1NJZA

Cytosine-thymine mismatch at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njzA01
3HW8A 3FYHA 5KFGA 4B9LA 2YHBA 5KFJA 4CHOA 5DBBA 1RT2A 3AU6A 9ICVA 4Z6EA 4DTPA 4FJ8A 2QKKA 4W5NA 8ICLA 3V1OA 1ZQGA 2OWOA 2R7YA 4F93B 4EEYA 3HM9A 1FKOA 2DY4A 4E7JA 2OPQA 3LP2A 3KD1E 2AGQA 1L5UA 4KHUA 5J2BA 2KTQA 8ICJA 3S3OA 4HUFA 5KG3A 1V9PA 1RDAA 1EX4A 9ICBA 2AQ4A 3V81A 4O3NA 2HHXA 3PY8A 2BCUA 4I29A 1UT8A 2OZMA 9ICOA 4IBNA 8ICYA 4K4HA 4DFPA 4ECUA 3OYCA 1BVSA 4KLQA 3ZT3A 4UAYA 2R8JA 2ISOA 2XHBA 4FLTA 4O5KA 4KLEA 4KLSA 5J1EA 3TAQA 3MXMA 3HVRA 3AVIA 5DBAA 3ZT2A 4ECYA 5HLFA 1S0NA 4HYKA 9ICCA 5HMMA 4M3RA 3KK2A 1TKZA 5HHIA 5DB6A 8ICIA 4ED1A 4FLVA 1HNIA 4RQ7A 2KZZA 4GXIA 2XC9A 4JK1A 5KFRA 2FPMA 4RQ5A 4YR0A 3RTVA 4CJWA 1MU2A 3L3UA 2UVWA 3AA4A 4E1MA 1VRTA 1T3NA 3JPPA 2HHQA 4DSEA 4RW8A 2BPFA 2BPCA 3HO1A 4B8AB 2DFHA 4YR3A 4NYFA 3PX0A 3UIQA 4Z4GA 3G6YA 4O5BA 4CEFA 4QZ8A 3L2UA 4MFAA 3AA5X 1TFRA 4FYDA 1ZBFA 4HHTA 1ZETA 3V6JA 3D45A 1K1QA 4CF9A 2IA6A 4O9MA 5CZ2A 2PFPA 7ICMA 4JRQA 5KFXA 1XSLA 7ICSA 7ICGA 5KFQA 3MEDA 5J0OA 4DFKA 3T19A 2KW4A 4F2RA 5J2DA 4EYIB 1F21A 4FBUA 2VG7A 4F2SA 5F9LA 4Z4IA 3VQ4A 5IIKA 1C1CA 3JPQA 3RJEA 4N5SA 4AHTA 5J2MA 3NGIA 3O3FA 2OA8A 3QIPA 4OVLA 3OHBA 1WSIA 4M9HA 1ZQWA 3RMCA 4MFFA 1ITGA 5DK5A 2Q0ZX 4FK4A 4E7KA 1CZ9A 3VQDA 5CYMA 1WNSA 4BDPA 1ZBHA 5KFTA 4IDKA 4BXOB 1KVCA 2R8GA 5J2FA 4MF8A 2J6UA 4I2IA 4K8XA 2V4QA 3JPOA 1VSEA 1S1UA 4M3XA 5DMRA 4I2AA 4LH5A 1JXLA 3ZSQA 4Y1DA 4RT2A 4M47A 3HPGA 3GILA 3EYZA 2F96A 4IG0A 4RQ6A 4W5RA 2GWSA 4KLMA 5KFLA 4ICLA 3TWHA 3HPOA 4Q8FA 4CGFA 4Z4FA 2E4LA 5JS1A 2BR0A 4BDZA 2JEGA 2ETJA 3T3FA 4DQRA 4RNOA 2NRXA 2F1IA 3OYEA 4YD2A 3H8WA 3BQTA 3KLGA 9ICXA 1NKBA 1U49A 3MR3A 3NDKA 2W9CA 5J0WA 1QTMA 3CFPA 4EBCA 9ICTA 1QHTA 4CJLA 2PI5A 3KJVA 2WONA 3RH4A 5KGWA 1WCNA 3TAEA 1Z00B 3C21A 4ECSA 3PW0A 4M3WA 2JZBA 2BHNA 1ZQCA 3SI8A 3KHGA 1ZQBA 1GOCA 1WSHA 1N48A 5J2AA 1S9GA 2ASLA 4QZAA 2VA8A 4CGGA 2XY8A 4KTQA 1S1XA 5KFZA 4B8CA 4QWDA 1T8EA 3L2RA 1LWCA 4DO9A 3Q8QB 3SZ2A 4IR9A 1W9HA 4FJIA 4C8MA 3OS1A 2ZUBA 3PVXA 4MEXA 1BPBA 4EZ9A 3QESA 3MXIA 1C1BA 2BGGA 3EW9A 4NM2A 4HVJA 1RTIA 4DTOA 3HT3A 4CFAA 4AHCA 1A77A 1S5JA 3BJYA 3ZSRA 2BCVA 4FLYA 4JUZA 3C1YA 4KRFA 4Z4CA 1WSGA 3KLIA 4I9QA 5DG7A 3NFAA 3ZD8A 4NCBA 3SV3A 4LZDA 3RJIA 4BE1A 1L3TA 5KT3A 2B5JA 1NK4A 2PFOA 2HHSA 5HBMA 2YNIA 2OYQA 3OS2A 3RR8A 3M8PA 1K1SA 1QSLA 3ISNC 5IIMA 5CZ1A 3IS9A 3GQCA 1BIZA 3AO1A 3GV5B 3H8SA 2W8KA 4CFBA 3NAEA 2E6MA 4FM2A 3PMNA 4M3UA 3RB6A 3THVA 3RR7A 3CYMA 4IR1A 1RXVA 2X74A 3NF9A 4PGXA 4N41A 4PH5A 2XCPA 2YHAA 3TFSA 5KT6A 2JEFA 1XSNA 3OYFA 3QNOA 5J2KA 1SL2A 4QCLA 1J9AA 3OYGA 2G8IA 2NRVA 2F8SA 1WCLA 5IIOA 1NK5A 3L3VA 1FK9A 5I3UA 3QERA 5KRTA 1RNHA 4ZH4A 4E7IA 2PXIA 3O3HA 4I2QA 4NLZA 5J0UA 7ICTA 4RG8A 5DDMA 2HW3A 1NKEA 4J2BA 4F8RA 3V6DA 4RNMA 1QSYA 2UVVA 3VQQA 5KFDA 3L2QA 2Y1IA 3BQ0A 2RDIA 2ISPA 2G8FA 1KFDA 3QEPA 7ICKA 1RDCA 3C2LA 3JPTA 5F9NA 4UB4A 3HJFA 2KFZA 1VSKA 3V9UA 5J2GA 3UQ0A 1TKTA 1D5AA 2B6AA 3K5OA 4O5EA 2YKMA 4QZBA 1BL3A 1CXUA 3UQ2A 1XC9A 1KLNA 4K4GA 4QOZB 1VRUA 3S3NA 4KI4A 1A5XA 4PHDA 2P66A 4CEOA 4Q0BA 3Q8LA 9ICPA 1PZNA 1EP4A 4FJLA 2KQ2A 4DS4A 4TURA 4RPXA 2B4JA 4I27A 1D9DA 1RPLA 1U48A 4F4XA 3NBPA 3KLFA 1ZQHA 4CFDA 2WTFA 4YXMA 4O3OA 1HNVA 3DMJA 1RT1A 5KFOA 3PNCA 3KLHA 3MAQA 3H08A 1HJPA 2W9BB 4FK0A 4RPZA 4I9LA 5D46A 3WNHA 5J2EA 2NRZA 3GIIA 5HP4A 4F92B 2ITGA 1REVA 5CY4A 4BE0A 1HJRA 3RRGA 1KVBA 1S6QA 3M9MB 5C25A 2VWJA 2IOCA 4ECVA 3FDSA 1TAQA 1XHXA 9ICRA 1NJXA 5DDYA 4B3OA 5FRNA 3RAXA 1RTDA 1ZQRA 1SV5A 3C6UA 2QKBA 4C8NA 4CEDA 3T1AA 5DQHA 1UT5A 1RDDA 4FO6A 3MGIA 5DB7A 4B9TA 1RYRA 4J9MA 5DG8A 4YG2A 4E7LA 1S9EA 4CK3A 3VQ9A 4OPKA 2PYLA 4C8KA 2ZUCA 4PHAA 4RPYA 4F5OA 2V4RA 2VA2A 1EXQA 3AO4A 3S9HA 1BGXT 4RNNA 3LK9A 3AVMA 7ICQA 1BPZA 4PA1A 3ZSWA 4YFKA 4FZZA 4B9SA 4FJGA 7ICPA 4P2HA 5KFNA 3CFOA 4GLXA 4RW4A 3NGYA 3K57A 5J0YA 3ZSXA 1QQCA 2Z1JA 4C8LA 4M3TA 4J9LA 5KG1A 4KLFA 1C0MA 3VA0A 1VSLA 4UB1A 3AO2A 1DLOA 3OYJA 4W5TA 1ASVA 5KG2A 2VG6A 4TUSA 3RMAA 4BGDA 1KSPA 3PX6A 3DRSA 9ICNA 4O3SA 3V4IA 3RBDA 2JGUA 3VQEA 4KITB 4FJMA 1B92A 4I2FA 4J9OA 3QO9A 1B22A 5C24A 4CGIA 2Z1GA 3V6KA 1L3SA 3E01A 2R8HA 4CEEA 1ZBIA 4DTNA 1W0HA 1T4GA 3OSPA 3PX4A 2ALZA 4GXJA 4FZYA 3M9NB 3QEAZ 1VK0A 4DL3A 4RQ1A 4YR2A 4CJ4A 3EZ5A 2HHWA 4KB1A 1D9FA 4F5PA 1RT6A 4M3YA 2J6SA 4CCHA 4ID5A 2I1QA 4KFBA 3RB3A 1IO2A 4FS1A 1BI4A 1S6PA 2X6NA 3RJGA 8ICUA 3NCIA 5KFFA 1XU4A 2GUIA 3K5LA 4YN4A 2G8KA 2JLEA 4IKFA 4BACA 1S77D 8ICVA 4JWNA 2W9AA 1Z25A 1RDBA 2WOMA 1ASWA 5HRPA 5J2CA 8ICGA 4I2DA 1VSHA 3NH1A 4CF0A 2KFNA 1WAFA 4X5VA 4Q8EA 1SUQA 1TVRA 4LY7A 3M8QA 5DQIA 1Q8IA 4PPXA 3GIJA 4DQPA 5J2HA 4QZ9A 3G0ZA 5HP1A 1BCMA 4YD1A 4KLJA 4KO0A 2ZTCA 3SUQA 4QZCA 4ED0A 1CUKA 1NJZA 3ZT1A 4O3RA 3SI6A 3AV9A 2YNGA 4NCAA 7ICRA 3IG1A 4UBBA 3QEIA 8ICXA 4J2EA 2PZSA 2C2RA 1KCFA 2QK9A 7ICNA 3JPRA 4F4KA 4FJXA 1HQUA 4KHQA 7ICUA 3ZCMA 1VSIA 9ICLA 5JS2A 2A1RA 2W8LA 2A1JA 1BISA 4DL6A 2NUBA 1B43A 5DGBA 1JLAA 3C23A 5I42A 1ZQFA 4J9NA 4IFVA 4FXDA 1C7YA 3C5GA 4DTXA 1Z26A 5EU7A 7ICLA 3PR4A 