1NK1A

Nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
b'TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEPATOCYTE GROWTH FACTOR PRECURSOR)
publication title Crystal structure of the NK1 fragment of HGF/SF suggests a novel mode for growth factor dimerization and receptor binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 32
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1nk1A02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1nk1A01
1B2IA 3E6PL 1I71A 5I25A 1NL1A 2DOIA 1PMKA 2I9AA 1PMLA 5HPGA 1KI0A 4R19A 3SP8A 1W8KA 4DURA 2Q8BA 2QJ2A 4BVCA 3ZLEA 2K51A 5CSQA 1URKA 2Z8WA 4Z09A 2X2ZA 1KIVA 4R1AA 3LAQA 4BV5A 4Z0DA 1PK2A 2K13X 1HKYA 2J8LA 5EODA 4UAOA 3HMSA 2LL4M 4NZQA 4Z0EA 4D3CA 3HN4A 4KIVA 2FD6A 1NK1A 2FEBA 1KRNA 5EOKA 2HGFA 2SPTA 3HMRA 5CS9A 2PK4A 1NL2A 2LL3A 3ZWZA 5CS1A 2Y8RA 3SRIA 1CEAA 5COEA 2HPQP 1KDUA 5CS5A 2QJ4A 4Z0FA 2HPPP 2L0SA 1PKRA 2K4RA 1GMOA 4R1CA 3K65A 3U73A 1PK4A 4BVDA 1BHTA 1JFNA 2Q8AA 1TPKA 5CT1A 3SRJA 1GP9A 2YIOA 2YIPA 5CT3A 2KJ4A 1HPJA 4APMA 3NXPA 1CEBA 2PF1A 5CS3A 4UV6A 5CP9A 2J8JA 3HMTA 4A5TS 1W81A 2I9BA 4BVWA 2KNFA 3BT1A 2DOHX 3BT2A 5CT2A 4IUAA 4R1BA 2YILA 1Z40A 3KIVA 2Z8VA 1I8NA 1GMNA 4CIKA 1YXEA 2F83A 3MKPA 4BVVA 4APLA 4O03A 4BV7A 1HPKA 1A0HA 4HZHA 1I5KA 2PF2A
chains in the Genus database with same CATH superfamily
1B2IA 3E6PL 1I71A 5I25A 1NL1A 2DOIA 1PMKA 2I9AA 1PMLA 5HPGA 1KI0A 4R19A 3SP8A 1W8KA 4DURA 2Q8BA 2QJ2A 4BVCA 3ZLEA 2K51A 5CSQA 1URKA 2Z8WA 4Z09A 2X2ZA 1KIVA 4R1AA 3LAQA 4BV5A 4Z0DA 1PK2A 2KL5A 2K13X 1HKYA 2J8LA 5EODA 4UAOA 3HMSA 2LL4M 4NZQA 4Z0EA 4D3CA 3HN4A 4KIVA 2FD6A 1NK1A 2FEBA 1KRNA 5EOKA 2HGFA 2SPTA 3HMRA 5CS9A 2PK4A 1NL2A 2LL3A 3ZWZA 5CS1A 2Y8RA 3SRIA 1CEAA 5COEA 2HPQP 1KDUA 5CS5A 2QJ4A 4Z0FA 2HPPP 2L0SA 1PKRA 2K4RA 1GMOA 4R1CA 3K65A 3U73A 1PK4A 4BVDA 4YIZA 1BHTA 1JFNA 2Q8AA 4YIVA 1TPKA 5CT1A 3SRJA 1GP9A 2YIOA 2YIPA 5CT3A 2KJ4A 1HPJA 4APMA 3NXPA 1CEBA 2PF1A 5CS3A 4UV6A 5CP9A 2J8JA 3HMTA 4A5TS 1W81A 2I9BA 4BVWA 2KNFA 3BT1A 2DOHX 3BT2A 5CT2A 4IUAA 4R1BA 2YILA 1Z40A 3KIVA 2Z8VA 1I8NA 1GMNA 4CIKA 1YXEA 2F83A 3MKPA 4BVVA 4APLA 4O03A 4BV7A 1HPKA 1A0HA 4HZHA 1I5KA 2PF2A
chains in the Genus database with same CATH topology
