1NK5A

Adenine-adenine mismatch at the polymerase active site
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk5A01
4KLIA 4KLHA 1S9FA 4F5NA 9ICFA 5CYMA 4M9LA 4M9NA 3L2WA 1BPEA 3TANA 5BOLA 1NK5A 1TK8A 2NRTA 3K5NA 2P5OA 3ZSVA 8ICBA 3MDCA 3RAXA 4E7KA 1NKBA 1Y88A 3PX0A 4JV2A 4YXJA 4UAZA 4MFBA 3OYLA 4RU9A 1QTMA 2QKBA 1JL1A 1X2IA 1VSJA 2KZMA 4KTZA 4QZCA 1W9HA 3CFOA 2VG7A 7ICIA 4B9VA 3AO3A 2MUTB 4DF4A 8ICQA 4KHYA 1ZJNA 3PW2A 3QZ8A 3NGDA 4B8CA 3ISNC 3AVCA 3OYJA 3ZCMA 2OPSA 2F1HA 5KT2A 1WCNA 3SUPA 5L1LA 1KRPA 4IRCA 1IKYA 4GXJA 8ICNA 1EXNA 8ICAA 5KFKA 1VRTA 3OYCA 4CGJA 3L3UA 1I39A 4DQIA 2FBYA 5KRTA 4M9HA 4CE9A 3EYZA 3KKRA 4KB1A 1FK9A 2JEGA 4CEAA 3ZSZA 2XY6A 3V1QA 4YMOA 1ZQZA 8ICVA 4X5VA 1LWEA 1SKSA 3O3GA 1RBRA 5CY4A 3KK2A 4KAZA 4DL3A 5J0RA 2HHVA 1XU4A 3H7IA 4CESA 4I2CA 4YD2A 3M9NB 5J0UA 2HVIA 4PGXA 1FKOA 4LY7A 3RJGA 3H08A 4F5PA 5HP1A 1BQMA 1VSDA 4B8AB 4O44A 1KFSA 4JS5A 4AHUA 1I3AA 4F93B 1VSLA 4UB2A 4UQGA 1JLAA 4M04A 9ICXA 1D8LA 1K6YA 1RTJA 2B21A 8ICRA 3HX0A 3QLHA 4BE2A 5KG7A 3SYZA 4W5NA 2NRVA 4F5RA 5FRMA 2QXFA 4BWJA 3GIJA 1C0MA 4RQ5A 5IILA 1SL1A 3K2PA 3RH5A 3S3OA 1S1TA 4M3RA 2FPLA 3SV3A 4FLYA 4I2JA 5KT7A 2DPIA 2ITGA 4DTXA 5J2QA 2PY5A 4CFDA 1S6PA 3ORYA 2ZUCA 4OKJA 4ECZA 5CWRA 3K5LA 5J2MA 3S9HA 1TGOA 1TK5A 4I2IA 1JIHA 1Z3EB 2FLNA 3AVAA 4J2BA 3ZD8A 1J5OA 4N5SA 1JLEA 2HHXA 1VSFA 3LK9A 4M2YA 2BCVA 3ZT4A 2G8KA 3P5JA 9ICTA 1D8YA 3RJHA 3RH6A 4FCYA 4M3ZA 2BKEA 4TQSA 5F9NA 3OYNA 2C2EA 2J6TA 3VQ6A 2FBXA 2G8FA 4KI6A 3NE6A 2UVWA 3OS0A 1XC9A 3LZJA 3WNFA 2KZ3A 5BOMA 4CF1A 3M8SA 1HJPA 1Q9YA 2HNDA 4E0DA 4DSJA 3MR2A 2BCSA 5KFCA 4C8LA 3CG7A 2JZBA 3JPQA 2ZUBA 3OJUA 5HMLA 1WN7A 4CIEA 1IKXA 1LWFA 4CEDA 1RBTA 4PQUA 2W9BA 3E2EA 4OLBA 4ID5A 3NF8A 2XY8A 4KN4A 4CF9A 3RBEA 4P2HA 4ECVA 3G0ZA 4CEEA 2ZTEA 5CP2A 1RILA 3ZT0A 3ETLA 4DWIA 4FJJA 3ZT2A 3AA5X 3HVRA 5I42A 3GIIA 3LANA 5KFAA 4J9PA 2FPMA 3NGIA 3C1YA 4BDZA 2FMQA 3UXNA 3M8QA 2R8GA 4FW2A 1RTDA 1RXWA 5L1KA 2ETJA 4YMNA 4F4ZA 3ISBA 2DPJA 3Q8QB 1WSIA 3C5GA 5DGBA 1N48A 1WLJA 5HNKA 4R66A 1EX4A 5F9LA 8ICXA 4R63A 4FM2A 2ZUDA 4RNOA 2HHTA 1WNSA 1QSLA 7ICTA 4FZXC 9ICUA 4CEBA 1XSPA 4KLMA 3DLBA 3MR3A 3JPSA 2ZTDA 3QO9A 5C25A 3H8WA 5JUMA 1RXVA 3OS1A 1B9DA 1RTIA 3PX6A 5J2KA 3B0YA 5KFSA 4CECA 5KFXA 1U47A 5HRPA 7ICMA 4AHSA 4JS4A 3V1RA 2HHSA 4E7JA 4KB0A 3AVGA 4OPKA 4UB4A 4UB5A 4RW6A 4R8UB 3AVFA 4YP3A 5J2EA 3C94A 3LDSA 2ISPA 4FYDA 1Z25A 1YT3A 3M8PA 4QWBA 1RZTA 3DLGA 3VQAA 4RQ2A 4J9SA 2R8HA 4LSNA 9ICPA 3PW0A 1TKTA 3NCIA 2G8WA 1JX4A 9ICRA 5KG2A 3Q8KA 4BDPA 3LDAA 2WTFA 3DLEA 2XGQA 1SL0A 1JXEA 3AU2A 3NTUA 4KRFA 2W9AA 4F50A 3V7KA 1T8EA 1ZQPA 4FLVA 2OPQA 1BI4A 2Q0ZX 3EW9A 1LV5A 2YHBA 4IQVA 5EU7A 3HT3A 1D5AA 1RT6A 4ZTFA 2XCAA 2WONA 8ICCA 1S0NA 1NJYA 4QZGA 4DQQA 5JS2A 4N47A 3V9UA 5KG4A 4QWDA 4BACA 2E4LA 2X6NA 2P66A 1BPBA 5SZTA 4CJWA 4KHNA 3AVLA 2PFOA 4RNMA 3V6HA 3OHBA 1NJZA 4Z4IA 7ICHA 3UXOA 4JRQA 4LVSA 2VWKA 3OYFA 3AV9A 5KG3A 5D49A 2AJQA 1B92A 5KT3A 3Q8SB 1TKDA 4M3WA 3QIPA 8ICIA 5EWFA 3T5JA 4FLTA 8ICFA 2WOMA 3G6VA 1QQCA 3BDPA 1ZBIA 4CGGA 2RDJA 4XA5A 2W9MA 2KZZA 1ZQHA 4AHTA 1R0AA 4DTRA 8ICWA 1ZQOA 4Q8FA 3ISCA 8ICTA 7ICFA 1ZQUA 2OA8A 4XUSA 4I29A 4PHDA 5FRNA 3QNNA 3ZDBA 4PGYA 4KMUA 2PFQA 4IFVA 4DG1A 8ICZA 1MC8A 1ZQIA 4CJFA 4MFFA 2AGPA 3TR8A 4KHQA 1S77D 4DQPA 3Q8RB 4J9KA 1JLGA 4WE1A 4B08A 4E3SA 5HRNA 3D45A 1HJRA 3RMCA 1JLFA 3CM6A 2C2DA 3Q8PB 5KGWA 3I0SA 5IINA 1HPZA 9ICHA 5BPCA 2IMWP 2QKKA 5IIMA 2OWOA 1ZYQA 2C22A 5KFIA 4Q43A 3I8DA 3TAPA 5DBCA 3SUNA 4JRPA 4OGEA 4F4XA 4QZAA 3OYBA 1UT5A 3ZDDA 5KG0A 3PW7A 3T5HA 2BPGA 4B9SA 5KT5A 4ELVA 1BPYA 2Z1IA 3JPTA 1KFTA 3HJFA 3IM1A 1TV9A 3SQ4A 5DLFA 4CEQA 3IHQB 3HVTA 4FLWA 4FVMA 2BQ3A 3M9OB 3VQQA 1JL2A 4GMJB 5KFJA 5J2HA 5L1IA 5CZ1A 4FZYA 4IQUA 3AVKA 1SV5A 3VQBA 1RT3A 3CYMA 4UBBA 3NDKA 4Z6DA 5K14A 4TURA 1BPZA 4NCGA 3UQ2A 4UAWA 7ICVA 2BR0A 1NKCA 3BQ1A 4CJQA 3C6TA 4BE0A 9ICCA 5DDMA 5J1EA 3RTVA 4EZ6A 3SUOA 1NOYA 3C5FA 2AU0A 1Z00A 1HNIA 4YR2A 4N76A 3AA4A 1BL3A 2PXIA 3PUFA 4DTUA 4I9LA 3RMAA 3B6PA 2P1JA 5DBAA 4CFAA 4UAYA 4DF8A 4E1NA 8ICPA 4ZH4A 5KFVA 4FLZA 1VSHA 3RRGA 1FXXA 4O3NA 4O3RA 4DLGA 3E01A 3TFRA 3NH2A 1XSNA 3H4DA 3QETA 3ZDAA 2OPRA 5D4BA 4CJUA 4CHYA 4MQ3A 4HTUA 3AVMA 4CEFA 4O3SA 1T05A 2LYHA 3QEIA 1C1BA 3MECA 3ZT1A 4Z4GA 3O3HA 3GV7B 4QZHA 2DFLA 4LH4A 4CJ3A 4KLFA 2RPIA 7ICQA 4KV8A 5T7BA 5TZVA 4B3OA 3SQ0A 4MEYA 4RQ7A 1RDBA 4DFPA 4NLZA 5KFMA 4Q0BA 3GV8B 4M6WA 3C1ZA 4Z6FA 1A5XA 4CEOA 1CXQA 1H38A 8ICMA 4KTWA 1KEJA 1ZBUA 4KN7A 2GUIA 3EWAA 3ZDEA 9ICLA 4ECRA 4CJVA 3L2RA 5DK5A 4N56A 1BQNA 2IS3A 3V4IA 4H4OA 3KTQA 3MXMA 4RZRA 5C5JA 1JLQA 1S10A 3D0PA 2W8KA 4R65A 3BGRA 4I2AA 3ZSWA 2JEFA 3LZIA 4N41A 3QZ7A 3K58A 1SKWA 4CHPA 4I2HA 4TQRA 3TQ1A 1UAXA 4EBCA 2B5JA 2NUBA 4DSEA 1RBUA 1IH7A 2I9GA 4FLUA 4Z4EA 4RW7A 3V9WA 4YVZA 4BGDA 5DDYA 2JZBB 3PO5A 4JV0A 4UBCA 4K4HA 3KHHA 2R8KA 3NF7A 4PHEA 4QW8A 1KVBA 2W9BB 4CIGA 1AROP 3Q8LA 4FK2A 2O4IA 1D9DA 1ZQYA 4ED7A 9ICBA 4FS2A 5J2DA 1C6VA 4FLXA 1XS9D 4CJKA 1VRUA 4Q5VA 4QW9A 4J9OA 2HB5A 2OZSA 3V9XA 3ZSRA 4HCBA 2DFEA 1RT1A 3LAKA 3O4QA 