C1ZA 4PHDA 4M47A 4CGFA 2OWOA 4J9QA 4X5VA 3LP1A 1XSPA 3VQCA 2DPIA 2HB5A 1X9WA 3SI8A 2PFQA 3N97B 8ICKA 3Q8LA 1IG9A 4EYIB 3V1OA 3JPQA 4FJMA 3NGZA 1VSFA 4ECXA 5KFXA 4HHTA 8ICFA 4I2FA 3AU6A 4R65A 2W9AA 4DFKA 4KLHA 8ICBA 5J2NA 8ICNA 2B5JA 5KT4A 2DFFA 4I28A 3NF9A 3M9NB 1SL0A 3G6VA 4FJLA 4RUCA 3NFAA 3AVGA 3AVMA 3BDPA 5I3UA 8ICAA 4Z4HA 3FDSA 4ECRA 2YKMA 3M8RA 4M6WA 4IFYA 1Y97A 5HNKA 4MFCA 4OGCA 4QZAA 1S1UA 2C2DA 3UPQA 2FMSA 1PZNA 4GXJA 4GMJB 1VSMA 2ZD1A 4FLTA 4I2IA 5KFQA 2HHUA 3V4IA 4ZH4A 4DWIA 4J2BA 3MR6A 3HSTB 4KLMA 3OGUA 9ICJA 3QINA 4BWJA 1JLCA 1BI4B 3KLGA 1ZQYA 2KFNA 4M0AA 4DTXA 1J9AA 1QHTA 4OVLA 3SI6A 2ZJ8A 8ICIA 4RNMA 5J1EA 1D8LA 7ICPA 3ZSWA 4RQ3A 1HPZA 3QIPA 3OJUA 1C6VA 1JX4A 4NLGA 4W5TA 4KLLA 4RQ0A 1NK6A 2F8SA 5FDLA 3OYNA 3MR5A 4C8NA 2FLPA 3JSMA 2BCRA 4PA1A 4E7IA 2VWKA 3JPOA 3Q8KA 3LZIA 1T03A 4M04A 5DK5A 4FJ7A 3RJIA 2P66A 4M9GA 1S6PA 3NCIA 2DY4A 2FC0A 3LAKA 4QZBA 3AVAA 4B8CA 4E7HA 4YQWA 4CEFA 1ZQEA 2D0BA 2IC3A 4CEOA 3ETLA 1KEJA 2WONA 4XA5A 3PR5B 4ED3A 2JEGA 3M8PA 5J0OA 4IRKA 3KD5E 3K5LA 1VSIA 4GC6A 2F1IA 3QNNA 3RMDA 4ED2A 1TVRA 4RNNA 5CY4A 1T4GA 4LH5A 4BE1A 1UA0A 3C95A 3OYJA 4FO6A 4EEYA 3D45A 5CP2A 1QSSA 1Z00B 5KFMA 4AH9A 5DQHA 4ID1A 3LK9A 3ORYA 1TV9A 5J2IA 3AA5X 4J9KA 4LH4A 4N41A 4H4OA 3UQ0A 4B8AB 4LSLA 4Z4FA 1ZQRA 2B4JA 1TKXA 4YN4A 3IM1A 4IRDA 3MGHA 3T5JA 3MGIA 3ZT3A 9ICFA 5J2CA 5HLFA 4DS4A 4H4MA 4BWMA 9ICIA 2G8HA 3EPIA 3M9OB 2YNFA 4KLEA 1REVA 4YVZA 1Z3EB 3KHRA 3K4GA 4FBUA 4FZYA 1CXUA 2ZJAA 4KLSA 5KG6A 4RQ5A 3HPOA 3HL8A 1ZQCA 2XC9A 2HHWA 3AO1A 4O3OA 3K2PA 7ICRA 3S9HA 2ZTEA 1TL3A 2R8HA 2JEIA 1ZQPA 4QW8A 1HQEA 2OZMA 4QZ9A 2IOCA 1COOA 5KFRA 1T8EA 3EW9A 4NLKA 1EX4A 5J2BA 1LW2A 4CJKA 1SZPA 4MEXA 2XGQA 4RW7A 4QZIA 1XS9D 4UB1A 4KITB 5J0RA 2KW4A 2KZ3A 5DBAA 2WOMA 2OA8A 1NK7A 1RT1A 4NLNA 2ZTDA 3G6XA 4O0IA 4ELVA 5KT7A 4F91B 4CK2A 3PX0A 4NM1A 5F9NA 7ICUA 5KFIA 3ISDA 3OYHA 4CIGA 2XRIA 3LPUA 4CHQA 1RBTA 1HNIA 3C2KA 5KFAA 5KGXA 3OYBA 5HBMA 3BQ0A 3AVJA 3QERA 1ZQTA 4YNQA 3K58A 3SUNA 2HMIA 1NK0A 2D0CA 4N5SA 1ZBUA 3QLHA 3RB3A 3NAEA 4KB0A 4JV2A 4N56A 1RBRA 1S5JA 1U49A 5J2MA 1ZQWA 4M3YA 3S3MA 4P2HA 1A76A 4PWDA 4KHSA 4FXDA 3MEDA 5L1JA 4QZDA 1U45A 2A1JB 1BIZA 1RT5A 4I2DA 5J0UA 4J9OA 2V9WA 4FM1A 4DU4A 5DGBA 4ZTJA 3OYDA 3AVKA 3K57A 1D5AA 2KTQA 4QZFA 2W9BB 1ZJNA 3RTVA 4O9MA 5KFYA 5CB1A 3RAQA 4K8XA 3C6UA 1H38A 3V9XA 4RQ8A 3VQ9A 4RW9A 7ICMA 2W8KA 9ICMA 1TGOA 1T05A 3T3FA 3DLGA 4CGIA 1RXWA 1WAFA 3HW8A 3T5KA 2AQ4A 1FKOA 2R8KA 1HJPA 1HUOA 5BPCA 1Q9YA 3DMJA 3NGYA 3H8WA 3LALA 3SQ4A 4M3XA 4FJKA 3HVTA 4KI4A 3AVFA 4O3QA 5KTQA 4I2JA 1C1BA 2B6AA 5SZTA 7ICVA 4OPJA 2GV9A 2EX3A 5J2HA 2KFZA 1BQMA 1HUZA 3AA3A 1NK4A 1LB2B 3LDSA 4CFBA 1S6QA 4J2AA 4P4OA 2DPJA 1VSJA 4AILC 5HHIA 2BCVA 2VG6A 2ASLA 5KG0A 5JS1A 2P6UA 1B43A 2VANA 1ASVA 2F8TA 4MQ3A 8ICTA 4BACA 4KTZA 4CCHA 4PHPA 3LWMA 3C21A 4Q43A 5KT5A 4CECA 1CLQA 1VSKA 3A2FA 4KLIA 1JMSA 4WE1A 4FCYA 5IIJA 3GV8B 4I27A 5C24A 4KLJA 9ICUA 1ZBLA 3GDXA 4W5OA 5CJ7A 2OZSA 2UVVA 4FVMA 3AA4A 5CYMA 1RYRA 4NYNA 5IIIA 5D4BA 2FLNA 4F4KA 1HQUA 3ZDAA 4YR0A 1RNHA 3ALYA 1IKXA 4EZ6A 1UWBA 2PXIA 3C2LA 4PGXA 4DO9A 4M6WB 3TAPA 1D9FA 4HYKA 4DU3A 1QQCA 4BDPA 3KIOA 2JEJA 4RQ4A 1KVAA 4YMNA 3NH0A 3L3UA 1BHLA 4ELUA 3OYEA 4R64A 1KSPA 4KPYA 1ZQAA 4OKEA 2A1RA 1TAQA 3WNGA 4F5OA 4J9MA 4JS5A 4DU1A 5KFHA 4B9VA 5KG7A 3BQ2A 3DRRA 4JRPA 2BPCA 2ATQA 3DLKA 3K59A 4KLQA 2G8KA 3K5NA 4DTUA 4O3SA 1WSEA 2WTFA 4ED0A 3RRGA 4K8ZA 5KFUA 1KFTA 3DLHA 4CHOA 3MXIA 1KRPA 5DG8A 4IBNA 2QKKA 3TAEA 3L3VA 1BPBA 3HK2A 4KLUA 3LP2A 3VQBA 4OGEA 2LSNA 4CEQA 4CF8A 2BGGA 3JPRA 3GIIA 1XWLA 4XUSA 1ZQSA 2NRXA 4ECSA 7ICTA 4F4ZA 4G1QA 1WSJA 2JZBA 1S0NA 4KLGA 1DGSA 2Q0ZX 3VQAA 2HNZA 2BPFA 4FLYA 3AO5A 3H4BA 4F3TA 2G8WA 2R8GA 4YD1A 2ISOA 4J9LA 3SPYA 1KFSA 5DB6A 1RTJA 4ECWA 4NCBA 3TAGA 1JL2A 3PUFA 2BE2A 3KKRA 1NKBA 4DSLA 4F92B 5KFGA 3PW2A 3IS9A 4W5NA 3PY8A 3AVIA 3OYKA 5D46A 5EWEA 2ZE2A 4CIFA 1A5WA 4KO0A 3O4NA 1BL3A 4QW9A 1ZQUA 5J2AA 4YR2A 1DLOA 3IHQB 5KG1A 4R66A 1RT7A 2IMWP 5J2DA 4DTJA 3TWHA 2UVUA 5J0PA 4PY5A 5KRTA 4OLBA 4NM2A 3RBEA 4XRHA 3T19A 3L8BA 3JPNA 1SL2A 4CESA 4CGGA 5IIOA 1RT3A 3WNFA 3RMAA 5HP1A 4KLDA 4QZGA 1BCMA 3U6FA 3HJFA 3ZSVA 3AO4A 5CHGA 2V4QA 4IRCA 3CFPA 4DSFA 4DFJA 2ZJ5A 2ALZA 4EBDA 1L3SA 9ICQA 8ICJA 4M45A 3Q8SB 5EU7A 2OPRA 3SUOA 4BDZA 3C5FA 5CWRA 3MXMA 