1B2IA 3E6PL 1I71A 5I25A 1NL1A 2DOIA 1PMKA 2I9AA 1PMLA 5HPGA 1KI0A 4R19A 3SP8A 1W8KA 4DURA 2Q8BA 2QJ2A 4BVCA 3ZLEA 2K51A 5CSQA 1URKA 2Z8WA 4Z09A 2X2ZA 1KIVA 4R1AA 3LAQA 4BV5A 4Z0DA 1PK2A 2KL5A 2K13X 1HKYA 2J8LA 5EODA 4UAOA 3HMSA 2LL4M 4NZQA 4Z0EA 4D3CA 3HN4A 4KIVA 2FD6A 1NK1A 2FEBA 1KRNA 5EOKA 2HGFA 2SPTA 3HMRA 5CS9A 2PK4A 1NL2A 2LL3A 3ZWZA 5CS1A 2Y8RA 3SRIA 1CEAA 5COEA 2HPQP 1KDUA 5CS5A 2QJ4A 4Z0FA 2HPPP 2L0SA 1PKRA 2K4RA 1GMOA 4R1CA 3K65A 3U73A 1PK4A 4BVDA 4YIZA 1BHTA 1JFNA 2Q8AA 4YIVA 1TPKA 5CT1A 3SRJA 1GP9A 2YIOA 2YIPA 5CT3A 2KJ4A 1HPJA 4APMA 3NXPA 1CEBA 2PF1A 5CS3A 4UV6A 5CP9A 2J8JA 3HMTA 4A5TS 1W81A 2I9BA 4BVWA 2KNFA 3BT1A 2DOHX 3BT2A 5CT2A 4IUAA 4R1BA 2YILA 1Z40A 3KIVA 2Z8VA 1I8NA 1GMNA 4CIKA 1YXEA 2F83A 3MKPA 4BVVA 4APLA 4O03A 4BV7A 1HPKA 1A0HA 4HZHA 1I5KA 2PF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2I A;  3E6P L;  1I71 A;  5I25 A;  1NL1 A;  2DOI A;  1PMK A;  2I9A A;  1PML A;  5HPG A;  1KI0 A;  4R19 A;  3SP8 A;  1W8K A;  4DUR A;  2Q8B A;  2QJ2 A;  4BVC A;  3ZLE A;  2K51 A;  5CSQ A;  1URK A;  2Z8W A;  4Z09 A;  2X2Z A;  1KIV A;  4R1A A;  3LAQ A;  4BV5 A;  4Z0D A;  1PK2 A;  2K13 X;  1HKY A;  2J8L A;  5EOD A;  4UAO A;  3HMS A;  2LL4 M;  4NZQ A;  4Z0E A;  4D3C A;  3HN4 A;  4KIV A;  2FD6 A;  1NK1 A;  2FEB A;  1KRN A;  5EOK A;  2HGF A;  2SPT A;  3HMR A;  5CS9 A;  2PK4 A;  1NL2 A;  2LL3 A;  3ZWZ A;  5CS1 A;  2Y8R A;  3SRI A;  1CEA A;  5COE A;  2HPQ P;  1KDU A;  5CS5 A;  2QJ4 A;  4Z0F A;  2HPP P;  2L0S A;  1PKR A;  2K4R A;  1GMO A;  4R1C A;  3K65 A;  3U73 A;  1PK4 A;  4BVD A;  1BHT A;  1JFN A;  2Q8A A;  1TPK A;  5CT1 A;  3SRJ A;  1GP9 A;  2YIO A;  2YIP A;  5CT3 A;  2KJ4 A;  1HPJ A;  4APM A;  3NXP A;  1CEB A;  2PF1 A;  5CS3 A;  4UV6 A;  5CP9 A;  2J8J A;  3HMT A;  4A5T S;  1W81 A;  2I9B A;  4BVW A;  2KNF A;  3BT1 A;  2DOH X;  3BT2 A;  5CT2 A;  4IUA A;  4R1B A;  2YIL A;  1Z40 A;  3KIV A;  2Z8V A;  1I8N A;  1GMN A;  4CIK A;  1YXE A;  2F83 A;  3MKP A;  4BVV A;  4APL A;  4O03 A;  4BV7 A;  1HPK A;  1A0H A;  4HZH A;  1I5K A;  2PF2 A; 
#chains in the Genus database with same CATH topology