5J0TA 4PHAA 3RB3A 2V9WA 4ECTA 5CR0A 3DYAA 4DS4A 4I2EA 4RQ8A 2F1IA 5J0SA 4M3XA 4PHPA 4FO6A 4F92B 4YR3A 4NLGA 2W42A 5DB9A 3NAEA 3L3VA 1RT2A 3LP2A 1TL1A 4HHTA 7ICGA 1N5YA 4DLEA 1RCHA 1WSFA 3AVIA 4G1QA 3QEWA 5KFBA 3NH1A 5DQGA 4DOCA 8ICHA 2IHMA 4DTPA 3LP1A 1GOBA 1XHZA 4RQ6A 2A1JA 5L9XA 1ZETA 1NK6A 3PV8A 4F2RA 4I2QA 3K57A 3MEDA 2NRWA 1T3NA 4H8KA 4ECQA 1WSGA 3DLKA 5KTQA 1L3SA 5DQIA 3T1AA 2KFNA 4NYNA 4UB3A 1RBSA 3K5OA 2G8VA 1BGXT 3KLEA 4ECYA 1SZPA 3P1GA 4CHNA 4CF2A 4I2BA 4KHUA 2A1RA 4LZGA 4QZ9A 4GW6A 3JPNA 1SL2A 3VQ4A 4QZBA 1CEZA 1VSKA 1IG9A 2GWSA 3ASMA 3AO5A 2XCPA 1MQ2A 1WAFA 3SQ1A 1N6QA 4RUCA 5DQHA 4EZ9A 4R64A 3VQ8A 1T03A 3LAMA 7ICOA 1RT4A 3CFRA 3BJYA 4NYFA 1ZQSA 4C8MA 4LZDA 5CJ7A 1BI4B 1BIUA 4R5PA 5E41A 4QZDA 3H4BA 3DI6A 4Y1CA 4RT2A 4G3IA 1BPXA 3PNCA 5KT4A 4K4GA 8ICSA 2AQ4A 4FJ9A 4I2FA 5J2FA 1TVAA 3CFPA 4ECWA 3VA3A 1A5WA 4Q45A 3ALYA 4IG3A 4UB1A 2PFNA 2KN7A 5HHIA 2KFZA 3PR5B 3ZD9A 3K75D 2D5RA 3KLGA 4M3YA 2YNHA 1RYSA 3PY8A 5CZ2A 4CGHA 1HYSA 4FM1A 3NGYA 4B9TA 4MFAA 2VANA 5J2GA 4RQ3A 3V7JA 1S97A 4M9GA 5KFNA 9ICWA 1NK7A 4P4OA 4ECUA 4RG8A 3SCXA 3EPGA 4MFCA 3GIKA 4MF8A 2BQRA 4HCCA 2EX3A 4IR9A 5KFOA 3HO1A 3AO1A 1ZQVA 4OLAA 4F4WA 1IXRA 4CF8A 3V72A 3DRPA 2F1JA 3HP6A 4RUAA 4AILC 4RNNA 2PYLA 2BQUA 1DGSA 4J9RA 5FDLA 1RPLA 2ALZA 4LH5A 2P6RA 4L8RB 8ICYA 3QEPA 1S1WA 4F4YA 4RW9A 3KD5E 1HUOA 1ZJMA 9ICNA 4ZTJA 4M9JA 1HYVA 4J2EA 1X9WA 4DQRA 4PUOA 5DB7A 2J6UA 5KFQA 3RB6A 4IR1A 4FJXA 3LP3A 1CZ9A 3VQ7A 4KFBA 3OYKA 2F96A 4YG2A 1JXBA 3GIMA 4IG0A 1VSMA 4DTNA 3OYHA 2I1QA 3B6OA 4RQ0A 1B43A 3GQCA 1UOCA 1GOCA 4GXIA 1TKZA 1XWLA 2BHNA 1SUQA 4YFUA 4M45A 3OYAA 4I2DA 1HQEA 1KVAA 4I28A 1WCLA 1JN3A 1C0UA 4MF2A 1QHTA 4BXOB 2RKIA 5KG5A 3TAFA 1VSEA 1NOMA 3C2MA 3F73A 4KLJA 2QK9A 4Z6CA 4DOBA 1LWCA 3OS2A 5DG7A 3KD1E 8ICOA 2VG5A 9ICJA 3RJKA 5HBMA 3LPTA 3K59A 4GC7A 4I9QA 1KDHA 4QWEA 3CM5A 1VSIA 3RMDA 3F9KA 3HP9A 1J54A 4NCAA 2JGUA 3ZSOA 3SPYA 4FBTA 2VG6A 3HPGA 3HPOA 4KTQA 2IGIA 4CERA 3K5MA 1XHXA 3DM2A 4B9NA 2Z1HA 1NJXA 3VQ9A 4YQWA 2IOCA 2P6UA 4EYIB 3RWUA 4DU4A 3V7LA 4PGQA 4FK0A 2R7YA 2DY4A 1ZQTA 1C1AA 3H8SA 4J9MA 3FYHA 3BQ0A 4ED0A 4EBEA 4YD1A 4EP4A 1Z00B 5DG9A 1CUKA 5J29A 3S3MA 4DO9A 1G15A 3GFKB 3AVJA 4O4GA 3UQ0A 2Z1JA 5KFTA 3SUQA 1T4GA 3HL8A 3PX4A 2JLEA 4YCXA 3L2VA 4RPZA 3DOLA 3RJFA 9ICQA 2PZSA 3V6KA 1KSPA 5KFWA 3MR5A 4FZZA 1L3TA 1CLQA 3AO2A 3VA0A 5KFDA 1S0VA 3QINA 3A2FA 4OVLA 4DL4A 3HK2A 1S76D 5J2IA 9ICAA 2D0AA 3V6DA 5D3GA 3VN5A 2LSNA 2ZE2A 2IBKA 2RF2A 3OYIA 4LD0A 2OYQA 1RDDA 4PWDA 4ELUA 3RJEA 1JKHA 3NH0A 2XO7A 4GLXA 3ZSYA 2XHBA 2J6SA 3C2KA 4KLGA 1HRHA 3S3NA 3EY1A 1ZBFA 4DSIA 2YNFA 4DFJA 4M6WB 1Q9XA 1B22A 2ZJ5A 5DMRA 3SNNA 2JEIA 3PO4A 1WSHA 4AHRA 4IRDA 8ICEA 2XGPA 4CHQA 1TAQA 4FW1A 2C2RA 1U4BA 4JV1A 3KJVA 3OGUA 3ULDA 1LAWA 2O4GA 2KTQA 4YN4A 5DKWA 1UT8A 4E7HA 4KPYA 2BCRA 4FJ7A 5KRSA 4KI4A 4DEZA 3LALA 2G8UA 1J53A 4O55A 5SWMA 3KLIA 2YV0X 5FROA 3N4MB 1S0OA 4AHCA 3JYTA 7ICEA 9ICMA 3AA3A 4K4IA 3JPRA 3PW5A 4XIUA 1ZBHA 1Z26A 4O3PA 2AQ0A 3MBYA 1ZQRA 4B9UA 1ZQCA 2M9NA 1TVRA 5KG1A 4F91B 1S1VA 1BVSA 1ASUA 5HMMA 5CA7A 1QLNA 2HNYA 4CJRA 1NK4A 4CK2A 1RBVA 4O5EA 5EWEA 5L1JA 1IKWA 4J9NA 4DTSA 4KLDA 1QS4A 3NF9A 5HP4A 2ATLA 4DFMA 4FBUA 4RQ4A 4O3OA 4W5TA 4CIFA 4FS1A 2BGWA 2IC3A 3SJJA 3SPZA 4DL5A 3G6XA 4EYHB 4XRHA 4Z4HA 3O3FA 1BCMA 2Q3SA 3GDXA 1ZQWA 5J2AA 5C42A 4FJ5A 2Z1GA 1UWBA 1MSWD 2IDOA 1RDAA 4J2AA 2FBVA 4KHSA 1X1PA 1J9AA 3KLFA 4FXDA 1RNHA 3RR7A 2A1JB 1TK0A 1ZQDA 1FKPA 4NY8A 1K1QA 1PZNA 3MFIA 4IKFA 3THVA 1F21A 5HRRA 4PPXA 2ZD1A 3O4NA 2OPPA 1NKEA 4CFCA 4DSFA 1B9FA 4M47A 4Z0UA 4OKKA 2W9CA 3PVXA 4RW8A 5KFLA 4MEXA 4IRKA 4RPXA 3TWHA 1BHLA 1C0TA 1Q8IA 4KITB 3TFSA 3QIOA 4O0JA 2F8TA 3HW8A 1U48A 4HUFA 3SV4A 2VA8A 1U45A 3FFIA 4QWAA 3U3YA 4ED3A 1K1SA 4O5KA 2FBTA 1S9GA 1CXUA 4I2PA 2HVHA 4DOAA 1IO2A 3VQDA 3G6YA 4HUEA 1SKRA 3UXPA 4CHZA 3V6JA 5KFZA 1ZQKA 2IA6A 5KFFA 1BCOA 1V9PA 4AH9A 4NCBA 5D46A 3RH4A 1ZQGA 4E7LA 4IFYA 2YNIA 3BQTA 3C6UA 3AVBA 5KFPA 4IQWA 4O9MA 4ED8A 1REVA 3OVNA 3QEVA 2G8HA 4CGIA 5KFYA 1BISA 4CK3A 3V81A 1C7YA 5J0YA 4EBDA 4Z6EA 2XRIA 3C2LA 4OGCA 1XI1A 4C8OA 4QZFA 2ISOA 4CJLA 3MABA 4RQ1A 4ELTA 4KLSA 1S5JA 5DG8A 4DQSA 3PW4A 1X9MA 4I2GA 7ICNA 4OJRA 5J2CA 4KLTA 1KLNA 5J0OA 4K8XA 4Q8EA 1U04A 4BDYA 3L2QA 2D0BA 9ICOA 3KK3A 3KHRA 1Y97A 4TUQA 4KLUA 1ZBLA 1S0MA 2PI4A 5C24A 3VQPA 4J2DA 1LAVA 2BCUA 4IDKA 2ZQBA 4ID1A 1WAJA 4W5QA 1ZQBA 1ITGA 2JEJA 3G10A 4O0IA 1ZQXA 1A76A 4HYKA 4KKOA 4Y1DA 2FLLA 2YKNA 2ZJ8A 4ZHRA 4F2SA 1BIZA 2XC9A 4O5BA 4M0AA 4QZIA 4OKEA 4TSXA 1HQUA 3B0XA 4F8RA 2MUTA 4FJ8A 2XY5A 5KI6A 2V4QA 3KIOA 3ZT3A 4CGFA 1QSYA 3MGIA 4HUGA 5J0WA 3MEEA 5DLGA 2FMPA 4FJMA 3SI8A 1EP4A 4ICLA 5KFGA 4DTJA 1A77A 2R8JA 4CK1A 3TAEA 5HLFA 4Z4FA 3Q8MA 2DFHA 3KHGA 1DOQA 1S1UA 4PY5A 2D0CA 3MXIA 4EP5A 3ZSXA 4FJNA 4C8KA 3H8JA 1LB2B 3LPUA 1S1XA 1U9LA 5DB8A 3KHLA 5DB6A 7ICPA 2UVUA 3HXMA 4CF0A 2AGQA 4DTMA 3DLHA 4KLQA 2PFPA 2W8LA 2HW3A 3LWLA 3RBDA 4F5OA 4FM0A 3TARA 1BPDA 9ICEA 3PMLA 4K8ZA 4F5QA 1COOA 1T7PA 2KW4A 4FJLA 1L3UA 3NF6A 3AO4A 4DSLA 3C95A 3QE9Y 5KT6A 