2UVRA 3PMLA 5HMLA 3BQTA 1XC9A 5J2QA 3L2UA 2RKIA 5DKWA 3SJJA 1XO1A 3GIKA 1SUQA 5FRMA 3HP6A 2QXFA 9ICXA 3IAYA 9ICWA 4DL3A 1HMVA 2J6SA 5J0TA 2XCAA 4O44A 4E7KA 3RR8A 4QZCA 5KG5A 1JLBA 1N5YA 4EP5A 3TABA 5D3GA 5I42A 9ICAA 1GOCA 2IGIA 4FBTA 2P5GA 2UVWA 3L2QA 4M3WA 3GQCA 4E3SA 5J2KA 3V6JA 1QTMA 3HYFA 1RZTA 4TQSA 1IM4A 3VQPA 1C0TA 3AVCA 4F5NA 3GIJA 1UAXA 1JLAA 5EWFA 4Q8FA 4F4YA 4N47A 2G8IA 1O1WA 4PGYA 3C5GA 4CJ5A 1LW0A 4QWBA 4MF2A 2C22A 1WSGA 8ICOA 3PX6A 2HNYA 3TAQA 3Q8MA 4FJIA 4HUFA 3RAXA 7ICKA 3CG7A 5IIMA 3WNHA 3SUQA 1RT2A 3RR7A 4UB5A 3VQ8A 3MDAA 4FZZA 3CM6A 3Q8QB 2DFLA 4I2PA 4I2AA 3DI6A 4Z0UA 3OYGA 3VQDA 1K1SA 3RMCA 4IKFA 1TK5A 3V9WA 2HHVA 2G8UA 3HM9A 3H8JA 2FPLA 2J6TA 4UB4A 4I2CA 3UIQA 3TR8A 4FLWA 3DLEA 4JV0A 3RB6A 5HRNA 4BE2A 4GXKA 2D0AA 4RUAA 3U3YA 2XCPA 4M3TA 2J6UA 1F21A 4E1NA 3V7JA 4K4GA 3KLFA 1WLJA 3KHHA 3DOKA 2VWJA 4KN7A 4KN4A 5KGWA 1RDBA 4QZEA 2W9MA 3T5LA 1C7YA 4CHPA 3ZCMA 4BDYA 3GFKB 2RPIA 4FW2A 1EETA 3OY9A 2P6RA 1X2IA 1ZQLA 4UAWA 4O4GA 3EWAA 4P4PA 4PUOA 1TFRA 3UXOA 4LY7A 3PW7A 4F4XA 1WAJA 1D8YA 1JXBA 4CF0A 3OJSA 1BPXA 1YVUA 4Z6FA 4KKOA 3TQ1A 3VA0A 4DL2A 4PHEA 4DF4A 2AQ0A 4Z4IA 4HTUA 5EOZA 2MUTA 3T5HA 4RW6A 2IA6A 4TSXA 4PPXA 5DDYA 1UA1A 4DQPA 5KT6A 3PX4A 4J9NA 9ICBA 5J2JA 3QEVA 3B6PA 4QWDA 3QZ7A 4CJ4A 4M42A 2NRWA 3VQ7A 2YHAA 4CGHA 4JWMA 5DB7A 3B6OA 3SYZA 1Q8IA 3V7LA 2ETJA 2Z1IA 3HT3A 1TK8A 1HJRA 2PY5A 4CGDA 4Y1DA 2H5XA 4CEBA 5HRPA 3KK2A 1CZBA 4G3IA 3OHBA 5KFCA 1JLFA 4KHWA 1S9GA 4R63A 5KFTA 3RRHA 3PNCA 1BQNA 1GOAA 1RDDA 2BHNA 4FJHA 3V6HA 1QE1A 3HVRA 2OYQA 4CK1A 3ZT1A 4YMMA 1L3UA 2PI5A 4HCCA 3JPTA 3PO5A 4DOAA 3MXJA 3VQ6A 4ELTA 2QK9A 3K5OA 1S97A 4CEEA 4CF2A 4JS4A 1NK8A 4CJSA 2P1JA 3KK3A 3AUOA 4ECYA 1U9LA 5HP4A 4E89A 1Q9XA 2BQ3A 4I7FA 2Z1HA 3ZSXA 3ZDCA 3C2MA 2BKEA 2F1JA 1VRTA 4RW8A 3ZDEA 3VN5A 3ISCA 2GUIA 4CJRA 4EZ9A 2JZBB 2XGPA 1KFDA 3OYCA 2FBXA 4EBCA 1RT4A 3ZD8A 4DL6A 5DG9A 1BVSA 4Z6EA 5DMRA 3C1YA 8ICPA 5KI6A 1B9FA 4DL5A 4CJLA 3ZSOA 4DTRA 3OSPA 2HVIA 4AHVA 1XSNA 4CEZA 3QEIA 1G15A 3L2RA 4RQ2A 2IHNA 2RDJA 3RJJA 2GWSA 2NUBA 4OJRA 1XSLA 3GV7B 1X1PA 5C25A 5KG2A 4TUQA 4ED1A 2I9GA 3ZDDA 3OYMA 3C6TA 1J5OA 4I2HA 4UB3A 2E4LA 5DGAA 3V6DA 9ICVA 4KFBA 4Z4CA 4R5PA 1ZBHA 4F93B 1N48A 4DEZA 1ASUA 4E7JA 1S10A 1N6QA 5KFKA 9ICRA 4AHSA 2HHQA 3LP0A 3SCXA 1TKDA 4KLFA 1QSLA 4P4MA 4MFBA 2R7YA 1KLMA 4AHTA 5FROA 5J0QA 1IKVA 4ZHRA 1KDHA 4DTSA 2X6NA 2ZTCA 1ZBIA 3OSNA 3IRXA 4UAYA 3NHGA 1NKCA 3KLHA 3U3GA 3ASMA 4FJXA 1XI1A 4JUZA 3M8QA 4Q44A 2ASDA 8ICMA 1VSLA 3DRPA 4EYHB
chains in the Genus database with same CATH superfamily
2Z0GA 1IG6A 3D0PA 1VYAA 7ICEA 1OWXA 1FFWB 1XHZA 1E6VA 1P8GA 1VQNN 2DCLA 1ATNA 4DTPA 3R5GA 3PIPQ 1L3TA 1WUDA 3M8YA 4Y6IA 3A3PB 1TUVA 5J0YA 3AQFA 2CQ3A 1RHRB 2J9CA 2X78A 4CJ3A 3O4QA 4K4IA 4MTPA 1NOYA 5AQPA 4PABA 3UDVA 1HMVB 1GLDG 5E0OA 5F3TA 2DRDA 4O44B 4C48A 3ISBA 5M1QA 3BQ7A 3N6MA 2WC9A 2H3IA 4YR3A 1NOZA 4M9NA 3PTWA 4FS1A 2FVPA 4OYOA 1YLXA 3T6BA 4FK4A 3MM6B 2VKRA 2Y1RI 3G4SS 1WHWA 4BGDA 1R8AA 3JQKA 3D7SB 4ICLA 2DKZA 1I3AA 1ZQVA 3RJKA 1YK9A 2HHTA 4JI2F 3DV9A 3ISZA 4ZOHC 3W3DA 5AI0A 5AK5A 1N36F 3K8WA 4AL6A 2VG7A 2GUPA 5ALLA 1Z4UA 1S0VA 3OL7A 2Q43A 2FPMA 5AZJA 3I8DA 3UKUA 3I82A 2AGPA 1VMBA 5DM7L 1IO2A 2BR0A 3T1AA 1VS3A 2Y9TA 1K47A 4I2EA 4MFFA 4GVMA 2PT0A 3DGVA 3OYIA 5IIKA 8ICUA 3LOUA 3MWTA 1RT2B 4KI6A 2V8GA 3SSRA 4O5KA 1VC5A 1CPZA 1TYQB 4PZNA 3M3ZA 2BW2A 4TUPA 2DR9A 2GQQA 4KJIA 5G0RA 3V72A 4DFPA 3C28A 3MMAA 3LL3A 4MF8A 3R9LA 2RRDA 3GB0A 4C8KA 3EX7B 4GFJA 1RM6C 4DLGA 1ZBFA 3DU5A 4A4JA 4EBEA 5CZVA 2VONA 3O08A 4J2EA 1RAJA 2KZZA 1S49A 3V6KA 5CQGA 2RHSB 2IYIA 3MHYA 3HLUA 3RRKA 4DX7A 2R7OA 3ZNUA 1JNRB 4Y1CA 2DGZA 3OS2A 1IH7A 4O3PA 1DQ8A 2P9EA 4A8SA 4PJ0U 1ZQHA 2BJ3A 1BLUA 3M2RA 1X9MA 7ICHA 4QIWF 1XNSA 1TQLA 4LR7A 2CJKA 2WB4A 4O4GB 4ZPDA 5HRSA 4PUOB 1AB8A 4CT8A 1ZQJA 5TISU 1IBMF 2FSKA 1T9WA 1N8RO 1TVAA 3NGDA 1VQSA 2XZTB 2EQYA 1HYVA 9ICLA 4HVJA 4RPXA 2C2RA 2ZZMA 4WQ5C 5CA7A 3Q2SC 3GLJA 3TYTA 1SIWB 4HL9A 5J2FA 2HVZA 1VQLS 1NJYA 4Z37A 2IRYA 3FZ2A 2VC1A 3H2VE 5HQMA 2PE8A 4OLPA 2YKNA 5DZ6A 4JI7F 2ZUDA 4JWNA 3IDWA 1X4HA 1F9HA 4MKVA 2YWEA 1CS4A 3D2FA 2DGVA 2FY8A 2C2KB 1KN6A 3TJ9A 1PYTA 3N5BA 2YWKA 4UQGA 5L8RC 3H5YA 4OYBA 3EL2A 3R3TA 4LF1A 4CJFA 1IXKA 2P9UA 3HHEA 1SV0A 4Y2TA 2NXCA 3ZTOA 1NK5A 4ZVSB 3BSNA 4OJHA 2BRKA 1BQNB 