 1B2I A;  3E6P L;  1I71 A;  5I25 A;  1NL1 A;  2DOI A;  1PMK A;  2I9A A;  1PML A;  5HPG A;  1KI0 A;  4R19 A;  3SP8 A;  1W8K A;  4DUR A;  2Q8B A;  2QJ2 A;  4BVC A;  3ZLE A;  2K51 A;  5CSQ A;  1URK A;  2Z8W A;  4Z09 A;  2X2Z A;  1KIV A;  4R1A A;  3LAQ A;  4BV5 A;  4Z0D A;  1PK2 A;  2KL5 A;  2K13 X;  1HKY A;  2J8L A;  5EOD A;  4UAO A;  3HMS A;  2LL4 M;  4NZQ A;  4Z0E A;  4D3C A;  3HN4 A;  4KIV A;  2FD6 A;  1NK1 A;  2FEB A;  1KRN A;  5EOK A;  2HGF A;  2SPT A;  3HMR A;  5CS9 A;  2PK4 A;  1NL2 A;  2LL3 A;  3ZWZ A;  5CS1 A;  2Y8R A;  3SRI A;  1CEA A;  5COE A;  2HPQ P;  1KDU A;  5CS5 A;  2QJ4 A;  4Z0F A;  2HPP P;  2L0S A;  1PKR A;  2K4R A;  1GMO A;  4R1C A;  3K65 A;  3U73 A;  1PK4 A;  4BVD A;  4YIZ A;  1BHT A;  1JFN A;  2Q8A A;  4YIV A;  1TPK A;  5CT1 A;  3SRJ A;  1GP9 A;  2YIO A;  2YIP A;  5CT3 A;  2KJ4 A;  1HPJ A;  4APM A;  3NXP A;  1CEB A;  2PF1 A;  5CS3 A;  4UV6 A;  5CP9 A;  2J8J A;  3HMT A;  4A5T S;  1W81 A;  2I9B A;  4BVW A;  2KNF A;  3BT1 A;  2DOH X;  3BT2 A;  5CT2 A;  4IUA A;  4R1B A;  2YIL A;  1Z40 A;  3KIV A;  2Z8V A;  1I8N A;  1GMN A;  4CIK A;  1YXE A;  2F83 A;  3MKP A;  4BVV A;  4APL A;  4O03 A;  4BV7 A;  1HPK A;  1A0H A;  4HZH A;  1I5K A;  2PF2 A; 
#chains in the Genus database with same CATH homology
 1B2I A;  3E6P L;  1I71 A;  5I25 A;  1NL1 A;  2DOI A;  1PMK A;  2I9A A;  1PML A;  5HPG A;  1KI0 A;  4R19 A;  3SP8 A;  1W8K A;  4DUR A;  2Q8B A;  2QJ2 A;  4BVC A;  3ZLE A;  2K51 A;  5CSQ A;  1URK A;  2Z8W A;  4Z09 A;  2X2Z A;  1KIV A;  4R1A A;  3LAQ A;  4BV5 A;  4Z0D A;  1PK2 A;  2KL5 A;  2K13 X;  1HKY A;  2J8L A;  5EOD A;  4UAO A;  3HMS A;  2LL4 M;  4NZQ A;  4Z0E A;  4D3C A;  3HN4 A;  4KIV A;  2FD6 A;  1NK1 A;  2FEB A;  1KRN A;  5EOK A;  2HGF A;  2SPT A;  3HMR A;  5CS9 A;  2PK4 A;  1NL2 A;  2LL3 A;  3ZWZ A;  5CS1 A;  2Y8R A;  3SRI A;  1CEA A;  5COE A;  2HPQ P;  1KDU A;  5CS5 A;  2QJ4 A;  4Z0F A;  2HPP P;  2L0S A;  1PKR A;  2K4R A;  1GMO A;  4R1C A;  3K65 A;  3U73 A;  1PK4 A;  4BVD A;  4YIZ A;  1BHT A;  1JFN A;  2Q8A A;  4YIV A;  1TPK A;  5CT1 A;  3SRJ A;  1GP9 A;  2YIO A;  2YIP A;  5CT3 A;  2KJ4 A;  1HPJ A;  4APM A;  3NXP A;  1CEB A;  2PF1 A;  5CS3 A;  4UV6 A;  5CP9 A;  2J8J A;  3HMT A;  4A5T S;  1W81 A;  2I9B A;  4BVW A;  2KNF A;  3BT1 A;  2DOH X;  3BT2 A;  5CT2 A;  4IUA A;  4R1B A;  2YIL A;  1Z40 A;  3KIV A;  2Z8V A;  1I8N A;  1GMN A;  4CIK A;  1YXE A;  2F83 A;  3MKP A;  4BVV A;  4APL A;  4O03 A;  4BV7 A;  1HPK A;  1A0H A;  4HZH A;  1I5K A;  2PF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...