4FJIA 4DSKA 2BPCA 5IIKA 3AVNA 3JPPA 5DBBA 3RB0A 4QZEA 4PA1A 5J0XA 1MQ3A 1L5UA 4KHWA 4JK1A 5KFUA 2RN2A 1YTUA 3MFHA 8ICJA 1KFDA 2BANA 4P4PA 1ZQEA 2BE2A 2FMSA 1IM4A 1C1CA 9ICIA 1NK8A 4J9LA 3AU6A 1JLCA 4CJ5A 4DMNA 3ZDCA 4QCLA 4NLKA 2XY7A 4JWMA 1TAUA 4DFKA 5CHGA 2UVVA 5EWGA 4YNQA 1XSLA 4CJPA 3AA2A 1JXLA 4M42A 4O5CA 3BQ2A 3MDAA 2X78A 3OYEA 2NRXA 3PR4A 3WNEA 1ZQJA 4ECXA 4M3TA 1X9SA 2HHWA 4NM1A 4DL7A 4YMMA 1EKEA 3IS9A 3FDSA 5CYQA 3NGZA 2V4RA 3UIQA 5KFHA 3AUOA 2H5XA 3QEBZ 1NOZA 3RJIA 3JPOA 3LP0A 4RPYA 3PMNA 3I0RA 2I5JA 3ITHA 8ICUA 2B4JA 4C8NA 4QZ8A 1ZQFA 4E1MA 1UA1A 3RRHA 3TAGA 4IQTA 7ICRA 3T3FA 2R8IA 4I27A 5IIIA 1NK0A 5J2JA 2IAJA 4O3QA 1L3VA 2E6LA 2ASLA 2FLPA 8ICGA 4NXZA 5CB1A 3MGHA 2PI5A 1VK0A 4IBNA 4DTOA 1KVCA 2RDIA 3HYFA 4AHVA 4RT3A 1TL3A 3MEGA 4FJHA 2A1SA 4ECSA 4P4MA 3IRXA 4QWCA 2ASJA 3CQ8A 3OJSA 1O1WA 5HROA 3NFAA 3N97B 4W5RA 4H4MA 3OY9A 1IKVA 3LWMA 3GILA 7ICUA 3C23A 4DU3A 4KLEA 3H40A 3L8BA 2HMIA 4DS5A 4E89A 2ASDA 3JSMA 3SI6A 1HMVA 4RW4A 2VA2A 1JLBA 4J9QA 4ED2A 4EEYA 2P5GA 5HRSA 5KFEA 2ZJAA 7ICJA 4F3OA 4QAGA 2E6MA 1XO1A 3T19A 1TFRA 3TI0A 4F4KA 3MAQA 4E19A 3HSTB 4KLOA 3DOKA 3QNOA 4BWMA 1ZQQA 5EOZA 3RJJA 1YVUA 3QEAZ 1ASWA 4GVMA 4CFBA 5DGAA 1RYRA 3SQ2A 5J0PA 1JMSA 1WSJA 2YNGA 3QEXA 4DL6A 2DTUA 2YHAA 3KKSA 2Y1JA 1CZBA 2P51A 1W0HA 4CHOA 5HHHA 4KLLA 5J2NA 4FJKA 3M8RA 2BDPA 2C28A 2BCQA 2IHNA 5JS1A 2FPKA 3IG1A 3OSPA 1A5VA 1TKXA 4LSLA 4E7IA 3DRRA 2F8SA 1RDCA 1ZQNA 3UPQA 2EHGA 4QOZB 1RTHA 5I3UA 1EETA 2YKMA 4W5OA 3P83D 1QSSA 4XQ8A 2NRZA 2VA3A 3TAQA 2OZMA 2X74A 1KCFA 5J2PA 4B9MA 3T5LA 3NHGA 4KO0A 3VQ5A 7ICKA 4M3UA 4YR0A 2HHQA 1MU2A 1YTAA 3GV5B 4CGDA 1ZQAA 3K4GA 1HUZA 1ASVA 1DTTA 2UVRA 3DRSA 3QESA 3TABA 3DMJA 4R8UA 8ICLA 4ED1A 1ZQMA 4JUZA 1U49A 3WNGA 4CEZA 4B9LA 3ZSQA 4TUSA 3M9MB 3EZ5A 4CJ4A 4BE1A 3V9ZA 2BPFA 3RMBA 1HNVA 3U3GA 1KLMA 9ICGA 3IAYA 1GOAA 3KLHA 2G8IA 3ISDA 1QE1A 3C21A 3TAMA 3KK1A 3V9SA 3HWTA 2BGGA 2X6SA 4BXOA 4CCHA 2HHUA 1DTQA 1S9EA 4Q44A 5KGXA 5J2BA 9ICVA 5KFRA 1NK9A 2HNZA 4CJSA 2W9CB 5KG6A 1RT5A 3MXJA 2Y1IA 5J0QA 2GBZA 4JLHA 4DU1A 4CJTA 3OSNA 3WNHA 4NLNA 1D9FA 2GV9A 1LW2A 3VQCA 2MAXA 3DLRA 1UA0A 4Z4CA 1S6QA 2FC0A 5IIJA 4PH5A 7ICSA 3OYGA 9ICKA 1WSEA 1HYZA 2ZTCA 3NBPA 1NJWA 3HPHA 4M41A 2VWJA 2AGOA 4TUPA 4GXKA 3L2UA 4ED6A 4CJEA 4NM2A 1DLOA 4KREA 3AVHA 3T5KA 4I7FA 4F3TA 1LW0A 4FK4A 3OYDA 3HM9A 1EXQA 1N56A 3RB4A 4YFKA 5IIOA 3QERA 3SZ2A 4OPJA 4YXMA 2B6AA 3OYMA 3RR8A 1TV6A 4FJGA 2PYJA 3OHAA 1ZQLA 3MR6A 3RAQA 3U6FA 8ICKA 4JWNA 2ATQA 3V1OA 3VQEA 1KTQA 2KQ2A 7ICLA 2DFFA 3EPIA 4DL2A 4GC6A 1RT7A 9ICSA 4HVJA
chains in the Genus database with same CATH superfamily
4OI2A 5ETOA 5K8MA 4F5NA 5M1QA 3TANA 4GIBA 4H5VA 4ISGA 2K89A 4IDKB 2P5OA 4DV5J 2GEMA 3JXUA 1VJQA 2EK6A 3O08A 4E7KA 3SSSA 3AMZA 3O0FA 4LVNP 5BPLA 1VQ4S 4X2BA 4JV2A 2VUGA 5D78A 2LHTA 3GJQB 3QXGA 4RU9A 1HUXA 1QTMA 3D3BJ 3O9UA 2KZMA 4KTZA 4QZCA 2HGLA 2VG7A 4B9VA 3CJQA 2H54B 2QEXS 2VBWA 2CFXA 4DF4A 1NBWA 4ZVTB 8ICQA 3UN5A 3KUHA 2BUPA 4KHYA 1P8GA 3UKUA 3AVCA 5A0YB 1VJ5A 1H1VA 2WVBA 4K0KJ 1A0PA 4LIWA 1SIJA 3FMWA 1WCNA 6AT1B 1NO8A 3KG0A 5HLFB 1IKYA 2GJFA 4LF2A 3PSIA 1FF2A 3OUYB 1WG8A 1SBRA 3C46A 1RCOB 2P6SA 3R5JB 1I39A 2FBYA 2DXEA 4YHHJ 5KRTA 1S1XB 3QBXA 4CE9A 1KQGB 3W2WA 3EYZA 3C15A 4B3RJ 5B0FA 3KG4A 4ZPAA 5A2QO 1WHYA 1WC6A 1E4FT 3VGLA 2HWTA 1NMDA 4YMOA 5ALZA 2DT9A 3QMQA 4P7VA 5E3CA 1DY3A 3W9HA 5AM1A 4C3KA 4KAZA 1TFWA 3QFHA 1TYQB 4OI3A 3UI3A 2YQEA 4PGXA 3ZZPA 4ZKAA 1Y11A 2I5HA 5HP1A 1VSDA 4CLUA 1KFSA 1NI3A 2DCLA 1QZ6A 3NRZA 4H0TB 2QA4G 1U25A 2EWSA 1OH7A 2G0AA 2Z7JA 4UATA 4M04A 3CIZA 2AMCB 3VZIA 4ZITA 2E1EA 1D8LA 2J9EA 3SQOP 2BE2B 1RAIB 4WIIA 3ALRA 5KG7A 4OYMA 4CO4A 1K8KB 4W5NA 1NPPA 5FRMA 2OI2A 2QXFA 4BWJA 3GIJA 2OGUA 1C0MA 1M6YA 7AT1B 3K2PA 2O8CB 2D0OA 1HR0F 2HMXA 3VVTA 3SV3A 4FLYA 3GU0A 5KT7A 1XJWB 2LU1A 3WK6A 4X4TA 4DTXA 4WKRA 2CPXA 2PY5A 2KHQA 4MKAA 4DR1J 1N33F 4PZOA 4CD3A 5CWRA 3C14B 4UT4A 1RWNB 2AF6A 5CYQB 3PEJA 4WQ5C 1JNRB 2J7WA 2RIJA 1N8RO 4NA2A 3AVAA 3ZD8A 1MWYA 3LTOA 5GAHU 4N5SA 1JLEA 3LP0B 1Q16B 3R8EA 2I5JB 4I6AA 2G8KA 1RI7A 9ICTA 1R8BA 3QJLA 5F9NA 3OYNA 2C2EA 1OVYA 3A8JA 2UVWA 3I76A 3C65A 2DY9A 3LZJA 1XC9A 4CH1A 5BOMA 1B70B 3M8SA 3MEGB 1SIWB 2HIYA 1Q9YA 3EGNA 3LDLA 3BBFA 2XYPB 3M7DA 5CEHA 4CF5A 1QAIA 5KFCA 4MKBA 3MCPA 3JB9k 3R5DA 4PPZA 4H4MB 3SSRA 3FEXB 4WP3A 4EX7A 1WN7A 1HMVB 3D0HE 2GX8A 4FOIA 4IH6A 2L9NA 2EZYA 1KOHA 1YG0A 4KN4A 3NF8A 2GW8A 3U26A 1M90T 1HKGA 3BH6B 3LDQA 3MMAA 1FE0A 5CP2A 3GDQA 3SAHA 3ZT0A 5A8RA 1TQLA 3DOKB 4PJ0U 1IBMJ 3HVRA 3GIIA 2GIQA 3POTA 1YITN 2YB1A 5KFAA 3C1YA 5IT9Y 5G0RB 3CERA 1YBUA 1YF5L 1ZM4A 2X1BA 4FW2A 3F2CA 1T6DA 3HFKA 3P4IA 3L5KA 3MTJA 4HDHA 1NGEA 1N48A 2WCXA 5LXYA 2YQ1A 3OTEA 2O67A 5K20B 4R63A 3IG1B 2EWHA 4C11A 2UUAJ 1RU2A 1WNSA 4GO7X 4LSLB 1TKXB 3CEDA 3DRRB 4FZXC 4BRIA 2QWQA 4KBOA 4KLMA 1LOTB 1RTHB 3UR3C 5I3UB 1WDDA 4IEIA 3OFGA 3JPSA 2HSTA 2ZTDA 4DV0J 3EWGA 5C25A 3I8BA 1RXVA 3OS1A 1H0HB 1B9DA 2FUG9 1KQFB 2A2DA 2RRBA 4DUYF 5J2KA 4KO0B 5KFSA 5AQPA 3U9DA 2ZIXA 5KFXA 5AQIA 7ICMA 2F8EX 1MU2B 1MLAA 