4Z7YA 1NH8A 4IKAA 4OKKA 1QE1B 4NLRA 8ICWA 3CJKB 4BR0A 4KRFA 4RQMA 1ZQKA 2YQEA 2PMHA 2YX8A 4I2GA 5KFWA 1S8OA 1GOBA 5FIIA 1ZYQA 4RZRA 2BQRA 4LFBF 1YIJN 2P9NB 5GADI 1OH8A 1U26A 1SAZA 2W2NP 1B4SA 1VBZA 8ICXA 5J8YA 4LR8A 2I6WA 3PMNA 1UT5A 3OTOJ 4ZVHA 1FRKA 2G09A 1JB0C 3RJHA 2OFGX 3WIVA 3QLHB 1Q5VA 3C7NB 3LM2A 3HWTA 4IQVA 3CCMN 2HPUA 4A5BA 3L7OA 1RT4B 4NMLA 2XSJA 1SGGA 2CQIA 5DM6L 4PG7A 2E9TA 1D9DA 2V69A 2WBMA 5AKKA 1J54A 4QIGA 4QR2A 4RBUA 1VJWA 2YQ3A 3DXMA 3BZCA 4CGJA 3UN3A 5HR7A 1HL6A 4Q5VA 3U1NA 3GSIA 5J1NA 2FBTA 5I3QA 2DRAA 4FJJA 1QVFM 4DR7J 2K4EA 2ZM6F 3H7IA 3BZQA 2ASMA 3LP0B 4GW6A 2KV2A 2ZJPQ 5CD4H 4F8RA 1C2PA 5ALKA 4X66K 4ZHRB 2VD3A 3NKYA 3BJYA 4FYDA 3TANA 1ZD2P 3NGUA 4DCCA 4ZDNA 2YCHA 4RWWA 1U8WA 1SJ4P 3RB0A 3JTOA 3KLHB 4Q0BA 3ZSYA 2OELA 4BR2A 2KNJA 4DV2K 2WVEA 5C42A 5D4NA 1URNA 3QSIA 4C8OA 5FRNA 4FNIA 3W5XA 1W7AA 4B3MK 2GWKA 4FW1A 3O9UA 4WKRA 2XHBA 1APSA 1AUSL 4DLEA 3SUPA 3UE2A 3I0SA 5IS2A 2GX9A 2YNIA 5AR0A 4FZXC 5J2PB 3RJFA 5J0SA 2DNQA 2Q36A 1VQPS 1NO8A 3F5TA 2ZHAA 1J53A 3R5AA 4IC9A 2W2QP 4FJ9A 2NYHA 3A5OC 3PACA 3V9ZA 1SKWA 3N5FA 2PEBA 1B7FA 5ALNA 2GVZA 5D0EA 4PL7A 2MAXA 5AHXA 3JAMY 4KREA 3K0SA 2JGUA 4U6PA 3S6JA 1SV5B 1FFGB 3M6UA 3P3DA 3MUMP 1V38A 3P8BB 4DI6A 2IBKA 3D0HE 3PFOA 2K4HA 1NDLA 2ZOFA 4P2SA 2UUCF 4EENA 3KNAA 2GHWA 1U47A 2YV0X 4CI6A 1RA6A 3NTUA 5K14B 2E8PA 4BC4A 1NJWA 3RGIA 1HBNB 2BJEA 2QWLA 1FESA 4H5TA 4PR6A 1PSDA 4JRQA 1MWZA 3D2WA 1RBOB 3EKSA 3GV5B 4CM2A 4XH1A 4G9ZA 1DHMA 4LD0A 4G65A 4NLZA 1PYOB 5HQ8A 1VQ9S 2EPIA 3H40A 1WBBA 3Q2TC 2Y1IA 4CHZA 3CJTA 2O4GA 4NY8A 3Q83A 2F8LA 2YKQA 3AB4B 4DX5A 3AY9A 3H45C 1R59O 1MN8A 1VQNS 3T41A 2M3DA 5LMUJ 3U9ZA 4UBCA 3RBDA 3CO9A 4V19S 1H0HB 1YTUA 3N7RC 1S59A 3A8EA 4HAIA 4GC7A 4YD2A 1NM1A 5CZ1A 4DUZK 2LECA 3CEDA 1SL1A 1W26A 4B9LA 5ALJA 4NLTA 4NXMK 3FZHA 4M41A 4PXDA 2HGNA 3GTYX 4B9MA 8ICHA 3ET6B 3NVMA 4CEAA 1HW9A 2VWBA 2V50A 3X3UA 5F2RA 1WOSA 4JYAK 1DTTB 2BXJA 5HMMA 1FNOA 1NZ8A 4ZVFA 1XQSC 1H7XA 1CC7A 4PG6A 4BVOA 4C3LA 3RH4A 4A2AA 4DR2F 4OX7A 2RS2A 2CPJA 1NOMA 1UZDA 2DNOA 2ZVIA 4OKJA 2AGOA 3CD6N 3HHLA 3SCJE 4J9RA 1N5VA 3I9ZA 4PPDA 3V5RA 4LF4F 1FNXH 4M9HA 3HTVA 2MKYA 2VBYA 5LY3A 1RACB 1VSDA 5AIAA 1UJ4A 1JALA 4IG3A 3W7BA 3QNOA 1SJQA 3H4DA 4S0MA 5M2UA 1KVJA 1IN0A 5JICA 1PUZA 1WNSA 4M3UA 1SH0A 3CC2S 8ICSA 5IT9U 1DGJA 1RXVA 4MKBA 4NXMF 5BRHA 3TAMA 3QRPA 2OPQB 1FI4A 3NUQA 2JH7A 5CZ2A 1TUYA 3B82A 3AQPA 4RW4B 2NSCA 2LYAA 1Q82T 3MGVA 2J7WA 1A0OB 4PQUA 3N0VA 5EDWA 3MECB 2W55A 2JR5A 2FPHX 4NOHA 1IBMJ 3AD9C 2IDEA 4OYAA 4YXJA 1NJZA 2CQBA 2ILZA 4CLSA 3ITHA 1XMQF 3Q8PB 5E3RA 4QIWD 2EI5A 1U09A 1UJ5A 1I6JA 2KG5A 1OY6A 4F5RA 1L8LA 3NL0A 3F73A 2F4FA 1XU4A 1TV6A 3M7VA 3CMAS 4DTNA 3MK6A 2FSNA 1KW4A 4AHCA 4USAA 1H2TZ 2IDOA 4C4RA 4QZHA 2OI2A 5E5NA 1S22A 4CJUA 4CLKA 4J9PA 2RE1A 2VA2A 4AL5A 1RCXB 3BR9A 1O8BA 1Q1KA 2P9PA 1RDAA 1U1MA 3OL6A 4UB2A 1UPPA 2EKNA 4RR5A 3FYHA 3NS5A 2L08A 3VEYA 2ERRA 4BC2A 5ALDA 1F9FA 2BQUA 4FZLA 1IKWB 1HARA 4DOBA 2OHFA 2VFUA 4CF1A 1S99A 2CQ1A 3E9LA 3QWUA 2BANA 4JV1A 1AYEA 5M1OA 2XQCA 2OPPB 2B8QA 5AKXA 3TVKA 3BEGB 3BF1A 3H1VX 4NLUA 1VQOS 2Z30B 4NEZA 4N8OA 3SDEA 1ZQZA 4RG8A 2KJ9A 3DLRA 2LQ8A 3ISND 3PYGA 2C2OB 5AI5A 4CIEA 4KV8A 2FJ6A 3QJPA 4I9LA 3R3LA 3D2EB 4IQWA 3VEWA 2VQEK 5HK4A 3BN4A 2EG2A 4UZCA 3NGKA 4NE9C 2BEFA 2RU3A 2RD5C 2JLEA 5DB9A 1GLEG 1UP1A 1XEZA 2AGQA 1MWKA 2NYIA 4F71A 2AP6A 1R0AA 4FZNA 3I55S 1S1WA 4BBYA 8AT1B 4E7LA 2WFAA 5L1MA 2IJRA 3DM2B 3H5SA 5AI4A 3SAGA 5IXUA 2GO7A 1GNKA 4F4AA 2ATLA 2RIJA 1IKYA 2CNKB 1YRUA 4JEPA 3VEZA 4LSNA 2PYLA 7ICSA 2MQPA 4WQ5A 2XLIA 1U48A 5AKEA 2UP1A 1HPMA 2CKWA 2H5EA 4J2DA 3CCMS 3RG6A 1Y10A 4PZOA 3ZD9A 2QSFA 3GZ7A 2ZDPA 4F0KA 2F4VK 1Z4OA 8ICRA 2JZ5A 2I5JA 2VQEF 2WCXA 2UXCF 3LF0A 4Y2JA 1HYSB 2XNRA 3LDLA 4KH1B 5GAGU 3FGVA 4YFUA 2X74A 1N63A 4ED8A 1IR2A 4FK0A 3DLBA 2Y0SC 3RBZA 4BXOB 1T9VA 4F3MA 1JLQB 5DDOC 2RJZA 1S72S 4JD2A 4ITSA 4YY3F 3BSOA 4ZKAA 2HMPA 1ZQQA 2R18A 4ZN1A 3RB4A 1TUGB 3CJRA 4TUSA 1VRQC 2RF2B 2AA4A 2J9EA 4EU0A 2YWGA 2W2PP 3AVBA 1LWEA 2KRRA 3P83D 1BA0A 3WT0A 2NZTA 1EP4B 2UUCJ 3EZUA 2ZH3A 5BRDA 2V8VA 3LP1A 2NXJA 1OH6A 2DXDA 2CPYA 1T0TV 2WSEC 4Y2XA 3Q8LA 4BRKA 3V1OA 5K8MA 3HT0A 3NGZA 4DV2J 3IBCB 1V5VA 4DZDA 1VSFA 2AYMA 1ZC6A 3EXCX 2RQCA 4P2FA 2OEMA 4KLHA 4OYMA 4FF4A 5E2QA 2LQ9A 1DK2A 5KT4A 2DFFA 3NF9A 1SL0A 2HWHA 