4FJ9A 4KMUA 4IRKA 2P51A 3GFKB 4CFCA 4MFBA 8ICZA 1S97A 1SL0A 4YFUA 4ECTA 3EWAA 2BQ3A 5HMLA 4ECRA 4Z6CA 4B9MA 5DLGA 3WNGA 3AVHA 4IQUA 4CGDA 3AVJA 4I2PA 3NF7A 4M0AA 4DU4A 1KFSA 8ICTA 3P1GA 3L2VA 4I7FA 3LP3A 3HPHA 3B6PA 3ZSZA 3CM6A 3M9OB 4IG3A 4J9RA 4IFYA 2P1JA 1K6YA 4CGHA 3EPGA 1S1TA 3AVNA 2ZJAA 3VQ8A 4FLZA 4I2GA 3LWMA 4YQWA 3TABA 1JLFA 2HHTA 3OYNA 4QWBA 2R8IA 4MF2A 2ZD1A 2D5RA 2ZTDA 3HVTA 5KFVA 1A5VA 2G8VA 3LWLA 4NLNA 3CQ8A 3KTQA 3E2EA 1NK8A 1X9WA 4YMNA 2W9CB 1VSMA 3C1ZA 1YVUA 2BQRA 7ICEA 4HCBA 3OGUA 3KK1A 4DOAA 9ICQA 4Z4EA 1A76A 4J9PA 4EP5A 2HNDA 3SCXA 2G8UA 2JEJA 4ZTFA 3ISBA 4I2CA 5DGAA 4CJUA 2JZBB 3SNNA 2RN2A 5JUMA 2FBVA 3AA2A 3O4QA 2ATQA 5HNKA 2DFLA 4QZGA 1JX4A 5J2NA 2MUTA 3IRXA 7ICHA 4B08A 3QINA 3V9XA 2Z1HA 1WLJA 4QZHA 3NF6A 4MFCA 5KFPA 1U47A 4ELVA 4JV0A 4RQ2A 4CJKA 4TUQA 1RILA 3AVBA 1GOAA 1TV6A 5KFEA 8ICRA 7ICFA 3HX0A 3AVLA 1N5YA 4OKEA 3U3YA 4NYNA 5J0RA 3SUNA 4PWDA 4DU3A 1ZQJA 4KREA 3ISDA 3OY9A 1D8LA 5KGXA 1BQNA 2X78A 4M9JA 1X9MA 4GW6A 2D0BA 2PFNA 5HRRA 3LPTA 4EP4A 3G6XA 3RMDA 3JPNA 4WE1A 4CEAA 5KI6A 5KTQA 3RBEA 3OYIA 5IILA 3SQ0A 1KFTA 1BIUA 2BCQA 8ICBA 4ED2A 4DS5A 1C0TA 1NK9A 5EWEA 2Y1JA 4JS4A 3AVGA 4CHZA 4FJJA 3ISCA 1ZQNA 9ICKA 4RQ3A 2HVIA 1NOYA 3AU2A 1S0VA 3SPZA 3H8JA 2NRTA 4XA5A 4FVMA 3AVFA 4KLIA 4NLKA 7ICOA 1S1WA 4RW9A 4ED3A 8ICFA 4FK2A 5BOLA 3P5JA 3H7IA 9ICAA 9ICWA 2O4GA 5E41A 4MEYA 3RJJA 3HL8A 3BGRA 1LAVA 3LPUA 4CEBA 3RJHA 3MGHA 2E6LA 2J6TA 1ZQPA 5KT5A 3JSMA 1IM4A 3MBYA 3AO5A 4O5CA 1TK0A 3L8BA 5J2IA 1WSJA 1Z3EB 4AHSA 4UQGA 3TQ1A 4CJVA 2O4IA 1ZQQA 1I3AA 2LYHA 2DPJA 9ICJA 4NXZA 2VG5A 2FMSA 3RJKA 3QEBZ 4HCCA 4AHVA 4PGQA 4JV1A 3KHHA 1DOQA 4KB0A 1YTUA 4DLEA 4QZDA 4CGJA 5KFSA 1CLQA 3PMLA 1Y97A 3V9SA 3MEEA 4KTWA 3OYBA 4M3ZA 2F1HA 2D0AA 5DLFA 1X1PA 4J9SA 5KG7A 4UB5A 5L1JA 4EBDA 3BDPA 1C6VA 4N76A 4Z6FA 1IKXA 3A2FA 1ZQXA 4KAZA 3GV8B 2QXFA 2ZJ5A 5KG6A 4DTMA 3V6HA 5KFWA 2FBTA 2YV0X 4XUSA 3NH0A 2HB5A 4AHRA 4QZFA 2IHMA 4QZEA 3RH6A 4BDYA 3SYZA 4E7HA 4RW6A 1JLCA 4OGCA 2FPLA 3C2KA 3UXNA 1AROP 4FJ5A 1HQEA 4K4IA 1MSWD 1LV5A 4M9GA 3OYMA 1ZQAA 1QSSA 2KZMA 3ZDEA 2KZ3A 3L2WA 3TI0A 1LWFA 3N97B 3F9KA 1TL1A 3CM5A 4CJEA 2IMWP 3HP6A 1SKSA 4R5PA 3BQ2A 3LDAA 2IHNA 2G8HA 3RB0A 2W42A 2RKIA 4ELUA 3NGDA 2C22A 4UAWA 4PHPA 1NKCA 4CF8A 3K59A 4KHWA 4RUCA 1I39A 1HUOA 2FLPA 4DL4A 4DQSA 4XRHA 4NLGA 1WSFA 4P4PA 5IIIA 4KKOA 2OPPA 3WNEA 3ASMA 4M6WA 1CXQA 2BGWA 1QLNA 4GVMA 4KHSA 1J53A 4CE9A 3DRRA 4YXJA 1JIHA 4B9VA 2A1SA 2PY5A 4DL5A 3MECA 4RT3A 2GV9A 3WNFA 1ZQLA 4DSKA 4QW9A 4FJKA 5KG0A 3MR2A 1FXXA 1J54A 4Z0UA 4M04A 1ZQEA 1O1WA 4HUGA 7ICVA 4ECQA 4ZTJA 3HYFA 4RUAA 4Q43A 4OGEA 1S1VA 1IKVA 3C95A 4FJNA 1BPYA 3DI6A 4K8ZA 3D0PA 3HP9A 3NF8A 3PW7A 4BE2A 5KFUA 2OZSA 4CK1A 4E19A 5CWRA 2AQ0A 2JEIA 4LD0A 2EX3A 4O0IA 2UVUA 8ICQA 4I2JA 4DL2A 2Z1IA 4F91B 2AU0A 1RBVA 1RT5A 4KHYA 4EYHB 3ULDA 1HYSA 1WAJA 4EZ6A 3OJUA 4W5OA 5J2JA 1TK8A 1ZQSA 4DSFA 1HMVA 4BWMA 4ZHRA 4CERA 2I9GA 4DTSA 1JLEA 3ZSVA 4TQSA 4RQ0A 3KLEA 4JS5A 2BE2A 4YVZA 3GIMA 4RW7A 4CECA 2G8WA 1BHLA 2XRIA 4I2EA 1SKRA 3TAFA 4FLWA 4XIUA 5CR0A 1MC8A 3QE9Y 3PUFA 1N56A 2ZTEA 3Q8PB 4B9NA 4TQRA 5KFCA 9ICFA 3EPIA 1BCOA 3OHAA 1ZQVA 3PW2A 3NH2A 4ECZA 5D3GA 1ZQUA 3OYLA 4KLLA 3BQ1A 4O3QA 1BI4B 4DF8A 2X6SA 3M8SA 2BANA 3SV4A 2NRWA 4YMMA 4KLGA 4DFMA 4P4MA 3KHRA 4LSLA 1IKYA 4H4MA 3B6OA 4F5RA 4CF2A 4UAZA 2RDJA 5J0TA 5DB8A 3MR5A 2FLLA 3K5MA 3UXPA 4DOCA 4KI6A 1SL1A 4QWAA 4NY8A 3ALYA 4E89A 2C28A 2HNYA 4TSXA 3K75D 3ZD9A 1TV9A 3OS0A 1ZQKA 3DLRA 1XSPA 3JYTA 4B9UA 2FBXA 1RBTA 4AHUA 3V1RA 4XQ8A 4RZRA 3TAMA 4CHQA 5FRMA 1LWEA 4IRDA 8ICPA 3OYKA 3C6TA 1TKXA 3K2PA 1JL2A 4R8UA 4RQ8A 5IIJA 2IDOA 5HHHA 1KDHA 1UAXA 2ZJ8A 4OLAA 5TZVA 1ZQDA 5EWFA 2FMQA 1FKPA 2ZE2A 3G6VA 5CA7A 3T5LA 5L1KA 2GBZA 4JRPA 3PW4A 2HHUA 1D8YA 4JWMA 1UWBA 1RXWA 3KIOA 1ZQOA 2A1JB 4W5QA 1RCHA 4R64A 4ID1A 5FROA 5KT2A 5L1IA 1T03A 3GIKA 1TK5A 4FCYA 1BPEA 4PY5A 4IQVA 3OYDA 3VQ7A 3S3MA 1NOMA 3Q8KA 1EXNA 3ZDDA 3OYAA 3DLGA 3MEGA 4DMNA 1ZJMA 4LSNA 4I28A 3B0XA 1T7PA 2DFFA 4RU9A 1S76D 4CIFA 4QAGA 2C2EA 4KLTA 2VWKA 3KKRA 2AJQA 5J0PA 1RBUA 5L9XA 1RBRA 3C2MA 5KT4A 2I5JA 1HUZA 1NK6A 5DQGA 3V7KA 4FS2A 3ITHA 4FLUA 3KHLA 4I2BA 2BPGA 4CEZA 1DTQA 1EETA 4M2YA 4TUPA 1DGSA 2ZQBA 1JLBA 9ICUA 5CHGA 4FZXC 4F3OA 2V9WA 3DLHA 1C1AA 3VQBA 4O3PA 8ICOA 2IC3A 1U04A 3HXMA 1RTHA 1XHZA 4QWCA 4O55A 4Q5VA 4UB2A 4N56A 8ICNA 1UOCA 2AGOA 4CESA 1U4BA 4CHNA 2XGPA 1VSFA 4M42A 2IS3A 3NHGA 1IG9A 3LZIA 1TKDA 4AILC 1XS9D 4IRCA 4DU1A 4KN4A 3PR5B 1R0AA 5KG5A 8ICHA 3OVNA 5KFAA 4Q45A 5BOMA 8ICCA 4OPJA 4FLXA 7ICJA 5J2QA 4J9KA 3LAMA 3VA3A 3CG7A 3DLKA 1Q9XA 1SZPA 4DTUA 4FBTA 1B9FA 3LANA 5KRSA 2MUTB 3TAPA 4DQIA 3QZ8A 1BQMA 4Q44A 4M45A 5FDLA 4YMOA 5EWGA 2FBYA 3KD5E 2C2DA 1JXBA 2OPRA 3KK3A 3LZJA 3V7JA 4O0JA 4OLBA 4O4GA 3V9WA 5J2PA 3RMBA 4CEQA 4GXKA 8ICAA 3NGZA 3MFHA 4FM1A 8ICEA 4OKJA 2FC0A 1S10A 4OJRA 1KVAA 3C5FA 1N6QA 1ZQTA 3OJSA 1VSDA 3AVKA 4M9LA 2FPKA 2HVHA 5HRSA 3JPSA 4CK2A 2YNHA 1ZBLA 4F50A 4PQUA 4CJRA 3DYAA 1CZBA 1JMSA 4BXOA 9ICSA 4EBEA 3T5HA 2UVRA 8ICKA 1YT3A 2RF2A 3ZT4A 1DTTA 