4E7JA 3IWXA 4P0PA 1XMQK 2LDYA 3DRSB 2H9ZA 4FWOA 2CJBA 5ALYA 4DR4K 5C2CA 1Z25A 1YT3A 1RZTA 5T7LA 1D8BA 2BJ3A 4LSNA 2GFFA 3I9ZA 3UQSA 2W04A 2H3EB 2G8WA 2R7XA 3KOOA 5AKEA 3EJMA 2JSXA 2OEKA 3THXA 1P8ZA 1QM9A 4BDPA 3LDAA 3MMCB 4LF8K 1QE1B 1KNZA 2KHVA 1JXEA 3NTUA 1N5QA 5E5NA 2W9AA 4F50A 3GFYA 5AQZA 4B1XB 4WFYA 1T8EA 2PAVA 1ZQPA 1GXLA 1RT5B 2LLZA 1IWAA 2GC8A 1FNXH 3LGHA 2YHBA 4WFBQ 5M1PA 5EU7A 3HT3A 2WONA 1LW2B 4QZVB 3V9UA 3TZWA 2OD6A 3CRXA 1GNKA 3CCUS 3MUVP 2VFTA 1S6QB 2E4LA 2B4UA 2X6NA 3UD3P 1RADB 1BPBA 3US5A 4CJWA 1VFJA 4W92B 3DFEA 3HI9A 4Z4IA 1UHUA 4MJKA 4A48A 5LXRA 3OYFA 1BMQB 4GV9A 4CF4A 2BRKA 1N2XA 2AJQA 4LF7F 1WTFA 5KT3A 1TKDA 1BWVA 8ICIA 1Z6RA 5HVHA 3AJ1A 2B9EA 8ICFA 5GADP 5F8LA 2MGZA 4U96A 1LW0B 4KY3A 3HRGA 5MAOA 2XO6A 4S0MA 4IJNA 2RDJA 5HI7A 2EG2A 2CPJA 2E1AA 1ZQHA 4Q8FA 3G6EN 2C3UA 1VQPN 1LVHA 1TV6B 5E3AA 3AOAA 1V5VA 3CIPA 3W2VB 2UU9J 4DG1A 4IFVA 2PFQA 2BE7D 4F7VA 3CD0A 2KJ5A 2VASA 4UY85 4J91A 4DR3F 3PSFA 2IRXA 1N60A 1JLGA 4WE1A 4WFAQ 4Y2VA 1J5EK 3CM6A 1K47A 1KWMA 5KPTA 9ICHA 5EVZA 1IBKF 4L3NA 4DPTA 2IMWP 1ULRA 5C7PA 5C2DA 4WJ3B 1AYEA 4JI1J 2C22A 5KFIA 5C2FA 4F4XA 2HZVA 1M5SA 3CQXA 2V8DA 4CLTA 3QT8A 2BPGA 4W98A 3UDEA 2DNKA 3M4XA 1Z4NA 3JPTA 3M6KA 1KFTA 2OPSB 3R3LA 2VQFK 2BZFA 3IR7B 1R59O 4FLWA 1QD1A 4AE5A 4FVMA 3M9OB 4X62F 5KFJA 5J2HA 4FVUA 4FZYA 2FSNA 3THYA 2MRLA 2PDAA 2FZKB 4UBBA 1RGIA 3B8HA 1U1PA 3BQ1A 3HHKA 1I6JA 4WP8A 1FK9B 4MIWA 5DDMA 4MHVA 4PABA 3TADC 2AIRB 1VBYA 5KAFU 1VQ6S 4BHQA 1NJIT 2VIHA 3QU5A 4YR2A 2I2YA 4JI5K 3OPXA 3J8AA 3JSBA 3N01A 3PUFA 3MHYA 3CNQP 3CO0P 1QAXA 4WTYA 4YOEA 3OD2A 3WC2A 3H2LA 3AQOA 3MMJA 3B6PA 2O8DB 2P1JA 5DBAA 1VDHA 1N32K 1NNDA 1ED1A 1N61A 2E5SA 4A2BA 2VZ9A 1BQMB 3RRGA 4P52A 1OH8A 4ETXA 1FXXA 2H51B 4O3NA 5AI9A 3NH2A 1JLAB 3NVWA 5KOWA 2RLTA 1W7AA 2NXJA 4NMXA 4CBWA 2RU3A 2BVZA 4ERDA 3ZT1A 4TLRA 2HWIA 3O3HA 4OJ1A 4N8NA 4QZHA 2CH6A 2F4FA 3A1YG 4X4SA 4CJ3A 2DNGA 2RPIA 1SCJB 5J2QB 2Y1LB 2FJXA 3M6XA 3PIPQ 4MEYA 2VPZB 3IGNA 4Q0BA 4M6WA 3CF5Q 4Z6FA 3PEHA 2DITA 3W8GA 2J4RA 3D7EO 1Y5NB 1DXSA 4ECRA 3L2RA 4N56A 1BQNA 2XMVA 3V4IA 1VAZA 3KTQA 3LL3A 4A8WA 5C5JA 1GLDG 2M3DA 4JHDA 1XNSA 3KVGA 4B9QA 2VJVA 1N0UA 1Q5VA 3ZSWA 2M2BA 4Q7AA 2ZHOA 3IV6A 2ZH1A 3EDRB 2IM0A 3AGRA 3TQ1A 4PXEA 3ULEB 4ANDA 5CABA 2GOLA 4RW7A 2CPHA 4DJBA 1VI7A 4BGDA 3KYLA 5DDYA 1RE1B 1X9JA 4WU2A 4UBCA 1WBBA 4RNFA 1LWFB 4BQLA 2PMHA 1KVBA 1MWZA 4PQUB 2W9BB 3HMJG 5KNIA 4ID5B 2ZIUB 3V4MA 1EB0A 1ZQYA 2E7XA 2BX6A 3N7PD 4YEAA 1JWWA 3SJHA 1XS9D 2HGNA 1KBRA 2GMLA 4YB5A 4KAIA 1OVQA 1SV0C 3EXCX 3CD6S 2OZSA 4UASA 3V9XA 1YK9A 3TX0A 4HCBA 3VETA 2VPYB 5LMUJ 3SCJE 3ZZRA 2V9WA 1RTDB 4K43A 5CR0A 3DDHA 4DS4A 1QQ6A 4DV2K 4M3XA 5J0SA 4WTOB 4ZVOB 2MYFA 3R1LA 4F92B 4YR3A 1EIYB 2H3VA 4AM6A 5AQQA 1VQ5S 5BXIA 2KJWA 5M1OA 3R7NB 4RWXA 1TL1A 4A47A 1FIQA 3HCXA 3AM9A 7ICGA 4HWIA 4DLEA 1WSFA 3AVIA 3QEWA 3I5BA 3QO9B 2OJ3A 2ILYA 3F2BA 2LXFA 2ES6A 1HI0P 1ZETA 5L9XA 5EE0A 1BWFO 3PV8A 4I2QA 2Q31A 3HHLB 1NSPA 4ECQA 1WSGA 2MLYA 1J2NA 1FWLA 2YXLA 1L3SA 1NGFA 2ZF5O 2HYIB 5AKLA 2VBYA 1IV0A 4RW6B 3VF0B 2N7YA 2ZIVA 1JRPA 1P1LA 2L5YA 4KX3A 1PC5A 3KLEA 4FPIA 5EY4A 3TUJC 3QWUA 1UETA 2EAPA 1H72C 4B3TF 1DZ5A 2MHEA 4I2BA 1TKTB 1U8SA 4QZ9A 4GW6A 1SL2A 1HBMB 4A8MP 2CPRA 4YOWA 2VBXA 1VSKA 2FB0A 1MQ2A 1N6QA 2BA9A 3P38A 4NLQA 5ALHA 3H90A 1CJKB 3VPZA 3UVJA 2OPQB 1B0VA 4F36A 4KHRA 4NWBA 3FJ2A 4RT2A 1VQ7S 4I68A 1X66A 4F04B 4MK7A 2CKWA 4IO8A 4LBPA 2JLFA 1R89A 3HLUA 3BPDA 1C0FA 4CH0S 3VA3A 5ALUA 3ALYA 4IG3A 3OR1A 2PFNA 1MROB 2R3VA 2ACYA 1MN9A 2GS8A 1X60A 5A76A 2R2RA 1Y5IB 4NI2B 1VISA 4QBUA 3KLGA 1KN5A 4M3YA 4C2MA 1S7IA 2ROGA 4CGHA 4PL8A 1C0GA 2VANA 2FGCA 2OTLS 1H3DA 1KDNA 4IQXA 5GADI 3MM6A 5KFNA 2KSOA 2WK4A 4P4OA 3KWIA 3EPGA 1LXJA 2WOMB 2G5HB 2BQRA 4OX9K 2W1BA 2EX3A 1WEYA 2G4BA 4GKJF 1HNZJ 3ILIA 1R0AB 3HO1A 3AO1A 2ZEJA 4Y2AA 4F4WA 4A8XA 4DPXA 4JV5F 5D77A 5F8MA 3V72A 3DRPA 3MM5B 4CJ7A 5E2QA 2YWHA 2PYLA 5FDLA 2ALZA 2ZWOA 4PZNA 1WELA 4L8RB 4F4YA 2GAHC 5ETVA 4NV0A 5FLXO 1HUOA 1ZJMA 4C80A 1LOUA 1X5OA 3ZZ0A 3CCWA 4R79A 3QB0A 5A8KB 3L3CA 1C4AA 3PFOA 4IR1A 3VQ7A 3LM9A 5AIBA 4YG2A 1JXBA 2EZZA 2I1QA 3TZZA 3GQCA 1UOCA 3AQPA 1JQGA 2BHNA 4YFUA 1NNEA 4M45A 2NQPA 2YX8A 3R8YA 4CW7B 3DLLQ 2BJEA 4ZVHA 2RT3A 2ASYA 4BXOB 2RKIA 3J81O 2KYZA 4CT9A 5AQNA 3C2MA 2DYAA 4IH7A 5F2RA 4DOBA 1H74A 5DG7A 3WQPA 4ZPTR 5I4MA 2VG5A 3RJKA 3C28A 3K59A 5IWAK 1KDHA 4QWEA 3DGPB 3F9KA 1J54A 4NCAA 4GFJA 1F2HA 4FBTA 4OJGA 4WFNQ 1L7MA 2V9KA 2QB0B 5KAIU 2JWNA 3W3SA 3MM8B 2Z1HA 3CB4A 1IR1A 1XEZA 1RT3B 1ZM2A 2VICA 2A10A 2P6UA 5K14B 5IM0A 1UCVA 3RWUA 3V7LA 2D3DA 2EAMA 4ER8A 4KMOB 5GTIU 5BREA 4FPRA 1ZQTA 3WX4A 3H8SA 2KMDA 4J9MA 3BSOA 4I1TA 3CJAA 4ED0A 5GAEU 2DKXA 2HS0A 4J37A 5J29A 4BRQA 3WUHA 1G15A 1DARA 1VMBA 4TU7A 2Z1JA 5KFTA 2O8FA 5F8NA 3BH7B 4OYWA 4DV3J 4ITSA 4P0QB 2DH8A 2ZNZA 5LJ5Y 4QOTA 4GVLA 1T95A 3EE3A 1JJCB 5BN8A 3AO2A 3ILJA 1FESA 5KFDA 3E01B 2MKHA 4QYRA 2HQFA 3PHEA 3NNCA 3D2NA 2ZIWB 2CGKA 3VEWA 2F44A 4H4KA 4IOCQ 4DL4A 1E6VB 2MLZA 2D0AA 3JQMA 2L9WA 2VJ5A 3VN5A 3EUB2 2IBKA 2ZOFA 3WXKA 