2DHSA 2ZH4A 4RUCA 3NFAA 2QLTA 3AVGA 3AVMA 1JCGA 2H3FA 3BDPA 3MCOA 1LWXA 1H2VZ 3EDQB 1BNPA 2RB7A 1YITS 1K9MT 4MFCA 4CDIA 1S1UA 4JKFA 3UPQA 2FMSA 1PZNA 1BMQB 3KLEB 1SXDA 2CPRA 4LQ3A 2ZD1A 4I2IA 2D8CA 1M1HA 1QUVA 2CUYA 1HEKA 3QINA 2VJUA 1JLCA 4M94A 5AICA 2ILYA 4Y2SA 1T9XA 4JB8B 1HIYA 3P4UB 3AQOA 3ZSWA 4RQ3A 1HPZA 2Y9HA 1JX4A 2ZXIA 1RAFB 4W5TA 2VFTA 2GAGC 2ZH9A 1JJ4A 2Z4PA 3C15A 4P2XA 2F8SA 5JU5A 5FDLA 2QARB 3OYNA 2WF8A 2X3DA 4JKGB 3JSMA 4PA1A 2B9EA 4E7IA 3JPOA 2VGNA 1EWQA 1T03A 4HDGA 4M04A 3UDLA 2MU2A 3CHWA 4B9QA 3W9JA 3GFYA 1WHXA 3QSYB 4X65F 1PVRA 4GKKF 2CJBA 2P66A 5A0YA 1S6PA 2BX6A 3E1YA 3NCIA 2DY4A 3KLIB 1Q8LA 4MO5A 2HZCA 3R7SB 1RBAA 4YQWA 4E7HA 1ZQEA 4A8XA 1I5OB 2GEMA 2LQ5A 4CEOA 3ETLA 3Q22A 4DUZJ 2LEAA 3M8ZA 4C7YA 2YWFA 5AJ3K 3KNGA 3H8YA 3M8PA 5J0OA 4GC6A 2FVSA 3O1WA 4NXMJ 3NASA 2W25A 3RMDA 4BR5A 1MMLA 1TVRA 2QWNA 2VKZG 4IOXA 1T4GA 4BGBA 1A7GE 4LH5A 1PAEX 1NAQA 3DXBA 3T6JA 4EK2A 1IWGA 2ACYA 5CP2A 5ALPA 1YJWN 4JYAJ 2VFRA 5KFMA 2UUAF 1DTQB 3J80Y 5J2IA 4LH4A 4J9KA 2VL1A 4HHUA 4TY8B 5IT4A 4N41A 3KKAA 3UQ0A 4DPWA 2E7VA 3Q0AA 3D68A 3PJWA 1WSRA 2CPZA 3W2WB 1TKZB 1NI3A 3MGHA 1S1TB 2HBLA 3T5JA 2QWRA 9ICFA 4EI2A 1XMQJ 3F44A 3HX9A 3M9OB 3PJ9A 1NHUA 4KLEA 3OPKA 5B0FA 4YVZA 1UW9A 2EBGA 4FZYA 5G4DA 4A8WA 5GIPA 1Y0HA 4RBTA 3CCJN 4CLZA 3KYLA 3KHYA 2DGXA 4KRWA 1Q3UA 4KR0B 1IBCB 3HL8A 2XC9A 1GMUA 2HHWA 2JSXA 4I64A 5D4LA 2PA3A 4TYBA 3BSCA 3FZBA 2HRTA 2YNGB 3S9HA 3T1YF 4HDHA 3V81B 1TL3A 2Z2MA 4TVAB 3IN5A 2R8HA 4B1ZA 4OHVA 2ZVSA 2OZMA 1T3OA 3D67A 3KVGA 1LW2A 1FRJA 5AKZA 4RW7A 2R7UA 2PFDA 2YPYA 3BPSP 1NGGA 3BF3A 2ZTDA 1MU2B 2WFBA 4NM1A 1FE0A 3OYHA 4B3SK 1PJ5A 3LVWA 4UB8U 4J9VA 4WFAL 1LNQA 3C2KA 5KFAA 1TL7B 3L4BC 3AVJA 5EE9A 2YQ0A 1NDKA 1NK0A 1GLAG 4N5SA 4U8VA 3P4IA 2QLBB 4F36A 3NVVA 3RB3A 1EKRA 1N60A 1RKIA 1S5JA 2LVWA 1FJ7A 1S12A 5J2MA 4LR9A 1U0HA 3IKMA 1FE4A 2K8BB 3GMGA 2HSZA 4FXDA 1WG5A 5L1JA 3MEDA 1U45A 3ENHA 3OYDA 4DR5F 2D0OA 2LFVA 2X1GA 1WC1A 4ISGA 1D5AA 3ZI4A 2KTQA 2R9LA 3LVVA 1LQ9A 2EWHA 3THWB 5CB1A 2DNGA 3QUTA 4P74A 1RG6A 4LUBA 3QT6A 3AM9A 3QRQA 5CCLA 1T05A 2W8KA 1TGOA 2B0CA 1YVFA 5AQUA 3DLGA 2HFOA 1RXWA 1X4AA 5HVFA 2MPUA 2G2ZA 2KKPA 2CIMA 1HUOA 1YJRA 3UKRA 1S4FA 4CE6A 5JLHA 4FJKA 2BJ7A 1FDDA 3AVFA 4K5SA 5KTQA 2E1AA 3P6YC 1WI8A 1S5ZA 1S1XB 3BF4A 2B9XA 1SC6A 2B6AA 2VQEJ 1IJFB 4WIIA 3IR5B 2LA6A 5GAGP 1QQOA 4KBOA 2EX3A 2KFZA 1Y11A 4GVBB 3RW6A 4RKUC 3AA3A 2KVCA 3Q7CA 4P4OA 2DPJA 1GTEA 4ANCA 1VSJA 4AILC 5HL7L 2ZWHA 1QAIA 4DR3K 5KG0A 3CC7S 2P6UA 3AB2B 2VANA 4BCAA 3LDNA 4CCHA 4PHPA 4L3KA 3LWMA 3C21A 4Q43A 4H5RA 5CAAA 2FIUA 4UOCA 1VR6A 1XERA 5T7LA 3E51A 4IOCQ 4YB7A 1XNRK 4BRHA 1YJ9N 1WDDA 2CGJA 4I27A 5C24A 2AJ0A 4KLJA 4YOXA 1ZBLA 4W5OA 5CJ7A 3SFUA 4ZVPB 2E1RA 4TKTA 1F1BB 4YOUA 3HHLD 5CYMA 2F4VJ 2ZBPA 4NYNA 2KT5A 2VOPA 2M88A 3ZDAA 1Q78A 3QFUA 2EAOA 1X8DA 5I3UB 3KJNB 2C3YA 4ZLPA 3TAPA 4HYKA 4DU3A 1QQCA 2FHMA 2A1AA 2NPIA 4YMNA 2B51A 3OYEA 2C1EB 1LFPA 4H03B 1NHKL 1ZOTA 2OTJN 4DU1A 2KRBA 2B8PA 3DLKA 5EX5A 4LBIA 3AAPA 1LVHA 5IQQA 2Z58B 4X4VA 2G8KA 4ZP6A 2XB2D 5F3XB 1NNEA 4U7UD 2CDQA 5AXKA 3I8BA 2CQHA 4KIAA 4TLRA 3WK9A 4OQJA 1KFTA 5ETOA 4Z2XA 4UATA 4CHOA 3MXIA 4H0XB 3R8YA 4IBNA 2QKKA 4WYBA 2EVZA 3QIPB 2O3DA 1JJ2R 4OGEA 3U9DA 4LFAK 2FDNA 3MN7A 1R8HA 5C2DA 1UCNA 4CLFA 3DCAA 3VF0B 5DRKA 2B0GA 3VQAA 2HNZA 3AA8A 3AO5A 2VH7A 4M5JA 5GTHU 2ITMA 2G8WA 1AT1B 5ALEA 1WHYA 2KM8B 4J9LA 3SPYA 2KLAA 4NCBA 1WG4A 1P90A 4OI1A 1ZQ1C 1IBKF 2YI1A 2B7BB 2YXLA 1PYSB 2BE2A 2WONB 4F92B 4URSA 4ZP8A 3ONQA 3OYKA 2KK0A 4UZBA 2A41A 4X65J 1MROA 4KO0A 2M0GB 1ZQUA 4JI8K 5LM7E 3IHQB 1KQFB 2P9GA 2IMWP 3ZZ0A 4DTJA 2HWTA 2UV8A 4JI6F 4YB6A 4H4OB 4L73A 4LSLB 2FF3B 3V2UC 3K1ZA 4OLBA 1LOTB 4NM2A 2D7SA 2L48A 3RBEA 2VU5A 1NBWA 2DNPA 3JPNA 3H2UB 3WXJA 1NCLA 5IIOA 3B4DA 1R6VA 3M32B 2CWXA 3RMAA 5HP1A 2YNFB 2FGOA 4G6VB 3KWGA 3MM7B 1LXNA 1VCTA 1BCMA 2CGKA 4YHHF 3U6FA 5CHGA 1SB6A 3KJQB 5AQGA 2UUAJ 1Q81T 4E2FB 3OV7A 3SSSA 4ERDA 5LSLA 9ICQA 2GVDA 4ISFA 2QLFB 1HWKA 3Q8SB 3RFAA 4FF1A 1TFYA 3MXMA 1UL3A 2KKZA 3P39A 1ZPWX 5J2QA 1ICEB 3MUTP 2ALYB 3Q86A 2QI2A 2RKIA 1VC0A 2ZIUA 2GIQA 4O5FA 3UMGA 3MMVA 3NCPA 3RR8A 1X6IA 4HVZA 4K5RA 3UVJB 3NNHA 3L3CA 5KQ8A 3ULHA 4QPXA 4LRBA 4K59A 3VVUA 5D3GA 5I42A 2O8CB 1RT1B 9ICAA 1XNQF 1HWUA 3L2QA 3PJXA 2D9PA 2F7VA 3ZTSA 3ZLJA 3CRXA 4E3SA 3HYFA 