1NK1A

Nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEPATOCYTE GROWTH FACTOR PRECURSOR)
publication title Crystal structure of the NK1 fragment of HGF/SF suggests a novel mode for growth factor dimerization and receptor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 32
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1nk1A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1nk1A01
1PK4A 4IUAA 1CEAA 2QJ4A 3BT2A 3NXPA 5EODA 3ZLEA 1NK1A 1W81A 4APLA 1Z40A 3E6PL 4HZHA 3HMSA 2J8LA 2YIPA 1JFNA 4UV6A 1CEBA 5CS9A 3HMTA 4DURA 2I9AA 4BVDA 1I71A 1NL1A 2QJ2A 3SRIA 4Z0DA 1PKRA 4APMA 4BV5A 4UAOA 2Z8VA 5CSQA 2F83A 4Z09A 4D3CA 3LAQA 3KIVA 4BVVA 4A5TS 4O03A 1I8NA 2I9BA 1GMOA 2J8JA 5CP9A 2K13X 2KJ4A 1W8KA 4NZQA 2HPPP 5I25A 1HPJA 1KRNA 2DOIA 2PF1A 2FEBA 1PMKA 4R1CA 2Z8WA 4R1AA 2LL3A 5CT1A 1GMNA 1I5KA 4CIKA 2YIOA 2K51A 1B2IA 2Q8AA 1HPKA 4R1BA 3HMRA 4BVCA 4KIVA 1PK2A 3MKPA 4BVWA 1PMLA 1KDUA 2SPTA 1NL2A 2PK4A 5EOKA 5CS1A 4BV7A 2DOHX 1A0HA 2L0SA 5CS5A 1TPKA 1YXEA 5HPGA 1KIVA 3BT1A 2YILA 2Y8RA 4Z0FA 5CT3A 3K65A 1KI0A 2HGFA 2Q8BA 3HN4A 1URKA 3U73A 2X2ZA 5CS3A 4R19A 1BHTA 3SP8A 3ZWZA 2HPQP 2FD6A 5COEA 3SRJA 2LL4M 4Z0EA 1HKYA 1GP9A 2K4RA 2KNFA 2PF2A 5CT2A
chains in the Genus database with same CATH superfamily
1PK4A 4IUAA 1CEAA 2QJ4A 3BT2A 3NXPA 5EODA 3ZLEA 1NK1A 1W81A 4APLA 1Z40A 3E6PL 4HZHA 3HMSA 2J8LA 2YIPA 1JFNA 4UV6A 1CEBA 5CS9A 3HMTA 4DURA 2I9AA 4BVDA 1I71A 1NL1A 2QJ2A 3SRIA 4Z0DA 1PKRA 4APMA 4BV5A 4UAOA 4YIVA 2Z8VA 5CSQA 2F83A 4Z09A 4D3CA 3LAQA 3KIVA 4BVVA 4A5TS 4O03A 1I8NA 2I9BA 1GMOA 2J8JA 5CP9A 2K13X 2KJ4A 1W8KA 4NZQA 2HPPP 5I25A 1HPJA 1KRNA 2DOIA 2PF1A 2FEBA 1PMKA 2KL5A 4R1CA 2Z8WA 4R1AA 2LL3A 5CT1A 1GMNA 1I5KA 4CIKA 2YIOA 2K51A 1B2IA 2Q8AA 1HPKA 4R1BA 3HMRA 4BVCA 4KIVA 1PK2A 3MKPA 4BVWA 1PMLA 1KDUA 2SPTA 1NL2A 2PK4A 5EOKA 5CS1A 4BV7A 2DOHX 1A0HA 2L0SA 5CS5A 1TPKA 1YXEA 5HPGA 1KIVA 3BT1A 2YILA 2Y8RA 4Z0FA 5CT3A 3K65A 1KI0A 2HGFA 2Q8BA 3HN4A 1URKA 3U73A 2X2ZA 5CS3A 4R19A 1BHTA 3SP8A 4YIZA 3ZWZA 2HPQP 2FD6A 5COEA 3SRJA 2LL4M 4Z0EA 1HKYA 1GP9A 2K4RA 2KNFA 2PF2A 5CT2A
chains in the Genus database with same CATH topology
