1NJZA

Cytosine-thymine mismatch at the polymerase active site
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1njzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1njzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1njzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1njzA01
5KFQA 4H8KA 4FLUA 1ZQRA 3VQ7A 4F5PA 4KHYA 4QWDA 1ZBHA 2O4GA 2BR0A 4O3OA 4XQ8A 5HRSA 1ZQAA 2FBVA 3AO3A 3U6FA 3RB6A 2W9MA 3HP6A 5DB6A 4RQ7A 4DTRA 4ED3A 5FRNA 5FRMA 4KKOA 5KT3A 1RTHA 1D9DA 2X6NA 4F5QA 4CEBA 4CGFA 1S97A 4PGQA 3H40A 4R8UA 4TQSA 2JZBA 3HWTA 4M3WA 3DMJA 3KLFA 4FLWA 5KFFA 3GV8B 1RBTA 4RQ4A 5JS2A 3TAEA 3RBDA 4RNNA 2P5GA 2DY4A 4J9OA 4YXMA 4MEYA 5DBBA 1TFRA 3JYTA 2W42A 3AVCA 3AVLA 3PW2A 3DLEA 1BIUA 4KV8A 4F93B 3O3GA 3HPGA 5J0UA 1LB2B 3OYCA 1T4GA 1ASUA 2G8UA 2D0CA 5KG3A 1RT3A 4Z6FA 2X78A 4AHRA 4GXJA 2ISPA 1A77A 5J0OA 2V4RA 4DL6A 2PFQA 4CJKA 3V6DA 3B0XA 2A1JB 3C2MA 2B5JA 5DKWA 2WONA 8ICRA 3P1GA 1IKXA 2BCSA 4NCGA 3L3VA 3TAMA 3KHGA 4TUQA 4ELVA 4QZCA 2VA2A 3AVJA 4ZH4A 1LWEA 5E41A 4LSNA 1ZQKA 5C42A 4TUPA 4O44A 4M9HA 4I2GA 2JLEA 4AHUA 3VA0A 1RILA 8ICJA 3DOLA 4FJXA 2ALZA 2QKBA 1TKXA 4EZ9A 3GV5B 4P4PA 3WNFA 3L3UA 4O4GA 4CCHA 4PHDA 2YNFA 3PO5A 5KRTA 2KN7A 1TKZA 3AA4A 4KLFA 1C1BA 4RW4A 4W5OA 2KZ3A 3S3NA 1SZPA 4FLTA 8ICQA 1TGOA 3KHLA 7ICUA 3JPRA 4O5EA 3HPHA 3ISDA 4FJLA 3UIQA 4P2HA 1ZQTA 4M42A 1SL1A 5DBAA 1CZBA 3K2PA 4IRKA 4UB5A 2ZJ5A 5IIIA 4UQGA 4E0DA 3G10A 3QNOA 2BQUA 2BCUA 2HHUA 8ICIA 5KG5A 1N56A 2W8LA 2HVIA 1FXXA 3RMDA 4I2EA 1BPBA 5FROA 2XCAA 5CP2A 3RJFA 4HYKA 4RG8A 4YR2A 3V81A 1T7PA 8ICNA 3SUNA 2Z1HA 1HYZA 2C2EA 4KFBA 4XRHA 1GOAA 4ECWA 4UB4A 3RAQA 2J6SA 2ZTDA 3LP0A 4RQ2A 4CGGA 3K75D 4GLXA 4CEQA 2KZZA 2I1QA 9ICIA 4FJGA 1RNHA 7ICSA 4M41A 2AGPA 3I0SA 2JGUA 2E4LA 3LALA 3ZDAA 3M9OB 3RR8A 2Z1JA 3AO1A 1J9AA 3K58A 3TQ1A 4O55A 4CFDA 2D0BA 2P5OA 4LZGA 3KTQA 4Q44A 4IQVA 5KFOA 3AVIA 4CK1A 4Q8FA 4FLYA 4NLGA 4ECXA 4CGIA 9ICGA 5J2JA 1A5WA 1FKOA 4UB3A 3K4GA 1IG9A 4DL7A 1LV5A 3RMBA 1NK7A 2FPMA 2UVUA 8ICUA 5CY4A 3I8DA 3KHHA 4I9QA 4MF2A 4E3SA 4DMNA 4PA1A 4Z4EA 2OPRA 3AVKA 1ZQFA 2XY5A 4M2YA 4DSKA 3LWMA 1HMVA 4NXZA 2W9AA 4O9MA 7ICNA 3V6JA 3TARA 1X9MA 1ITGA 3E2EA 4ID1A 4M9LA 3K5MA 5J2BA 3OHBA 3EPIA 4I2BA 4ELTA 3OY9A 3PR5B 3O4NA 4RQ6A 4O3PA 4KMUA 3NFAA 3RJJA 4CHQA 4FLXA 1ZQNA 5C5JA 7ICJA 5J0YA 1X9WA 1SKRA 1ZQZA 1ZQQA 5HHHA 1L5UA 3RJIA 3LAKA 1RPLA 4HUGA 3VQ6A 3Q8SB 1BISA 4F2SA 4E1NA 5DG7A 4I2HA 8ICYA 2HNYA 2OYQA 3NTUA 5KRSA 4EYIB 4RW8A 4C8MA 1QE1A 1IO2A 4KLLA 4CGHA 3JPPA 1TAUA 4N5SA 3T19A 3GDXA 4NY8A 4FYDA 3OYNA 4F5OA 1WSHA 3NBPA 5KFHA 4KB0A 1I3AA 2OZSA 4CGDA 5KGWA 4CF0A 5KTQA 1QQCA 1HQUA 4DTJA 4KITB 3NHGA 4M3ZA 5J2DA 3OJSA 1BPDA 1RZTA 3KHRA 4TUSA 2P66A 5KFJA 4DLEA 1O1WA 5KFPA 3WNHA 4DTXA 4B9UA 2VG5A 3AO5A 1VSJA 4QAGA 1TK8A 3NGYA 1CXQA 1X9SA 2X6SA 1H38A 2D5RA 3Q8PB 1TV9A 4YXJA 3SI6A 1JL2A 4QOZB 1VSIA 1RDAA 4CJEA 4KAZA 3IM1A 9ICFA 3PW4A 4YFKA 4UAYA 3F9KA 4B08A 5J2NA 4KI4A 5DGAA 4CFBA 4J9RA 5KFWA 3BJYA 4KLOA 3AV9A 3ZT4A 4I9LA 4N56A 3H8SA 3LP2A 5L1KA 2PI4A 4MFBA 1A5XA 4Z4IA 2FLLA 2BDPA 4JK1A 4CEEA 2A1SA 3DOKA 2ZUBA 1DTTA 2HNZA 1XI1A 3ITHA 2I5JA 1ZQLA 1D8LA 1BQNA 5DGBA 4LVSA 3LZJA 1RXVA 4BDYA 3KD5E 1S6PA 4ECZA 3U3YA 2HHTA 1D8YA 3KK2A 1KLNA 5J2EA 3NGZA 4CFCA 1NOMA 3MXIA 3QLHA 3H4BA 3MBYA 8ICZA 3C23A 1BCOA 2HHQA 4KN4A 4UB1A 1VRUA 4JV2A 1QTMA 3HYFA 3TI0A 4RW9A 4CJ5A 3PV8A 4P4OA 3MR2A 5J0XA 4J9SA 3VQ8A 4KB1A 1GOCA 4EYHB 2YNHA 1RT4A 4NYNA 3D0PA 4E7HA 4E7IA 1YT3A 5JS1A 1C0TA 4IR1A 3H8JA 4O5CA 4F3OA 4O3NA 2IOCA 3GFKB 3FDSA 1TL3A 3KK3A 2XY8A 1J53A 3L2WA 8ICWA 4QZ8A 3PY8A 4M04A 5J0QA 3GIIA 4KLEA 2FMSA 1XSLA 4HUEA 3NAEA 4PUOA 1S0OA 4IFVA 3S3OA 3SQ1A 4B9VA 4IFYA 4FJJA 2FMPA 4FBUA 2EHGA 3CM5A 5C24A 4E7KA 2VG7A 1ZQGA 4QZBA 3B6OA 3S9HA 4FBTA 4DQQA 4YQWA 1KTQA 3TWHA 2R8HA 3C1ZA 3H7IA 1QHTA 3QESA 1RT5A 3T5HA 2IS3A 4OKJA 5CWRA 5KFUA 4B9LA 4PQUA 2AGOA 4Q5VA 4M0AA 4XA5A 2BHNA 5DMRA 2E6LA 3Q8LA 1QSLA 4QZGA 4W5TA 4YR0A 5L1JA 3AA2A 3MEGA 1RXWA 9ICKA 3ISBA 3SUOA 1ZBUA 5KT6A 4K4IA 4KLUA 3C6TA 4OGEA 4I29A 4DTSA 5DK5A 3LDSA 4DOCA 1HJRA 3ZSWA 3BGRA 1UA1A 1B92A 1DGSA 4I2AA 3VA3A 4QW8A 5IIOA 4YMOA 4Z4GA 2KZMA 3ZT3A 4E89A 4JRPA 4KI6A 2HMIA 2UVWA 4DU1A 4RUCA 4J9PA 4DL2A 4IR9A 4M9JA 4KTZA 4G1QA 3PMLA 4FCYA 5J0RA 3HVTA 3M8RA 4DLGA 5IINA 3NF7A 4FK2A 2XY6A 5DBCA 2Q3SA 2G8WA 3V1RA 3EW9A 2F1HA 2FPKA 3KJVA 3G0ZA 5J29A 3SV3A 3C94A 5CJ7A 3RTVA 2DFFA 9ICHA 2ZD1A 1VSHA 3NCIA 3LWLA 5J2CA 3AVAA 1JLBA 4CJTA 3I0RA 1SL0A 1S1UA 4Q43A 4IQUA 4M3XA 3T3FA 1NKBA 1C7YA 3BQ2A 3CFPA 4F4XA 3P5JA 2KQ2A 3K57A 3QIOA 3MR6A 4QWBA 4O0IA 1C6VA 1RBVA 2GBZA 1EXNA 2R7YA 1HNVA 4CESA 4CJWA 4KHWA 1CUKA 3PR4A 4E7LA 4EEYA 1RBUA 5IILA 1S0VA 4HCCA 3MAQA 4KTQA 2OPQA 1JLFA 1JLGA 5HROA 5JUMA 1MQ3A 1K6YA 4RNOA 1JN3A 3Q8MA 2UVRA 4DL4A 4CK2A 4ECTA 1ZQCA 4N47A 8ICCA 4ID5A 3HK2A 5DG9A 8ICMA 4RPXA 1S1VA 2Z1IA 3V7KA 3LP1A 2ZTCA 5SZTA 1KCFA 1KLMA 1ZQJA 1RCHA 4J9MA 3OYJA 3RRGA 4DSFA 2NUBA 2IA6A 4IKFA 4QCLA 3RB3A 4CHNA 3JPSA 4B3OA 3Q8KA 2DFLA 2BQ3A 2R8KA 4DEZA 2R8JA 4DFPA 5IIJA 4DQRA 2PY5A 3BDPA 2BQRA 2YHAA 9ICJA 