1PC4A 2V4JB 4W92B 3H59A 5HBMB 3EGZA 2W4PA 4F5NA 3P5BP 4PCQA 1JLAA 1OW5A 2PMZC 5EWFA 3VQTA 3G82B 2G0AA 4CJ5A 4IJNA 2HBJA 3K1RB 4MF2A 2C22A 2YX7A 2PSZA 1WJ9A 4QOTA 1WSGA 1BC6A 4I67A 2HNYA 3O9TA 3PXGa 3Q8MA 1ZM9A 2KJVA 5B7WA 3OT9A 3RF9A 3KUGA 2E3TA 1HX1A 2B9WA 1NHVA 3M1FA 4CDGA 3Q8QB 3MMCA 4Z0UA 3OYGA 1OUQA 1K1SA 1TK5A 1VQ5S 2DHXA 1F2HA 3HM9A 5B0AA 3H8JA 2HHHK 4DOZA 2QX0A 1OKJA 4RW9B 4CF4A 4NZ6A 2BE7D 4QS7A 3U3YA 4KY3A 3D5MA 3CJQA 2KDOA 2FD2A 3KKFA 1FHTA 3FQLA 4NMXA 1UHUA 4HTLA 2CADA 3D0GE 4K4GA 3KLFA 4DR5J 4PG8A 3KBBA 1WB9A 1NZBA 3KHHA 1S57A 2N4CA 3HVTB 2OSQA 2UYTA 4KN7A 4ZIWA 1RE1B 1E6YA 4LF7F 2EWSA 2VYPA 2WB1D 2UV8G 1J27A 1UVLA 2GHVC 3F2BA 3ZCMA 3OLAA 1OPZA 3I6PA 3PLAA 2AJ1A 3MPWA 1BQMB 1ZQLA 1VIXA 2GH1A 1S6QB 3GYNA 2YMLA 4Y2UA 1MW7A 2JVOA 2CZ4A 5IWAK 5EOYA 2UXBF 3OJSA 1BPXA 4Z6FA 3TQ1A 2NRRA 2ZIWB 2AQ0A 7FDRA 2D3O1 2PEHA 3RSEA 2MZJA 2OD4A 4RJVA 3WK4A 3WK6A 2KHCA 1L8OA 1ZZFA 3H1QA 2HHHF 4TSXA 4PPXA 4C4TA 1OJ4A 1MWYA 4J9NA 1G2EA 1BY9A 3QEVA 3Q8VA 2PKEA 4UOGA 4QWDA 2KMDA 1FFVA 5E33A 5GAHU 6FDRA 2YHAA 4BR9A 1RAOA 3B6OA 3B54A 4O8KA 2Y0SF 3V7LA 4BC7A 4ZCLA 3HT3A 1TK8A 5GAEU 1HJRA 1ITPA 2NV3A 2BKOA 4OX9K 2HAIA 2RVJA 3CJ3A 3R6GB 4G3IA 4CZFA 3UQSA 3KWIA 1CLFA 3H25A 4R63A 1KEKA 3JXOA 4MKYA 3PNCA 3AJ1A 3C3LA 4NLWA 3E58A 1Y5NB 2ZC4A 3WXMB 1ELOA 3B78A 3OBYA 2XMJA 5IWAF 2AMCB 3ZT1A 2WRMA 2ZIVA 3BSAA 1HI1A 4ELTA 1SQGA 4CEEA 2P1JA 3KK3A 4OJ1A 3AUOA 5AQOA 2LMRA 3UMBA 2BQ3A 2HK3A 4I7FA 3OR2B 3UWTA 2HBKA 5LSRA 2CJQA 5T14A 4MT1A 1VDVA 4WYWA 2F1JA 1VRTA 4XAKA 2VKQA 4H0TB 1SJFA 3ISCA 2GUIA 2BJDA 4G1QB 1YJ9S 1HR0K 2G06A 4K50A 1KFDA 2R7QA 1N32F 4DL6A 5CHCB 4Z6EA 5DMRA 3C1YA 5A6WA 4DL5A 2FVRA 3QEIA 3TX0A 2IHNA 1S79A 3CT9A 2MJNA 2YY3A 5ALZA 1RWOB 3MMBB 4OX9F 5EE1A 1RTJB 3A3OB 4AQYF 1XNRJ 4CWBA 4EX7A 2V8PA 4HR2A 4NLBA 3C6TA 3RAMA 3PEJA 5TKWA 3M05A 2JRSA 1I1GA 2KICA 3RU0A 9ICVA 1EQMA 4R5PA 1ZBHA 4OV1A 2ZE2B 2CPDA 1S10A 1HD0A 5KFKA 3J81O 5AFUA 2OTJS 4HT7A 1J6ZA 3QYYA 4KLFA 2R7YA 2W43A 3CCES 4FOEA 4AHTA 5FROA 1IBKJ 2X7IA 4K41A 2ZJRL 4UAYA 2K60A 1NZAA 2ZJQQ 2V5HG 3NHGA 4L74A 2EFNA 4JD2B 1V4SA 1JCFA 5F41A 8ICMA 4PZVA 2LDYA 1T3QA 4FWQA 1X0PA 1WSHA 3PG9A 4EELA 1KR4A 1VQ6N 1RDCA 4YUDA 4JI6J 1FWPA 4JI3K 1RDRA 4O3NA 5CYQA 3EVMA 3R2CJ 2OPRB 4O5CA 2HHXA 4LFAJ 4YEAA 3PM9A 4MLHA 1XHXA 2AT1B 4IDKA 2YNHA 5A8RB 1SUQB 5HSPA 4FF3A 4NZ0A 2EFGA 3FCHA 3VAFA 1WC3A 2QWPA 4QZ8A 1FT8A 2MKKA 3F2KA 3HJVA 3QT8A 2FMQA 2HQCA 5ADXA 3BBFA 1WC4A 1JLBB 2V63A 3M2UA 4ES3A 3G8TA 1N5YB 4ZJOA 3I28A 2ADCA 2HNDA 1FVQA 4CJQA 3QNWB 4JB3A 2CQCA 4CBUA 5IC6B 1YJTA 2FVQA 4LF9F 5DDMA 3L2VA 1JN3A 4NRTA 4JI8J 1C0TB 2DK2A 3QU4A 4IO1A 4GNIA 3MEKA 3MX2A 3HFKA 2CQPA 3GL1A 3D66A 3M1VB 4JHDA 3NDKA 1FF2A 1LWCA 3NGSA 3QDKA 3QBCA 1Y3KA 4IFVA 1SKRA 4NLQA 3TA1A 1JXVA 2NRTA 4DF8A 3VF6A 4GKJF 1LW0B 4FWMA 2C2MB 3C2PA 5KNIA 1T6DA 3O1BA 2DNZA 4DPTA 5C15A 1QAYA 1S4EA 3M6XA 4FWKA 4CZJA 2H48B 5HROA 3CCWA 4K4HA 2ASPA 1QM9A 2F9WA 1WORA 4M5DA 1DKGD 4CFDA 2VA8A 4I2PB 5BN8A 4X4OA 3HZEA 3G10A 3NG8A 3V9SA 1LXJA 2ZOMA 4JKBA 2EAPA 9ICTA 1WYGA 7ICOA 3NE6A 3D9BA 3W64A 3WKDA 2Q3PA 2W24A 3D1HA 5A8WB 3DGPB 1YBAA 3THVA 3G6YA 2P9LA 1YT3A 2DT9A 5AZIA 4FLXA 4USWA 3K9KA 2E1EA 2Z1GA 5F8LA 1BPZA 4D3GA 2FJWA 4UBBA 4MYUA 4NLDA 2LQBA 4Y2IA 5AT1B 4ZVQB 1X66A 2PA8D 3FFIA 2VDHA 4XIUA 2I38A 5EX0A 4F5QA 4J91A 4KHPK 1RWXB 3IMQJ 2CPEA 3PRDA 5EE3A 2Y3YA 5J1PA 1U6BA 5TZVA 1Q5YA 4PKGA 3EE3A 2P5VA 3LH2S 3K5MA 1C0FA 3OYLA 4ID5A 1JLEA 3AEVA 3BR8A 9ICKA 3KOAA 4KKOB 2BA9A 4P73A 1MN7A 3E66A 3I0RA 3HHNB 4PGQA 2LEPA 3I56S 1BIUA 2IHMA 5L1KA 4P6QA 2UXDK 1ZQXA 1N2XA 2CQGA 1GK8A 4C8YA 3W0LA 2VPYB 4CLTA 1Q7YT 2CQDA 1ZTWA 4C98A 3LDQA 2BABA 3M2VB 2VV5A 5AKLA 7ICFA 3OYFA 3AV9A 4FO0A 3I76A 3VTIA 4M9JA 2YVSA 1WF1A 1RB0A 2DEJA 2P9IA 2VPWB 1U1RA 5BXIA 3QEBZ 2H9ZA 3VQQA 2E2QA 4KGVB 4F2SA 8ICEA 1VRUA 2ZFHA 4QS8A 2BOPA 4AM6A 2VF3A 4NZ7A 1YWXA 2HHHJ 3KK2B 3QBWA 1SH2A 2BKPA 2IRXA 5EGYA 4KHPF 1UW4A 2NUUG 1ZQMA 1S9GB 5GAHP 3OXFA 3B8HA 3KK1A 3W1YC 1RFQA 4A62A 4TURA 2PZSA 2V0NA 4AYBD 2VBXA 5EWGA 4ILHA 3NY0A 4USKA 2LLZA 5GAEP 3SQ1A 1FERA 5T7BA 4I6MA 2UUBF 3G8SA 4DCHA 4RT3A 3TZYA 2ZBCA 3VGLA 5DB8A 5DG7A 4OPHA 4KSEB 3J7ZT 5BYQA 4B1VA 3NGIA 1RJJA 1JXEA 3V1QA 3TP2A 5KG3A 1KOHA 1NSKL 4OJOA 2Y0SD 4DQRA 3LGMA 1HBOB 3M6ZA 1NJIT 3ZZZA 3C23A 4I9QA 5DQIA 4DL7A 