1PK4A 4IUAA 1CEAA 2QJ4A 3BT2A 3NXPA 5EODA 3ZLEA 1NK1A 1W81A 4APLA 1Z40A 3E6PL 4HZHA 3HMSA 2J8LA 2YIPA 1JFNA 4UV6A 1CEBA 5CS9A 3HMTA 4DURA 2I9AA 4BVDA 1I71A 1NL1A 2QJ2A 3SRIA 4Z0DA 1PKRA 4APMA 4BV5A 4UAOA 4YIVA 2Z8VA 5CSQA 2F83A 4Z09A 4D3CA 3LAQA 3KIVA 4BVVA 4A5TS 4O03A 1I8NA 2I9BA 1GMOA 2J8JA 5CP9A 2K13X 2KJ4A 1W8KA 4NZQA 2HPPP 5I25A 1HPJA 1KRNA 2DOIA 2PF1A 2FEBA 1PMKA 2KL5A 4R1CA 2Z8WA 4R1AA 2LL3A 5CT1A 1GMNA 1I5KA 4CIKA 2YIOA 2K51A 1B2IA 2Q8AA 1HPKA 4R1BA 3HMRA 4BVCA 4KIVA 1PK2A 3MKPA 4BVWA 1PMLA 1KDUA 2SPTA 1NL2A 2PK4A 5EOKA 5CS1A 4BV7A 2DOHX 1A0HA 2L0SA 5CS5A 1TPKA 1YXEA 5HPGA 1KIVA 3BT1A 2YILA 2Y8RA 4Z0FA 5CT3A 3K65A 1KI0A 2HGFA 2Q8BA 3HN4A 1URKA 3U73A 2X2ZA 5CS3A 4R19A 1BHTA 3SP8A 4YIZA 3ZWZA 2HPQP 2FD6A 5COEA 3SRJA 2LL4M 4Z0EA 1HKYA 1GP9A 2K4RA 2KNFA 2PF2A 5CT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PK4 A;  4IUA A;  1CEA A;  2QJ4 A;  3BT2 A;  3NXP A;  5EOD A;  3ZLE A;  1NK1 A;  1W81 A;  4APL A;  1Z40 A;  3E6P L;  4HZH A;  3HMS A;  2J8L A;  2YIP A;  1JFN A;  4UV6 A;  1CEB A;  5CS9 A;  3HMT A;  4DUR A;  2I9A A;  4BVD A;  1I71 A;  1NL1 A;  2QJ2 A;  3SRI A;  4Z0D A;  1PKR A;  4APM A;  4BV5 A;  4UAO A;  2Z8V A;  5CSQ A;  2F83 A;  4Z09 A;  4D3C A;  3LAQ A;  3KIV A;  4BVV A;  4A5T S;  4O03 A;  1I8N A;  2I9B A;  1GMO A;  2J8J A;  5CP9 A;  2K13 X;  2KJ4 A;  1W8K A;  4NZQ A;  2HPP P;  5I25 A;  1HPJ A;  1KRN A;  2DOI A;  2PF1 A;  2FEB A;  1PMK A;  4R1C A;  2Z8W A;  4R1A A;  2LL3 A;  5CT1 A;  1GMN A;  1I5K A;  4CIK A;  2YIO A;  2K51 A;  1B2I A;  2Q8A A;  1HPK A;  4R1B A;  3HMR A;  4BVC A;  4KIV A;  1PK2 A;  3MKP A;  4BVW A;  1PML A;  1KDU A;  2SPT A;  1NL2 A;  2PK4 A;  5EOK A;  5CS1 A;  4BV7 A;  2DOH X;  1A0H A;  2L0S A;  5CS5 A;  1TPK A;  1YXE A;  5HPG A;  1KIV A;  3BT1 A;  2YIL A;  2Y8R A;  4Z0F A;  5CT3 A;  3K65 A;  1KI0 A;  2HGF A;  2Q8B A;  3HN4 A;  1URK A;  3U73 A;  2X2Z A;  5CS3 A;  4R19 A;  1BHT A;  3SP8 A;  3ZWZ A;  2HPQ P;  2FD6 A;  5COE A;  3SRJ A;  2LL4 M;  4Z0E A;  1HKY A;  1GP9 A;  2K4R A;  2KNF A;  2PF2 A;  5CT2 A; 
#chains in the Genus database with same CATH topology