4R64A 4ED7A 1NKEA 5L1IA 4J2DA 3ZSYA 2J6UA 3B0YA 3C6UA 1Q9XA 1B9FA 3JPNA 3CQ8A 4UBBA 5D3GA 1NJXA 1B43A 2LYHA 4DS5A 3NE6A 3VQ9A 3LZIA 5KFMA 1JLAA 7ICFA 1TV6A 4DQIA 2UVVA 3L2VA 1D9FA 2W9BA 5HBMA 3V1OA 3ZT0A 3RB0A 2ZJAA 3OYMA 1EKEA 2HHVA 7ICOA 8ICTA 1SKSA 5DB8A 2DPIA 4FO6A 5KFKA 3QO9A 3DLHA 1RT6A 3HW8A 3IAYA 4Q8EA 4MF8A 5KG1A 2IHNA 3G6XA 4BXOA 2HW3A 1K1QA 1ZQYA 9ICNA 5KGXA 1S10A 3M8PA 5DDMA 2VANA 3V6KA 3EY1A 1U48A 3M8QA 4MFFA 4DOAA 4J9LA 4CEAA 1T05A 1RDBA 4QZHA 3ETLA 2RN2A 3VQ5A 4KLMA 3OYLA 4GC7A 1U45A 4ECSA 4BWJA 4R8UB 3LK9A 1HPZA 2JZBB 1WNSA 3SQ2A 4PPXA 3BQTA 4FM0A 4PGYA 1ZJMA 4J9QA 3HVRA 4DTOA 1COOA 3OJUA 4FJ7A 5DQIA 4R63A 2YHBA 3LANA 4ZTJA 8ICBA 3DLRA 5FDLA 3DLGA 4IRDA 3FFIA 4CEDA 3ZSXA 4O3RA 1Z00A 4F91B 4CIFA 4FVMA 3QNNA 4LY7A 4CJFA 4PY5A 1JXEA 4YNQA 3MR5A 1ZQVA 3M8SA 2VA3A 4MQ3A 5T7BA 1WSEA 4DL3A 1B22A 4PHAA 2GV9A 4DTMA 3BQ0A 4DU3A 1TL1A 4KLTA 1CEZA 2AQ0A 2PXIA 2C22A 1NK8A 2DTUA 3TAPA 3LDAA 4ZTFA 8ICOA 4DSIA 2IGIA 1IXRA 4NM2A 4J2EA 3PW7A 4RQ8A 4ECVA 5KT2A 3Q8QB 3TFRA 3SZ2A 4NYFA 4OKEA 3SPYA 5J2HA 4BDPA 4IG3A 3QERA 2P6UA 4F4YA 1BGXT 1XSPA 4KRFA 4RT3A 4DSEA 7ICTA 3MR3A 5K14A 1AROP 3SYZA 4I7FA 3UXNA 5KFRA 4QWAA 3SPZA 2HHSA 3QZ8A 2RKIA 3NH2A 5KG2A 1L3SA 3SNNA 3OS1A 1KVCA 5J2IA 3OHAA 3OYGA 5CHGA 2NRXA 3V4IA 4N41A 1IKYA 2BCVA 1IH7A 4CERA 3TABA 4XIUA 2G8KA 3ZDEA 1JLQA 3MABA 1TVRA 4EZ6A 1YTUA 4DF4A 1NKCA 2WTFA 4CJVA 2PYJA 2YV0X 1WAFA 4OJRA 4F2RA 4Z6DA 1J54A 3EYZA 1JXLA 1FKPA 4YD1A 3O3FA 2Y1IA 2FLPA 3RB4A 4B8CA 8ICPA 4JV1A 4F92B 4RW7A 9ICVA 9ICCA 4FJ8A 1Z26A 5KFXA 4O5BA 2DPJA 2HHWA 3QINA 4ED6A 4KTWA 4JV0A 5KT4A 1XS9D 4YG2A 3L8BA 1ZQDA 7ICLA 3C2LA 4OLAA 3UXOA 3H8WA 3MDCA 3SJJA 5F9LA 4UAZA 1VSEA 2ZUDA 2MAXA 2MUTA 2HB5A 2C2DA 5KFTA 1QS4A 3HL8A 9ICOA 1RBRA 4M9GA 1YVUA 3ZSOA 1UAXA 4RQ1A 4AHCA 2W9CA 4FJMA 5SWMA 4KREA 4M6WA 4TQRA 1KDHA 2BGGA 4FLZA 2BCQA 3HPOA 1U9LA 1N6QA 3MGIA 2J6TA 2YKMA 1A5VA 1WN7A 2I9GA 2GWSA 2B21A 3OS2A 3BQ1A 1D5AA 4QZEA 4Y1CA 5J0PA 4FW2A 5CZ2A 3CM6A 3GIMA 2M9NA 3VQAA 2IDOA 3HM9A 1QLNA 3PUFA 4QZIA 2FBTA 4RPZA 4IDKA 4CF1A 4NCBA 3EPGA 3KK1A 1BIZA 5J2MA 2FLNA 3GIKA 4PHPA 3JPTA 1ZQHA 1S0MA 1EXQA 3B6PA 3OYEA 3RMAA 5D4BA 3OSPA 8ICVA 1ZQEA 4YMMA 3NH0A 1S1TA 1S9GA 1WSIA 1JLEA 3HO1A 2PFPA 8ICFA 7ICHA 4DQSA 4YR3A 1T8EA 2ZJ8A 3TFSA 3QEVA 1NOZA 4CEZA 3EWAA 4RQ5A 3KIOA 1KVAA 9ICTA 5CR0A 1QSYA 4OPKA 3ISNC 7ICQA 1XWLA 2BE2A 2D0AA 4TURA 1PZNA 5HRPA 4I2QA 4YP3A 1EETA 3MXMA 4GC6A 2PZSA 2RDIA 4CJQA 4W5RA 2HHXA 5KFGA 1IKWA 2RDJA 4B9NA 1RDDA 4J2AA 3QEIA 5J0TA 3PNCA 1IKVA 3N97B 2AGQA 1QSSA 1ZBFA 2ZUCA 3AVBA 4M3UA 5DLFA 4DFJA 4AHTA 3NGDA 1VSMA 2GUIA 4JUZA 1RT1A 3GQCA 4LH5A 3MDAA 3ZCMA 3MFHA 4M6WB 5HP4A 3ZDCA 4YD2A 3CYMA 3V9ZA 5EWGA 4M3YA 3QZ7A 3OYDA 4O3SA 2O4IA 3DRPA 4GMJB 2OWOA 5L1LA 2ZQBA 4CEOA 3K5NA 3IHQB 5KFNA 1KFDA 4I2PA 4KPYA 3RJKA 3ISCA 4DFKA 4O3QA 4CECA 3QEWA 3AU2A 1ASVA 1W9HA 4FLVA 1LWCA 5KFDA 1NJYA 3ASMA 4I2IA 3C5GA 4DTPA 4E1MA 3HXMA 1S76D 3V9WA 1NK5A 3KLEA 5J2GA 5HMLA 4DL5A 3SI8A 2ASLA 3O4QA 3KD1E 5J0WA 5DLGA 4K8ZA 1ZQMA 4HUFA 4FJHA 3AVFA 1HUZA 4R65A 4BE2A 4CJ3A 3THVA 3V9XA 5EWEA 4CK3A 4DFMA 2YNIA 3VQDA 1RTIA 1G15A 4DQPA 4E7JA 4F3TA 1K1SA 4H4OA 2E6MA 3UXPA 3QEAZ 3AVMA 4KHQA 4L8RB 2XO7A 9ICWA 2G8IA 4QZ9A 8ICGA 1BPEA 3K5OA 2A1JA 1S6QA 2JEIA 4K8XA 4KHUA 4CHYA 5I3UA 9ICRA 5J2KA 8ICEA 7ICVA 4CJPA 2FBYA 2BKEA 2IMWP 4MEXA 3IG1A 2DFEA 9ICUA 3DLKA 4RPYA 3SUQA 5D49A 2F96A 3AA3A 4Z4CA 5HRNA 2Q0ZX 4CF2A 1YTAA 4N76A 3ZSRA 3C2KA 5KFLA 2KFZA 7ICPA 3IS9A 4RQ3A 1MC8A 4CHZA 9ICBA 2BPGA 3S3MA 1KRPA 2OA8A 4CE9A 3PVXA 4ELUA 4BE1A 5KG6A 2XY7A 1Y88A 4EBEA 4J9KA 4YCXA 5I42A 3VQQA 5CYQA 4RT2A 2VA8A 2Y1JA 3ZSZA 2AQ4A 4KLSA 4NM1A 1HNIA 1IM4A 5KFBA 2B4JA 1KVBA 3WNGA 4FM2A 1BI4A 5KFZA 2RF2A 2ATLA 1DOQA 2C28A 1KFTA 4AHSA 3OYAA 9ICEA 3N4MB 1VK0A 4M3RA 3Q8RB 4HVJA 4QZDA 4PHEA 9ICPA 4O5KA 1BL3A 4F50A 3T5LA 1C0UA 3QEPA 4OPJA 3O3HA 3OSNA 5J2QA 4IBNA 4DSLA 5L9XA 1TKDA 2BPCA 2FMQA 1WAJA 2JEFA 2G8HA 1TKTA 4C8LA 4DTNA 3M9NB 5J2PA 4ED8A 3LAMA 4OLBA 4CJLA 1HYSA 2PYLA 3RR7A 5EU7A 3TAGA 8ICSA 5HP1A 3UQ0A 1XHZA 4B9SA 4J2BA 1U47A 4FJ9A 4GVMA 3F73A 1VSFA 4FK0A 1LAVA 1W0HA 4X5VA 3A2FA 9ICLA 3T5JA 4PH5A 5KFCA 4GXKA 4R66A 4DOBA 2HVHA 1NJWA 4AHVA 1U4BA 2NRZA 2A1RA 2KW4A 3HSTB 4CJ4A 3AVNA 4KN7A 4OVLA 3LPUA 4BWMA 4I27A 1JMSA 3RMCA 5BOMA 1KEJA 4DG1A 3DM2A 4MFAA 3TAFA 1Z3EB 2F1IA 4ED2A 1Q8IA 1XU4A 4Z6CA 3QE9Y 1B9DA 3ULDA 4RQ0A 3V7LA 3GIJA 1TK5A 4NLKA 3QEBZ 4GXIA 2FBXA 1UT8A 1UOCA 5KG4A 3T1AA 8ICHA 1FK9A 4FW1A 3KLHA 1UWBA 1SKWA 2BCRA 5HRRA 8ICKA 1RYRA 2KFNA 2OZMA 3C5FA 2XRIA 1MSWD 4Z0UA 1X2IA 1CLQA 4F8RA 1JXBA 2LSNA 5DQHA 1UT5A 4RW6A 1BI4B 4FJIA 1XSNA 3ZDDA 4FXDA 1RTDA 1ZQXA 3OYKA 4Q0BA 3RBEA 5TZVA 7ICRA 1C1CA 3HJFA 2PI5A 4F4ZA 4LZDA 1SL2A 4P4MA 3K59A 1LW0A 2JEGA 4CJRA 1T3NA 4QWCA 1BCMA 3PX4A 5KT7A 4W5NA 4G3IA 4QWEA 5IIKA 5KT5A 3TAQA 3DRRA 4CGJA 4FS2A 1XHXA 1SV5A 3ALYA 3PX6A 2XGQA 3QIPA 4K4HA 3KKSA 3RWUA 3CFOA 3OYBA 2V9WA 5KG7A 9ICQA 2QK9A 2H5XA 4QW9A 2XGPA 3OVNA 1S1XA 4YMNA 4BGDA 1Z25A 5HNKA 3LP3A 3QEXA 3PW0A 1VSLA 4RUAA 9ICXA 4TSXA 4M9NA 2EX3A 3L2UA 