1UFKA 3ZX0A 1O5JA 4RW8B 3TEGA 5H1SV 2BPGA 5IWAJ 4F50A 4B9SA 3HXMA 4NWIA 4FWPA 1RCHA 2ASJA 2P35A 1N56A 2X3GA 1B7YB 2IBOA 4DQIA 4DZ6A 3HOSA 3ED5A 4DV6K 1ZS6A 1WCLA 2FF6A 1BUXA 3B0XA 2ASOA 1J5OB 3V6DB 2PFOA 2L5YA 4DSEA 1B9DA 3I9V9 1L5UA 1S77D 1CZ9A 9ICEA 4DFDA 1N6QB 4IDHA 2KL8A 1XQIA 4ZTFA 2XSFA 4OX9J 5H9EK 1PAUB 3TNVA 1HNZK 3L7UA 1BOTO 4RO0A 3W60A 5IM0B 4K4WA 2RRAA 3MDFA 4FWOA 2NS1B 4OJPA 2XYHB 3VQ5A 2U1AA 4BG9A 1SXEA 5AM3A 4QWAA 5AQFA 2B6AB 1HRHA 2KJ8A 1K1QA 1HNVA 3HFVA 2A6OA 1ZQOA 3DRPB 2W40A 4BRFA 2KD1A 2HF4A 4ZVOB 2LM1A 3AOBA 3H90A 4A61A 3O4WA 4FJNA 3SQ0A 4NB4A 3QU5A 5JUMA 4DV3K 1YZ6A 1GMWA 2E5LK 5K8OA 3L2WA 7ICGA 4PXEA 4K0KK 1QTNB 2QWQA 4OZ1A 4BRLA 1T3VA 2I5HA 1SWWA 3CJAA 4BR7A 1WOQA 4AFFA 1BPDA 4DV6F 4BREA 3JPPA 2QA2A 4KQZA 3UXPA 3DOLB 2JWLA 4NYFA 3OHAA 4IR9A 3NF6A 4HUEA 5BPLA 1SKSA 4HH1A 1IR0A 1MSWD 2FHOB 2FJVA 2HVDA 2D41A 1NPKA 2R2UA 9ICOA 2BH1A 2W42A 4KLOA 5ALMA 3P5JA 1DRZA 3SQIA 3FRYA 2ZWOA 5CYMB 4R8UB 3TTDA 2GMHA 2K1RA 4I2QA 4DUYF 4E19A 5BPMA 4KAZA 4PAAA 2DBBA 3BY5A 4ZA1A 5JLFA 2OP5A 1QQMA 3PW0A 3JAMO 4X62K 4F0MA 2E5LF 4ISEA 2F9TA 2V7YA 3T1HK 2FC8A 3PNIA 4LZGA 3FMBA 3HHDA 5GMEA 4CYUB 3VZIA 2N7YA 3WKEA 2HAFA 3ENQA 2DPNA 2AIRB 3C16A 1WEXA 1RT6B 2YMPA 1NG9A 3CYMA 4OHXA 2F96A 2ZNYA 3D6FB 3UI3A 3V7KA 1KVIA 3OL9A 1UAWA 3Q24A 3CM5A 4F7VA 5ETNA 3THXA 4GKJJ 5IT0A 4JI3J 5EN1A 1K8AO 1QVFR 1KCFA 2XG8A 4Q8EA 3NOCA 1HBUB 1RYSA 4QCLA 2GAHC 3LUYA 3QUBA 5CH7B 2WF9A 3J7AP 3AOCA 4AF1A 4FLZA 2YY6A 3AXKA 2E6MA 3GILA 1GMVA 1Z26A 4I6YA 2HFZA 2HSTA 3VAIA 1CJTA 1CEZA 3P49B 4X62F 1XK8A 5KFZA 2DYAA 4GMKA 1BI4A 2PMZF 1SC4B 3F9KA 1ZQDA 3A5NC 2DQNB 1RTDB 2DY1A 4LRFA 4BS2A 4KGXB 4DG1B 2A6MA 5H1SQ 2KQ2A 3CCRN 3AA2A 5CABA 4HI2A 3PW4A 4ZPVR 4UW9A 2UUTA 2P6TA 4KTQA 2C2ZB 4ED5A 3EE9A 1LOUA 1R3NA 2LA4A 3MEEA 2MSSA 3ZX2A 2OEKA 3SLCA 5AI6A 1LWFB 1XTZA 4YXMA 3CDAA 5ALHA 2ZF5O 3VA3A 1P7DA 4IQTA 2ESEA 2LYVA 3CCZA 4I4BA 2RAQA 2BDPA 1F5AA 5HP1B 4F5PA 2KZMA 1K6YA 1FEHA 3ETOA 3LAMA 3KDNA 1ZM2A 2IAJB 1SJ1A 1U1NA 1K0VA 2F8EX 3B0YA 3M30A 3O6WA 3SMZA 3K2YA 4HACB 1P6TA 3GIMA 4DQQA 4AHUA 2LQJA 2HG4A 3J7YU 1BPEA 2V4RA 3D6TB 2XIDA 3VAGA 3LANA 2NYVA 2GQCA 4KE5A 2DGTA 3DWLA 3AFGA 4C2MA 5AM2A 1RQNA 1QDUB 5D4PA 4A8KA 4GY2B 3RMBA 4NXNK 2UU9K 4HCBA 3ZT4A 1Z00A 3HPHA 3NAHA 4XQ8A 1RAIB 4B9NA 2ZIUB 4BRQA 3ISNC 4JKCA 4CLUA 1N34K 2OEJA 1A6SA 1DOQA 2G0CA 3WQUA 2QN6B 3RBXA 2DD8S 5F0WA 4LBHA 1RWUA 1R8PA 4DFMA 4JI1K 4CEDA 3IBWA 3LZJA 5KFSA 1FKPA 5J29A 3PYFA 3HZGA 2E9ZA 7ICNA 3TI0A 8ICLA 1S1VB 2C2EA 4KHPJ 3JAMU 2O8DA 5AK3A 4CTAA 1R31A 3IG1B 3CCSS 4G1PA 4QIFA 5C12A 3CTRA 3CF5L 1QQ6A 4HEA9 2JHEA 5DJBA 2EFVA 2B4PA 3WNEA 4NCGA 2VA3A 1S9EB 3G6EN 4JI0F 2CN1A 2JDJA 3QWPA 1LKZA 3FEYB 2OXOA 2IVNA 3HSCA 2JOQA 2UXDJ 2ZGZA 4EWTA 5AE3A 3MR2A 4IG0A 3NBPA 2A10A 2QMUB 1OS5A 4ZPBA 5K4LA 2V67A 3LP3A 4K4ZA 3N01A 1N61A 3OTBA 5ALWA 3CCLS 3TWZA 2XHWA 2C3OA 1BISA 5AM5A 4OZ5A 4QYZK 3QO9A 3ZEUA 9ICCA 2L41A 2NLXA 1VSHA 1W0HA 2YHYA 4BR4A 3BZKA 4OYZA 1NLVA 2DHAA 2G5IB 3KD3A 2G4BA 1K8KA 4RNOA 3UFCX 4Y2YA 3GBTA 3AAQA 2DGOA 4WFBQ 3PDNA 4CJVA 1RTHA 3JYTA 4Y2VA 2DIVA 2G2OA 2HFSA 4H0PA 1SS6A 3HD2A 2PYJA 3KJVB 3UNYA 3VGTA 2W9CB 3O3HA 3ZSRA 3CD7A 4RNHA 3LA0A 2KE7A 3JXUA 1FDNA 3E01B 2NRZA 3MCPA 2KG1A 2ZITA 5KFEA 4RT2A 5HQLA 4IO9Q 3LGNA 1X7VA 5AXLA 5KFLA 4ZLJA 4DPUA 3FKBA 4RQ1A 4UOFA 1QZ6A 4IR1A 2RDIA 1NGJA 1NJXA 2CNNB 4BRMA 2J7KA 4H5VA 2AEJA 1N62A 3MOZA 1EXQA 4LVSA 3MEGA 1F9EB 5LT5A 4C0OC 1W9HA 2VG5B 2BCUA 5HMXA 9ICNA 2BVZA 3OUYB 1KD1T 1Z05A 5J2EA 3POTA 4WFZA 3QAUA 4LRDA 8ATCB 4DV6J 1M1KT 4AUKA 2IA0A 4B6JA 1HKBA 4M7YA 2CJAA 3DYAB 3M8WA 5C10A 2RRBA 3QEWA 4RQ6A 2YMQA 3RH6A 4GLXA 1JJCB 4A57A 3OTQA 2PFNA 3GJQB 3JQMA 2HI0A 2ZHOA 3QICA 4B1YB 3LGHA 4NLVA 1N33K 5H9EJ 1YVNA 1VK8A 1D1UA 1HNZJ 3EEQA 4NI2B 2OWOA 3QPIA 2HQDA 4OX6A 3H2LA 3NS7B 2DPIA 1UFLA 1X9WA 1SB3C 5AE2A 4CO4A 2PFQA 8ICKA 1IG9A 5AM4A 4EYIB 5L9NA 5K20B 4IUFA 4DUYJ 3WHIA 1GLJO 5HOOA 1PC5A 4A8OA 3OR1A 4F3QA 1ILYA 8ICFA 4I2FA 2OEHA 4BGAA 3HILA 2JFDA 3OTEA 4DV3J 4BRNA 4DFKA 4CNYA 2E5LJ 2OJ3A 1Y00A 5J2NA 4K0KJ 2B5JA 4X2BA 5ALQA 1RGIA 9ATCB 2GS8A 3G6VA 1BD6A 4MIAA 1FK9B 4Z4HA 3FDSA 2YKMA 4YOTA 4IFYA 2E5SA 4A8MP 1Y97A 5KPRA 5ETTA 5HNKA 2MEWA 3CD0A 1JUDA 2VZ9A 4OGCA 2JGAA 1IIPA 2MYFA 2W41A 2HQ3A 1QQ7A 2O8BB 1VSMA 2EKYA 3J8AA 2YWWA 5IT9Y 3I87A 