3GZ7A 3OYIA 3ICLA 4ZN3A 4IO9Q 4QQBA 3ZNJ1 1NH7A 1RDDA 5IQ6A 4PWDA 2KIWA 4H5TA 1JKHA 5AHXA 1XR7A 1U09A 3VQTA 5IV3A 1HEKA 4B3OB 4O8KA 3EY1A 3S3NA 1YJUA 3M6ZA 2C3MA 2NO4A 4DSIA 2FGOA 3ETMA 3KMQA 3KOAA 2HVDA 4E2FB 5A2QY 4GKKK 4F72A 2ZJ5A 3UR0A 4K41A 5DMRA 3QSYB 3VGVA 4JI0J 3SMPA 3PO4A 3UKUB 5CHIA 2ZGZA 1XNQJ 4IRDA 4K7QA 1F5CA 4CHQA 5H1SV 3BZQA 4NLXA 3U8XA 4H4OB 1FJGK 4ISEA 2AWZA 4PG8A 3T1HJ 3CI5A 4KIAA 3CUNA 3G71S 3MX5A 2HGMA 2CZ9A 1U4BA 3HKWA 2PKEA 2J0SD 1F3VA 1UT8A 5I3PA 2POKA 3TZXA 2BEFA 3PRDA 1SJ3P 2B5JB 2CQGA 4DEZA 2BJ7A 4Q2MA 2EW9A 2EKNA 1J53A 1MA7A 2RMLA 1NCLA 9ICMA 4CM2A 3AA3A 4LRDA 1NXIA 4OD0A 4XIUA 1ZBHA 2AQ0A 3CPWM 3PZPA 1HHQA 5ALXA 2OIHA 2ZJQQ 5ETSA 2K8CB 1ZQCA 4DPUA 3Q8VA 5CA7A 3CP8A 3PIPL 3M5RA 5HMXA 3CF5L 2CQ1A 4JI7J 4H5RA 4WCEL 1RT1B 4JKDA 2F2AB 1T9XA 4CTAB 5CE3A 5HP4A 2ZUAA 2HZAA 4DFMA 4FBUA 4IZ9A 1U2VA 4O3OA 4W5TA 4OZJA 2WHOA 4CIFA 3MR7A 4TY8B 4OJ5A 1Q46A 3SBMA 3UN3A 3SJJA 1UVJA 3SPZA 4U67Q 3CJ1A 2NSBA 4Z4HA 5AQJA 3O3FA 3HF5A 3LGNA 2F3JA 1YVFA 1OY9A 1MSWD 2HS3A 3DOMB 3MM9B 2FBVA 4O0NA 4KHSA 5AKZA 3BS5B 1M5HA 3M2VA 3GG0A 4NEZA 3KLFA 4FXDA 2A1JB 1TK0A 1ZQDA 1Q8KA 2LQ8A 3MEDB 4RWWA 4IKFA 5AK5A 3BO4A 4PPXA 2OAUA 1SQFA 3R6MA 5FPEA 5H9FJ 1W97L 1B9FA 1SJRA 4TN2A 3LO3A 1DRGA 4M47A 5I9EB 4OKKA 2W9CA 3T1YF 4K8RA 3UMGA 2MY7A 4ALZA 4RPXA 1Q8IA 2ADBA 1GLEG 3QIOA 4K4UA 2ZBCA 4ZJLA 1VQ9N 1U48A 5AE2A 1U45A 1GMWD 1S5LU 1NEEA 3GJSB 1NGCA 2G0JA 2UXCJ 1FI4A 4ED3A 4NXMK 1CXUA 2U2FA 2MKSA 1HFEL 2Z2MA 4USWA 3O9SA 2R7VA 2WAQF 1RT4B 1RJJA 3HILA 3UXPA 4CHZA 3V6JA 3HI0A 4OI4A 4XAKA 2KVIA 1W2BM 3GBTA 4YOVA 5D46A 3N5FA 1KQSM 3IDWA 4LF9J 1R7IA 3CJ5A 4DV7J 4H03B 3OVNA 1FXRA 2G8HA 1N34K 1XMOK 3POTB 4OHWA 3DXKA 4EBDA 4NX9A 4M1KA 5BRFA 1RHUB 4FXVA 2XRIA 3CJCA 4NLVA 3MABA 2GQQA 4LF6F 1TUWA 2P9SB 2YKOA 3FK4A 4KLSA 3W5ZA 4BLGA 4NZ7A 4OYBA 2KV2A 3PW4A 4I2GA 4OJRA 4MKYA 2I7PA 5J0OA 1KHWA 3ENAA 4K8XA 4Q8EA 1S5ZA 4ED5A 1ZBLA 3HSJA 4KH4A 2PI4A 3VQPA 4J2DA 1LAVA 3V2UC 2ZQBA 4NLUA 4ID1A 2MZTA 3MWBA 4W5QA 2IJFA 3GU3A 1I94J 4CZMA 4DV5K 3DXBA 2LMIA 2XIDA 1JCFA 2V8PA 1XERA 3PYEA 3QRQA 3IRUA 2FHOB 1S1WB 4ZHRA 5LT5A 2HOFA 2QA4N 2XC9A 4YS2A 3BV8A 5AZJA 1AFJA 3A5MC 1UFKA 2LI6A 2BM1A 2Z58B 4TSXA 2BABA 2GWJA 2NV3A 2GWKA 3PJWA 3JAMO 5AXNA 3KIOA 4QU7A 1QSYA 2AYGA 1T9TA 5J0WA 5T7LB 3CJBA 4LSNB 2ZH9A 1U24A 4FJMA 2FC8A 2V2VA 1YJNN 4DTJA 1SUQB 4CK1A 3TAEA 1FEHA 2CNOB 2VFVA 2DFHA 1DBDA 4CT8A 1C0UB 3D5MA 1DOQA 2NYVA 1S1UA 2QWOA 2ZXIA 1N0VC 3H8JA 2XYHB 1IV8A 1LB2B 3SIPB 1U9LA 4AQYF 1NGJA 2OTJN 3QT7A 4IS7A 1PK1A 7ICPA 2UVUA 2NZ4A 3D9BA 3GL1A 2PFPA 5K8OA 2ZBRA 3JXOA 5ALMA 3RBDA 2R2UA 1N4LA 2QGFB 1V3RA 4C0OC 3DM2B 4JKCA 3WKBA 2W2MP 1BLUA 4K8ZA 3BYPA 1CLFA 4YOYA 4ZJQA 1XC3A 3AO4A 4DSLA 3QE9Y 1NGDA 2GVDB 2AYBA 3CMQA 5KAKA 3RB0A 4FOEA 4QZEA 2M4MA 2RN2A 1YTUA 2J0XA 8ICJA 2BANA 2GQCA 2Y8YA 2K4PA 2Y0SD 3ISND 2J8SA 4LF1A 5FD1A 4J9LA 4LF4F 1JLCA 4JI4J 4C4SA 3HFZB 2LXUA 3H5XA 2EC2A 2XY7A 2HQCA 4YY3J 5LL6d 2X51A 1Z19A 3QJJA 2UVVA 2Q1NA 3DOLB 4URSA 2MJUA 3CJ0A 5EWGA 1I51B 3O1BA 3AA2A 4MDAA 2CPZA 2GJ2A 2MLXA 1ATSA 4LQ3A 3PR4A 3WNEA 4ECXA 1VR6A 3DLLL 1RQ0A 1X9SA 1RHQB 3KNGA 1B99A 3NGZA 5D3GB 5MLCV 2H5XA 2RF2B 1NOZA 4K4XA 3IN5A 3PMNA 3I0RA 4USJC 3L09A 1IN0A 3QBWA 3SMZA 4QZ8A 4E1MA 1F44A 1KKXA 2V2ZA 2B9XA 2LKZA 2FDNA 4IFEA 2DGZA 2I0XA 5IIIA 4DR5F 2KLAA 3TEHB 1X3MA 3NY0A 4X4UA 2W2OP 3A5LC 2IAJA 1BNOA 4O3QA 2PA3A 1O03A 1FO1A 3L4PA 4Q2LA 2FLPA 2HHPA 3VERA 1EWRA 1KAXA 1Q3VA 2BRLA 4RBVA 3F2DA 1F9FA 3UE2A 4AHVA 4F71A 4ECSA 2BJDA 1TZ0A 2MTLA 2F9WA 4BC2A 5HROA 3NFAA 3JSYA 3N97B 3QBCA 4W5RA 1IKVA 3LWMA 3C23A 4ZVFA 4NB4A 3Q8YA 3QWPA 2V52B 1HL6A 1VCTA 2MEWA 3SI6A 4OYPA 1JLBA 4J7CA 3KJVB 3NXZA 3D6TB 2P5GA 1KN6A 2XSJB 1U26A 4KGXB 3VEOA 4F3OA 1MWMA 1PK3A 1MA9B 3T19A 2W3RA 3QGHA 2J7UA 2LDIA 4E19A 4KLOA 3I9V9 3NCPA 1ZQQA 4H5NA 1Y10A 3RJJA 1IBMK 1LCUA 1FRHA 3U02A 1Q0NA 1RYRA 1BO5O 3DU5A 4JI6J 1S49A 1HWJA 2YNGA 1YITS 4UY8O 1CZBA 3SENA 4IO9L 3H8YA 3MX2A 2BDPA 4L76A 2C28A 3FZKA 5JS1A 3FSIA 1WBDA 5DDOC 2FTRA 3I6PA 2I7NA 2FVPA 4DV1F 3UPQA 4QOZB 2ZH4A 4W5OA 3P83D 1QDUB 4FF2A 3M6GA 1IKWB 5A0LA 4JI2K 1KCFA 1MN8A 1Z2LA 3P49B 4B9MA 4KPCA 4DV0K 3T5LA 3NHGA 1G1XA 4A5AA 4M3UA 4YR0A 1AXQA 2G2ZA 4HTLA 2RD5C 2QARA 3BREA 3PJXA 2HHQA 1VRQC 2CVIA 3VEVA 4AUKA 2XI2A 1DTTA 3GG1A 2AH5A 4R8UA 2Q1LA 1ZQMA 4JUZA 1ATNA 1U49A 2IYIA 3G8SA 2CWKA 5C42B 5AXKA 2N7CA 3ZYYX 4CEZA 4NYPA 2UXDJ 4TUSA 3M9MB 4ZVGA 4BE1A 4OI1A 3LVWA 4A8SA 2EANA 3HZ6A 1HNVA 2JDJA 1KLMA 3GFHA 2G8IA 4H54A 2JXJA 1KL9A 4DU7A 3G82A 2M8DB 4B1VA 2OPPB 1P6TA 2X6SA 4JYAK 2P35A 4CCHA 1DTQA 3JTOA 3FFKB 5J2BA 9ICVA 2ZC3A 2HNZA 4CJSA 2NXEA 2YMQA 4FWKA 2Y1IA 5J0QA 1T3QA 2GBZA 4JLHA 2QA2A 1SKUB 3T41A 1VIXA 2DQNB 3OSNA 3WNHA 1HNWF 3VQCA 3S1TA 3DLRA 3E9LA 4QNLA 5EXWA 4Z4CA 5LSRA 4RW7B 2Y0SF 4I2PB 2W4PA 4V19X 3BQ7A 9RUBA 1HYZA 2ZTCA 2CPDA 3ZZOA 1MMNA 4M41A 2VWJA 3Q7BA 3TW0A 4GXKA 4X4NA 4CNZA 2Q0RA 3BBCA 2YNIB 3D2EB 1LKYA 1U0HA 2D3ZA 4OZ5A 2AX0A 1REVB 5F8IA 2DR6A 4F3TA 2CYYA 4MT1A 2R42A 3FCWA 1YZ7A 3OTOJ 3BGOP 3LW5C 1EXQA 