1VSKA 4FJKA 3MEEA 4C8NA 5F9NA 2W9BB 2ISOA 4FM1A 1HJPA 4M3TA 1S9EA 1S9FA 3RJHA 3JPOA 1T03A 7ICKA 2P51A 9ICMA 1RYSA 1NK9A 1JL1A 2F8SA 4J9NA 1L3TA 4I2FA 3RAXA 2AJQA 1LAWA 4JS4A 1S1WA 4BXOB 2G8VA 1CZ9A 3KLIA 5KFSA 1DLOA 1RDCA 2F1JA 4CIEA 1S0NA 2NRVA 3OS0A 4C8KA 1ZQBA 2XC9A 3VQPA 3D45A 4EBDA 4ED1A 1V9PA 1Q9YA 2IBKA 5DB7A 3P83D 1WCNA 2PFNA 3DI6A 4CJSA 3V7JA 3NF6A 4C8OA 3C1YA 2W8KA 1KSPA 5BOLA 3G6YA 4KLIA 1HUOA 1LWFA 4NCAA 4FJNA 4YN4A 2VWJA 2G8FA 5EOZA 4NLZA 8ICXA 4CHPA 4RZRA 4F4WA 4BACA 4M47A 1L3UA 1NK0A 4DWIA 4FK4A 4M45A 4JRQA 4UBCA 3VQ4A 5HHIA 3GILA 4IG0A 2IAJA 3FYHA 4JS5A 1Z00B 9ICSA 2BANA 3AVHA 4W5QA 3ZD8A 4PGXA 3AU6A 2QXFA 4YVZA 4Z6EA 2AU0A 4CJUA 1N5YA 4BE0A 4IQTA 3U3GA 3C21A 1N48A 4QZAA 5KFEA 4I28A 3VQCA 4KHNA 2X74A 1ZETA 4Z4HA 3RRHA 1ZQUA 2ZTEA 2B6AA 3KLGA 3DLBA 2FC0A 4Y1DA 2P1JA 4JWMA 3AA5X 2OPSA 1WLJA 4Z4FA 3HP9A 4KLGA 3NDKA 3ZT2A 4DTUA 2QKKA 1I39A 4DU4A 4ED0A 5BPCA 9ICAA 3WNEA 3CFRA 4ZHRA 1EP4A 3GV7B 1BQMA 4CF9A 7ICMA 8ICAA 4MFCA 1NK4A 1BPXA 4CIGA 3V1QA 2JEJA 4O0JA 3L2RA 1NJZA 1HQEA 4FZYA 3EZ5A 1JIHA 3OYIA 2RPIA 2KTQA 1ZBLA 3T5KA 4Q45A 1JLCA 3NGIA 5CZ1A 1VRTA 4K4GA 3V9SA 1HYVA 1F21A 2ITGA 3OYFA 2WOMA 4B8AB 4KHSA 5EWFA 5KG0A 3V72A 3OYHA 1TK0A 7ICGA 3JSMA 2NRWA 1S77D 3MECA 3V9UA 1Y97A 3V6HA 2IC3A 4UAWA 1GOBA 1R0AA 3NF8A 1J5OA 4DS4A 4I2DA 1S5JA 1WSJA 4R5PA 3TR8A 5HMMA 2XHBA 1L3VA 4HHTA 1DTQA 1ZJNA 2VG6A 1MQ2A 4KLDA 4YFUA 1BPZA 1UA0A 2V4QA 1ZQOA 1ZQWA 4LSLA 2ZE2A 4LH4A 3HX0A 4F4KA 4GW6A 4E19A 3ZT1A 1REVA 3NF9A 4OKKA 4I2CA 3TANA 3DYAA 4NLNA 5J2AA 4IRCA 3RJEA 4WE1A 3RH5A 1VSDA 1JX4A 3H08A 3ORYA 3HT3A 3LPTA 4HCBA 1RTJA 4DSJA 4EBCA 4RU9A 5KFAA 4RNMA 4KLQA 3RH4A 3ZD9A 3RJGA 2MUTB 1A76A 1HRHA 3SQ4A 5C25A 4B9TA 2ASDA 4FZXC 2R8IA 2ATQA 4ECQA 5DQGA 1ZQSA 3AUOA 3C95A 2W9CB 3MXJA 1NOYA 1U04A 2ETJA 1X1PA 2F8TA 4EP4A 3K5LA 3L2QA 2R8GA 1RBSA 1RT7A 3UPQA 1CXUA 4EP5A 2OPPA 5DDYA 4OGCA 8ICLA 4FZZA 4CF8A 4AILC 1BPYA 1ZQPA 3UQ2A 3VQEA 1WCLA 3DRSA 1XC9A 2FPLA 2BGWA 4IQWA 3E01A 1KFSA 1TAQA 5KI6A 1ZQIA 3IRXA 5J0SA 4HTUA 3VN5A 1TVAA 2IHMA 4CFAA 5CA7A 4B9MA 4CHOA 3G6VA 2C2RA 5D46A 4F5NA 5HLFA 2BPFA 4KLHA 3M9MB 5J1EA 5KFYA 4CEFA 4F5RA 4UB2A 1NK6A 1MU2A 3MFIA 3ZSQA 1ZYQA 1SUQA 4KO0A 4JWNA 2NRTA 4DO9A 1WSFA 2XCPA 3MEDA 2YKNA 2P6RA 1JKHA 3CG7A 4QZFA 5KFVA 3SCXA 4LD0A 5DB9A 4AH9A 4FJ5A 2VWKA 3AO4A 2ASJA 4ECRA 1RT2A 1BVSA 2Z1GA 2DFHA 3H4DA 1LW2A 4FS1A 5KFIA 5IIMA 3RH6A 3JPQA 1XO1A 4H4MA 3SQ0A 3SV4A 1U49A 5CB1A 1WSGA 3AO2A 1BHLA 2PFOA 3AVGA 4PWDA 3PMNA 3SUPA 1ASWA 1C1AA 5CYMA 2HNDA 1EX4A 3OGUA 3PX0A 5J2FA 2YNGA 5DG8A 4BDZA 4JLHA 3VQBA 3QETA 1C0MA 4XUSA 7ICEA 3MGHA 4I2JA 3PW5A 4KLJA 4DF8A 7ICIA 3ZSVA 3NH1A 1ZBIA 3KKRA 4ECYA 4ECUA 3PO4A 3ZDBA 4ICLA
chains in the Genus database with same CATH superfamily
1VQ9N 3PG9A 4KHYA 2H48B 1QZ5A 2AV5A 4Y2TA 5C2DA 1LFPA 4O3OA 2B56A 2CAJA 5HRSA 4HHJA 3TSPA 2CJ9A 3AO3A 4DR3J 4ICAA 1FW6A 1PVQA 2W9MA 1X31C 1C2PA 3HP6A 5AICA 1FXDA 2QKQA 3B78A 3FGVA 4ZKAA 1LWCB 4KKOA 5KT3A 1RTHA 1HL6A 4CZKA 1IR0A 2G06A 4CEBA 3OR1A 3FJ2A 5HLFB 3HWTA 1ZS6A 5F8MA 4M3WA 3QFWA 3DMJA 3KLFA 3GV8B 1RBTA 4RQ4A 4USVA 1S4FA 3NMUA 5HVFA 4F26A 3HSGA 3MN9A 1U25A 4J9OA 3CJ1A 2Z2ZA 2OI2A 1V4SA 3SFGA 4EWTA 4I6WA 4L73A 4MAKA 4U8VA 4WKRA 1RTIB 1UW4A 1KAXA 3O3GA 2D3DA 2WB1D 5IOLA 5J0UA 1L7NA 1LB2B 1RT3A 1SVDA 4YB1P 2X78A 3HHDA 2W1BA 2XWXA 2ISPA 4UTGA 3B0XA 1T9TA 5ALVA 4G9ZA 2WONA 3W2WB 3P1GA 4IJNA 4BS2A 2BCSA 1YGYA 2L3MA 3A5MC 1VQPS 4US8A 2HQCA 2UUCF 4EO8A 2CFXA 3QPIA 1TL7A 4YDDB 1H6KX 2KO1A 2CQPA 5BR9A 2WCXA 4AL6A 4C8ZA 1WC6A 3QSIA 2D3OR 1QVGR 3KNAA 4M9HA 4DKWA 1OW5A 1DXSA 2JLEA 4AHUA 2YQ1A 3VA0A 3DOLA 1CJUA 2QKBA 1TKXA 2Q6CA 5KPTA 2E88A 3WNFA 5K9FA 3K0JA 1HNIB 4PHDA 2YNFA 1S7IA 1C1BA 4GV6A 4XH5A 2LMRA 2KKPA 3RZAA 1YJ7A 2CPRA 3PYDA 2C3PA 3SCKE 3GFYA 3BYPA 4YOXA 3L3CA 4FLTA 4KKOB 1M5PC 3NVKA 5F8LA 3JPRA 3UIQA 4P2HA 4K8RA 4M42A 2E1FA 3H90A 2I8EA 5DBAA 2N4CA 3CF5Q 4IRKA 4UB5A 3G8TA 3DMJB 5IIIA 3G10A 3QNOA 8ICIA 1FFSB 1TKTB 3KZXA 1HYSB 3VQTA 1NHKL 2XCAA 2D69A 3MMVA 5EY4A 3RJFA 4FYXB 2GHPA 1EHWA 2IRUA 4RG8A 3J8AA 1DKGD 8AT1B 3AN1A 4YR2A 4JHDB 2GELA 1T7PA 4C23A 1X3NA 8ICNA 2QMUB 2D1KA 1HYZA 3QQCD 1GLJO 1S8OA 2HLTA 3RAQA 2ZTDA 3VAKA 2R7TA 1KVIA 1SH0A 2B51A 5AK6A 1EIYB 4C0HA 1M1HA 2B4UA 3A0IX 4FJGA 2F4FA 4CLWA 4X62K 3EE3A 1X4BA 4Y2YA 4M41A 3QYPA 2GFFA 2KXHA 4AL5A 3I0SA 3VF4A 1BD6A 2HCFA 1TL7B 4JP8A 4BC7A 2NS1B 3ENBA 3TSQA 1B70B 2M0GB 3M9OB 1AYEA 3RR8A 3QU2A 2Z1JA 2NPIA 2IDEA 3PM9A 2B0CA 5E3AA 2QLXA 4IL6U 1NDKA 5KFOA 1H2VZ 1RLCL 4OHWA 1UWBB 2ILYA 3ENOA 1DARA 4FLYA 4DQ8A 3QRRA 3DOLB 5IQQA 1TKXB 1RJJA 1OUQA 5J2JA 1A5WA 4UB3A 2W6LA 3K4GA 2PT0A 1LV5A 1TUVA 3RMBA 2B4VA 3MMBB 3CCUN 2LYBA 4DBQA 3I8DA 4I9QA 2YNFB 3GG1A 1ILYA 2VJVA 4E3SA 1C0FA 4DMNA 4Y0FA 3AVKA 3LGMA 1GMUA 1RWPB 3LWMA 2DKZA 4P74A 2W9AA 5AFUA 1RLDA 3V6JA 3K8WA 1C1CB 4KPCA 3AARA 1UHUA 4M9LA 4DR2F 1LW0B 1FERA 5MLCQ 2J7WA 1RUSA 3MC1A 2CQDA 3OHBA 3FLCO 3GYGA 3NASA 4UW9A 1RXOB 2KYXA 4ELTA 3CCZA 4CBUA 3PR5B 1SV5B 4O3PA 4CNYA 3AY0A 2GGPB 3QAEA 1OVQA 4PHTX 1X60A 7ICJA 4LF7J 3U26A 1SXDA 