3ZSOA 1S9FA 2ZUDA 3MR6A 4PHEA 3AO3A 1TGOA 2XCAA 4CHPA 3KKSA 4KLUA 1XI1A 2BDPA 2HMIA 2HNZA 3AA3A 3GV7B 3VQPA 5DB9A 5SWMA 3LP1A 4PGYA 3FFIA 3SUPA 4DLGA 5KFBA 4AH9A 5KT7A 2PYJA 4GC7A 3RJFA 9ICMA 3HSTB 3QIOA 4YNQA 3H4DA 3EY1A 2R8KA 9ICGA 4F5NA 1UA1A 2P6RA 1JN3A 4N47A 4P4OA 3K58A 4LVSA 1RBSA 4QW8A 3SQ2A 3I8DA 1JLQA 5K14A 3DLBA 5KFIA 3F73A 5DG9A 1S0OA 5KFMA 1Z00A 2KN7A 5L1LA 4LZGA 4R66A 4LH4A 3LALA 2RPIA 1G15A 1A5WA 1GOBA 4J2AA 3MABA 4ED7A 4J9QA 1JL1A 4DG1A 1U45A 3V72A 2P6UA 3DOLA 4E1NA 1X2IA 5CB1A 3DM2A 3K4GA 3UXOA 5J0XA 4DEZA 2AGPA 3SUOA 3TARA 1T05A 4CJPA 3VN5A 3ZDAA 3DLEA 4FW2A 1XWLA 2FLNA 2VA3A 3ZT0A 3IHQB 4YP3A 3V9ZA 3NTUA 1H38A 1U9LA 1BPDA 1RTJA 4F3TA 3VQAA 1X9SA 4L8RB 2MAXA 4KLDA 4CJQA 2W9MA 4DSIA 1L3UA 5IINA 1VSJA 1NJYA 5CYQA 3Q8SB 4KN7A 4OKKA 3CFRA 3VQCA 4M9NA 1UA0A 1NK0A 2PI4A 9ICIA 4DFJA 5J0QA 4CJTA 4G1QA 5CP2A 1ZQYA 1ZQIA 5D49A 4Y1CA 3ZSYA 3IAYA 3AUOA 1C0UA 4F5QA 5C5JA 3LAKA 3PV8A 1S0MA 2ASDA 5KFKA 1TAUA 1LB2B 3UPQA 4PUOA 3RH5A 4O44A 9ICHA 5J0SA 3QLHA 4NM1A 4CJFA 1NK7A 1RT4A 3V1QA 2IGIA 7ICIA 1MQ2A 4UBCA 2H5XA 4M41A 4DOBA 4DTRA 4ELTA 4F4ZA 3M8RA 8ICMA 4FW1A 2DPIA 2VANA 3PO5A 4QZIA 4RQ4A 1EKEA 1L3VA 2IAJA 3I0RA 3ZDCA 3SQ1A 4CJ3A 3Q8MA 8ICWA 4M6WB 4CIEA 4R63A 4DSJA 5DKWA 4ECWA 4KHNA 2EHGA 4F4YA 3RB4A 4UB3A 2F1JA 1JKHA 3OSNA 1BPXA 9ICEA 3ETLA 3VQ5A 4E3SA 1RZTA 3HK2A 3MDAA 2HHVA 4R65A 4KPYA 3OYHA 1IXRA 4KV8A 4CF1A 4ECXA 1WSEA 3ZDBA 3AVAA 2BKEA 2BQUA 2LSNA 3DRPA 1KEJA 1ZJNA 4DF4A 3LDSA 3U3GA 4MQ3A 5J29A 3K5NA 3NE6A 3V7LA 4JLHA 5CJ7A 5DBCA 3C94A 5D4BA 3PW5A 3IM1A 4CHYA 3T5JA 3VQ6A 3LP0A 3ORYA 3RWUA 4F4WA 5HRNA 2ATLA 1MQ3A 1YTAA 3MFIA 4CJSA 2YKNA 3QETA 3RAQA 3B0YA 4NCGA 1TL3A 5KFHA 3QNNA 1WN7A 4C8OA 2P5GA 4BWJA 4DWIA 4CIGA 1COOA 1HPZA 1RT7A 5T7BA 1ZQZA 2BCRA 1ZYQA 4IQTA 2ASJA 5SZTA 5BPCA 2XGQA 1RT3A 3SQ4A 4DSLA 3DOKA 5EOZA 8ICSA 3T5KA 1B9DA 3SPYA 2OPSA 3TAGA 1ZBUA 3O4NA 3TR8A 5C42A 4FJ7A 2W9BA 2XY7A 2D0CA 3I0SA 4E0DA 3TFRA 1TVAA 4IQWA 1J5OA 3AVCA 3MXJA 1QE1A 1HYVA 4FJHA 3N4MB 1LAWA 3HWTA 2B21A 5KG4A 3RRHA 1Q9YA 4DL7A 4H8KA 5KFYA 3QZ7A 2DFEA 4DTJA 3SJJA 1IH7A 4GC6A 4H4OA 2P5OA 2M9NA 1RYSA 4DQQA 1HYZA 1KLMA 3QEVA 2PFQA 3Q8RB 1NOZA 2XO7A 4GMJB 5HROA 1KTQA 1XO1A 4ED6A 4QWEA 4FM0A 4KLHA 3P83D 3G10A 4Z6DA 1SKWA 1ZQMA 3O3GA 3GDXA 3QEWA 1IKWA 1QS4A 4JV2A 1ASUA 2Q3SA 4KLOA 4KTZA 1NJWA 3H40A 4I2HA 4CJ5A 3U6FA 1JXEA 2XY6A 3PO4A 4HUEA 1LW0A 1HRHA 2F8TA 1JLGA 2DTUA 4Z4HA 4R8UB 4HTUA 4YCXA 1LW2A 3TANA 2XY5A 1KRPA 3QEXA 2YNFA 3H4BA 3MDCA 4G3IA 2IBKA 4ED8A 4J2DA 1Y88A 1CEZA 2BCSA 2FMPA
chains in the Genus database with same CATH superfamily
3GYXB 2F9JA 1SXEA 5J1NA 3DEEA 3MPYA 1RT2A 3H0RB 5KPRA 4H5VA 4IEEA 2FVCA 3BY5A 3MMCA 3PXGa 3JSBA 2Z2ZA 4FJ8A 4GFJA 2WCXA 5ALNA 8ICLA 4J9VA 2PA8D 1T9YA 1PJ5A 4F93B 2K60A 2KKPA 1U0HA 2VF3A 1FKOA 5ETSA 2OPQA 3KD1E 2AGQA 1I5OB 4A8SA 2KTQA 4OL8A 8ICJA 3NOCA 4LF4J 4YOUA 5L8RC 5KG3A 2H3EB 1RDAA 2Q66A 4BR4A 2P9KB 3N4QA 2W40A 2HHXA 3VGTA 3US5A 1UT8A 5A0LA 2OZMA 5GIOA 3OYCA 3HFVA 1B3TA 2R4FA 1DTQB 1EETB 4O5KA 4KLEA 3KKAC 4P2SA 3WK9A 2DGUA 2KRRA 3BYPA 3R1HA 1XNRK 2FF6A 2F77X 1SXLA 4DXLA 5LY3A 2R7OA 3VWSA 4ECYA 4ZPTR 9ICCA 1VK8A 2JFKA 3GIRA 3KK2A 1J6ZA 3Q24A 1W26A 2CJBA 4FZVA 1SWVA 1HNIA 4RQ7A 4M63A 1NH7A 2VODA 3L3UA 3QRPA 4WK3A 1FX2A 3O6QA 3EVMA 3SSSA 2UUAK 4LRBA 3EZWA 3M3ZA 3WEEB 5A2QO 4MHVA 3H6EA 1KS2A 4QIEA 2BBEA 4YR3A 1QH9A 4NYFA 1TFYA 3UIQA 5J8YC 1TZ0A 4O5BA 5AK5A 4CEFA 2L08A 4MFAA 4JHDA 1EJ7L 1TQLA 2HLUA 4HHTA 2FI1A 3HFZB 3D45A 1R43A 1K1QA 2KG5A 4H4KA 5CCLA 3X1LB 1N0UA 3SMSA 1E6VA 4AM7A 2AYGA 5KFQA 2OPRB 5J0OA 3T19A 4F2RA 3FK4A 4X4NA 4F0HA 1YJNN 4O4GB 5J2PB 4LRFA 2KJ8A 1XMQK 3CSKA 3JPQA 3OXLA 1NM2A 5J2MA 5AI8A 4C4WA 4KAIA 1O8BA 5EVZA 4KT0C 2RB7A 2ZH7A 1WSIA 4OVLA 1RWKB 2QM1A 3ET6B 1RQ0A 3ZFVA 5K8NA 2HFOA 1AT1B 4DR6K 3F2BA 1CZ9A 1M5OC 1WNSA 4PXCA 5KFTA 4IDKA 5KNIA 4BXOB 3NRWA 5HL7Q 3N9UC 4MF8A 2RQMA 3GONA 3FSYA 4M5IA 4JNEA 2YHXA 1VSEA 1S1UA 1KQFB 2ADBA 4M3XA 4I2AA 1SI9A 4H5TA 4WBFA 4LH5A 4YDXA 3MEKA 2WF7A 1MMLA 1FDAA 3HPGA 5F2RA 2HMIB 2W03A 2HNZB 4IG0A 4W5RA 5ETVA 3H46O 1ZAVA 2KYZA 2GWSA 4DX7A 3SEIA 4KLMA 1S12A 4ZVPB 3TWHA 3HPOA 2AEMA 1M1KO 3OTOK 3AT1B 1KQQA 4BDZA 2MKCA 2JEGA 3E3XA 4UQTA 1D8ZA 1H3DA 2F1IA 3O9SA 1VQ7N 3CP8A 2QYGA 2JJ4D 1VQ9N 3D2SA 1QTMA 4P0QB 1UZDA 5JJBA 5KOWA 2W1BA 4BVPA 4EBCA 4CJLA 3VETA 3KJVA 2J8AA 3MGVA 1NGJA 2RUSA 2P9NB 4IKAA 5LL6d 1ECWA 1ZQBA 2GZOA 3I4HX 1N48A 4G9ZA 5J2AA 1S9GA 3KLIB 2ASLA 1VQ8N 9ATCB 3O5BA 1VQMS 4KTQA 2NV3A 5ALUA 4MH8A 2HFZA 2FD2A 1FD2A 4B8CA 3IMXA 4BC2A 4QWDA 4U67L 3UNGC 3HILA 1LWCA 3W8GA 3DLEB 4DO9A 1RSCA 1FJ7A 3B8AX 3NGKA 2KIWA 2ZH6A 2ZUBA 3PVXA 3ONNA 2KV2A 4EZ9A 4LFBF 3I9V9 1S7HA 2N3LA 2QWLA 3OBWA 2VPWB 4HVJA 1RTIA 4DV0F 4AHCA 2HSZA 4GNIA 2P35A 3ZSRA 2BCVA 4Z4CA 3KLIA 4G1QB 4KHPK 1YJWN 4I9QA 4PXEA 3NFAA 2D3DA 3I5BA 3TVYA 5JMVA 1C0UB 3A8JA 3P45B 2ZIWB 4OD0A 9RUBA 1L3TA 2AJ4A 5HBMA 4BRAA 2OYQA 3DXBA 3M8PA 5C12A 5IIMA 1FTCA 2AJ1A 4O44B 1MWKA 5CZ1A 3QLHB 2C2KB 3HDSA 3HVWA 3J80O 4LF4K 4MK7A 1U1MA 4CFBA 1V38A 2CWXA 