3IR5B 5AKGA 1N56A 4YFKA 3FQLA 3QERA 3SZ2A 1Y7PA 2WSEC 3OYMA 3H5SA 3I4HX 3M3ZA 1IBLF 3G6ES 8ICKA 1HW8A 2BZ2A 2UU9K 2ATQA 3V1OA 4BG8A 1JB0C 2LU2A 4URQU 3NNHA 2ZFHA 1CJVA 4OLOA 4DL2A 3QYPA 4LFAF 4FWLA 4KLIA 4KLHA 1RA7A 4M9NA 3OVAA 5BOLA 3CCVS 1TK8A 1Q81O 2QA1A 5C24B 4G65A 3K5NA 8ICBA 1FRIA 2X1AA 4EFHA 3WKCA 3MDCA 1WDTA 4DR2F 4JD2A 1V3SA 2HBJA 3K5PA 4B3SJ 1QVGM 3VENA 3WIUA 2ADCA 1Y88A 2DNOA 4MFBA 4NLBA 3O1LA 2YKNB 3F44A 2UXBK 3OYLA 1QTNB 1VQMN 3O1WA 4G9ZA 1W9HA 1FVSA 4OZLA 3CFOA 7ICIA 2MUTB 4A8FA 1ZJNA 3D1OA 1RLCL 2XMMA 3IDHA 2Y0SC 1UPPA 3ET6B 3ISNC 3D3CJ 3NAIA 1DURA 2BJ9A 2N82B 2XHWA 3KKAA 5KT2A 4ZN1A 3F5AA 5EX5A 4ICLB 5DM7L 3SUPA 2YQ0A 5IC6B 4YOTA 4MYTA 1KR4A 1HI1A 5AK4A 3M1YA 3IM9A 2FHJA 4FL9A 5KFKA 1M5VC 1VRTA 4CDIA 3OYCA 4ZLJA 4H0XB 1N54B 2VOPA 2AJ2A 2LA6A 1YRUA 4DQIA 2UYTA 2M70A 3QRPA 4U95A 3KKRA 4CEAA 4ENOA 3ZSZA 3HKZD 1XUPO 5IT9U 3FZLA 4PXBA 4W90B 3ZTRA 5ETMA 1ZQZA 1PJ7A 2HFVA 1LWEA 1X5PA 1SKSA 3FVYA 2Y1RI 2VJUA 1RBRA 3KK2A 3OR1B 1QJHA 2MZSA 3OQ2A 4CO1A 5L9NA 5J0UA 2O01C 4HH1A 2HVIA 2KT5A 3VOVA 5FLXY 3RJGA 3G4SS 1HR0J 3WQTA 4B8AB 3UKRB 2LVWA 1I3AA 3MM7A 3KNAA 2ZZMA 2E9TA 2KSOB 9ICXA 4ZJOA 4KHMA 8ICRA 3QLHA 3SYZA 2EEYA 1N33J 2KFYA 3THWB 2NRVA 1ZAVA 2WFAA 4CLPA 3E9OA 2A41A 5IILA 3RH5A 2HPUA 3E58A 3DRPB 2B56A 1GLFO 2KD1A 1FFWB 1Q81T 4QIWF 4CDGA 4NL9A 2PEBA 5HVFA 2DPIA 3L9ZA 5FDLB 1RFQA 4ZLPA 3DJCA 2XB2D 4WYBA 4IOAL 4CFDA 3J7A1 1FWPA 3J81Y 3WXIA 2F9JA 3ORYA 3DHWC 2ZUCA 3FKBA 1YJ9N 4OKJA 3DDKA 4ECZA 4X65F 3K5LA 3S9HA 1ZBTA 1TGOA 1TK5A 3IS9B 5AKJA 3TTDA 3WK9A 2FLNA 4XK8C 1T94A 1VQLS 3A3PB 3LK9A 2DEIA 3ITHB 1TL7B 2QL5B 3NLCA 2C42A 3N28A 1HX1A 4WBFA 3GP9A 4DR4J 1PYOB 2C2KB 3LOUA 3TVZA 4FCYA 4CNYA 3I31A 1UEKA 1YJ7A 2J6TA 3VAHA 3ZEUA 2ZC4A 2G8FA 3NE6A 2MKJA 4N8OA 3OS0A 4ED4A 2K8BB 4I6MB 2KZ3A 1V97A 1VHXA 4HDGA 2RQ5A 3IRXB 4LF8J 2DK2A 1NSQA 4TYBA 4DSJA 1WTBA 4JEPA 3MR2A 2DNZA 3WK7A 4C8LA 1DEJA 3CG7A 4B1WB 1M5PC 4OV1A 3E66A 2JZBA 3P5TL 2HMIB 5HMLA 4CIEA 1IKXA 4CEDA 1U02A 3QSIA 3JSMB 1RBTA 3SDEA 2QWMA 3M32B 4QU6A 1L8OA 4DUZF 3E2EA 2XY8A 1BU6O 4CEEA 3CDBA 4D3HA 3ZX2A 3ETLA 1NMNA 4DWIA 4BS2A 3NOGA 2VKRA 3JTPA 4ZP8A 5I42A 4X84A 2K7KA 5CAAA 4FKYA 3L95X 3LANA 4J9PA 2EQYA 1T3VA 2LEBA 3UXNA 3D0IE 8RUCA 2PT0A 2MA1A 3KJFB 1B0XA 4F4ZA 3ISBA 3Q8QB 4DUYJ 5DGBA 4KBIA 1WLJA 4U7UK 1FFSB 5F9LA 2PMZD 2EBEA 4RUBA 2YH0A 2ZUDA 4RNOA 2VH7A 2HHTA 1PGZA 2G0IA 7ICTA 5A8WB 3TO8A 1S22A 1KBUA 2XS5A 4F26A 3TWZA 3PNIA 2CPFA 3MR3A 3NOCA 4DZDA 1S72S 1FD8A 5CA5A 1TMMA 4KHPK 2Q3PA 3CCJN 1GMUA 4AD6A 2OSRA 1RTIA 1VBKA 4CLYA 1GMVA 5J2PB 3QGIA 4DCJB 3TJAA 1IVZA 5J1NA 2VC1A 4CECA 5HRPA 2K2PA 2HOIA 2PFUA 5HANA 4KB0A 3AVGA 1TUGB 1OPIA 3AVFA 4YP3A 3P96A 1VK3A 3C94A 4RUHA 5ALWA 1RAFB 1ZAXA 2V51B 4K5RA 1PG5B 2ZKUA 2R8HA 5AQKA 5L8RC 1I5OB 3EZUA 4L72B 3PW0A 1K8AO 3W61A 1JX4A 3U9ZA 4CZFA 3HKZF 2WTFA 3DLEA 3QICA 3TAMB 3F5EA 1N5VA 1JNZB 3AY0A 1X9XA 2JJ4D 3DDNA 5THWA 1BI4A 2VQFJ 1EKSA 2IBOA 1KQSR 5ITHA 1T11A 1Q18A 4MIBA 3UN2A 5ADXH 3F41A 3VTIA 2XCAA 3W9JA 2OO4A 4DQQA 1HBNB 1OYEA 1CVJA 2VJ4A 1LWXA 4JOUA 4FPAA 2GELA 1J97A 2RHFA 5F8GA 3ZZYA 1RM6C 2LMRA 1BE4A 1BNPA 4OJLA 4RNMA 3V6HA 4OX8A 3UXOA 3NBPB 1SVDA 2RVJA 4OHYA 2VWKA 2QFJA 2G0CA 1UJ5A 5KG3A 1V4SA 1UVNA 4M3WA 1AB8A 3UNYA 1M1KO 3BGLA 3QIPA 4MO4A 5EWFA 1DLOB 5LMNF 2YH1A 4FLTA 1SPBP 3IG5A 2HBLA 2UUBF 3BP8A 4DR3J 3BDPA 4C97A 3DXMA 1ZBIA 1XIQA 2K4HA 1OQ6A 1N32J 1B7YB 3GE1A 3LA0A 2E8PA 3SCLE 1ZQOA 2KKZA 2B6AB 2MZRA 3CC7N 1GAOA 4I29A 2I6XA 4PGYA 3CJ4A 4A8EA 4CJFA 3H0PA 3CCRN 1U1NA 3WDOA 1W2IA 1OSDA 1IBKJ 4DQPA 3Q8RB 1GLJO 3TUPA 4RU2A 3OW2R 4B08A 3HKZC 5CYMB 3I87A 4EK2A 1YJTA 2I6WA 1JLFA 4A8OA 1J27A 2ZH6A 2C2DA 4Y2IA 1CQMA 3I0SA 4EMDA 3OBWA 1VQYA 5IINA 4MH8A 4PWWA 3G8QA 4P75A 3VALA 3H45C 4B3MK 3I8DA 3ETRA 3SUNA 1FKAF 1QZ5A 2HK2A 3PW7A 5ALFA 2R2SA 5KT5A 3ENHA 2FDRA 3IM1A 2VF3A 1OKJA 5LSOA 2NSCA 3IHQB 3HVTA 4AXIA 2CRLA 1JL2A 4FWMA 2CN1A 5L1IA 2G9OA 2KOBA 1RAEB 3A8YA 3ZZUA 4DKWA 3NDKA 4Z6DA 4DCPB 4ZPCA 1BPZA 3UQ2A 4UAWA 1NKCA 3C7NA 2PEHA 3EE8A 2JH7A 5C10A 4C8YA 3QGGA 2PMZF 3B6BA 9ATCB 1K44A 4EZ6A 4ZCIA 3SUOA 1K5OA 3IBWA 1NOYA 2M0GB 3C5FA 2R18A 2JOQA 3BDEA 4CZCA 1RG6A 1HNIA 4QS7A 4N76A 4B02A 3AA4A 1BL3A 2EDUA 1PVPA 1FRLA 3DXKB 1NHVA 2FQQB 2XMUA 2NLWA 4LUBA 4BBYA 2KDOA 8ICPA 2E7WA 5KFVA 2CQCA 4DV3K 4PAAA 1CQNA 2BXJA 1CG2A 2L08A 2LEPA 4O44B 2DGTA 5AQYA 2KK0A 5BR8F 3N6LA 3JAMY 3QETA 2BTFA 1HIYA 2DIUA 1Z1VA 4DMZA 2OPRA 5D4BA 3EZWA 3MN7A 4MQ3A 2QL7B 4A8QA 4CEFA 2DPNA 4KGVB 3QDKA 1CZAN 3MECA 1S1TB 4NLDA 3EZOA 2KRRA 1E6YB 2BBEA 4CBUA 2DFLA 1DKGD 4LH4A 3TSUA 3OV7A 4ILHA 4ZHRB 1S6PB 2XNRA 4X64F 2HF4A 4RQ7A 2HZCA 5E26A 5AZJB 5KFMA 3GV8B 1CJUB 2N4DA 4BROA 1A5XA 1PKUA 1CXQA 1J5OB 8ICMA 3FQKA 4PXDA 4KC5A 2JVOA 4FYYB 4QS8A 1Q4RA 3CIMA 9ICLA 4JI0K 3N4WA 1NSKL 1I1GA 1XNQK 2IS3A 1SQKA 2P9UA 1IM6A 2NUHA 3KLVA 1MMLA 2PMZC 2LQBA 2ZH8A 4CD1A 2DNLA 2DJWA 2YBVA 3QFUA 2KH9A 4OHXA 4E98A 3QZ7A 2CH5A 3KFUF 3KDOA 4K0KF 2HNDB 1F9HA 4TQRA 2NUBA 4DSEA 1PK1B 3JQKA 4EUVA 1NU4A 8AT1B 3WEEB 1RBUA 1RWUA 5AKYA 2I9GA 4Z4EA 