1ZQQA 1NUEA 1L5UA 3RJIA 2DQNB 5DZ6A 4ISGA 3VQ6A 5B8HA 1NCLA 4PYAA 2VPZB 2GVDB 1DFDA 1CJVA 1PAEX 1RI7A 2WBRA 4CZEA 3NTUA 5KRSA 4BHQA 4GVEA 3BR9A 3MTKA 1U02A 4FYDA 4HTJA 3D6TB 1JMTA 5KFHA 1P8GA 4KB0A 3JTOA 5KQDA 3B54A 1S9EB 2P9PB 5AE1A 4CF0A 2CRXA 5GAGI 3NHGA 4ILGB 5J2DA 1Y3KA 3FBCA 4YHHK 5IV4A 2W54A 2ZUAA 2FJVA 3KHRA 4NLQA 2MZRA 3P6YC 3J7ZO 1SJQA 4TUSA 5KFJA 1HLWA 3D9BA 1PVRA 3F41A 3KLIB 1NB2A 1U6FA 2G0JA 4A8OA 2OH2A 2D5RA 2XWYA 2F8KA 3F9KA 5J2NA 2OXOA 3QFHA 2ZKUA 2OO4A 3ZT4A 4NLOA 5L1KA 4BRGA 2FLLA 2ZUBA 2GZOA 2LU2A 3KUGA 1RWOB 3Q22A 1BQNA 3PRBA 2PO4A 4LVSA 2GWKA 1FD2A 2HOEA 4BDYA 2O8BB 4ID8A 5EE3A 2IJFA 4K4UA 3W7BA 1AW0A 4CBXA 5AKKA 4ILJA 5B0AA 5EGYA 2DVIA 3HRDD 3ID6A 1KLNA 5J2EA 1NGFA 3MBYA 5LL6d 5IV3A 4MMOA 3AFGA 4CLFA 1IWAA 4IH7A 4KN4A 1VRUA 2XIDA 2BANB 4JV2A 4K59A 1RGVA 1F0XA 3VQ8A 4KB1A 1XNSA 1LKYB 2YNHA 3OL7A 4XH4A 1IBKK 1RT4A 1SH2A 2GOLA 1N5YB 1C0TA 3CD0A 3H8JA 3DDNA 1VMBA 3HFZB 3E51A 1OWXA 4F3OA 1S59A 2C2NA 3KLGB 2KN4A 1SB6A 2XY8A 1J53A 4KC5A 2HFNA 4HUEA 2MHEA 3A5NC 3GR0A 1S0OA 1F9EB 3ENHA 3JQMA 5C24A 1UVIA 2VG7A 1ZQGA 3S9HA 5IT0A 4FBTA 2P35A 4YQWA 3FBBA 2C3OA 3UKUB 3TWHA 3NCRA 2GJFA 4OKJA 3BS5B 1RADB 1VQ6S 3Q0AA 5KFUA 3IMXA 4FFDA 3NL0A 5AK4A 2LYAA 3J7ZT 2ZJPL 1MMNA 2FHJD 4Q5VA 1FJEB 4M0AA 3MWBA 2FTRA 2BHNA 1VRTB 2CYYA 3SBMA 1RHJB 3DU6A 4FYYB 2IBOA 4QZGA 3MOJB 4QYZK 2WVFA 4K4VA 2LDYA 4CWBA 4MYTA 3MEGA 3CCQN 1RXWA 3ISBA 1ZBUA 1HD0A 3J7AP 3C6TA 2A0FB 1OXJA 3OPXA 5E3QA 1VQ7N 3RU0A 4DTSA 3LDLA 4GKJF 2WSEC 2VG6B 4CE6A 3ZETB 3CCVS 4BBYA 5TKWA 4I2AA 4B1WB 3QGGA 5JLHA 5IIOA 4LF5F 2DH8A 4Z4GA 3H3NO 2LM1A 3CMAS 1XNRJ 4NB4A 4CJ7A 3O9TA 1FXLA 4RUCA 1WSRA 4DL2A 1W2IA 3OTQA 1MMLA 4G1QA 1RDUA 4FCYA 3H0LB 1IXKA 2EZXA 4YEAA 3AOBA 4FK2A 4JI7K 3KFUF 1J5EJ 2WC9A 2G8WA 4B9QA 3V1RA 1Y10A 3CDAA 3D5MA 2FPKA 3LF0A 3BY5A 1O08A 3WXLA 3C94A 3RTVA 3TTCA 4H5TA 3SENA 2VIXA 3AVAA 2XMJA 3I0RA 2APOA 2X51A 4B1YB 3H59A 2CPHA 3BQ2A 4FKXA 3L6QA 3P5JA 2RD5C 3G71N 3ETMA 3P5BP 2MQQA 1RBVA 1UEVA 2GBZA 1EXNA 1WTFA 3CJTA 3AMZA 3GJTB 2PC6A 4KHWA 3NVMA 2FJ6A 1RBUA 1C0GA 4KTQA 1EQYA 4DV1J 1N88A 1QVGM 3DRSB 3NY0A 1K8AT 1YBTA 4OZLA 3WDOA 3IRXB 3IR7B 3H7HB 1MG7A 5D77A 5LJWA 4OHYA 1QJHA 1SWVA 2LHTA 1KBRA 3H25A 2JV3A 3HFVA 5AQRA 4ID5A 3HK2A 3KHYA 5DG9A 8ICMA 1R8CA 4DV6K 1MU2B 5G4DA 3TJ9A 4YOVA 3V7KA 3DCAA 4DR1F 1SUQB 3UI3A 4QJVA 5SZTA 4X64K 4YOYA 5C10A 1RYUA 3AQEA 4HT5A 3OYJA 1RWWB 5I3QA 2G9OA 4DSFA 5AKHA 1M1GA 4B3OA 2OANA 4P6QA 3U9ZA 2UUAJ 3VALA 3WUHA 4DEZA 1ZZNA 2WF9A 1HBOB 3R3LA 1YJWN 4B1UB 5IIJA 3TZWA 3T1YF 4BRHA 2UXBF 1HNXF 3BDPA 1IBMK 1LW2B 3WKCA 3NVVA 4DUZF 4H4MB 2ZM6F 3ZSYA 1QD1A 3EE9A 2ZZTA 3JPNA 3CQ8A 4DV0K 2HNDB 3VQ9A 3TUZC 3C16A 4IZ9A 5KFMA 4HT7A 1JLAA 2YNGB 3FSYA 3L2VA 1D9FA 2QYCA 1YJRA 2ZJAA 2A41A 1N5TA 1U1OA 3BR8A 2IMOA 1OH6A 7ICOA 3WIVA 2JHEA 2PMZC 1PJ6A 5D15A 1T0TV 3TSUA 1SKSA 4ZS6A 4ICLB 1VDVA 4LQ3A 1RT6A 3IAYA 4Q8EA 5KG1A 3GR1A 2HW3A 3E8OA 4A59A 9ICNA 5KGXA 1OMSA 3NVZA 3M8PA 2VANA 2CQ0A 3M2RA 1MROB 2M52A 1U48A 3LDQA 3EE8A 3ISND 2ACYA 4J9LA 2DGUA 3FEXB 2EANA 3R5BA 1SKUB 2R2TA 2E29A 4GC7A 4R8UB 1HPZA 2E7WA 3SQ2A 5FPNA 4FM0A 1ZJMA 3RJMB 1RWXB 1Z1VA 3HZGA 1T6DA 3G82B 1DY3A 4F7VA 2YJFA 1KW4A 1FE0A 4Q7AA 3CCLS 2YHBA 3LANA 3HFKA 3DLRA 2OD4A 3O9RA 1RA7A 3ZC4A 2V8HA 4NLCA 4RQNA 4KV8B 4LF6J 1SC4B 4F3MA 1BWVA 4FWQA 2FY1A 3ZSXA 2DNQA 3FSIA 3MPVA 2J0XA 4XPCA 1Z00A 2JDJA 1ATNA 4F91B 4K2JA 5AQIA 4WYBA 3V6DB 2WFAA 4LT6A 4JK7A 4PY5A 1JXEA 2E44A 3EVOA 1AFJA 4MQ3A 2O8DA 5ALRA 1XNQK 5IWAJ 1AA1B 2DNNA 1Q81O 2EFVA 4KLTA 3PRDA 2YWEA 1T3OA 3ETRA 2C22A 4FZVA 1MWMA 1Q5YA 1N5XA 8ICOA 4DSIA 4GMKA 1IXRA 4LSNB 4RQ8A 2A6AA 5KT2A 3Q8QB 2NO4A 2YKAA 5AQVA 3IKMA 2V69A 3D2EB 1RHQB 2A2DA 4IG3A 1ZD4A 3QERA 1VS3A 3AAQA 1T95A 4WXWA 5EHHA 4RT3A 4DSEA 3EJMA 3G25A 4ZJQA 5AQLA 3F5EA 1AROP 3SYZA 2W4DA 2KSOA 1DGKN 4O8UA 1TKZB 4LC9B 2HHSA 5EOYA 2FHKA 3AD9C 4P73A 1L3SA 3SNNA 1WOSA 3BF4A 5J2IA 6AT1B 3OYGA 1SWWA 2BCVA 3EGNA 4QZVB 3TABA 4XIUA 2G8KA 1JLQA 4DF4A 2YV0X 4OJRA 2XG8A 1F2GA 1DRGA 1QUVA 1TUUA 3ULEA 2HEKA 3I5BA 4EAHD 2O66A 1DJ0A 5C2CA 4B8CA 3HHLB 8ICPA 4JV1A 2EKYA 4NI2B 3W9JA 4C0BA 2E1ZA 4XDDA 4O5BA 2HHWA 3GFHA 4Y2RA 1VOMA 2NXEA 3NS5A 3CJBA 3LP0B 1EWQA 3H5UA 3ZX0A 3L8BA 1YJNS 3HSZA 3C0BA 5HJXA 1G4CA 4ZCIA 3MM8A 3F2DA 3MDCA 3NNCA 2G1DA 1TFWA 4UAZA 3THPA 1PGZA 2B3TB 2O8DB 1N33J 4O0NA 5HMWA 3R27A 2Y8WA 1X9JA 5T7LB 4ERDA 2RRAA 1Q1KA 1WJ9A 1VISA 4M5NA 4CRXA 2AYBA 1HX1A 4OJPA 3BDEA 4AD6A 1YVUA 4P75A 2NRRA 1WEXA 2NZCA 2W9CA 4UZBA 4X4RA 3OLAA 4KREA 2GQCA 1KDHA 1HBUA 1S5ZA 3W1YC 4ZIWA 4OMFG 3QICA 2R7UA 4DPWA 4USIA 2KJWA 2KG1A 4W4MA 1LNQA 2IM3A 2YKMA 2QFIA 4JI4J 4ZPAA 4OZ0A 1YHQS 5FJ4A 1WN7A 2I9GA 3HILA 4ES3A 4KYZA 2GWSA 4BRCA 4QZEA 2HSTA 2OPRB 5CZ2A 2M9NA 4CVNE 4F67A 3HM9A 1WDDA 4DZDA 3BBCA 4QZIA 1UPMB 2HS3A 4RUBA 4C4WA 1WBBA 3TADC 2X3GA 2KM8B 4FVCA 1IBLJ 3HM8A 3RMAA 1PK3A 1NGJA 1QQNA 3OSPA 3O6WA 4JI3J 5A2QU 3CPWM 1RP5A 4QYRA 2IYGA 3ZTOA 1KOHA 4YMMA 2H65B 1S9GA 3OFHA 1L7OA 4WFBL 2PFPA 8ICFA 5AZIB 1SIWB 2ZJ8A 3QEVA 3LM9A 4CO4A 4OYBA 3PYFA 4CEZA 1G1XA 1YVFA 4RQ5A 