1X7VA 1MMNA 5ALMA 4CZHA 3RR7A 2PKEA 4IR1A 2DNGA 4N41A 2IVPA 3NF9A 1YKWA 1G4CA 2EC0A 2YMLA 3I0RB 2MSSA 1F3VA 3OYFA 3IGVA 1HKAA 4CZCA 2BDUA 3WKCA 4QS8A 1ZQ1C 1J9AA 4DV2F 2NRVA 4DPXA 1J2VA 2V8DA 3L3VA 1FK9A 2JGAA 3OL6A 1RNHA 2CJKA 4E7IA 5AFUA 1GLBG 4NLZA 4DR4J 5J0UA 4RG8A 5DDMA 2CVEA 2HW3A 4OJPA 3DFEA 5SUHA 2J4RA 4CDGA 2VB6A 4NLOA 2G8FA 1KFDA 2V2KA 3W66A 1PC4A 3QEPA 4Q0BB 2UZAA 1RDCA 1RLDA 2Y9HA 4NV0A 1U26A 4LF6F 4IYQA 4QIGA 1IWGA 2P9PB 3ZNUA 1IBMF 3C29A 3NVKA 4F0MA 5E79U 5J2GA 2ZGZA 4O0NA 2R2RA 1YLXA 2YKNB 2DR6A 1SIWB 4BROA 3ILOA 2PA3A 5HAOA 1FWLA 1VJ5A 1LFWA 2V6AA 4K4GA 4DX5A 4QOZB 4GV9A 1JALA 2ILZA 3JTPA 2O8FA 3S3NA 1QD1A 1NGIA 1R31A 3BO4A 2UXCJ 1A5XA 3KJNB 4Q0BA 9ICPA 1A0OB 1EP4A 2KQ2A 4TURA 4RPXA 5GADI 2Y3YA 5BPLA 2W25A 2VFTA 4F4XA 3KLFA 2YN4A 4BX9C 4CFDA 1WC3A 2DRDA 2PMZD 3PNCA 1SV5B 3KLHA 3NVYA 1HJPA 1RBOB 1VCTA 3PEJA 2W9BB 2LLZA 5H9FK 5T7LB 3MWBA 1QE1B 3BS7A 3WNHA 5M1PA 2CJAA 2IOFK 2FJXA 3VGMA 2W2OP 2LEPA 4NL5A 1U6FA 2M7SA 1REVA 4BE0A 3TZXA 1JJ4A 1HJRA 5DM6Q 3BO3A 3THYB 5C25A 1FXRA 3ZTRA 1FWPA 3BUZB 4JEPA 3N28A 3OFGA 4JK7A 5M1QA 3TSUA 3U1NA 3EEQA 2M70A 1XJWB 5FRNA 1LXNA 3MCSA 1SV5A 3C6UA 4CZFA 3J7AP 5HROB 2QKBA 4CEDA 5AQOA 3H0PA 2Z2YB 1RDDA 4FO6A 1RWWB 3F5TA 5IWAF 4MO5A 3BGFA 2YB4A 3PM9A 3I31A 3VENA 4A8OA 5DG8A 2E8MA 4YG2A 1NNLA 4CK3A 5M2UA 2C2OB 1LW0B 2PYLA 2ZUCA 4PHAA 2V4RA 4AQYJ 3DRYA 1JLGB 2QA4N 2OMLA 3HKZD 5AE3A 1X3NA 3ZXWA 1BGXT 1HI8A 1LW2B 4RNNA 4Y28C 4P2XA 3ZSWA 4YFKA 2V0NA 4KGZB 3NKYA 4B9SA 5AKYA 1P27B 1YAGA 3CFOA 3NCQA 3MDFA 2ZBIA 4RW4A 2X1BA 2OLWA 3J7A1 3ELHA 2LKZA 3Q23A 2IJRA 2W55A 4J9LA 3BM7A 1BA1A 3GP9A 3OFFA 3DOMB 4X64J 1K9MO 1VSLA 5D4NA 5CR4A 2GX8A 4UASA 3AFGA 3H0MB 4JI6J 2ROPA 3DRSA 4O3SA 4KITB 3MPUB 1OXJA 3TEGA 5M1KA 4FJMA 5C15A 1B92A 2B3TB 5AI4A 4J9OA 5BN8A 1NGGA 3QO9A 1B22A 5C24A 2HF3A 4MTPA 2KJ9A 4ZP6A 4A8XA 2ZJQQ 4DTNA 4NLQA 3EMTA 3LP2B 4OJ6A 4RR5A 1VBKA 1W0HA 2O8BB 2CGKA 3OSPA 1MN7A 1UZHA 3K9KA 4X65K 3M1YA 2E88A 4DUZF 4GXJA 4CYUA 3CO0P 4FZYA 4ZIWA 3KBBA 2VONA 2YX6A 3U4LA 2B9EA 4KYZA 4RQ1A 2K8AA 2G09A 2BJDA 4IFEA 2D6FC 1D9FA 4CO3A 1XERA 1IIPA 1XR5A 4EGLA 4FS1A 4OJ1A 2QWPA 2X6NA 3RJGA 1OKJA 4AYBC 2JVRA 2LCWA 5HLFB 4IKFA 4J91A 5IS2A 1WBDA 4KB7A 1TKZB 3JB9k 3D6MB 4JI0J 1U2VA 1Z25A 2VBWA 1ZAXA 4GO5X 2EFVA 3O0FA 2GMLA 3HFKA 5HVHA 3ATUA 1ASWA 3MC1A 2LPEA 5B09A 2NYHA 3T9ZA 3F9MA 1RHQB 3TSQA 2IOFA 1D8BA 2E44A 4DR2J 3TACB 4PG7A 3IV6A 5D77A 1JCFA 4AYBF 4ZP7A 4FF1A 2CPFA 3H90A 5AJ3F 4QZ9A 3G0ZA 2LXFA 3SDEA 4YD1A 1NHVA 1K0VA 4BRFA 1DBDA 4US8A 4CTAB 2HEKA 4UY8O 3DGVA 3NGUA 4B6JA 1NJZA 3ZT1A 3SI6A 2CQGA 3FRZA 3TR5A 1RZMA 4J2EA 5HO4A 5AQLA 3NVVA 3GZ7A 2QK9A 4I68A 2OYYA 3FZMA 2ZIXA 5AZIB 1DRZA 2VG7B 2W8LA 5DGBA 3OL8A 1M5PC 4IFVA 1C7YA 2Y0BB 3C5GA 5AM4A 1Z26A 2E1ZA 1D4XA 1HWKA 3MMBA 2P9EA 3VGSA 3QYYA 1S97A 3U9ZA 1BG3A 5EXWA 5CYMB 4EENA 3LUYA 1WOQA 2V4JB 3UCZP 5GTHU 5DLGA 2D69A 5E3CA 3L7OA 3AVHA 2ZJPQ 3WNGA 2EVZA 4LIRA 3NCPA 4LUBA 3AVJA 2QA1A 1AYEA 2HVZA 3RU0A 1KBUA 3UMCA 3QSYB 1OW5A 1HJOA 4FYXB 4WYWA 8ICTA 3L2VA 1WUDA 4I7FA 1X6JA 5I3QA 3ZSZA 3CM6A 3PIOQ 1XNSA 4IG3A 4J9RA 4QU7A 4IFYA 2P1JA 1K6YA 2UV8A 3CWJA 4CGHA 3UNYA 1TR0A 3R6LB 1DHMA 3LWMA 4NJ8A 2HKEA 1LVHA 2B43A 2Q0RA 3OXGA 2HHTA 4MF2A 1C20A 2E29A 4CW7B 2D5RA 1LOUA 3KLGB 2G8VA 4WQ4C 4NLNA 3CQ8A 3E2EA 1NK8A 5CYJA 1ZOTA 2W9CB 1NU4A 4OYPA 1YVUA 3VESA 3HZEA 3HSGA 4I4BA 4HCBA 3OGUA 1VQKS 3KK1A 1VQ6S 1U2CA 4DOAA 4P7TA 4Z4EA 1ELOA 4G9BA 2G8UA 2RE2A 3DN9A 3ILIA 4NMXA 3NEKA 3ISBA 1LKYB 4CJUA 1RJJA 2F5GA 3AGKA 1RHJB 5E33A 1HWJA 1U1NA 3E51A 2DHAA 1R6YA 4V19J 5HNKA 5JXSA 3M30A 2MKHA 2LQ5A 3HMJG 5J2NA 3G87A 2ZXIA 4F9OA 2ITMA 1G1XA 5EX0A 3H5YA 3CCTA 4H0XB 4C11A 4BS2A 4KBOA 2WMMA 1GOAA 1PAEX 1TV6A 4P2MA 1R0CB 7ICFA 1O13A 2BACA 4PKDB 3AVLA 3EVOA 4DOZA 5J0RA 1JNZB 4DU3A 4KREA 3Q8UA 3SAFA 5ALJA 3TA2A 1TUVA 2G13A 4M9JA 2I6XA 4GW6A 4X64K 2LEAA 3BSOA 2PFNA 3RMDA 4M7YA 4F3MA 2XULA 4QR2A 3DDHA 1S49A 4F71A 3QT8A 5ETRA 1WNEA 3OYIA 3R5DA 4UTGA 1JCEA 3SQ0A 1Q3UA 4DZ6A 2EFPA 2XS2A 1SC6A 5EWEA 2F4VK 1P6TA 3DRXA 1ZQNA 4F0KA 3ALRA 4RQ3A 2HVIA 3W63A 3EE9A 3T1YF 3H1QA 3C0BA 3SPZA 2GO9A 4D3HA 3AGRA 1VQMN 4KLIA 4PAAA 4ED3A 2JDJA 5F0WA 1OVYA 1Z4NA 1Q86T 3O2IA 4ETZA 3CF5L 4CM0A 4HACB 3PRDA 2M88A 4DV5F 4LF5K 3BGRA 2B0CA 3PRBA 3OTBA 1Y64A 3MGHA 1YSJA 1PBUA 4R0JA 4L3NA 1YJVA 3MBYA 2MKSA 2CPZA 3AO5A 5J2IA 1WSJA 1Z3EB 2QA4G 5ALWA 5JVGL 2G06A 1HKCA 3DLLQ 3P31A 4CJVA 1OH7A 2F65A 4JI0K 2XMJA 3V6DB 1BU6O 2VG5A 1U1KA 1UHUA 2FMSA 2HQ3A 3ZZ0A 1XQIA 5GAGU 3QEBZ 2QMXA 2PIIA 2OCEA 2MKJA 5B0CA 2K8GA 1P1TA 3CXCM 4DLEA 4F67A 3F53A 2W6KA 1CLQA 1CULA 1FERA 4LVOP 4MKBA 3M32A 2CNKB 2IVMA 3MEEA 4KTWA 2R7VA 4M3ZA 2F1HA 5DLFA 5KG7A 3J7YI 1VC0A 4EBDA 1C6VA 3BDPA 3ZZZA 5IT9Y 1W2IA 3TW0A 2PEHA 4JI1J 4NMLA 1XMOF 2DISA 2AEFA 3W2WB 3GV8B 1FJCA 2QXFA 3L4IA 1ITPA 1EO1A 4NLUA 5KFWA 3PSPA 1VRUB 1Q5YA 4PRFA 2QW9A 4QZFA 2CA9A 2AYEA 2AD9A 4NL9C 1P1LA 4FJ5A 1HQEA 4B3MJ 3NBPB 1UFWA 1QZ6A 4ER8A 3OL9A 2G0IA 3BS5B 2KJ5A 2CIMA 1RKIA 1RAGB 4LQ9A 2CQ1A 2NO4A 3TI0A 3BF1A 2CXYA 2GVDB 