4AL7A 4DHVA 2HHUA 2P2CB 5GAGI 1CJKB 4ZH4A 5ADXH 3MR6A 3CSKA 3IP0A 3C6TB 5K5MA 4M0AA 5AQNA 1QHTA 4USIA 2QFJA 2JJ4D 2GJFA 2CG8A 8ICIA 2HOQA 1HUXA 1C6VA 1YHQN 2KHOA 3WQPA 4Y65A 1NK6A 4WIQA 1VQLN 4ZP7A 4X62J 3Q8KA 2XWXA 2QG9B 3W8GA 4BG8A 2F76X 3T1HJ 2LXIA 1IV0A 2ZH7A 2R3VA 4MMOA 4DJBA 3QFWA 3KK7A 4QZBA 4B8CA 4IQMA 4UW2A 3EXYA 2D0BA 4LMZA 3KZIU 3RVCA 3PYDA 2JC0A 3GG1A 2OPSB 1UEVA 2PMZD 4XA5A 1DGKN 2JEGA 5I9EB 4LREA 1D09B 2QWMA 4BE1A 2DTJA 3C95A 2QL7B 4B1UB 3VAMA 2DGWA 3R9PA 4DHYA 1LFWA 1L6NA 1SJ3P 1OYDA 4AH9A 5DQHA 4ID1A 1RQLA 2JLFA 3SXLA 2POKA 2CZ9A 3AA5X 3J7YP 4Z4FA 2GOLA 2IOFK 1U7LA 3UCZP 2BW7A 4YN4A 2L9DA 3IM1A 2IY5B 4IRDA 5G5GA 2HKEA 5HLFA 4DS4A 3RJMB 4H4MA 4TYAA 2QB0B 5HVHA 1REVA 2WVBA 4BX9C 1Z3EB 1JLGB 3KHRA 3OVSA 3AY0A 2CNLB 1GLLO 3BS5B 1UVKA 1A9NB 4LF6K 3MPDA 1HNXK 5KG6A 2FY1A 4RQ5A 4FZMA 4ZPCA 1ZQCA 1T9YA 3J80O 3DDKA 4O3OA 5IOLA 3BPDA 2Z2LA 2A2DA 3K2PA 3NWGA 5KAKA 2JEIA 4JMUA 4CO2A 1GFWB 1P1LA 3H42A 3Q89A 1EX4A 4EHUA 3PEHA 2OLWA 4OD0A 3OTOF 1FXDA 1SZPA 4FXVA 4MEXA 2XGQA 4QZIA 4UB1A 1U02A 5J0RA 5DBAA 1NK7A 1MMDA 4NLNA 4HWIA 2KB2A 3DRSB 4O0IA 4F91B 4CK2A 4ZPAA 3PX0A 1IG8A 4OZNA 7ICUA 4WXOA 1HNWK 4DUTA 2XRIA 1UEKA 1RWWB 4NXNJ 1RBTA 2H5IB 3OYBA 1FJGK 1GMWD 3BQ0A 1LEOA 2JV3A 4WFNL 3GFZA 1NMEB 1EWRA 3SUNA 1C1CB 2HMIA 2D0CA 1N34J 1U25A 2MMYA 4YDUC 4LC9B 3NAEA 1X0FA 2PMWA 3WEEB 2D74B 2QW9A 1RBRA 4DR7F 1UPHA 1U49A 3FFIB 3U1LA 3S1TA 4M3YA 3S3MA 4P2HA 3OTCA 1SH3A 1VQPN 4JI1J 2XICA 1YI2N 1PILA 4PWDA 1DQ9A 3TUJC 1CI4A 1RISA 5D4OA 1X5PA 4QZDA 2OHDA 4XPEA 5B0GA 2A1JB 4OZ0A 1BIZA 2DNRA 5J0UA 2DITA 2XTJP 4FNHA 2XI9A 2IVFB 4DU4A 1AZSA 5DGBA 3K57A 3AVKA 3G6ES 3FBCA 3BGRB 3B9JA 4QZFA 2W9BB 5CHIA 5KFYA 1X3NA 4IEEA 3ENBA 2P9SA 4Y2RA 4K8XA 3VV2B 4UUWA 3V9XA 2ZZTA 3VQ9A 4P10A 3FRZA 1Q79A 5ALOA 4DR6K 4CGIA 2PN6A 3LPEA 1RTIB 2W2OP 1FKOA 3BV8A 2R8KA 3IC1A 1F5CA 4R25A 4BRDA 1ZRNA 2QFIA 1O0PA 3NGYA 3LALA 1FJGF 4WFXA 4JK8A 3BBCA 1HBMB 5E7OB 2B43A 1B99A 1FO4A 1PIEA 1QY7A 1T9TA 2H5JB 4ZLNA 4I2JA 1C1BA 1VQ9N 1RU2A 3CE8A 4P71A 5SZTA 3SQGA 2R7XA 3TPQA 5AQIA 5L46A 1ZM4A 2GV9A 4XEIA 1J2NA 1FXRA 2W11A 2DF4B 1NK4A 1KVKA 1UQVA 2YKAA 1V97A 4F0HA 3CJ9A 1TFWA 3G96A 4ZPTR 5HHIA 2BCVA 2VG6A 2ASLA 3NVYA 1Q7YO 1I94F 1IJEB 1TE2A 4FZVA 1OYEA 2EANA 4IFEA 4BROA 2F8TA 3MAAA 4MQ3A 4BACA 1JJHA 2MKCA 4NYPA 3TO8A 4UARA 5KT5A 4CECA 4DV7F 1CLQA 1VSKA 3TU5A 3FC4A 5JRTA 3IWNC 2DO0A 4KLIA 2ZBIA 3QU2A 2IHR1 5KAFU 1MDUB 3TKAA 4K2JA 4WE1A 4FCYA 5IIJA 4DR6F 3GV8B 2QA4G 2MHEA 3J80U 2R2SA 3GDXA 4A59A 2GO8A 4C7QA 1FWKA 2UVVA 1RAGB 1WTFA 1FRXA 1NGAA 3AA4A 5LMUF 2GIRA 2FLNA 3FGUA 4IEIA 4DB3A 4F4KA 1HQUA 3KOOA 4YR0A 1YBTA 3QATA 1IKXA 3ZTRA 3C2LA 4ILLA 4M6WB 1LKYA 2KEYA 4BDPA 2JEJA 3R2DJ 4RQ4A 1KVAA 3J7ZO 4F04B 4KPYA 1KAZA 3CJ5A 3IAS9 2HQFA 5A8KA 4A2BA 2A1RA 4ILMA 4J9MA 5KFHA 3V4IB 5KG7A 1IWAA 3DRRA 2CZVC 1X4CA 2ATQA 2H4YB 2N1RA 5M2PA 1W7WA 2J0XA 1NJIO 3K5NA 3KLGB 2IFXA 3LM9A 1WSEA 3CC2N 3G71N 5J1EB 3DLHA 2LMIA 1NXIA 5DG8A 1KS2A 1KQKA 3UN2A 3TAEA 1BPBA 3HK2A 3UD3P 1XO0A 3LP2A 5C2CA 4CF8A 3THTA 2BGGA 3KG4A 2Z57B 4XUSA 1ZQSA 1OSDA 1N33J 1NWKA 4F4ZA 2DNHA 4KLGA 2BPFA 2HMXA 1N5XA 2IOHA 1WKJA 5AXNA 1DARA 1PO6A 3WX8A 2R8GA 4PL1A 2F5GA 2ISOA 5AQSA 4ECWA 2IC3B 3OFGA 1U24A 4A48A 3CMAN 3PIOQ 2ZH5A 1UFWA 4A5AA 2QLWA 3PUFA 1NKBA 2BV3A 1NGDA 3PW2A 4FYVB 1NZPA 1ZD4A 3HRDD 3IS9A 2E2NA 4C80A 3DLLL 1HW8A 3HM8A 3MM9B 4CIFA 4CRJA 1R6YA 3B8AX 3O4NA 1F5SA 1YJVA 4WU2A 4ZIVA 5IC4B 4R66A 2JWKA 1VQ7S 2ROGA 1CJVB 3TWHA 2UVUA 2KVIA 2HOIA 4PY5A 1NDPA 2K4PA 5KRTA 1RWKB 1FX2A 1X4BA 1OIAA 1QAXA 1TKXB 2K4IA 2DNLA 2H1YA 4CESA 1YHQS 3E8OA 4JKDA 4CGGA 2W01A 1PJ6A 1RT3A 2JFKA 3WNFA 4A8QA 2CG4A 4QZGA 1ULRA 4LF8K 3HKZD 3G86A 2QIFA 4FWSA 3ZSVA 3AO4A 1PK1B 4IRCA 3AGKA 3OW2M 2AXTU 4DSFA 4DFJA 2GO9A 1VQON 2ZJ5A 2ALZA 2RLTA 1OSCA 8ICJA 5E26A 5EU7A 1UETA 1FRLA 3EWGA 4AP9A 3SUOA 4BHQA 1GTHA 1U2VB 4OI4A 3IV6A 3ILOA 3UCGA 4NJ8A 5CWRA 2GGPB 1ZBTA 4LVNP 1EAYC 3L2UA 3FBBA 3BH7B 5K8NA 3GIKA 1HQEB 2WW4A 5F0XA 5FRMA 3VC8A 3H98A 3D0IE 3HP6A 4N8NA 4Y2MA 1HMVA 4KC5A 3UR0A 2RQKA 4O44A 5DDQC 3TADC 2QO3A 1Q8BA 3TABA 2WOMB 3I55N 3MM6A 3WBZA 3PSFA 4FBTA 2P5GA 3GQCA 2C3MA 3ZYYX 3CC4S 3EICA 5J2KA 2XM3A 1QTMA 1J97A 4NO7A 1U6ZA 4TQSA 2HBZB 3G9CA 1WF0A 3VQPA 2LI6A 2UZAA 1PBUA 3BGUA 4CGZA 2RUGA 1NB7A 3AA9A 2W6KA 4IWVA 2BYCA 3UN5A 