3KIOA 3KJQB 9ICTA 2P9NA 3WKDA 4RW8B 1PILA 2KHOA 4J03A 3QXGA 1DAXA 5A8WB 1R3NA 2B9WA 2CJXB 4K0KF 3NBPB 2QYGA 4AF1A 3BQ7A 1P90A 1EETA 1YTYA 2PZSA 3TA0A 2BJDA 1UL3A 3IDHA 4W5RA 1RHUB 3DJCA 2RDJA 1KWMA 3SLCA 1EAYC 5J0TA 3PNCA 3N97B 4OIXA 3R2DJ 4UOFA 2YN4A 1WHVA 4DFJA 2VG5B 1QQMA 4MIAA 4AHTA 3U1NA 3EN9A 3J7YP 4DR3F 1HBUB 3A12A 1Z6RA 5ADZA 5BXIA 3UMCA 4YD2A 3W61A 1F1BB 5EWGA 1T9XA 4LJXA 4M3YA 2KJ9A 2OAUA 4O3SA 1GT8A 5FP0A 5E33A 2QG9B 4JI1J 4GMJB 2Q2RA 3IGNA 4MFBB 1RBOB 2UV8A 3D28A 3RJKA 3ISCA 3MCMA 4DFKA 3BO2A 4FDFA 3DOKB 3H20A 4CECA 2FZCB 3QEWA 4P52A 2HNZB 4FLVA 1NJYA 3ASMA 1VQLN 2X1GA 4DTPA 3L0QA 1OPZA 3QT8A 3HXMA 1IIPA 5AZJA 1NK5A 3KLEA 3I9V9 2CQ3A 5HMLA 3JTPA 3KWGA 3QT5A 2RSQA 2UUCK 4QU6A 1Y0HA 1VQMS 3O4QA 3KD1E 5LSRA 5J0WA 1WD6A 1TL5A 1KHWA 5LOQA 2EK1A 3EEQA 1U1MA 4CJ3A 2UXDJ 3TR5A 1ZAVA 4RW9B 2YNIA 3QU5A 1H98A 3RFAA 4DQPA 3O1BA 4F3TA 4DR6F 1K1SA 2K8AA 5E3RA 3KVGA 3UXPA 5CAAA 5F0XA 4KGXB 3D2FB 2XO7A 5I3PA 3LOUA 5EDWA 2G8IA 4QZ9A 1WOOA 1RHRB 2WW8A 2JEIA 3ZLJA 5I3UA 5LL6Z 4A57A 4B1ZA 5J2KA 1NJIO 2DR6A 2HVDA 3R7SB 2FBYA 4PUOB 2BKEA 3IG1A 4IFVB 2KHQA 2P6SA 3SUQA 2F96A 4IFYB 4Z4CA 5AI6A 2DB1A 2G0CA 4CF2A 3ZSRA 2RE2A 3PEHA 2LI6A 1LK5A 4N7TA 3KK7A 2AJ1A 5AKLA 3WK5A 3M32B 5A0LA 1X4HA 2R9LA 4BE1A 2XY7A 1JCEA 3FCVA 4NLDA 1VRQC 1X4FA 4PYDA 4EBEA 2DD8S 2CZ9A 4M5LA 4ZCMA 3HD2A 5CYQA 4RT2A 4YOWA 3OLBA 2LKYA 4KLSA 1IM4A 5KFBA 2CDQA 1NPRA 2KRRA 5KFZA 2RF2A 4TY8A 4H0OA 3GBTA 4QR0A 3TWZA 3TUIC 3LH2S 2C28A 1KFTA 1VQPN 4FWPA 4UAUA 4M63A 5BN8A 4UOCA 4DR7J 3WC0A 2M0NA 3T5LA 4PG4A 4NXMJ 4W98A 3PEJA 4OPJA 5AQQA 1HR0J 5JVGL 4IOCL 3BH6B 4DSLA 3BGRB 3MM6B 3UR3C 2DGTA 4YHHJ 2V52B 2A18A 1RAOA 3BH7B 4ED8A 1JQGA 1RAHB 4PPZA 3LL3A 1V85A 3GSDA 2BACA 3W66A 3HVTB 1X0PA 3HHEA 4LR8A 1TYQB 5CZXA 3GJQB 4ZK7M 2WSCC 2DCLA 3GYNA 4X5VA 4A8QA 1B0VA 2UU9F 4F9OA 1RFQA 1NJWA 4AHVA 3MCSA 4Q2LA 2A1RA 4KN7A 4OVLA 2ADBA 1NNDA 1YAGA 3F5AA 4RWTA 4I27A 2RRBA 1S1UB 4BGBA 3DM2A 2F65A 4ED2A 2MA1A 4KGVB 3QE9Y 4KGKA 4RQ0A 2PMHA 1QQ6A 1ZM3A 1NJIT 3V7LA 4DR2K 3GIJA 4CO2A 1IWGA 1V3ZA 4KHRA 4DI6A 4JYAF 1UT8A 1GMWD 1HNVB 1R6YA 4LRBA 2IM0A 1MNEA 4W90B 2YMPA 5A8RA 4FW1A 3V4MA 2OSQA 2QLTA 3O6QA 4OV6A 3DXMA 5BN9A 2BCRA 3TX8A 5HROB 2LYVA 4QR1A 2KFNA 3C5FA 4YDUA 2KP7A 3NS6A 2VKQA 5H1SQ 1X2IA 2DL0A 3W3DA 1HKCA 1J2NA 2VDIA 3H2VE 4RW6A 2DYAA 4BCAA 3IWLA 3U02A 1XSNA 2XHWA 3VESA 2LPEA 4FXDA 1RTDA 1QY7A 4HTLA 1RKJA 3ZZZA 1N63A 3OYKA 5TZVA 7ICRA 4E98A 4JI2J 4AYBC 2BZ2A 3K59A 2JR5A 3CSKA 1RG6A 4WP3A 2JEGA 2FDRA 3L4IA 1T3NA 2H9ZA 2DRAA 1BCMA 4LF7F 3J80O 1UMJA 3C19A 5KT7A 3RUBL 4CGJA 2E2QA 3DOMB 3HI9A 4PKGA 1XMQJ 4I0WA 1JUDA 3ALYA 3QGPA 1IG8A 3KKSA 3RWUA 2HRTA 3FK4A 3FGUA 2QK9A 3OFEA 3I33A 1RHMB 4CW7B 2J76E 2DK2A 3F9MA 2OTJS 3LP3A 3PW0A 5D3GB 4RUAA 3W5XA 2PSZA 1WHYA 4X66J 3BSCA 2ZGYA 3D2QA 4Y3CA 2EX3A 3L2UA 3D1QA 5AXKA 4CYUB 3P5TL 2W9BB 2MEWA 2ISOA 4FM1A 2ZJQL 3CIMA 4M7YA 5DZ7A 4P0PA 3K1ZA 2DY9A 2P51A 3CPEA 2CDRB 2F8SA 1UP1A 4I2FA 3UN2A 4C2MA 4JS4A 1C4AA 3I5CA 4OHVA 4BXOB 1RA6A 4J90A 3HHLD 1FRKA 5HATA 1FWKA 1DLOA 3I1YA 4DR4J 2NRVA 4WZMA 3GZ7A 4NLPA 4C48A 5BRDA 5AQHA 2XC9A 2ZOFA 3ZTSA 2WAQD 3OR2B 5B0CA 4LREA 1Q9YA 5DB7A 2L9DA 3D7SB 2PFNA 3BUZB 2QWLA 4C8OA 3NF6A 3QBWA 2XM3A 2ODGA 2W8KA 3G6YA 5E3PA 2QV6A 3THWB 3KNGA 5A2QY 2VWJA 2HWTA 4BRAA 5H2FU 3CJ0A 1WG1A 4J37A 5EOZA 2XS5A 1T94A 2P9UB 4JKEA 4I4BA 3M6KA 4P2SA 1YLXA 2Q3PA 4OX9K 2V34A 2VKZG 4BR7A 1LXNA 3DLGB 4FK4A 5KOXA 2F4VJ 3FEYB 2PE8A 4UBCA 1ZM2A 2BKNA 3R5DA 3TA1A 1UCNA 4IG0A 2IAJA 1DURA 4RTFD 3KDOA 2ATCB 4XK8C 3L3FX 1TMJA 1N0VC 4P0QA 1A0PA 2O8CA 2EPIA 1SIJA 4IQTA 3ZYYX 2P9GA 4GV9A 3QBCA 2LQJA 3VQCA 4NE9C 4J9VA 3AA5X 1O0PA 1TUWA 4XDCA 4ANCA 2CKWA 1I39A 3KG0A 1ZOLA 5BPCA 4ZHRA 4URQU 3EVMA 4WP8A 5BJRA 5AQTA 3AJ2A 3C6AA 7ICMA 1VIXA 4MFCA 4GKJK 3PACA 4PCQA 1SGGA 3L2RA 3KG1A 1NJZA 5AXNA 1HQEA 3CTRA 5K14B 2ZHBA 2JWNA 2EFQA 4FZYA 4LF5K 2RPIA 3LVWA 2KTQA 4KHPJ 3T5KA 5LT5A 1IBMJ 5D0GA 1YQHA 3SCIE 1TU0B 3GE1A 2KOBA 1VQ8S 1R59O 2ITGA 1OYEA 2WOMA 3V4IB 1IKYB 4ZP8A 5KG0A 1NSKL 1FRXA 3V72A 1G2EA 7ICGA 3MPDA 1S77D 2FB0A 3V9UA 3V6HA 1S5LU 1RE1B 1GLEG 2IC3A 3IV6A 2QB0A 4F04B 3THYA 3AXMA 4LFCJ 1FNOA 1NAQA 5HMMA 4JKBA 1KAZA 1XNRF 1L3VA 3HHNB 3NNHA 4UQTA 3D0IE 1MQ2A 4WFNL 4JEPA 4R79A 4RW7B 1VQ6N 1ZQWA 2QA4G 4LH4A 3HX0A 3CJQA 2P9SB 3AEVA 3NF9A 4OKKA 1J5EF 3OUYA 3U1LA 3TANA 4IRCA 3RH5A 1FT8A 4PG6A 2QJ3A 2DHAA 3H08A 3HT3A 2FPHX 3LPTA 1PK1A 3P4UB 1D3WA 1CJTA 4HCBA 2Y3YA 5D78A 5KAKA 4WKYA 2D4WA 3ZD9A 1SXLA 3AB2B 2HRUA 1KL9A 2ZIVA 1J2MA 3T1HF 2LDIA 2CQ2A 3J80Y 3E0FA 1A6LA 4ZVGA 3CQXA 3UDVA 3Q24A 2R8IA 1NM1A 2QGFB 3WK6A 1ZQSA 2J7UA 2K7JA 5KOWA 3THXA 4DR1K 1U04A 4FF1A 1YBAA 4ZHRB 3SFUA 4DV1F 2R8GA 1FDNA 1S12A 2PFFB 1RBSA 1OJ4A 3UPQA 1B7YB 5AE3A 1CI4A 2KXFA 1BPYA 1ZQPA 3T1YK 3UQ2A 2UXBK 4B17A 1PCAA 1HNXK 4GKKJ 4IEIA 3E01A 1M90O 1KFSA 2EQYA 4DUZK 2XYPB 4IDKB 5J0SA 2Q0UA 3LUYA 2IHMA 4DR5J 2ZM6K 4FNIA 3O5BA 1VC5A 1S7HA 3TACB 3DEEA 3NKYA 1GLAG 2BPFA 4K7QA 2DGQA 5DM7L 2YX1A 5E3CA 4UB2A 1NK6A 4CBWA 4JWNA 3GWCA 4DO9A 5KFVA 3Q7BA 1TUYA 2FGOA 4USHA 3TZYA 3H8YA 