 1PK4 A;  4IUA A;  1CEA A;  2QJ4 A;  3BT2 A;  3NXP A;  5EOD A;  3ZLE A;  1NK1 A;  1W81 A;  4APL A;  1Z40 A;  3E6P L;  4HZH A;  3HMS A;  2J8L A;  2YIP A;  1JFN A;  4UV6 A;  1CEB A;  5CS9 A;  3HMT A;  4DUR A;  2I9A A;  4BVD A;  1I71 A;  1NL1 A;  2QJ2 A;  3SRI A;  4Z0D A;  1PKR A;  4APM A;  4BV5 A;  4UAO A;  4YIV A;  2Z8V A;  5CSQ A;  2F83 A;  4Z09 A;  4D3C A;  3LAQ A;  3KIV A;  4BVV A;  4A5T S;  4O03 A;  1I8N A;  2I9B A;  1GMO A;  2J8J A;  5CP9 A;  2K13 X;  2KJ4 A;  1W8K A;  4NZQ A;  2HPP P;  5I25 A;  1HPJ A;  1KRN A;  2DOI A;  2PF1 A;  2FEB A;  1PMK A;  2KL5 A;  4R1C A;  2Z8W A;  4R1A A;  2LL3 A;  5CT1 A;  1GMN A;  1I5K A;  4CIK A;  2YIO A;  2K51 A;  1B2I A;  2Q8A A;  1HPK A;  4R1B A;  3HMR A;  4BVC A;  4KIV A;  1PK2 A;  3MKP A;  4BVW A;  1PML A;  1KDU A;  2SPT A;  1NL2 A;  2PK4 A;  5EOK A;  5CS1 A;  4BV7 A;  2DOH X;  1A0H A;  2L0S A;  5CS5 A;  1TPK A;  1YXE A;  5HPG A;  1KIV A;  3BT1 A;  2YIL A;  2Y8R A;  4Z0F A;  5CT3 A;  3K65 A;  1KI0 A;  2HGF A;  2Q8B A;  3HN4 A;  1URK A;  3U73 A;  2X2Z A;  5CS3 A;  4R19 A;  1BHT A;  3SP8 A;  4YIZ A;  3ZWZ A;  2HPQ P;  2FD6 A;  5COE A;  3SRJ A;  2LL4 M;  4Z0E A;  1HKY A;  1GP9 A;  2K4R A;  2KNF A;  2PF2 A;  5CT2 A; 
#chains in the Genus database with same CATH homology
 1PK4 A;  4IUA A;  1CEA A;  2QJ4 A;  3BT2 A;  3NXP A;  5EOD A;  3ZLE A;  1NK1 A;  1W81 A;  4APL A;  1Z40 A;  3E6P L;  4HZH A;  3HMS A;  2J8L A;  2YIP A;  1JFN A;  4UV6 A;  1CEB A;  5CS9 A;  3HMT A;  4DUR A;  2I9A A;  4BVD A;  1I71 A;  1NL1 A;  2QJ2 A;  3SRI A;  4Z0D A;  1PKR A;  4APM A;  4BV5 A;  4UAO A;  4YIV A;  2Z8V A;  5CSQ A;  2F83 A;  4Z09 A;  4D3C A;  3LAQ A;  3KIV A;  4BVV A;  4A5T S;  4O03 A;  1I8N A;  2I9B A;  1GMO A;  2J8J A;  5CP9 A;  2K13 X;  2KJ4 A;  1W8K A;  4NZQ A;  2HPP P;  5I25 A;  1HPJ A;  1KRN A;  2DOI A;  2PF1 A;  2FEB A;  1PMK A;  2KL5 A;  4R1C A;  2Z8W A;  4R1A A;  2LL3 A;  5CT1 A;  1GMN A;  1I5K A;  4CIK A;  2YIO A;  2K51 A;  1B2I A;  2Q8A A;  1HPK A;  4R1B A;  3HMR A;  4BVC A;  4KIV A;  1PK2 A;  3MKP A;  4BVW A;  1PML A;  1KDU A;  2SPT A;  1NL2 A;  2PK4 A;  5EOK A;  5CS1 A;  4BV7 A;  2DOH X;  1A0H A;  2L0S A;  5CS5 A;  1TPK A;  1YXE A;  5HPG A;  1KIV A;  3BT1 A;  2YIL A;  2Y8R A;  4Z0F A;  5CT3 A;  3K65 A;  1KI0 A;  2HGF A;  2Q8B A;  3HN4 A;  1URK A;  3U73 A;  2X2Z A;  5CS3 A;  4R19 A;  1BHT A;  3SP8 A;  4YIZ A;  3ZWZ A;  2HPQ P;  2FD6 A;  5COE A;  3SRJ A;  2LL4 M;  4Z0E A;  1HKY A;  1GP9 A;  2K4R A;  2KNF A;  2PF2 A;  5CT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...