5LT5A 3F9KA 1S6UA 1WTFA 2IMWP 2ESEA 2GGPA 1D1UA 2MQLA 3BV8A 2W42A 1RISA 3MN9A 2C22A 4UAWA 4CF8A 2E8OA 4RUCA 1I39A 1HUOA 4K4TA 1O0PA 4B3OB 1WSFA 4W98A 3SMZA 4MIAA 3WNEA 2EH9A 2MA1A 4KHSA 4QQBA 4N8NA 4DHVA 4ZLNA 3I9ZA 1M5HA 2HBKA 2NZCA 3I8BA 3VCBA 4DL5A 2UUWA 3K9JA 3MECA 4IJAA 2MGZA 5B0AA 1ZQLA 4QW9A 2YQ0A 4DPYA 5KG0A 3ISND 1L7MA 1FXXA 4OJGA 4HDHA 1B64A 3MUTP 4HUGA 7ICVA 3BGLA 3K0JA 4ECQA 2Q4TA 1YBAA 3CMEN 4RUAA 4Q43A 1S1VA 3G6EN 3SQOP 4NEYA 5AQTA 2L9WA 1WELA 4KHMA 4CO4A 4B1YB 5ALXA 3G9CA 4BE2A 5KFUA 4DCJB 4CK1A 7FDRA 3J81U 3TUPA 5CWRA 2AQ0A 3N5FA 3TO8A 2NRHA 3W0LA 2EX3A 2JH1A 2GA7A 4DL2A 2QG9B 1RDRA 4HEA9 4ZDNA 3DDIA 2AU0A 4DV6J 3MGJA 1H2UX 1RT5A 3BREA 3KG1A 1HYSA 3W8PA 4ZN1A 2D1KA 3OJUA 3V4IB 4DR5F 1U25A 1TK8A 2Q36A 5CD4H 2OEMA 4Y3CA 3MN6A 4DSFA 3W1YC 4XDDA 5BR8K 4RQ0A 2MSNA 2EG2A 2RH3A 5B0EA 2BE2A 3GIMA 4UY85 2G8WA 4NPOA 1BHLA 3AD9C 3NAHA 3VAMA 4P71A 2XRIA 2UP1A 2HURA 1SKRA 4K59A 1HKBA 1BWFO 3TAFA 4EU0A 2Z57B 4Z7CA 2QV6A 1MC8A 1OO0B 3GDQA 4HI2A 4TQRA 9ICFA 5C2DA 4CVNE 1RT6B 4M7XA 5IFMA 5D3GA 1ZQUA 2HOEA 3OYLA 2WB4A 4KFBB 1WG4A 5AI9A 4O3QA 3EGVA 4TKTA 2R2UA 4DF8A 3UW1A 4C3MA 3L5KA 5LXRA 5GAEI 3KHRA 2M52A 2OTLS 2I7NA 1IKYA 4ISFA 4I56A 3UMBA 3UXPA 4KI6A 3UM9A 2WOMB 3G96A 3ALYA 2NSCA 3S8SA 3TZWA 4E89A 4TSXA 4RLEA 1TVRB 1XSPA 2H5EA 3HF5A 4GV6A 1NGFA 3M8QB 3V1RA 3TTCA 3MXHP 3KZBA 1LWEA 3H5UA 8ICPA 2BE7D 5F8NA 1HWUA 4WTYA 4R8UA 4KO0B 2HQGA 3UDEA 3CD0A 1KDHA 1KP6A 2ZJ8A 3NASA 1T9XA 1UFLA 2YVSA 4OLAA 5TZVA 5EE1A 4ZPVR 2W4PA 3PFEA 3UR0A 2HGNA 1WG5A 3IMQJ 2E2NA 2FMQA 3CB4A 4EHUA 4U9RA 4WF9Q 5BRFA 5CA7A 2L5YA 4GKKJ 3LM9A 3RF9A 4E2FB 2IVNA 1N34K 3PW4A 2HHUA 2LU2A 3VMFB 1D8YA 3K5PA 1UWBA 1CPZA 1RXWA 1ZQOA 4PWUA 2A1JB 2R3VA 4ZVSB 1UVIA 1T95A 5KT2A 4FCYA 4HI1A 4ZMMA 4PQAA 2OO4A 3MPVA 3VQ7A 3S3MA 5AE1A 1RQLA 1VISA 3BGUA 5BYSA 2A41A 1W2BM 2GS8A 3A5LC 1HBNA 2QL7B 5DDRC 4PZOA 4LSNA 4LF8F 3SBGA 2KT3A 4RU9A 4CIFA 2UYTA 4KLTA 2FSJA 4QBUA 3WKEA 3CDEA 3KKRA 4B3MK 1RBUA 5L9XA 2KLAA 3VOVA 2CQPA 3TA0A 2I5JA 1HUZA 2XWYA 1NK6A 2MQPA 3F0NA 4M95A 1Q8LA 2U1AA 1WEZA 1WD6A 2GO8A 1S1TB 3TA1A 4TUPA 1A6LA 1S5ZA 2MLXA 4DB3A 4PJ0U 1MLAA 3AA8A 2QX0A 4FZXC 1PAUB 2V9WA 4CGZA 5B0BA 8ICOA 3HJVA 3HXMA 1RTHA 4QWCA 4N56A 2HMPA 2AGOA 4MK8A 4CHNA 4D3GA 1VSFA 4DUTA 3R5AA 3VF6A 3N6MA 2DGXA 3QNWB 4M42A 1VQLN 4MMOA 1X4HA 3I5CA 3QQCD 3K89A 1ZPWX 3PR5B 2KSOA 2R2SA 4OPJA 5J2QA 4FLXA 2QSWA 3LAMA 1T44A 3VA3A 1YQHA 1M1KT 3DLKA 3CG7A 4U8VA 2YY3A 3IRXB 1GFWB 3CIMA 4ILJA 2GW8A 3QZ8A 2WC9A 5LSRA 4USWA 4KQZA 4Y2PA 1R3NA 2MKYA 5FDLA 4FWOA 2Y0SC 1SB6A 1J97A 2SXLA 2LYAA 4OLBA 3CCRS 3ENVA 4GXKA 1XN9A 3K1RB 2J7UA 2XTJP 4Y2QA 3IRWP 4FM1A 4PWDB 2AEJA 1KVAA 4GVBB 1BQNB 1DARA 2J0XA 3AAPA 2ZHAA 4BGAA 1ZQTA 2JNJA 3PSFA 2QYCA 4LFBJ 3FZ2A 4WIIA 4O4RA 1VQKN 5HRSA 5EE0A 1VQ6N 2O8EA 4K4ZA 1ZBLA 1FJGF 4JKDA 3JSYA 4USAA 3OPKA 1KKHA 2IA0A 3RFAA 3OQ2A 4DV0J 2Y0SF 5HQ8A 5HQLA 9ICSA 4IQMA 2DITA 4OZ2A 2G4BA 3DWLA 1S22A 3O8MA 2UVRA 4P52A 1DTTA 3IGNA 3VGUA 3KVGA 4C0ZA 2E1FA 4JI7F 3AO3A 4M5DB 5JLFA 1HI0P 3THPA 2XCAA 2HPUA 4LREA 1N5QA 2CN1A 3VQPA 4I69A 4QS7A 4J7CA 4U96A 4DLGA 1Q53A 2ZM6F 5KT7A 2FJDB 3DOLB 2MPUA 5JICA 3HSTB 1U7LA 4YNQA 3EY1A 2MZSA 4WU2A 1B0TA 4P74A 9ICGA 2VBXA 1UA1A 3W7BA 3MR7A 4N47A 4LVSA 2QIFA 4DV2J 4QW8A 3I8DA 2L9NA 5K14A 4UZBA 3DLBA 1N2XA 5DG9A 1S0OA 1Q4RA 3ZNJ1 1MW7A 2WVCA 4JKHA 1Z00A 2KN7A 2ZHBA 1VAZA 4R66A 4LH4A 2LQ9A 4K50A 4HL9A 4WPAA 3OV7A 1GOBA 3MABA 4DG1A 4J9QA 1O6XA 1JL1A 3V72A 2P6UA 3DOLA 3IM9A 2IRYA 3DM2A 3K4GA 4DEZA 1TUWA 1WOOA 1UW9A 1WKKA 3SENA 3CPWR 2GWKA 3EXYA 3TVZA 2MQNA 4LF6J 4CJPA 3J80Y 1IBMJ 4NA3A 1LCUA 2DNNA 1DURA 1VQ5N 3CERA 1Z2LA 4HHUA 4Z7YA 5AM3A 4UUXA 2GVZB 2W2NP 1X9SA 3NVZA 2W9MA 2DGTA 3ID6A 5CYQA 3LYSA 2PI4A 3ED5A 4C80A 2LYVA 3AODA 3VAFA 3TQEA 5IT0A 1ZQIA 3D66A 3A8EA 3ZSYA 2B8PA 3IAYA 4UOFA 5C5JA 1SV0C 4NOHA 4O8KA 2FIUA 1JMTA 2BM0A 2UV8G 1LWFB 2R7WA 2DHXA 1TL1B 3UO0A 4PKIA 1IBCB 4EX6A 3UN3A 4BRLA 1NK7A 1RT4A 1BD6A 3I5AA 1MQ2A 4C4RA 4UBCA 2CUYA 2RKIB 2H5XA 4F02A 5ITHA 4Y6IA 1EKEA 4X4OA 3SQ1A 1ZD4A 3PIPQ 4CJ3A 4TYAA 3Q8MA 3O6WA 3POTB 3OLAA 2G2YA 3W65A 1GH8A 4DSJA 2RVJA 4ECWA 3DC2A 4F4YA 1LK7A 2AX0A 3LDOA 2F1JA 3BSAA 3OTDA 2DNQA 3DRRB 3W64A 1BPXA 4BR2A 9ICEA 1UEUA 3VQ5A 2BKOA 1HPMA 5LMUF 1N8RO 4JD2A 4KMOB 2MY7A 4ECXA 3TX0A 2BKEA 4PKHA 4USKA 3QX7A 3MZIA 2BQUA 3L4PA 3DRPA 4NWBA 2KHDA 5IWAJ 3M8YA 2UUTA 4OI3A 1IKVB 4H0TB 3F56A 3H1VX 2GH1A 1KR4A 4AL7A 5DBCA 4WWSA 3FGUA 5D4BA 4CHYA 3VQ6A 1NCLA 3TPQA 3LP0A 4QOTA 3DAWA 1RUSA 5HRNA 1OPIA 1R8CA 4ISEA 1MQ3A 2MXYA 1FDDA 3N5BA 3DXMB 4B3TF 1YTAA 3QETA 1AW0A 3VVTA 4IL6U 1Y5NB 3C6AA 3H45C 2P5GA 4US9A 3P39A 3DHXA 3R9LA 3VR1A 1GTEA 4ZN3A 2FDRA 1UW4A 1TUYA 3UFCX 3L4QA 3H0LB 1SQEA 1RT3A 5IM0B 4DSLA 3DOKA 5EOZA 2OHFA 4MLEA 3T5KA 1QQ6A 5EE3A 2DUYA 5CD4A 5C42A 2D0CA 3KOOA 3AVCA 4LFBK 5EE9A 4NB4A 3KKAA 3IFEA 1HYVA 3VQTA 2J8SA 5ALLA 1K9MT 5E5NA 4DUZJ 1Q9YA 1G7CB 2CJXB 2KI2A 1T9VA 4Q2MA 1PO6A 5C10A 1NO8A 4OLPA 3ILJA 1VHFA 5L38A 1Q16B 1YRTA 2BANB 4GC6A 1N33F 2LKYA 3THTA 2P5OA 4CI6A 1RYSA 