2VICA 5ALUA 4CLZA 5CR4A 2YBVA 4HHUA 3I32A 2ASJA 3CD7A 5SUHA 3N79A 4C1NI 2PGCA 4DX5A 2MLZA 4FS1A 2LEBA 2KKVA 1H73A 3BS9A 3VENA 3SV4A 5EXWA 5CB1A 1NLVA 3SSRA 2L9WA 4UOGA 1XMOK 2VONA 2OELA 5IC6B 3Q89A 3B9JA 5CYMA 5ETVA 2A3VA 2ZJPQ 3OGUA 2AYGA 5DG8A 1S79A 2LKZA 3VQBA 2IJNA 3CJCA 3GTYX 2Z57B 4KLJA 4DPTA 1IG6A 5IM0A 2XBPA 2QXLA 3SQGB 1ZBIA 3N28A 4H0PA 2ADCA 4BR9A 3THTA 1RT1B 4Y65A 5F8HA 5C12A 4QQBA 4B3MJ 4UASA 3O9SA 2YKOA 1NNEA 4EGLA 5GIOA 4LQ9A 1RZMA 2EW9A 3KXDA 5GAHU 2QMXA 2V4JA 4WWSA 3F2BA 3DLLL 1RCOB 4TYAA 2VBZA 5DB6A 4RQ7A 2E7VA 3FZFA 4UZCA 3E01B 2MKIA 5FRMA 2RDDA 3OD2A 1SPBP 5LSLA 4BRFA 4F5QA 2OHDA 2XMVA 2NLXA 1UTAA 2FLOA 3H40A 3I9ZA 4FWRA 2XVTA 2QTDA 2IM2A 4OJGA 1M90T 4FLWA 4U7CA 4LF6F 2HIYA 1YBUA 1U8WA 1FRIA 1WUUA 1IVZA 3TAEA 1WKKA 5ETLA 2W7PA 3QBXA 2P5GA 1NHVA 5ALGA 3JYTA 4CI0B 2W42A 3PW2A 4P2FA 4LFBJ 2N7CA 2J0QD 1GXTA 3DLEA 4LF8J 3FC4A 3BPDA 1M5SA 1NDLA 1WNEA 3DXSX 1COKA 3GSIA 3OYCA 2L9NA 4CD1A 2FVPA 2G8UA 5KG3A 4H4OB 4Z6FA 4AHRA 4GXJA 5IWAF 2FHOB 5FD1A 2KJ5A 1K9MO 2PFQA 4CJKA 3L5KA 2A1JB 2Q1LA 2NZTA 1OPIA 3DXBA 2Q66A 2B5JA 3V2UC 1IKXA 4UW2A 2VBYA 1Z2ZA 4L3KA 4NCGA 4KY3A 2D9OA 4UARA 2KV2A 4QIWC 3TAMA 4H54A 3M7VA 1FVQA 3NMAA 4ELVA 4QZCA 3CCLN 3R5GA 1ZQKA 3ZEUB 5B08A 2LEAA 1K0VA 4OZ1A 4TUPA 4KR0B 3C7NA 1RKIA 4K4XA 4GIBA 3S6JA 1NPPA 3TEGA 1RILA 4FJXA 3BZKA 2L08A 4IDHA 2HQGA 1QAYA 1BQXA 3DGVA 2HBLA 2OMLA 1M5VC 1UPPA 4CCHA 3SDEA 3WXMB 3PO5A 4OYOA 4A61A 2G07A 3UD4P 3QNMA 5HQLA 4BJQA 3JB9k 4RW4A 1HKGA 1NZ8A 3N5FA 4ZP9A 5BYRA 1Q46A 3DU5A 1RDRA 2E8MA 3HJEA 3KHLA 1TGOA 1L8OA 7ICUA 3AJ1A 1R8BA 4GRSA 1ITPA 1C0UB 2NQPA 4QIWF 4FJLA 2HS0A 1RAJA 4WU3A 3BSOA 5J2QB 3OXFA 2PDAA 4AQYJ 1WI6A 2GQ2A 4NZ7A 1CZBA 4EENA 3K2PA 3TTDA 2ZJ5A 4UQGA 2RRNA 2CQ4A 1HIWA 2BCUA 2HHUA 2LCWA 5J2PB 3R5JB 5KPRA 3HX9A 1FXXA 4I2EA 4OI0A 2BUNA 1X5TA 1TELA 5HP1B 3NUQA 3I31A 2GTDA 2N4DA 4K5RA 3J7A1 3V81A 2HI0A 1DZ5A 1PYSB 4PL1A 3SUNA 4OFZA 3ONNA 1X5PA 2I7PA 3CJAA 3G4SN 4XRHA 4ALZA 1GOAA 4ECWA 1N33F 3CCMN 4AUKA 2YHXA 1NGBA 3K75D 2ZDPA 4K4WA 4GLXA 2KZZA 2XMAA 3TTFA 3SAHA 9ICIA 4R0JA 3ILJA 4M5GA 1WI8A 3RG6A 2CA9A 2JGUA 1K9MT 2DXDA 4WP9A 1NGDA 1N54B 3AO1A 4TLRA 1VI7A 1VQNS 4JI4F 1WF1A 3CC2N 4CK1A 3C7NB 3KLHB 4Q8FA 4ECXA 1A0OB 1YIJS 2RS2A 1FKOA 4ZMMA 5A0YA 3OV7A 4X4TA 2FPMA 8ICUA 5CY4A 3SDEB 1DEJA 1VK3A 1Y00A 5T41A 2HFOA 2BXJA 3M6UA 1IBLF 2XY5A 4M2YA 4X4NA 5B7WA 3UO0A 1HMVA 3QYYA 1YJ9S 1J97A 5B0DA 4JI3F 2GIRA 7ICNA 2E5GA 3CGIA 3M2UA 1DQ9A 3TARA 1X9MA 1EQ0A 4NO7A 1YVNA 4WTOB 1N52B 3BGLA 1O5JA 3K5MA 2MB0B 5J2BA 1U0HB 5ETRA 3EPIA 3UFCX 4C8YA 2IY5B 2D9PA 2M88A 2DNOA 3DRRB 2IVMA 1MA7A 2HSZA 4KMUA 3OTBA 2EWSA 5B0BA 2K8CB 1X9WA 1SKRA 5U47A 3WQUA 1RGIA 2ZH7A 1ZQZA 2CQCA 1S22A 1YHQN 2BDUA 4EU0A 4FPAA 1YZ7A 1ZD3A 3UW1A 2J9DE 5AFUH 2D6FC 4DR3K 3UVJA 1FFUA 2MXYA 4UF4A 2OYQA 2E5JA 3X1LB 4EYIB 4C8MA 3GL1A 1IO2A 4CGHA 1TAUA 3GE9A 3GDXA 3MHYA 1BOTO 2KKHA 2YMMA 4Y6IA 3R6LB 1WSHA 4B02A 2B6GA 3WXJA 4CGDA 3RVCA 1U0SA 1T03B 4DTJA 1VQKS 1SBRA 4KGZB 3S01A 3H46O 1RZTA 1VQ5S 1H7XA 1S99A 2M70A 2X3DA 4DHVA 4DLEA 4IS7A 1SJFA 2ASPA 3OPKA 4DTXA 4B9UA 3NVYA 1DHMA 3AO5A 5AKJA 4JI1F 1SV0A 1X4DA 4LRCA 4CLYA 1V38A 1H38A 4JKGB 5G0RA 4YXJA 2QA1A 3SI6A 1ACMB 2BH1A 2K89A 3BZQA 1B99A 5DGAA 2OFGX 4CFBA 1R27B 1Y9OA 4ZCLA 3BJYA 1MMDA 4MK8A 4N56A 3LP2A 2AT1B 2GX8A 2KT2A 2BDPA 3TUJC 1OH7A 3W63A 4CEEA 3PJ9A 1SJ1A 2K4PA 3AQOA 1NGIA 4OQJA 3E9OA 1YJTA 4ECZA 3MCPA 2UXDF 2HHTA 4BR5A 3SAGA 3KK2A 2XSJA 1WBDA 3NGZA 3MXIA 5J1NA 2KB2A 1ZRMA 8ICZA 1BCOA 2VFUA 2XICA 2C2MB 4KT0C 3HYFA 1N32J 3TI0A 5I9EB 3EKUA 4P4OA 3MR2A 5J0XA 3AOCA 4HACB 4ZLPA 1XR5A 2V9KA 3D0PA 4FF3A 1YT3A 4ZVUB 4B3RF 3QUQA 5AJ3F 4O5CA 3Q8VA 3GFKB 5DM6L 2U1AA 3FDSA 2AD9A 4BLGA 2E20A 3PY8A 5J0QA 3VEYA 3KUHA 2ZFHA 3GIIA 1XSLA 3ILOA 3SQ1A 1VQMN 3OVSA 2VL1A 1HW9A 1PYTA 1EP4B 3Q2SC 4E7KA 1NM2A 1XTZA 3POTA 1KN6A 1CULA 1N5VA 4DQQA 3QU9A 2HYIB 1HBMA 3C1ZA 3MF5A 1RT5A 4OJLA 2LQ9A 1P9YA 3MUTP 5CWRA 2PMWA 2GHWA 3M2VA 3US5A 4PQUA 1JLCB 2H5IB 4WFBQ 3N0VA 2W25A 2F40A 2E6LA 2K4EA 4DR7F 4W5TA 2VJUA 3M8WA 2KDOA 4DMZA 3ET6A 2FJWA 3VVUA 3ICLA 4NXMF 4IO1A 3M8ZA 3ALRA 1HR0F 3SUOA 3N6MA 2ZH6A 3UMGA 3CJSA 1NGHA 2MQLA 3QT7A 4KLUA 1Q95G 2UU9K 4HH0A 1J5OB 4QPTA 1IN0A 2KLAA 2ABYA 3A5LC 4A5BA 2EG1A 1FJGJ 5DK5A 1DTQB 3LDSA 2J7KA 2DGXA 5B0FA 1HJRA 3ZSWA 1UA1A 1AZSA 2JH3A 3VA3A 4QW8A 2M7SA 2LECA 4RKUC 1TQLA 3PYEA 4MLHA 2Y8YA 3R1HA 3ZI4A 3VR1A 2HMIA 3SEIA 2LQ5A 4JYAK 4ETZA 4WE1B 4KTZA 2CVIA 1Z2LA 3PMLA 3QMQA 3TW0A 4IOAL 3M8RA 3CJ5A 1LK7A 1VLYA 4OJHA 3IR6B 3NF7A 4LRFA 5FLXO 5DBCA 3CO9A 1RAFB 3K8VA 4ISEA 3R8EA 5M2RA 4QPXA 3DHXA 4NA2A 3KJVA 5J29A 3SV3A 2QLJB 3SQIA 1VSHA 2JX2A 2DNMA 1JLBA 4CJTA 4HTIA 4NLRA 5AQJA 4Q43A 4NL5A 1VBXA 4M3XA 1NKBA 2QL5B 3MM5A 2H51B 3MR6A 1SQEA 2HIQA 1C6VA 3O8MA 2XTJP 2MSSA 1EZZB 2ZC4A 2BUPA 1KXPA 2ZH4A 2ZVIA 4LF7K 2OPPB 3IXQA 1FDDA 4FWKA 5IILA 1S0VA 2I6XA 3MAQA 1JLGA 1CJKB 2BX6A 1HARA 2AJ0A 1K6YA 2CJKA 2DXFA 5AKGA 1JN3A 3VAJA 4ECTA 4JI2F 2E5LJ 1RABB 8ICCA 4C9DA 2CQBA 2Y1LB 4I64A 3GDQA 1S1VA 3C15A 3LW5C 1FO4A 2KM8C 4IYQA 3LP1A 1ZQJA 