4JN4A 3C5GA 4X4RA 3H8MA 2WB1C 3GE9A 2MSTA 4DU7A 4DU8A 4HUFA 7ICKA 5IIMA 2B9YA 3SUQA 1RT2A 3RR7A 3CULA 4JOUA 2V2VA 1T95A 1RT5B 3KLVA 2MKJA 1TYQA 3CM6A 1FIQA 4LF6J 2DXEA 3H3NO 3AD7C 5LJ3Y 4ANDA 5CEHA 4UAVA 4ES2A 2N7CA 1YUWA 1WC0A 3KFUF 3C6UB 3TR8A 5F8HA 2BZFA 2FYXA 3NRZA 3RB6A 2ZG6A 1S72N 2B4OA 1C4CA 2WF6A 2A0FB 1RTZA 3UD4P 2J6UA 3BH6B 1F21A 2CH6A 2E1PA 3A1YG 1N8RT 3S41A 3DMJB 3KWMA 1GXLA 1FVSA 1M5KC 1K73T 2DGUA 4R79A 3D2SA 4NLYA 4HI1A 3JSYA 1RDBA 3T5LA 2R42A 3D6RA 4NPOA 3D4JA 3FBFA 4ZJQA 2BKNA 4YOEA 3CMQA 5L39A 5D8HB 1R8CA 3D6MB 1X2IA 3C66A 1HNWJ 4O4GA 1JMTA 4CZEA 4P4PA 4PUOA 2KH9A 3BKFA 2LYBA 3PW7A 4DN9A 1FJGJ 3MM8B 2BJ8A 3WIUA 1YI2S 3QYPA 4PHEA 5D15A 2E88A 4Z4IA 3SEOA 2F8KA 4J03A 5EOZA 3MI7X 3ENOA 1ZOLA 2E7XA 2ROEA 3LO3A 4WU3A 2WSFC 1UMJA 3R1HA 4V1Ak 3VEOA 4KH6A 3QZ7A 3M4XA 4X66F 1YITN 4J9UE 3SYZA 1NH7A 1I94J 4C9DA 2HS4A 1ECWA 3SBTA 1DRGA 3DOMB 1HKGA 3ULEB 4Y1DA 2JMGA 4Q2MA 2H5XA 1UWBB 4CEBA 4DV7J 4DV2F 1BUPA 4HH0A 4LBPA 4M1KA 5B0BA 4KHWA 1IUJA 3KKAC 3OXGA 5KFTA 4DR6J 1WACA 4B3MF 3QUQA 4MDAA 3RRHA 1BQNA 4NRUA 4FFDA 2PC6A 1RDDA 1Z2ZA 2P6SA 2O8FA 1QE1A 2J8SA 3CJKA 4YDUA 4B3TK 2OYQA 4RX6A 5GINA 2W4CA 4YMMA 1L3UA 3JPTA 4DOAA 2QK9A 3ZZYA 2VFSA 3K5OA 2OYYA 4D3HA 3EMTA 1S97A 2P9KB 2JWNA 1NK8A 2P9NA 4CJSA 2OTLS 2VIXA 1N5QA 1WG8A 1SVDA 4KH5A 2MHNA 3H5UA 2G1DA 1NGEA 2XWYA 2Z1HA 3PFEA 1TZ0A 3A12A 5DZ7A 1RKJA 2O8EB 4WF9L 3ZDCA 2GFFA 3C2MA 2Q4TA 1EQYA 2GV1A 3SAFA 4X4QA 5DM7Q 2DJWA 2ODGA 3THYB 1KP6A 3VN5A 1ZPVA 3K17A 3C7NA 3HI9A 2JZBB 3OYCA 5F8IA 1H6KX 1F0XA 2QE5A 1RT4A 3HRGA 3ID6A 3W5YA 4P0PB 5DG9A 2EFOA 3MURP 1B9FA 1PBAA 3ZSOA 2KSOB 3OSPA 3GJRB 1XSNA 4CEZA 1FJCA 3L2RA 3MR7A 2RDJA 4M5LA 4UQTA 2NNWA 1BHNA 2KN4A 4OJRA 2F8MA 1UEUA 2EC0A 1M90O 4OZJA 5KG2A 2I9GA 3OL8A 5D77A 4I2HA 2E4LA 4Z4CA 4B3TF 4DV1K 2RH3A 4F93B 1N48A 3D54A 5AQMA 5GAHI 4E7JA 2HZAA 1DJ0A 1S5LU 2HHQA 3LP0A 1DFDA 3K5PA 3SCXA 2LCWA 1TKDA 4PWWA 4R0EA 4P4MA 1DLOB 1NB2A 4DUZF 3AHPA 5GAEI 2ZH1A 1RT7B 3ZETB 4ZHRA 3UDCA 4DTSA 4FWRA 2X6NA 1FRHA 4IZ9A 4P0QB 3G71S 2XS2A 3HVAA 4FKXA 2FZKB 4U67L 2RS8A 3KLHA 3U3GA 4FJXA 5BYSA 1QVGR 5EX3A 2ASDA 4EYHB 4H0YB 2MQLA 4JYAF 3UQ2A 3MBYA 3EYZA 2BOAA 1VQMS 1W25A 4HTIA 5D0GA 5AKHA 3Q8RB 3O0FA 2CJXB 1NM2A 1CULB 4H54A 3I1YA 5J2PA 2YQ1A 4LVOP 1TL1A 1MWMA 2FLOA 3MAQA 1E4FT 2KIVA 5IV3A 1D9AA 2FGCA 5KFVA 3RZAA 3QJLA 1KD1O 3AH6A 3TAFA 5I4MA 4CD1A 4DV1F 1CZAN 1U04A 1VC6A 4M95A 3ZTQA 3ZZUA 1SV5A 1IXRA 2J7UA 2A19A 3V1RA 4FLVA 2GX8A 2PAVA 2IJNA 3W3SA 5C5JA 8ICCA 3J7A1 3VF2A 1NMNA 5K14A 5ALGA 2ACMA 1OH5A 1HBNA 1Z2LA 3OYAA 2Q0RA 1TR0A 1DT9A 5AI9A 4EGLA 2NREA 3G87A 3R8EA 4CF9A 3A8KA 4DSKA 3BM7A 3FEZA 2FMPA 5CR0A 3C14A 3FCWA 4KT0C 2H54B 3SCLE 3M6WA 2HIYA 3LQVA 4E1JA 1COKA 2MZQA 1C0MA 2W7OA 2V51B 4PG5A 1WSIA 3QNMA 2QKBA 3R6LB 1N0UA 1D8ZA 4O5EA 2ZBRA 1Z1ZA 3BKTA 3H0PA 2RT3A 3CJ1A 4KMOB 3ZDBA 5AM1A 4ECUA 4NL5A 3KG1A 1FX4A 4KHYA 3M6GA 1VHFA 1FA0A 4ZK7M 4OYIA 4J9SA 3AD8C 5AQVA 4JK7A 5D6GA 5JJBA 3MCAB 3VAKA 5KFPA 3OD2A 1C1AA 3E0FA 3DI6B 2MGZB 3LPTA 2J9DA 4IH6A 3ET6A 1BPYA 4JI5K 4CH1A 2EXUA 4O0NA 3KXDA 3C94A 6AT1B 1DTTA 3DLEB 1YG0A 1TAUA 4AHRA 2DGQA 5DM6Q 5AQJA 4QPTA 4YG2A 2E20A 2NLWA 3IR6B 2FZGB 2Y1LB 3CUNA 4JV5K 5ETRA 2HHPA 2D1KA 2WVDA 3VQEA 2CVIA 4Z4GA 2QXLA 2V6AA 4DR4K 3BKUA 1UCVA 1HI0P 4M3ZA 3MN9A 3DOKB 2W3RA 4DQSA 3I5CA 1RLDA 1AFIA 3QEAZ 2CRLA 3O3LA 3CC7N 3CD5A 2OIHA 4MKAA 3W2VB 3BUZB 1M5SA 1G7CB 4X4UA 1EETB 4NEYA 2RMLA 2W1BA 4E1MA 1HYZA 7FD1A 2F1HA 3Q7BA 2BZ2A 3M8SA 1FXXA 4AYBC 1RAHB 1YTAA 1BQXA 4CJPA 3AT1B 3CDEA 2LU2A 5AIBA 1A5VA 3MPVA 2OPQA 1HFEL 1NDCA 1VISA 3NP5A 1ZQBA 4H5NA 2GQ2A 4JI5F 2V8DA 1UVMA 3ICLA 2MUTB 1N54B 1XMOK 2QL9B 4RW6B 4FP9A 3D28A 4RW4A 4DR1K 3MMJA 5JTIA 2E6LA 3QT7A 1FDAA 2G2YA 2EHGA 3MECA 3UR3C 3ONNA 4JV5F 1RPLA 2ZC3A 1VQ8S 3TADA 1W2BM 3PO4A 2MB0B 1VBYA 4URQU 3W65A 4Y2PA 2EAMA 1Z4NA 2VJVA 2G0JA 3SR6A 3QETA 3KKSA 2GNKA 4CK3A 2XMAA 1H98A 2RU9A 4HKQA 1RAAB 3HPGA 2HVEA 3DDNA 1DAXA 1NNDA 3DXKB 4CHYA 2H3QA 1JLFB 2C28A 3SQOP 2FTRA 3N79A 3P45B 2ZIXB 3NCRA 3F56A 1V6HA 4X66J 4IOAL 4YFKA 2F4VF 2CYYA 2CQ0A 1DK3A 4QYRA 4CO3A 2ZUBA 3HVWA 4NLOA 2F2AB 1S9FA 1U1QA 1G1XA 2YX1A 3FEXB 3R9KA 2Q31A 2JX2A 4H8KA 2AF6A 3GE1A 2XY5A 4CO0A 2VUGA 4USVA 4DR1F 4B3MJ 4L72B 6FD1A 2QA4N 2XMVA 4C3KA 1IKWA 1KXPA 4C11A 3JSBA 2W04A 1RQ0A 2R2RA 2NXNA