1BUXA 4DQQA 1HYZA 1KLMA 1SJ4P 3KZIU 2PFQA 1NOZA 1FNXH 2F8MA 1KTQA 1TAMA 4QWEA 2J9EA 3QBXA 4KLHA 3FSXA 2N7YA 4C8ZA 3ZZTA 1EARA 3GDXA 3NVWA 5J8YA 4FPBA 3VERA 4MIWA 3FRYA 1SBRA 2VHGA 2ZH4A 2Q3SA 4KTZA 1NJWA 3H40A 4I2HA 4K42A 1NGHA 2NLXA 4DMZA 3TAMB 3ZEUA 3C6TB 2KMDA 4LFAF 3TANA 2XY5A 3QEXA 2YNFA 2V52B 5A8RA 3MDCA 2IBKA 4WP3A 3WBZA 2KJVA 2GIQA 5AJ3J 3O9RA 1Z2ZA 3FYHA 5KFGA 4B9LA 5LJWA 2H4WB 1XNQF 4ANDA 5KFJA 9ICVA 4Z6EA 2Z2LA 3O4WA 2OTLN 2FXUA 3HOSA 5ALSA 2QB0A 3W62A 4URGA 3PHEA 3KHYA 1ZQGA 3UKRA 2R7YA 1UPHA 2FZCB 1H72C 3HM9A 2GC8A 1SV4A 1IBMK 4CH7A 4UY8T 1BWEA 5ALGA 2QWRA 2D3ZA 2F9TA 4CLWA 3DLGB 2EAOA 1L5UA 4TYBA 2E1EA 4JKGA 4DN0A 1NJIO 2KKVA 1T9UA 5BN9A 2VL1A 9ICBA 4GVLA 3V81A 4O3NA 1URRA 4KY3A 1BY9A 4I29A 3FMWA 2FDNA 4ZCKA 2CPHA 4IO9L 4WFNQ 2KIVA 2QO3A 4ECUA 1BVSA 3ITHB 1R8AA 4FLTA 2AH5A 4BRHA 5CHIA 2HQDA 2EFOA 5AKEA 5LMNK 2D3OR 3PLAA 1DEJA 3THWA 3QGIA 2LM4A 1AB8A 2Y1LB 4C6AA 3J7YP 1LNQA 4CO2A 1S0NA 2WHEA 4IQXA 4X2BA 2CQHA 3ENWA 3AOCA 2WVEA 2OEKA 3OR2A 4GXIA 2XC9A 5KFRA 4RQ5A 2FPMA 4CJWA 3OR1B 2UVWA 1Q5VA 3FBCA 2FSNA 2YI1A 2H1YA 2HHQA 5LSLA 1B70B 1UL3A 3WK7A 1R0AB 4B8AB 3S01A 3PRVA 1S59A 3MOZA 1LEOA 4JKEA 4N8OA 4QZ8A 2P8IA 3SCJE 3L2UA 2N82B 3AA5X 4TNOA 1TFRA 2ZVSA 5AKXA 3LQVA 2IA6A 4O9MA 2FHMA 3ZZPA 2WSFC 1JROA 4JRQA 3LDLA 3P5TL 3A3PB 5KFXA 2AMCB 1XSLA 3M2VB 1N5TA 1I1GA 3HI0A 3IN5A 1NPPA 2KW4A 2RU9A 4EYIB 2HQIA 3ZTSA 1TUGB 2CKWA 4NXMK 4F2SA 3D6TB 3VQ4A 2A2DA 4LVNP 3UPFA 1NEEA 3A1YG 1L7OA 1CVJA 3Q8VA 5IOLA 1N5XA 3DHWC 3ZO7A 1N6QB 2JWNA 3QIPA 3BBBA 2HBYB 1ZQWA 3RMCA 2BVZA 2YNHB 1IJJA 2Q0ZX 1QAYA 5F0XA 2WZ1A 2E5SA 1ZBHA 3QJLA 5ALKA 4K8XA 3HLUA 4RX6A 1VIOA 3JPOA 3GWCA 4YHHF 5DMRA 3CD5A 1JUDA 1WUUA 4RT2A 3K1ZA 2ZOFA 2KG0A 3GILA 4P2FA 1VQNS 3EYZA 5GAHP 2XNRA 4RQ6A 2JH7A 2QJ3A 2XZTB 4L75A 4B1WB 4HH1A 3SQGA 2EK1A 3LP1B 2DK2A 3NMRA 2DNHA 4PPZA 4LJMA 3FFIB 4DUZK 3QU2A 1LOTB 2ZJRQ 5JS1A 3T1YJ 1H1VA 1AZSB 3T3FA 3CCRN 3TU5A 2NRXA 4IDHA 2ACMA 1JXVA 2MZTA 2AT1B 2PFFB 2GMHA 1Z4UA 1RP5A 4DV5J 2ZIUB 3MCOA 4YB6A 1EX8A 3I28A 4PHTX 1M5SA 4X66F 2AJ0A 1IXKA 9ICTA 1PGZA 1FRLA 4YOWA 2K4IA 3PW0A 3SIPB 5LJ5Y 2JZBA 2DGVA 1IUJA 1YI2S 3RBXA 1WSHA 5D78A 3OXFA 4QZAA 2VA8A 1NZ8A 3C46A 5KFZA 2LQJA 1X5SA 2BXJA 5M2RA 3C7NA 3L2RA 4OYMA 4A61A 2P9GA 1FA0A 1NWKA 4IR9A 1W9HA 3GPAA 4C8MA 3OS1A 4MEXA 2B4PA 2GMJA 3P4IA 1RTJB 1OQ6A 4PL2A 2XI2A 4NLXA 5FPNA 5GAEP 1ED1A 1XMOJ 2E2QA 4CFAA 1A77A 3BJYA 4FLYA 3C1YA 4KRFA 1N36F 1WSGA 5HL7L 2BE9B 2K7KA 4NCBA 3C28A 4OV6A 4JN4A 1VGYA 3GE1A 4LZDA 1KTVA 4Y2JA 2QEXS 1Q18A 2LA6A 3TSPA 1C4CA 1NK4A 2PFOA 4WFBQ 2YNIA 3RR8A 2FY1A 4P6QA 2CGLA 1SZHA 5DRKA 2XS5A 3CC2S 3IS9A 1I6JA 1KHVA 4OQJA 1U2FA 2YKAA 4WFAL 3H8SA 4OIXA 3MX2A 3VQSA 1LQ9A 4FM2A 4WCEQ 3ENAA 3HT0A 1RXVA 5K20B 2X74A 4PGXA 4PH5A 3UB5A 1HHTP 2KRBA 2JEFA 2K4PA 1XSNA 5BYQA 5J2KA 4QCLA 4KH4A 1JKHB 3N7PD 5IIOA 3N0VA 4OYZA 2VBYA 2O5DA 4ZH4A 2NLWA 2PXIA 2AZ3A 3NP5A 2HF4A 7ICTA 3O1LA 1YRUA 4BRQA 1F44A 2UVVA 3VQQA 1HNWF 3LDQA 3BQ0A 2RDIA 2ISPA 2BH1A 1EQMA 4OJLA 3N7SC 3C2LA 1YBTA 3BQ7A 3R97A 4RU2A 4KJIA 1G99A 1ZA1B 4K5RA 3HJFA 1XIQA 2UU9K 3V9UA 1F2GA 2Z8QA 3BR9A 1NG9A 2HFVA 3MM9A 2BJ9A 4O5EA 3CJ5A 3D0HE 1OH5A 2B9XA 2D3O1 1C2PA 3UQ2A 1XC9A 2KVIA 4OX9J 1KLNA 1TYQA 5C2CA 3IBWA 2ROGA 5KQDA 1HPZB 4KGMA 1RT7B 2A19A 2VQFK 4FJLA 1QVGR 2F8KA 1UEKA 4DS4A 4LR7A 1U02A 1U6ZA 2XMWA 3QGGA 3R2DJ 1CJTB 5A0YB 2HRYA 1U48A 2MZ1A 4B3RF 2MJNA 4DR5J 4Q7AA 2QB1A 3DMJA 4BC4A 1RT1A 1N5VA 3MAQA 2BJ8A 1RHRB 1BOTO 2HDOA 4OI0A 2H3GX 4I9LA 5K5MA 3KFUF 5B0FA 1ACMB 2OD6A 3TRGA 5I3PA 3GIIA 5A6WA 5HP4A 3I1YA 4PL8A 2KFYA 2G0CA 3MD3A 4BCAA 4FOIA 3RRGA 5FP0A 1S6QA 1P8ZA 5AXMA 3CJKB 4C0HA 4XDCA 4ECVA 1HIYA 9ICRA 1NJXA 4JV5F 2A3VA 3ULEA 4C8NA 4FXVA 3T1AA 1NZBA 4K0KK 1WSRA 1UT5A 3MAAA 1D3WA 5L46A 1IKWB 4FPRA 4FWSA 3T1YK 2B0GA 4UAVA 2NYIA 1PVRA 3W5ZA 2OXOA 1S9EA 2OEJA 5AM5A 1G6BA 3D2EB 2MU2A 1K0TA 4C8KA 2IM1A 1WBBA 3WDOA 4F5OA 4DV5K 3CQYA 2VA2A 3CW2C 3M7VA 3U1LA 3S9HA 1ZOLA 1ZRMA 3NUQA 3AJDA 4ZVFA 3F2KA 2OFGX 3AVMA 1OWXA 4PA1A 1CS4A 3HSCA 2H3IA 1NGDA 5BPMA 2OMOA 3MWTA 1XMBA 3K57A 4C0OC 5J0YA 2DO4A 3H3OB 2JRZA 4M3TA 3HHLB 5KG1A 3R3LA 2IYIA 4KLFA 1C0MA 4Y2RA 3OYJA 4W5TA 5A76A 2KVQE 3RMAA 3W9IA 2FUG9 2ZNZA 8ATCB 2JGUA 4GKJF 3GBTA 4LRAA 1S4FA 2RRNA 2GIFA 4CGIA 4DCPB 1BO5O 1L3SA 4CEEA 1ZBIA 4ZP9A 1LK5A 3MM8A 2VQEF 2ADCA 5E3RA 1U1QA 1XMOK 2ZOGA 4J03A 3QEAZ 4LF7F 1VK0A 4DL3A 3HHLA 3G82B 3FEYB 2ZDPA 5DM6L 2W7OA 2I7PA 1KOOA 3VCDA 4F5PA 1URNA 4LF8J 2NXUA 4M3YA 1A7GE 4CCHA 2ZWOA 3VAJA 2I1QA 5J1EB 5AZJB 3RB3A 4A8YA 4IH6A 3VEZA 3U27A 2NZTA 1D9AA 1SXDA 1HNZF 5FLXY 1JJ2R 5KFFA 2B4OA 1T0TV 2E9TA 1NZPA 1AUDA 1YHQS 4WQ4A 1AXQA 2JLEA 2GX9A 4BACA 1S77D 8ICVA 2WF5A 3TJAA 4JWNA 4JYAF 4FFDA 3OW2M 1MU2B 1RDBA 1ATNA 4H0OA 1VRTB 3D3CJ 2XO6A 8ICGA 1VSHA 1IR1A 3FMBA 3NH1A 4RW8B 4JI6F 3CC7S 3D7SB 4Q8EA 2V8PA 1SUQA 1ZH5A 4LY7A 1R0BG 3BGOP 3GIJA 4LBHA 4JI5F 4DQPA 4LF1A 2BMBA 3LA0A 2WB1C 2A42A 3ZX2A 3I4PA 5B08A 4CQ1A 3C8YA 2ZTCA 4QZCA 1CC8A 1WB9A 3GE9A 4H0YB 5A2QU 1UVLA 3IG1A 4UBBA 1IR0A 4HTJA 4XPCA 