3EX7B 3PO5A 3JSRA 4K4HA 3NF7A 5H9EJ 1AROP 2ZOMA 4R0JA 3F9MA 2D7SA 3Q8LA 2EXUA 1U1RA 3GONA 4O8UA 4HTIA 4YHHF 4BR9A 4ED7A 3NAHA 4B3RF 3IBPA 9ICBA 5J2DA 2DGOA 3CSKA 2MKCA 3MUMP 1VRUA 4QIVA 1CULA 3OFEA 5EX0A 3T6JA 5ALNA 3ZSRA 1T6CA 4FWPA 2WC9A 4P6QA 2DFEA 2G2YA 4F02A 3M8QB 2P6TA 1UEVA 3IFRA 5BYQA 3DYAA 2F3NA 4I2EA 4RQ8A 4FO6A 4NLGA 2W42A 4BRMA 2O8BB 5DB9A 1D1UA 4OX9J 3ZTPA 3L3VA 4PYAA 1RT2A 3LP2A 3QMLA 3DLJA 4EO8A 3IWNC 3R5GA 2FSKA 3UW1A 3DRYA 4PKDB 4HHTA 1N5YA 1RAHB 4ICAA 3NH1A 5DQGA 3W0LA 3WT0A 4WU3A 2FY1A 2RUGA 4OYAA 1UTAA 2YVSA 1RP5A 1EKRA 3U1LA 4RQ6A 1S48A 3VGMA 5D8HB 1NK6A 4F2RA 4EI2A 4ILJA 4UARA 2PMWA 5E33A 2X7IA 3DLKA 2E5LF 2DGXA 6FD1A 5KTQA 1FX4A 5LJWA 4PL2A 2KFNA 3D4JA 1ZD3A 4UB3A 4OZ0A 1BQXA 4DR1F 3BUZB 3K5OA 2G8VA 1R31A 2IAJB 4F9OA 5U47A 4JKAA 4DR6F 3M8PB 3I96A 3DLGB 1W7WA 3C6HA 5ALRA 5ADZA 1RDUA 2LQ9A 4WYLA 3P1GA 2JRSA 4KHUA 2A1RA 5JVHQ 4UW2A 1VYAA 4CI6A 2BYCA 2K4IA 1T9YA 3FSYA 1VQ9S 3MOJB 3TQEA 2GWSA 1IG9A 3TEGA 2UXCK 4TVAB 1JROA 1OWXA 1X4GA 5DQHA 2E7VA 3TYTA 3LAMA 7ICOA 2ZZNA 2E1MC 3BJYA 2ZM6F 3O6QA 1NGIA 2YY3A 3WBZA 1HBUB 4LZDA 5CJ7A 2K3IA 1BIUA 5IWAJ 1TELA 4A59A 4NZ0A 4Y1CA 1YRTA 1RT6B 5KT4A 4U7BA 4FJ9A 1SXEA 4Y2XA 1ESVA 2CJ9A 4BR5A 1NPKA 2ZOGA 4LF9K 4DX6A 4DCCA 4ECWA 2P9PB 1A5WA 4Q45A 4H5WA 2GGPA 3TKAA 2AJ4A 3R97A 2KFZA 4GKJJ 3CJKB 4LC9B 2FJEB 3CCSS 2DBYA 2Q79A 5TKYA 4OZ1A 1RYSA 3AAPA 3PSPA 2YY6A 2VONA 3NGYA 3TZYA 4FN5A 4A8YA 4MFAA 2RNEA 2F4VF 3V7JA 2W24A 9ICWA 4M9GA 3CJ8A 1NK7A 1FDNA 4MFCA 2H1YA 2YKQA 3N0VA 3ZC4A 2XSFA 4ILLA 3R2CJ 5T41A 4M5DB 1F1BB 4L75A 1H6KX 4IR9A 4PKIA 4KH0B 3MCMA 2RQMA 2CQ4A 3ZXWA 1GXTA 2F1JA 4RUAA 2HBQB 4AILC 1DGSA 4J9RA 4LF5K 4NXNK 2YX1A 2UUAF 2WW8A 2GTDA 2W43A 2HHHF 3H0RB 3SR6A 5A2QU 1DTTB 4M9JA 4ZVRB 2RE1A 4LFBK 4PUOA 2HEKA 2QA4S 4W4MA 2MSNA 3RB6A 4FJXA 1WHWA 1CZ9A 5EE9A 4KFBA 2M0NA 3OYKA 3PKYA 4IG0A 3M05A 1VHIA 1B43A 1HPZB 1RB0A 3VVUA 1BUPA 1LFPA 3RGIA 4Y2KA 4OJ3A 2I8EA 3CPEA 2B9YA 4GKKJ 2BKOA 2R7SA 1UZHA 4I2DA 1HQEA 2E2PA 4RBUA 3MMBA 1QHTA 2XQCA 2QK9A 3OS2A 8ICOA 4XTTA 4GMKA 4F3QA 2FY8A 9ICJA 1WORA 1FJGJ 3LPTA 4GC7A 2E9RX 3CM5A 4LBIA 1VSIA 3C6AA 3HP9A 1RDWX 2JGUA 8ATCB 2VG6A 2Z2YB 3CC4N 1WSRA 3H5UA 1XHXA 1R0BG 3BEXA 5C0YA 1SV5B 1RBLA 3CMAN 2K1RA 2IOCA 1MN7A 4NCGB 4HVZA 3OLAA 3M1FA 1KC8O 4PGQA 3C6TB 2HBZB 3SEIA 1FNOA 5J1EB 1C1AA 3UE5A 4YD1A 2ZJRQ 1U0HB 1Z00B 3BZCA 1UPHA 1FFUA 1JJ4A 5JXSA 3S3MA 2ZDPA 4DO9A 2JVRA 3AJDA 3AVJA 1WF2A 3UQ0A 3SUQA 3I55N 3ATUA 4JI4K 3PX4A 2JLEA 1RU1A 1NHKL 1C4CA 4DHVA 4YY3K 3RJFA 9ICQA 2PZSA 3V6KA 5KFWA 3MR5A 3OXGA 2J9CA 4O23A 1Y0HA 1CLQA 3VA0A 5JMVA 1S0VA 3D66A 3QINA 2RUSA 2OELA 1CJVB 1VLYA 1QQ7A 4WK3A 1WWHA 4BVOA 2J76E 5L46A 9ICAA 4C4TA 2E5IA 1ZAWA 1T05B 3TSPA 1C1BB 4LD0A 3A8EA 1U1QA 5E7OB 1QVFR 2KVCA 3NH0A 1PYSB 4PXCA 1JI7A 4GLXA 3AAQA 2ZBPA 4KV8B 3SQGB 4DV6F 2P9IB 3GFXA 2W40A 3KHYA 4OPAA 5HQLA 2BH1A 3A8IA 2QEXN 1ZBFA 2GQ2A 1WKJA 1DHMA 2YNFA 1RZMA 3Q24A 1Q9XA 4DV4K 1B22A 1FJ7A 3W60A 4U7UD 4OZ3A 2JEIA 5BRDA 3M30A 2DGUA 4IH5A 2CQPA 3CXCM 1RHMB 4ILRA 2CNKB 4Y2PA 3MOZA 5CYJA 1N52B 4JI1F 1YGYA 2EH9A 4K4WA 1JLQB 3WXJA 3CGIA 4MK9A 2LEAA 3BGRB 1LAWA 1FERA 1GH8A 3MZIA 2E29A 4YN4A 2DO4A 3DV9A 4PYDA 3MXHP 4BRDA 3NS1A 1VQON 4HI1A 3P45B 3NRBA 1V38A 4JI3F 3LALA 3EL2A 2G8UA 4O55A 5AR0A 3KLIA 5E84A 1DFDA 1GEHA 4OYOA 2QJ3A 1SH2A 5HMZA 2EK1A 4FNIA 2L41A 4P2SA 1PVRA 3JPRA 3NVZA 3AN1A 3T69A 4CBXA 3CDWA 3I33A 4E1JA 2OSQA 4QJVA 2I1RA 3QUQA 2D4WA 2M9NA 5KG1A 4F91B 4Y2RA 3I32A 1N34J 1S1VA 4BRKA 3LPEA 4LSZB 3MM7B 3MURP 4BG9A 2HNYA 1N5SA 1NK4A 3CD7A 1UW4A 1BA1A 2EPIA 4DTSA 2KL8A 2V34A 1Z05A 5ETRA 3HSDA 3NF9A 1IJJA 2UUTA 1XQIA 3VCDA 2ATLA 2A3ZA 1RKIA 2KIVA 4DL5A 3ENVA 4EYHB 2YX7A 3P31A 4XRHA 5D0RA 3D2SA 2V67A 1K0VA 1HD0A 4FJ5A 2IDOA 1KXPA 2HVZA 4CE6A 5ALLA 3D28A 1X1PA 1YVNA 3LP1B 2UXDK 3T1YJ 2MJNA 2GAGC 1FKPA 3M1VB 3A8KA 2W3SA 1K1QA 1PZNA 5HRRA 5ALPA 2WVDA 4K50A 3M6VA 5A6WA 1NAQA 2B9WA 2O8EB 1KW4A 4CFCA 2DXDA 3ZTQA 1X5SA 3H46O 1JUDA 4Z0UA 2ZZTA 2PSZA 1SC1B 3PVXA 1KVJA 4RW8A 4LFCK 4H4KC 1BHLA 3DEEA 3PFEA 3ENOA 3HD1A 3HW8A 3SQIA 3SV4A 5AQXA 2VA8A 3D0GE 5GAGP 2DKZA 2A2CA 3MAAA 4KGZB 3H59A 2Y0BB 4OX7A 3KBBA 5AXLA 4DOAA 2HSEB 2Q0UA 1PAUB 4C23A 4HUEA 2D74B 2MQMA 3MWPA 1ZQKA 2AD9A 2IA6A 5KFFA 4R5PB 1NU0A 3BGUA 2AA4A 3DI6B 4LF6J 1WSVA 3C6UA 3BO2A 2H3FA 1CJTA 5IV4A 2P9KA 2DHHA 4NA1A 1M90O 2MQOA 4CK3A 1SAZA 4JKGA 2DHAA 5BRHA 1LK7A 4Z6EA 1M5KC 4NA3A 3OTOK 1FXDA 4CJLA 1BUXA 2YNHB 4BRPA 3K8WA 4CO3A 1A0OB 2CPEA 2J0QD 1HYSB 1S5JA 4DQSA 1X9MA 1R8HA 2UP1A 4KLTA 2KNJA 4DX5A 5HATA 3O9RA 3HVWA 3L2QA 4OYIA 9ICOA 4USHA 1Y97A 5LMUF 4R25A 3NNAA 2JHDA 4URGA 4CO2A 4JBCA 3C2PA 2E1YA 4IDKA 3U7JA 4TNOA 1D3WA 3TA0A 1ZQBA 2OEHA 5AKXA 5AQSA 1A76A 4KKOA 4B3SK 4WP9A 5HL7Q 3M2UB 2RQ4A 4RW9B 1HA1A 4F2SA 4O5BA 1RACB 1GLBG 4OKEA 3RSEB 3SMVA 3LPYA 1VQMS 5BJRA 2O66A 4HACB 2YWGA 1WI8A 3HSCA 1TL5A 2UUWA 1GLLO 3FLCO 4HUGA 5A0YA 2YMMA 3HJVA 5DLGA 4D3GA 1TMJA 2VPWB 2IOHA 1IWGA 4EWTA 3M6WA 3SI8A 1TKZB 1EP4A 2M9KA 2LQJA 3WXMB 1YHQN 3CCEN 5G5GA 1A77A 1HKAA 5HLFA 4Z4FA 3Q8MA 