1RCHA 1XMQF 5AQKA 1KP6A 4RR5A 2DIUA 2VB6A 3F44A 1BUXA 4AT1B 2IA6A 1KQGB 4QCLA 3RB3A 4MT1A 2BQ3A 5K20B 2R8KA 2JL9A 2DHXA 2P2CB 5FPEA 4Y2AA 3OW2M 4DQRA 2MLYA 4DV5J 4U8YA 3BF1A 2H4YB 4X66F 9ICJA 3D6HB 4J2DA 4JD2A 4H0VB 4PWDB 1N4LA 3C6UA 1O51A 1B9FA 3CE8A 2HSEB 2WMMA 1NJXA 1B43A 4DS5A 3LZIA 1ZPVA 1ZC6A 4AP9A 3EZWA 3V1OA 5HBMA 3O08A 3OYMA 5GIPA 2E2OA 2WZ1A 1UWAA 2OP5A 3MWTA 2MQPA 4MN4C 5DB8A 1WG8A 2W2NP 2YHYA 2KICA 1E6VA 3HW8A 2V5HG 2IHNA 4ED4A 5JVGQ 4IOCQ 3B6BA 1K1QA 1ZQYA 3GOIA 3T7ZA 2OTJN 3IRWP 3QU7A 5DDMA 3EL2A 3KG4A 2DISA 3SXLA 4CLTA 3TZXA 5HI7A 4DOAA 1F5AA 4CEAA 2YQEA 1J6ZA 4FZLA 3VCBA 3OYLA 5AKZA 4BWJA 2JZBB 3RYLA 2BRLA 3BQTA 1YKWA 1SH3A 4WYWA 4J9QA 3HVRA 3BBFA 4DTOA 2F4VF 3SMVA 3TJAA 4FJ7A 1RAGB 3BSAA 3ID8A 5EE9A 3D54A 8ICBA 2C3UA 2V67A 2P8IA 4JOUA 2EH9A 2XYGB 5FDLA 4GVBA 3T41A 2GS8A 3MCOA 3LPYA 2CQIA 1Q3UA 4JI5J 1JRPA 4J8FA 3CC4S 2MQ8A 2GV1A 4HHHA 4Z7CA 1BG3A 2E9RX 1U1RA 4CIFA 4LY7A 4CJFA 5AQFA 5I4MA 4DN9A 4X4UA 2CPYA 4YNQA 3M8SA 1FHTA 4H5NA 4FPIA 1KEKA 2X1AA 1TP7A 4PAAA 1B22A 4PHAA 3DRXA 3HKZD 2CGLA 4DUZJ 4DTMA 4ILHA 4DU3A 2B7CB 4YS2A 1CEZA 4NLWA 3WQPA 4EFAC 5ITHA 1NK8A 2DTUA 4KH4A 1LWEB 5HBMB 1UW9A 2YCHA 4J2EA 3PJXA 3PW7A 3TFRA 2XULA 3M6WA 5C42B 1XIQA 4O44B 2ZIWA 1OH5A 2DEIA 3H2LA 1GTEA 1WKJA 2P6UA 1FF2A 4KHPF 4F4YA 5A6PA 4RLEA 1BGXT 1XSPA 3ELHA 1XNRK 4C7YA 5GAGP 7ICTA 3OL9A 2GAGC 2BOPA 4O4GB 5FLXY 4I7FA 3QJPA 3MGJA 4QWAA 4QOTA 4BRPA 1J5EK 3ONQA 2BMBA 3NH2A 3OS1A 2CNLB 1MW7A 3OHAA 4KHMA 1JNRB 3CHWA 4LFCF 3A8EA 3NOGA 3ZDEA 4MO5A 1YTUA 2QT7A 4M95A 2Z4PA 2WTFA 1V5IB 1WAFA 1E3MA 1HLUA 3LDPA 1F0MA 1J54A 2FC8A 3T1HK 1NGEA 3I82A 1NZPA 4ES2A 2ZJQQ 3VC8A 1M1KO 2VH7A 5L46A 3CIZA 5D4OA 9ICCA 5RUBA 4Z94A 4FJ8A 2GAHC 5KFXA 1Z26A 2UZAA 4HEA9 3MEKA 1RISA 4KFBB 4DV1K 4KTWA 3J81j 5KT4A 2V7ZA 2BA9A 5AQZA 1FRJA 3CDUA 3DGPA 3AT1B 1KQFB 3QUTA 5F9LA 3R2CJ 4M5DA 2OCEA 2I2YA 5AKYA 3F2CA 4CQ1A 2MUTA 2P9KB 4URSA 3CB4A 2F7TA 3WKAA 1U1QA 2A42A 2E5HA 2C2DA 2EFOA 3FZHA 2Y0SC 3I28A 3FCWA 3AA9A 3GFXA 4OZNA 2IOFA 2Z30B 3KMQA 1ED1A 2WVCA 2MQOA 1SC1B 4NZ0A 3ED5A 1UAXA 4RQ1A 2AYMA 4FJMA 5SWMA 4JB8B 5CEHA 3FZBA 3P39A 3KOOA 4U7BA 2EDUA 3AB4B 3BF3A 1ZH5A 4GKKF 3HPOA 1UFKA 3CMES 1MN7A 1ZPWX 1BU6O 2MZTA 3OTOJ 2IIHA 4DR5F 3CETA 3WK4A 1NLKL 4X84A 1CRXA 1A5VA 2JC1A 4Y1CA 4FW2A 2KEYA 4DPUA 3PUFA 2HK2A 4NCBA 5L9NA 2GWJA 2PAVA 4PKIA 3EPGA 3KK1A 4CF1A 5KPZA 4DX7A 4LBIA 1BIZA 5J2MA 3KKFA 3RGIA 1OQ6A 4PHPA 4X4QA 3JPTA 1ZQHA 1HWJA 1S0MA 1KTVA 5M1PA 3FAHA 2N1RA 1EXQA 2R18A 2JWLA 3Q7CA 1WOQA 4Y2XA 4H0YB 4FZMA 3D6JA 2W03A 1ZQEA 1KOOA 1S1TA 1WSIA 3NH0A 1JLEA 3W9IA 1PAUB 3CCWA 2FF6A 1VBZA 2GO8A 7ICHA 4JK8A 1FVSA 2RU9A 4WQ4C 5AK3A 3MI7X 2FHJA 3WEEB 4DV2J 2K1RB 2HNYB 1QSYA 2LXFA 2DITA 1QE1B 3NGRA 3KLVA 4OPKA 2E9TA 1M1KT 3FRZA 1ATRA 4ZOHC 4TURA 1UVLA 4ZJOA 1BY9A 4I2QA 3R1XA 2CXYA 5IT9Y 4M5DB 1HQUB 2RDIA 2KIVA 2V2QA 4HWIA 2ASOA 3BYRA 4UATA 2NYIA 4E8UA 4BUGA 4B9NA 1DQAA 3QEIA 1FDBA 4KJIA 4B3MF 2R7WA 3DAWA 4BR4A 1ZBFA 2V8PA 4M3UA 3PZPA 2C1EB 4LF6K 1GK8A 3CJ2A 1HWUA 2XI9A 3MFHA 1T3VA 5HJYA 4ZVEA 2OYYA 3QZ7A 4WFNQ 3OYDA 2ZZMA 2O4IA 1P9QC 3VZHA 2WBMA 2IPOB 2OWOA 5L1LA 1H72C 3CJ7A 4YDUC 3FQKA 3K5NA 3IHQB 5KFNA 1KFDA 4B1XB 1H1VA 4O3QA 3AAPA 2PIIA 3QUCA 1DTTB 3AU2A 5IWAK 2DKXA 2I5JB 1LWCA 2ES6A 4DX6A 3KK1B 2V8GA 3C5GA 2H3IA 3KKAA 1VBKA 3A1YG 3V9WA 1F44A 4TYBA 4LFBF 4OL8A 5C0YA 4LF8F 5DLGA 1M5OC 3AAWB 2ZJRL 4K8ZA 4MYUA 2HQ3A 3MM7B 2MHNA 1JLEB 5AQMA 3DC2A 1HUZA 3C2PA 1RTIA 2XZTB 3B8AX 3FSXA 1G15A 5CHCB 2KVCA 2H5EA 1S6OA 2ESEA 3JXOA 3CD6S 5F41A 2Q97A 9ICWA 3BEXA 2FC9A 1TL3B 3MMAA 3KK3B 1E4FT 3K5OA 2I38A 1H74A 3UCUP 4MH8A 3W2WA 1IR2A 8ICEA 7ICVA 4CJPA 2FXUA 4QJFB 5F1XA 2QL7B 4CH0S 3MTJA 4P10A 1YTAA 1I3OB 4K0KJ 4XH1A 2KFZA 1B7FA 3CJ4A 5L8RC 4RQ3A 5DM7Q 1ZM4A 2PN6A 5HAOA 1KRPA 1FX2A 2KRBA 5H9EJ 3LTOA 1GLCG 3MZIA 1Y88A 2K3KA 2V63A 1G99A 3RW6A 2JWKA 3W5YA 2AYEA 3PKYA 4FWNA 1XK8A 2Y1JA 4Z37A 5T14A 3IM9A 3MN7A 2VFTA 2AQ4A 4NM1A 1HNIA 2B4JA 5JMVA 2MLXA 1VJ5A 4ITSA 4FM2A 2CJYB 1BI4A 4JI6J 2ATLA 4BROA 4TU8A 3A3OB 1DOQA 2HHHJ 3UDLA 4AHSA 4AQYF 3ILIA 2F9TA 3QWPA 1VK0A 1N33K 4QZDA 4Y28C 2H3EB 1IJJA 9ICPA 3ATVA 5ALOA 4A4JA 3O3HA 3OSNA 2HOIA 3RRKA 3EX7B 1TKDA 2BPCA 1WAJA 3CDWA 2G8HA 1TKTA 4B3SJ 2E8AA 4C1NK 1Q16B 4OLBA 1HYSA 4U67L 5EU7A 2PEBA 3UQ0A 2R7RA 2B7BB 1OY8A 1FD8A 1FNMA 4JHDA 4B9SA 3SBGA 4JI4K 1XHZA 2DNHA 2OTLN 2GEMA 2R2SA 1U47A 5E26A 4GVMA 5DO2A 4BRLA 1W0HA 3A2FA 2BE9B 4PH5A 5KFCA 4GXKA 3CO0P 3M4XA 2HVHA 3MMAB 1U4BA 2ZD1B 3I5AA 3DLLQ 2Z2MA 4CJ4A 2FVQA 2ZZNA 3MXHP 3LPUA 4DR6J 3PSFA 2VQFJ 2JMGA 1IBLK 4A2BA 1KEJA 3FZLA 2G13A 1M5KC 4RL1A 4JI3K 2ZNZA 1GLDG 1B9DA 3ULDA 1CQNA 2RB7A 1P6TA 4GXIA 5LJ3Y 4JI8J 3IAM9 3GG0A 3T1AA 2VUGA 1FA0A 1UWBA 2OPQB 1JLFB 3CDBA 2GNKA 2KH9A 5DS7A 2JGAA 3VAFA 5GVQA 4Z0UA 4BVPA 3MMBA 1CLQA 3CJKA 1TL4A 2LSNA 2AJFE 4P7VA 1Z19A 2NSBA 4DV7J 3AGKA 1BI4B 4FJIA 3RAMA 2W4PA 3U8XA 2P9CA 3RBEA 4FWLA 1NI3A 5CABA 1C1CA 1VQ4N 4Y2JA 4AFFA 3F2KA 3N4WA 1LW0A 4YDXA 4RBUA 1JJ2M 5ALMA 4QWCA 1Y11A 3PX4A 3TEHB 1VQNN 4G3IA 4NEZA 1XHXA 1SV5A 5GADI 1YIJN 1Q86T 