2PZSA 1FESA 3MEDB 4RQMA 7ICNA 4F4KA 2VICA 1HQUA 2NXCA 2ALYB 2RP5A 1DKGD 3ZCMA 1IJEB 2PEBA 3QBCA 4GMKA 1VSIA 2A1RA 3ATVA 4I6WA 1C1CB 4DL6A 2NUBA 2XSFA 5I42A 1JLAA 3A13A 1ZQFA 4J9NA 3SBTA 2WB1F 2D1CA 3WIUA 4DTXA 1SJ1A 4X4QA 3PR4A 4KMUA 4DI6A 3GFKB 4CFCA 2ZIVA 4MFBA 1GQEA 4WYLA 3U7JA 4FPAA 3AQOA 1H74A 2QARA 1SL0A 1BHNA 2F4FA 3EM1A 3EWAA 1HFEL 2BQ3A 4JBCA 3N4WA 3T7ZA 4DPOA 4NO7A 4B9MA 2AJFE 1GLDG 4BJQA 2VH7A 3UKUB 2WTUA 4I2PA 3GG1A 2DF4B 1T11A 4DR2F 4DU4A 1YITS 1FJGJ 4UZCA 1KFSA 3MOJB 1AQ6A 2HAFA 3HPHA 4CP5A 3KXDA 3L0QA 2VKQA 2DY9A 4JI4K 3EPGA 2B6GA 2CPJA 4ICLB 3RRKA 2JVOA 4LRCA 3TABA 1RK8A 3E9LA 4JI7J 2R8IA 5F8LA 3H8MA 3QU7A 3SSRA 2ZTDA 2AIRB 1Q79A 1YWXA 2LMIA 3HVTA 3SCIE 2GCFA 4C8YA 2HBZB 3C1ZA 4NXNF 2ZG6A 7ICEA 2P9LB 2BOAA 3L95X 2ZM6J 2IDEA 2K3IA 3SCXA 2WONB 6FDRA 1HBMA 2JEJA 2H54B 5DM7Q 4M5NA 4I2CA 5DGAA 3OVAA 4ZLPA 1RQNA 3O9QA 4X4SA 1RAIB 5HJXA 5D4LA 2ATQA 1T9TA 2HS3A 5C2FA 4QZGA 5IV4A 2V51B 7ICHA 2GO7A 4I6MA 1OSCA 2Z1HA 4FKXA 4QZHA 2VFRA 1QQOA 1S1XB 1VQNN 3NF6A 4MFCA 3QDKA 4ED5A 1U47A 1ULRA 5G4DA 4ELVA 3L3CA 1BA0A 4ANCA 4YB5A 5KFEA 3HX0A 1JNRB 1QM9A 4NL9A 3AHPA 3RSEA 2I2YA 3U3YA 1Q82O 3B78A 3GG4A 3SUNA 3AAWB 3ISDA 3OY9A 3D5MA 1X9MA 2POKA 3JXUA 2NO5A 4C7YA 2Q43A 3LPTA 1HBOA 3G6XA 2IVYA 4WQ5C 4CZKA 4WE1A 3CRXA 4ID8A 3NNAA 3QWUA 1HBUA 3CJ9A 1CJKB 5KTQA 1X4AA 3OD2A 4Y2CA 2B5JB 2BV3A 8ICBA 1KC8O 1FWKA 3WX8A 1YK9A 4NLDA 4NZ0A 4CHZA 4XTTA 1ICEB 1YI2N 2DTJA 1YJWS 4ES1A 3T1HF 4ALZA 2NRTA 3JS9A 7ICOA 1S1WA 1SC1B 4FK2A 5BOLA 1N32K 2WFBA 1XK8A 2IRXA 3P5JA 1RU2A 2XWXA 3H7IA 2MY8A 2MTLA 3D6HB 2KH9A 2VASA 4LF8K 3RJJA 3HL8A 1NPRA 2WAQD 3IAS9 2XMAA 4A8MP 1WEXA 1ZQPA 4X4PA 2Q31A 2CQ2A 3CMES 2GJ2A 4O5CA 3OUYA 4PYAA 1F2HA 2ZWPA 5I3UB 2Y0SD 4FOEA 5ADXH 4UQGA 4NYPA 4I2QB 1VQYA 2GAHC 1YTYA 3TUJC 3L3FX 3VF4A 2DPJA 3M7DA 2AWZA 2C3UA 1A0PA 2K8CB 4PZVA 3AARA 4HCCA 1H2TZ 2QEXN 7AT1B 4XH4A 5ALYA 2RQCA 3F2DA 4JV1A 4JP8A 3C14B 2FHJD 2XYPB 2QN6B 1YTUA 1QTNB 5CEHA 3GMGA 2I1RA 4QZDA 1V4TA 3PMLA 1XC3A 4CM2A 4KR0B 2D0AA 1TKTB 4J9SA 4UB5A 2B6AB 4MT1A 3G86A 2YKMB 1IKXA 4NLTA 3A2FA 5F3ZA 3PYDA 3M2RB 1N8RT 4M1KA 2ZJ5A 3MUMP 3V6HA 3FR0A 4USHA 1T3OA 2Q79A 2QT7A 2B4VA 1HR0F 1DQAA 5IT9O 4RTFD 2O8CB 4PL1A 2IBOA 4AHRA 2DH9A 4B3TJ 1IBKK 3RH6A 1WDTA 3J8AA 3SYZA 4E7HA 4RW6A 1CJUB 4OGCA 2E2PA 3C2KA 3HKWA 5FJ4A 1AROP 3AN1A 4EAHD 1MSWD 3D7EO 1LV5A 4FZNA 4OHZA 4M9GA 1HNVB 4IS7A 2CQIA 3D0IE 3U8XA 3FQLA 5HMZA 1ZQAA 2RU3A 2DNRA 2BABA 3SMVA 3U26A 4KC5A 3EE8A 2P9UA 2KXHA 4ZJOA 3E0FA 4R5PA 1OH8A 3BQ2A 1A9NB 2G8HA 1EWQA 3NGDA 4IZ9A 4PCQA 1PYOB 1RB0A 3RUBL 3JAMY 3K59A 3M1VA 5IZHA 1FJGK 5AI0A 1Q3VA 1XNRF 3NCRA 4IJNA 4L3KA 3ASMA 4BVOA 3A3NB 3DLLL 2HWTA 2PGCA 3KJFB 1JJCB 2CQCA 1KHWA 5AXKA 1N33J 2YWEA 3IG8A 3HD2A 5D0HA 1FT8A 4CF3A 2KO1A 1UJ5A 4CZIA 4KRWA 2UUAF 3RVCA 4JI7K 3HRDD 3CJTA 3WQTA 3MR2A 2YMQA 2XQCA 4MKYA 5HR6A 2Y1RI 5J1PA 1ZQEA 1O1WA 1Y0HA 1RXOB 2HQCA 1TL7B 1HW9A 4EI2A 3U02A 5M1OA 4XH1A 2ZM6K 3JQMA 1HMVB 3JS6A 1H7WA 4K8ZA 1OSDA 4ZHRB 3D0PA 4ITSA 2P2CB 3HX9A 4QJFB 3NF8A 2CQ0A 3P5BP 5MLCV 2I0XA 1I3OB 4FXWA 1P9YA 4GIBA 3ID8A 8ICQA 4LFAJ 3OLBA 3C16B 3QICA 1HKGA 5F8HA 1U24A 4LSZB 5AIAA 1RBVA 1APSA 3C66A 4V19X 1DLOB 1BC6A 4EYHB 3ULDA 1IQTA 1WAJA 1XEZA 2VG6B 1XMQF 4OJ5A 4W5OA 1ZM4A 1XNQJ 3OBYA 1HMVA 5MAOA 4ZHRA 4TY8B 3DGPA 3E01B 4DTSA 3ZSVA 5GMKa 3KLEA 4JS5A 4YVZA 4M5HA 3RG6A 1K8KB 4FSVA 4CECA 2CPDA 3LGMA 3ILLA 3I87A 3B9JA 4X84A 4DR6F 3FCHA 4XIUA 4BY9C 2MZQA 4WZMA 3QE9Y 3N79A 3PUFA 2R7TA 3Q8PB 1IG8A 2NREA 3OHAA 3PW2A 2DBBA 4ECZA 2V2ZA 4PG4A 4ID5B 3BQ1A 1X66A 2Q1NA 1BI4B 3R9PA 1S6PB 3PJWA 1I94F 3W60A 2HSTA 3A5NC 1IR2A 5G0RA 4P4MA 4K4UA 1YJRA 3OTOF 3B6OA 3Q86A 3UCUP 2F76X 1NJIT 4CLLA 2E8NA 4CF2A 2RDJA 2VCPA 2FLLA 1BDGA 2W3RA 4QWAA 3VPZA 8AT1B 2NYVA 3J81j 3IDWA 2H51B 2HNYA 3W9HA 2XMVA 3M6VA 3ZD9A 2YQEA 4ZVUB 1U8WA 4OPHA 4J9UE 5HMWA 1P8GA 1VR6A 4I64A 4YDUC 1RBTA 4XQ8A 3ICXA 4RZRA 1X4EA 2HK3A 1HEKA 1UTAA 4IRDA 2FJBB 4DR3F 5HP1B 1UETA 1TKXA 1J5EF 3KDOA 1JL2A 1ZM3A 4RQ8A 5IIJA 4RL1A 4Y2XA 3R1LA 3V4MA 4L73A 2CRLA 1ZQDA 2F8HA 5G5GA 4UARA 2WF9A 2YNGB 5ALHA 1DAXA 3QUTA 3I55S 1ZZFA 2DGOA 5LMUK 2ZE2A 4MYUA 2DIVA 3ZTQA 3T5LA 5L1KA 3TX8A 1VBYA 2B8QA 4F26A 1NBWA 2VWBA 2WBRA 2ASYA 1W97L 5K8OA 4JWMA 1YHQN 4USUA 1PK3A 4IO1A 4B1VA 2FHJA 1RCHA 4ZP8A 3MAHA 2GHPA 3H3NO 3GJTB 2MZRA 3GIKA 3CJCA 1FNOA 2DCLA 3H8YA 4DR7K 4IQVA 3OYDA 2KG1A 2IIHA 1NOMA 3Q8KA 4H5WA 4KHPF 3CJ3A 2O66A 3AOBA 1JLBB 1FFSB 3CC7N 3OYAA 4LBIA 4KH1B 3WK4A 2JZ5A 3B0XA 4C4TA 2DFFA 2LXIA 2CDQA 4WIQA 3VZIA 2P9KA 4RKUC 5AKZA 2YWWA 1BQXA 1QAXA 2E1YA 3EE3A 4LJXA 2M2BA 2C3PA 1EWRA 1UEVA 3TOQA 5DQGA 4FS2A 4IWVA 1MWZA 3BEXA 4J37A 4CEZA 1DTQA 1EETA 2XSJB 3IWXA 1F9EB 4YHHJ 1JLBA 9ICUA 1JLFB 4F3OA 4OI6A 3U1MA 4H0VB 3TJ9A 2MQMA 5AKJA 2D0OA 1C4AA 5CABA 4O3PA 2G5IB 4F7VA 2ZD1B 3ZC4A 4GKKF 4O55A 4O23A 2C3OA 4RBUA 1DK3A 2IM0A 4BRCA 3ZETB 4CESA 1MWYA 4G1IA 1QUPA 1S5LU 5D8HB 1IBLK 2VUGA 3ONQA 3D6JA 3WEEA 2HNDB 1XS9D 1WHXA 1N33K 5E7OB 4NE9C 2EEYA 5KFAA 3F41A 3H5SA 5JVHL 4X66J 3GZFA 3CI5A 1ILYA 3TVKA 4FBTA 