2IRYA 3E0FA 3DDIA 1NZBA 3OUYA 4FDFA 4LR8A 5ETTA 1JK9B 3KHGA 3VGTA 3MXIA 4C8KA 3MAHA 1NNLA 2IIHA 2MSTA 3LPUA 1S1XA 1LWCB 3FRZA 4PKHA 4B6JA 4DX7A 3KHLA 5B08A 3I5AA 2H3QA 5HBMB 3HXMA 4CF0A 4KX5A 1VC0A 3CCUN 3R7BB 3PXGa 4IYQA 2OYYA 2CG4A 5KOXA 2P2CB 4FM0A 5B0DA 1NGHA 2RDDA 3J7ZT 4F5QA 1CBKA 4LF4J 2G13A 1TYQA 2MZJA 1L3UA 2QM1A 4XPCA 4ANCA 2BPCA 5IIKA 3AVNA 4JKBA 4PA1A 4JK1A 3QIPB 1HR0K 1NB7A 4PRFA 3L7UA 4MKVA 5SUHA 2BE2A 2HAFA 2GVZB 2FMSA 4DXLA 9ICIA 3AU6A 4DX8H 1K8KA 1X8DA 2KRBA 4DMNA 4O4GB 4Y00A 5EX3A 1J6ZA 2ZBQA 1N33K 2E44A 4M63A 2OH2A 3Q2TC 4DFKA 2O8CA 5CHGA 3NGRA 4C6AA 1RHJB 3BN7A 4YNQA 1XSLA 2W03A 1VJWA 4CJPA 1JXLA 4K42A 5IZHA 2XNQA 3OXLA 2X78A 2YTUA 1D09B 4HT5A 1ZQJA 5GADU 4DR5J 2FZCB 4JI2J 2YB4A 1EKEA 3FDSA 1HNZF 1UKUA 5CYQA 2V4RA 1U1LA 1JJ2R 3V6DB 2UUCF 3UIQA 1YJ9S 5KFHA 2ZE2B 4ZPDA 2WUSA 4A57A 3IG8A 3LP0A 3BO3A 4CRJA 1L7NA 2JFKA 4H0PA 2I5JA 2B4JA 1UA1A 1NMEB 3OVBA 4LREA 3T3FA 3RJMB 4CP5A 4PHTX 3S7RA 1WEZA 1T9WA 3ZI4A 1L3VA 3ADAC 5ELZA 2ASLA 2G08A 1PCAA 1HBOB 4G1IA 4WKYA 5CB1A 3MGHA 2JHEA 3UPFA 3MEGA 4FJHA 1X4FA 2ASJA 2VFUA 2VWBA 3CQ8A 2Z57B 3OJSA 1O1WA 4FZVA 1REGX 3A5NC 5GVQA 4JYAJ 2CQBA 3LDPA 4MLEA 2ZJRL 4H4MA 4JP8A 3CCLS 2DNPA 2M52A 3H40A 3L8BA 1HMVA 4J9QA 2GLEA 3WKDA 3RW6A 3OBYA 1PYTA 2P9NB 2ZJAA 4QAGA 4FZMA 2NZCA 1XO1A 2WB1C 1ZZNA 1YJWN 5HMYA 1TFRA 3MAQA 4UOHA 1VQ6N 4BRNA 3HSTB 3DOKA 4BWMA 1L7OA 5EOZA 1RKJA 3LM2A 2HWHA 2VQEF 1YVUA 3QEAZ 1ASWA 3JYTB 2XLKA 3BBBA 2LECA 5G0RA 4DV1J 3R5AA 3AJ2A 1GK8A 1JMSA 2MY8A 2DTUA 4ZVSB 4DL6A 1NJIO 5H2FU 4CHOA 1ZBSA 5AQGA 3R5BA 4IOBA 4K4VA 1HD1A 3MWTA 2QLBB 1TVRB 1XK8A 2NYIA 3IG1A 4ATNA 4DUYK 2NRRA 3N6NA 1EQMA 4LSLA 1TKXA 4JK7A 3DRRA 5D4LA 1FDBA 2M88A 1AUDA 4BGAA 3H1VX 1RTHA 1WUUA 5I3UA 3DC2A 2NRZA 1WKKA 5DDPC 2W7OA 5B0CA 2FVSA 2COLA 4TKTA 3ID6A 4KO0A 3VQ5A 1GX5A 1V85A 5CR4A 3CCJS 1Q82O 4GO5X 1MU2A 2IC3B 4CGDA 2HS4A 4DHYA 3DRSA 3GR1A 3QESA 3TABA 3EGWB 3WNGA 1UWBB 1LEOA 2DNHA 1WNEA 4B9LA 3EZ5A 2G09A 3JTNA 3MGVA 2KICA 1N36F 3RMBA 3U3GA 2UXBJ 3VGSA 3H3NO 9ICGA 1GOAA 3MDFA 2X3DA 3ISDA 1S12A 3CHWA 4CZIA 3FZ2A 3FBFA 3MMCA 1HNWJ 1XNRF 1QE1A 3C21A 3VC8A 1XR5A 2HQGA 2ZD1B 2P9UB 2Y8WA 3HWTA 1HWUA 1BA0A 2BGGA 1ZPVA 2FHJD 3FE1A 5DDQC 4FZNA 5B0EA 2RE2A 3F53A 4LRAA 4JI8F 2ZBIA 5KG6A 1RT5A 4BC5A 1C0TB 1CC7A 4DU1A 4CJTA 4NLNA 2YX6A 1YI2N 4JMUA 1LW2A 4C4WA 4NEYA 5GAGI 2MAXA 1O0PA 3FFIB 1IQTA 1UA0A 5EGYA 4LF7K 3AA9A 3T1HF 4NYOA 1S9GB 1S6QA 2IJNA 3K9KA 5AM4A 2FVQA 7ICSA 4H0VB 9ICKA 5FLXU 2KM8C 3UMCA 3S8SA 3SAGA 2CG8A 3HPHA 5JJBA 1CSJA 3L2UA 4CM0A 2E5GA 4ED6A 4IFYB 4X4OA 4QIFA 3PIOQ 4K4SA 2A6MA 1LW0A 4OHZA 2E1FA 4UTGA 3V81B 3RBZA 2LKYA 4LFAJ 5B0AA 4Y2MA 3M2RA 5IIOA 4DR3K 5JRTA 2CJYB 3P39A 4OPJA 2IJRA 3RR8A 3QNMA 1TV6A 3KUEA 1X31C 3CT9A 2PYJA 4BR4A 3J81U 3W2VA 2IHR1 1WEXA 4DR2J 2FJVA 3HVAA 2A3VA 3CC7S 2PN6A 3EVWA 3U6FA 4HI2A 4JWNA 5ETKA 3VQEA 3FR0A 3H3OB 1IBCB 7ICLA 2DFFA 3LP2B 2R7YA 9ICSA 4ZLNA 1Q82T 2O6KA 1IBKK 3CCRS 5FIIA 3KK3B 2CGLA 9ICFA 4JI7F 4M9LA 3NGKA 2V0NA 4P73A 1NK5A 1SJ4P 2NRTA 3O9TA 3S01A 4LT6A 1X40A 3RAXA 2D8CA 4DN0A 1NKBA 3BGFA 3PX0A 4UAZA 3MPYA 4TU9A 2SXLA 1VC6A 2DEJA 3JQJA 3DLKB 2PD1A 2QKBA 1Y9OA 1JL1A 1X2IA 2VDIA 1VSJA 4LRCA 4GNIA 1P90A 1HQUB 5F0XA 1B7FA 3AO3A 3ILLA 2HCFA 4GVBB 1ZXOA 4X62K 4B8CA 2W54A 4FF3A 3MMVA 1NGGA 4C7YA 2B0CA 3GTYX 3THTA 2OPSA 1SZHA 4I6YA 2LYBA 3RFAA 4CNQA 1QAYA 1KVIA 4IRCA 4GXJA 3AD9C 2Y9HA 8ICNA 5GIPA 5AM3A 3H6EA 2CNNB 4YDXA 1N63A 1NLVA 3QU2A 4JKHA 1QAJA 2NXUA 1WWUA 4BC9A 4M9HA 1HNXF 4V1Ak 3J7YI 4KB1A 1FK9A 1MWQA 5LJ3Y 4MAKA 3UO0A 2XY6A 3PYDA 3V1QA 8ICVA 3B82A 4X5VA 1FCAA 2KVQE 1F3FA 3VTHA 5JU5A 1AZSA 5L39A 4LJXA 4QR2A 4WYWA 2F8HA 3W9IA 5CY4A 2GGPB 4DL3A 3CDEA 2O8DA 1H98A 3HM8A 5J0RA 1XU4A 4CESA 4I2CA 3M9NB 2W2QP 1FKOA 2OTLN 4J03A 1NZAA 4LY7A 3AGKA 4F5PA 4C7QA 1BQMA 2VPXB 2KXHA 4F93B 1WD6A 4DR7F 2AJFE 4DV7F 1VSLA 4UB2A 4UQGA 3CC2N 1JLAA 1WOQA 5ALTA 2B21A 3PM9A 1C1CB 4BE2A 2B7CB 4F5RA 2DD8S 1WF0A 3UCUP 3M8ZA 4ZPVR 2KG0A 2IDEA 3S3OA 2KI2A 4M3RA 2FPLA 5AKKA 4I2JA 1SXDA 3UCGA 3IP4B 3G87A 2H5EA 1X7VA 1ZD4A 5J2QA 2H4YB 4TU8A 2Z2ZA 1Y00A 1QQMA 4KHPJ 3R1XA 2HLTA 5AI8A 1JIHA 3ZETB 4PUOB 2HMPA 4J2BA 3CXCR 2W11A 1X4BA 2HHXA 4M2YA 4FWSA 1I94F 1N5XA 3ZT4A 4IG0B 3D6HB 1V5IB 3VWSA 4WXWA 3Q86A 1CS4B 1U6BA 4ZVPB 2J0WA 1D8YA 3IGVA 2DGQA 3GCWP 1JALA 2JC1A 2BKEA 1HHTP 4TQSA 3GJRB 4TXSA 1NB2A 3VQ6A 1U7LA 2FBXA 2UV8A 4F0HA 1UJ6A 2QI2A 3WXLA 2RS2A 3WNFA 1YJVA 4DUZJ 3J7AP 1TL3B 1HJPA 3TPQA 2MDAA 1SJ1A 2D69A 1FFVA 2IM2A 4C1NI 3ULEA 4KH6A 2RHQB 2W7PA 4WJBA 2BCSA 3F5TA 1RABB 3MI7X 1EHWA 2CIMA 4ZLLA 2E8NA 1LWFA 4RWTA 4PQUA 2MU2A 2W9BA 3PLAA 5E79U 3N7SC 4ID5A 2ZIUA 5H9EK 1VQ8S 1SIZA 4P2MA 3GOIA 4P2HA 4ECVA 3G0ZA 2ZTEA 4X66F 2BKPA 1XO0A 4FJJA 1OH5A 2WB4A 3L4QA 2DR5A 3HHEA 1RLDA 4NE9C 2OKQA 3KDNA 3KKAC 3NGIA 2FPMA 3AQFA 4US9A 3EUNA 2F5GA 3FUYA 4BDZA 5IFMA 4J8FA 2R8GA 1RTDA 2KXFA 1RXWA 4YMNA 3K8VA 1MG7A 5J2NB 5GIOA 3C5GA 3CJ2A 1YIJN 4R66A 1UP1A 4FM2A 1NBEB 2GJIA 3QX7A 3VAIA 2J5AA 1PSDA 3VAJA 1QSLA 3KJNB 1BWEA 9ICUA 2CDRB 3D2FB 4CEBA 5AJ3F