4KAIA 4K4HA 2ZBRA 2GGPA 3CFOA 3ILLA 3OYBA 2HFUA 2KIWA 4BC3A 2YWGA 4ZVRB 4QW9A 5LXYA 2EXUA 4OYZA 1MLAA 4Y2VA 3HF5A 4YMNA 4JI1K 3B4MA 3ZO7A 2GVDA 9ICXA 4TSXA 4M9NA 4NA3A 1TV6B 1LEOA 5ALEA 1R8HA 1K8KB 2EG2A 1VSKA 2ZH1A 1VYAA 3GIRA 4C8NA 5F9NA 5CHIA 3GJSB 4EIAA 1MDUB 1KQKA 4YB5A 1Q8BA 1S9EA 4A5AA 4PABA 1T11A 2P9PA 4CT8A 3AOAA 9ICMA 2UU9J 2AP1A 4RX6A 3L9ZA 3QO9B 2EEYA 4WK1A 1L3TA 5CCMA 1LAWA 1NMNA 1Z05A 2R7VA 3KLIA 2UXDK 1EKSA 5E7OB 3W2VB 2RUGA 5LMNJ 3RSEB 1QQ7A 2J8AA 4CIEA 2ZH2A 1S0NA 3M8QB 3OS0A 1KONA 1ZQBA 3WZ0A 4ZPWR 1RTZA 4JYAJ 3D45A 4LR7A 4WFXA 3VQPA 4EBDA 1T05B 2MJNA 2IBKA 2FZGB 3P83D 3CC7S 3CJKB 3C1YA 1ZRNA 2ZF5O 1PJ7A 3Q86A 3E58A 3DDIA 4B3RK 1VQKN 5AJ3K 4YN4A 3ZZ0A 3UE2A 2RRDA 4H5WA 4NLZA 1VQ5N 1RWKB 3OA9A 2BABA 4WYLA 4JV5J 3SSSA 2CIMA 2O8BA 4F4WA 4M47A 4CZCA 1YXQA 4DWIA 4K4TA 7FD1A 1N32F 3MMJA 3PLAA 1NU4A 4OJ5A 3FFIB 1U6BA 1T44A 3GILA 2HPUA 1TAMA 2BANA 1RQLA 2RLTA 2ZKTA 5A6WA 3AVHA 4W5QA 2DNLA 3CCUS 1W2BM 4PGXA 3N6NA 1LKYA 4YVZA 2AU0A 1N0UA 4A48A 4NL9A 1SJ3P 1N5YA 3VZIA 4QS7A 3LPEA 3C21A 3SMSA 3T79A 3R9LA 1V97A 3B8HA 4JN4A 5EX3A 1TL1B 1ZETA 4DR7K 3RRHA 1ZQUA 2LXIA 3KLGA 2FC0A 3CD5A 4ZVFA 5GMDA 2CJAA 5G5HA 2CQHA 4NXMK 3N4QA 1KHVA 1WLJA 4DB3A 4Z4FA 2ZIXB 4EHUA 4KLGA 3BKUA 3CERA 4JB3A 3NDKA 1HR0K 4DTUA 4A2AA 2WUSA 4NLBA 2QEXS 5A8KB 1WWUA 9ICAA 3VGVA 3WNEA 1G3OA 2V2KA 3O1WA 1BQMA 3DV9A 1DRZA 1NK4A 2R7OA 5GAHP 3UKUA 2JEJA 4BVOA 4OYWA 1U8SA 4C11B 3BS5A 5F3TA 3TUPA 4KH5A 3BGUA 1CPZA 1NDPA 1ZBLA 4OYAA 1UJ5A 2RKIB 5CZ1A 4W92B 3W65A 1VRTA 1P8ZA 1F21A 2EBGA 2RHFA 4F0KA 2A6OA 2Q36A 3WXKA 1YDLA 1LQ9A 1FJGF 1TK0A 3NMRA 1TVRB 2NRWA 3Q2TC 1Y97A 3QFUA 4PQAA 2GLEA 3AJDA 4HI2A 4EMDA 3NF8A 4DS4A 1S5JA 3TA2A 1VJWA 8RUCA 1F5SA 1UFLA 3E1YA 4HHTA 3C29A 1L8LA 2VG6A 1YRTA 3ZETA 4KLDA 4YFUA 1BPZA 4X4OA 4LSLA 1EQMA 4BX9C 4E19A 2HF3A 4HVZA 3ZT1A 3WK9A 2O8FB 2D74B 3BZCA 2BJ7A 1CS4B 4I2CA 3HKWA 1R89A 4NLNA 5J2AA 3DKDA 4BRQA 4EX6A 3IG8A 1F60B 4EFHA 1VSDA 2AH5A 5ALHA 3N01A 1K0TA 2KVIA 4V19J 5HO4A 1XUPO 2Q4TA 1O13A 3O9UA 4DSJA 3RH4A 4F0MA 3RJGA 1IJEB 2O01C 1TMMA 2IA0A 4JI2K 4B9TA 2HBYB 2ASDA 3HMJG 5BREA 4FZXC 2XSFA 4ECQA 4XAKA 2C2OB 4CZLA 1XEZA 7AT1B 5ALYA 3C95A 3M6GA 5AK5A 3MXJA 1GAOA 1XMQK 1BQMB 3W60A 3MPYA 4EP4A 3BP8A 1RBLA 3K5LA 2ZHOA 1K8AO 2WVBA 3W64A 3MAAB 3ZNJ1 4OGCA 8ICLA 4FZZA 4C3KA 4CF8A 4QIEA 4AILC 2E5LF 5CQGA 1DK2A 4P72A 4OCZA 2D3UA 2E1AA 3DRSA 1FTRA 5ALZA 4X66K 4JAXA 4DUYF 1WF0A 1NH7A 2MZQA 1ZQIA 3IRXA 2O3DA 4ZLJA 4CHOA 2C2RA 1CQMA 4CO5A 3WK7A 4F5NA 4WQ5A 3QAUA 3TQEA 3M9MB 3CPWR 5BRHA 3ZSQA 1MU2A 1SUQA 5DM6Q 2NRTA 2P6RA 3FC9A 1F2HA 2P9IB 3M7DA 3SCXA 4DV5F 2E7XA 5DB9A 1NSAA 3MX2A 4K25A 2GQQA 2PFDA 4CDIA 4UB8U 2N82B 1HBOA 2CNKB 2VWKA 1WC1A 1M6YA 4LSLB 4KX5A 4K2XA 2F76X 3IO1A 4ECRA 2Z1GA 2DFHA 1LW2A 5AM1A 4DR4K 3RH6A 1XO1A 2WB4A 4H4MA 3SQ0A 3J7AN 3OT9A 2DRDA 3AO2A 2BE2B 2VPYB 3C3LA 2PFOA 3QGHA 1BHLA 3ZZOA 2RE1A 1ASWA 3QIDA 3IA0A 3FNNA 1IV8A 2MY7A 2HNDA 1NGAA 5MAOA 2YNGA 3MM9A 2KL8A 4CLKA 4JLHA 1C0MA 4DCHA 1U1PA 4I56A 4XUSA 1IKWB 4I2JA 4UY85 4DF8A 3WQTA 4BC4A 1IKVB 4CO3A 3ZSVA 1GX5A 2QW9A 1NZBA 2XS2A 4ECYA 3VERA 3PO4A 3PYGA 4QIFA 2YKPA 2BJ1A 4ICLA 4H8KA 2NLWA 2F4VK 1WC0A 2FI1A 3VQ7A 4F5PA 3T1HJ 4QWDA 4N8NA 2O4GA 2BV3A 2BR0A 3QU4A 2HKEA 4XQ8A 1AT1B 3DRPB 1ZQAA 1NO8A 3H8MA 1MROA 1IQZA 1QM9A 2RAQA 4NLSA 4QS9A 3HJVA 3KOAA 4DJBA 2XHCA 4DTRA 4ED3A 5FRNA 4IOAQ 1D9DA 3K17A 4ZVPB 3I76A 1X5OA 1F9HA 3TVZA 4R8UA 5IS2A 4LSZB 2FQQB 1GTHA 5JRTA 5KFFA 4DL0C 3G82A 4NYZA 2K4IA 4RNNA 3G71S 1EO1A 1BC6A 4CI6A 5DDQC 3EDRB 4WIIA 4OJ6A 4MEYA 4YXMA 5DBBA 4JI5F 3AVCA 1GMWA 3AVLA 4BC2A 4EUVA 1A7GE 4KV8A 3CRXA 2JRZA 4F93B 1DGJA 2MGZB 3HLUA 1T4GA 4NLXA 1ASUA 4KHPK 2XO6A 1ZBSA 4PZVA 1A77A 3V6DA 1Q3VA 1S6QB 3C2MA 1NMDA 3TU5A 1N2XA 2OGUA 4GO5X 2QA4S 3C14B 2DTJA 3DLKB 2B9EA 3MM9B 1Z1BA 3M1YA 2EK6A 4L72B 4LBHA 4LFCK 2VA2A 5DDRC 3AVJA 4ZH4A 4LSNA 3VEWA 3CCRS 3A8IA 3IS9B 2ZXIA 3VGTA 1RAIB 1FESA 3W8GA 4NLVA 1X4GA 3CVKA 3D2EA 1FRHA 2ALZA 2QWNA 2QWPA 1SV0C 4OHZA 4EZ9A 2KG5A 4IXCA 3MN6A 4MK9A 1VFJA 2OEKA 5I42B 3M30B 2E9ZA 3L3UA 2JRSA 4MIBA 4K42A 1GXLA 1B3TA 5KRTA 2KN7A 2RVJA 1CC8A 1FWPA 1TKZA 2XLIA 3DRYA 3AA4A 4KLFA 4G9BA 1O03A 1Z4UA 5EUHA 4RU2A 1PKUA 2LA6A 2KZ3A 5HK4A 3NRBA 3EZOA 4FYWB 1EX8A 4K50A 2W43A 1KKHA 2IIRA 2YPYA 4OYIA 4O5EA 3HPHA 3ISDA 2YPZA 3HOTA 2HFZA 3EZUA 3IM8A 1ZQTA 2C3MA 4I6AA 4NLTA 3IP4B 1SL1A 2VGNA 2F3JA 4S0MA 1QHAA 1XR7A 3L7UA 4UT4A 3EUNA 4E0DA 2E1MC 4L6V3 1N56A 3IGVA 2W8LA 4P9SA 5ALLA 4KGMA 2HVIA 2QE5A 2PMZF 3RMDA 5FROA 4NLYA 4HYKA 3HHLA 3JAMO 4NI2A 3H0RB 3HSDA 4FO0A 4IQXA 2Z1HA 1UZHA 2WVDA 3CCSS 2Z2LA 4UB4A 2J6SA 4GKKK 3LP0A 4C4SA 2RQMA 3AD7C 2RMLA 1HHSA 3VWSA 4OLOA 4DR5K 1KS2A 4CEQA 2I1QA 1YRUA 1FJ7A 4YB7A 4CO1A 3D2SA 4WBFA 4AE5A 2YJEA 1L6NA 4L3NA 2AGPA 2LP4A 2UUTA 3N9UC 4OX7A 2MSTA 3CJ8A 3N7SC 5T7LA 4X4SA 2E4LA 3ZDAA 1WSVA 2HQDA 1N34J 3DWLA 1J9AA 3J81O 2YX7A 3TQ1A 4CFDA 2XNRA 4U95A 4LZGA 3QMLA 4IWVA 4Q44A 3OTOF 3CCJS 1RCXB 4CGIA 1JI7A 9ICGA 2V7YA 2W01A 3ENAA 4DL7A 5HN0A 1WC3A 3WXIA 3QRQA 5AHXA 2Y9TA 1MWZA 2HRYA 5F8GA 3KHHA 1NG9A