4BBYA 3LANA 1FDNA 1YITN 2MUTB 3CF5Q 2YWFA 1T3VA 2X3GA 4FL9A 4TXSA 5JTIA 3D54A 5FD1A 3CJ4A 3KD5E 1JXBA 2OPRA 3K2YA 4DCHA 3LZJA 2FJAB 4O4GA 3CJ1A 5J2PA 4WJBA 1N5YB 3DJCA 3MFHA 5LL6Z 4LFAK 1FRHA 3VEOA 1KVKA 4MDBA 5EGYA 2GNKA 2FVPA 3C5FA 2ROEA 1VSDA 3AVKA 2FPKA 2HVHA 1SV0A 1GNKA 2UUCK 1WWVA 2A6MA 3ET6A 3M6GA 4B3SK 4NX9A 3MMVA 1PG5B 4A2BA 1CZBA 4L74A 4BXOA 1C0TB 1N36J 3DU6A 2GFFA 4DX8H 2F8LA 2NXNA 1DZ5A 1R89A 2HOQA 1S9FA 1SC4B 4JI8F 1CJVB 2UXDF 3R8EA 3MR6A 3EICA 3ISZA 2HMIA 4RW9B 2HNZA 3AA3A 3THXB 2QLXA 1UFKA 1CQMA 2RS2A 1KW4A 1HW8A 3SUPA 3RJMB 2IJFA 4BRPA 4AH9A 3JSMB 2DH7A 4S0MA 3RJFA 2EAMA 4FDFA 2XZDB 1M5KC 2HS4A 9ICMA 1SCJB 2I8EA 3QIOA 1MG7A 4CD1A 3H4DA 2KHVA 1PILA 4OI1A 4ZPBA 4F5NA 2FSKA 3CD6N 3Q2SC 2GLEA 4FWQA 1FFUA 4P0QA 1S7IA 4ICAA 1KOHA 2JFDA 4JI2F 1KBRA 3UD5A 4CNQA 2JXJA 2EXUA 2HZCA 3KMSA 1V5IB 1QQ7A 3FBFA 2RPIA 1G15A 1PK1B 4J2AA 2P9NA 2OJ3A 3T9NA 2Q6CA 1HNWJ 2PMZC 1RADB 2MQOA 1JRPA 5CB1A 3DU5A 5TKWA 4USMA 3O44A 5EDWA 2X1FA 5TKYA 1DQ9A 3DLEA 1K47A 2ZH2A 4FW2A 3ZT0A 2VA3A 2HGLA 3IHQB 3NTUA 2BUPA 3MMAB 4F3TA 3VQAA 2MAXA 4JOUA 1RACB 4DSIA 3I32A 3O1BA 3CPWM 3BEGB 3K17A 2QTDA 1NJYA 1F9FA 2IVFB 2C3YA 2ZDOA 4FZMA 3UDCA 3Q22A 4KN7A 5KAKA 4E1JA 3CFRA 1UA0A 2PMZF 3ZYYX 4CJTA 4G1QA 5CP2A 1ZQYA 1H2VZ 2MQ8A 4RWXA 4Y1CA 5E3PA 1C0UA 4F5QA 2KKZA 4X65F 2ZIWA 1S0MA 2DT9A 5AM1A 1DJ0A 5AQYA 3T6JA 3OTQA 4L76A 3NNHA 3RH5A 4B3RJ 4O44A 4FVUA 9ICHA 1BNOA 3QLHA 4U95A 2KN4A 1RHUB 2RHSB 4M41A 1OQ3A 3HKZC 3R7NB 2CJQA 4PYDA 4NI2B 3M8RA 1RDUA 2DPIA 2VANA 1I51B 3BYRA 1NGCA 5F8IA 1SVDA 3I0RA 3TUZC 2DHGA 3NLCA 4KKOB 2OPPB 8ICWA 5LM7E 1TUUA 4M6WB 4M94A 3HZ6A 4XAKA 2F44A 5DKWA 3ZI4A 2ZZTA 2KKHA 4YHHK 1RGVA 2KM8B 1WC5A 3B54A 3FKBA 4JV5J 1DY3A 4EIAA 2Q0UA 2PMWA 2JHDA 1OUQA 3IG5A 1PCAA 2QA2A 2EKNA 3HKZF 2MB0B 4A8KA 5H9EJ 3AVAA 2LSNA 3J7YU 2HHHF 2E3TA 4UW9A 1ZJNA 2EZYA 4IH5A 3LDSA 4TU8A 3WXMB 1V6HA 3UQSA 4UW2A 3NE6A 4LF2A 4JLHA 1M90O 4AD6A 3C94A 4FWMA 1XO0A 2J7KA 2P9PA 3N4PA 3LO3A 1ZZNA 2ATLA 3MFIA 4CJSA 4MN4C 2YKNA 3RAQA 3VF2A 4UF4A 5E26A 1AFJA 1H73A 1J5OB 3G6ES 3NOGA 1N60A 2KYXA 3QUCA 2HG4A 4CLPA 4BWJA 2KEYA 4DWIA 2EWSA 2JR5A 3O1WA 1NDCA 2GUPA 1EAYC 3H2UB 5T7BA 1ZQZA 3GOIA 3O9TA 4CNYA 5CRXA 1JLEB 2HHPA 4B1UB 4NLBA 5BPCA 4DFDA 4RW7B 2QGFB 3D2FB 5F0UA 5G5HA 1WG1A 1HLUA 4PL7A 4AUKA 8ICSA 1B9DA 2EANA 2G2OA 1WF1A 3G8SA 3OTEA 4GKJJ 4U7CA 1GLEG 1ZBUA 1QZ5A 1KD1O 2W9BA 2XY7A 4E0DA 2ZKUA 3TFRA 1TVAA 1J5OA 4QIWC 2QWMA 5T7LA 1QE1A 2RRBA 2VQEJ 3MM7B 2V8GA 3N4MB 3HWTA 3RRHA 2GQQA 3FZHA 4LF7J 3PIPL 3QZ7A 4DTJA 4ERDA 1X5PA 2KHCA 2A18A 3THYA 4LSLB 3WXIA 3QEVA 4ZOSA 4H4MB 4PABA 3VF0B 3GLJA 2KOBA 1Y9OA 4YB1P 2DGSA 2XO7A 5HROA 1HNZJ 4QIWF 4ED6A 4CLUA 2OP5A 1ZQMA 2QWOA 2ZVIA 1YRXA 5I9EB 4HTLA 2MDAA 1QS4A 4OJ3A 2OANA 5GAHU 3BKUA 5DO2A 2IM2A 4RWWA 4FF4A 3JYTB 4JYAJ 2VJUA 2V94A 1OY6A 4HUEA 1LW0A 2BOPA 3LPYA 1JLGA 1HWLA 3OVSA 3S1TA 1LW2A 1MROB 1QAJA 2APOA 2BRKA 4JI5J 1FKPB 2FMPA 3KJQB 3H98A 2CZ4A 2YHBA 3FAHA 2O01C 2HFSA 5B5EU 3A4TA 1HNWK 1NMEB 1VOMA 4IOBA 4IXCA 3AU6A 1OYDA 3DOMA 4FWRA 4M5JA 1T03B 1AA1B 3G25A 1VC6A 1ZD2P 3M6KA 3CCSS 1GXLA 1SZ2A 4ZVEA 2G1HA 3CIZA 2GV1A 4JK8A 3L9ZA 4E7JA 2GJFA 1ZD5A 3LP2A 2KP7A 3MEGB 2O8BA 4KHUA 1E6YB 2R42A 5J2BA 3CCWA 3S3OA 4HUFA 1V9PA 1EX4A 4CBUA 3UVJB 3PY8A 1W2BR 4LBPA 2E20A 1NGAA 2RS8A 5GAEU 5ETKA 4LFCF 9ICOA 8ICYA 3ZX3A 3NRZA 2H5JB 3KYLA 4KLQA 5ALVA 1X4GA 3ZT3A 4UAYA 2R8JA 2ISOA 3NVMA 1D0EA 3I55N 1ZPVA 1EQ0A 1H6KX 4C3LA 5DBAA 3AVIA 2CNNB 3ZT2A 3C15B 4A5AA 5HLFA 2YWHA 4HYKA 4DR4K 5HMMA 2IC3B 4LF5F 2K2PA 1Q7YO 1TKZA 4KBIA 4USIA 8ICIA 4ED1A 4FLVA 4YR0A 4BLGA 4E1MA 1WG8A 4DSEA 3MHYA 1TP7A 2BPFA 3HVAA 2BPCA 2DJWA 3HO1A 3NS5A 2DFHA 2CZVC 2D9PA 3CETA 3G6YA 2D41A 4JV5K 4NXNJ 1VRQC 1X0FA 2KXFA 2X3DA 4TU7A 5A8WB 3B8HA 1ZBFA 1X9XA 1J2MA 1IQZA 2RAQA 4CTAA 1KVIA 1VQLS 1NAQA 1S79A 4CF9A 2LQBA 5CZ2A 3C19A 3I82A 1GXUA 1BQMB 2UXCK 1QQNA 2XMMA 1JB0C 1ROFA 5K8PA 3KK3B 4DFKA 5J2DA 1F21A 5AZIA 3WKDA 1TMJA 2VG7A 5F9LA 4HWIA 4Z4IA 4R0EA 2YPZA 2V34A 3M6XA 5ALPA 3RJEA 4N5SA 1N63A 4AHTA 3V5RA 3HHLC 3NGIA 3D28A 2CYYA 3WQUA 1VQPS 2OA8A 4URSA 5K4LA 1H0HB 3O08A 4MFFA 3LOUA 1ITGA 5DK5A 4PQUB 4MDAA 3DXSX 4FK4A 4E7KA 2XMUA 5CYMA 4BDPA 3GFYA 4J90A 5GTIU 3CJBA 3W2VB 2R8GA 2A6AA 2V4JA 4NLCA 2J6UA 4XEIA 1FRKA 3A8YA 2RF2B 2GTDA 1UVNA 3JTOA 3QU5A 3FM9A 1NPKA 1Q82T 1JXLA 5GIPA 4Y1DA 2Q3PA 4KH5A 2F96A 4O8UA 2VQEK 2XB2D 2EW9A 2WB1D 5AKIA 5KFLA 3FCVA 5CA5A 3CCLS 1TL5A 4ZKAA 3CCQS 3KZXA 4Q8FA 4Z4FA 2E4LA 1GT8A 3VEYA 3T1HJ 4IOCL 2BJ3A 3QFUA 4MKAA 4DQRA 2C2ZB 3W2VA 4RNOA 1RAHB 2I9SA 1T02A 3OYEA 3H8WA 4P0PB 3KLGA 1KC8T 2CAJA 5D15A 3MR3A 4AQYK 3NDKA 3F2CA 2W9CA 5J0WA 5LXYA 3HHNB 4OHYA 1COKA 1QHTA 1FJEB 4Y65A 2PI5A 1JLQB 1HNZK 3FJ2A 1HA1A 5KGWA 1WCNA 1KONA 3CMAN 2QL9B 1LKYA 3C21A 2HBJA 4ECSA 1NGEA 2BHNA 2PN6A 2GQCA 2PO4A 3CNQP 5CE3A 5AQJA 1ZQCA 3SI8A 1V85A 4NEZA 1GOCA 1RBLA 4PEOA 2V68A 2V50A 4CGGA 2NXJA 2XY8A 4JI6K 2D74B 1IN0A 1T05B 4XO0A 4BC7A 3CNHA 4FJIA 3WHIA 3IUCA 4E98A 3WK6A 4CLYA 3MX5A 2VPXB 1VIXA 2HIYA 4IOAL 2BGGA 6FD1A 4NM2A