1NK5A

Adenine-adenine mismatch at the polymerase active site
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk5A01
3QESA 3S3MA 4QW9A 2XY6A 3Q8LA 4QZDA 4ECUA 3RB0A 5CZ1A 3OS0A 4KLUA 1B22A 5J2PA 3KTQA 1ZQZA 2FLLA 1ITGA 4ED2A 2HHUA 4H4OA 8ICNA 1VSEA 1BPZA 3DLEA 1WN7A 5CYMA 3TFSA 1SKRA 3OYAA 4O3OA 4G3IA 4AILC 3AO2A 4BDYA 4LH4A 3FDSA 3KK3A 3MAQA 2BDPA 4FM2A 1NOMA 1TKTA 4J9SA 4HYKA 2YHBA 3NGIA 5D49A 4CEBA 4I9QA 3H7IA 4I2BA 1C1CA 2X6SA 2BR0A 3PX6A 1ZQMA 1ZQNA 4YQWA 1QSYA 4JLHA 4E1MA 1T7PA 4QZGA 2Z1HA 4BE2A 3RMBA 2G8HA 5J2IA 3IHQB 4CESA 1ZYQA 1X2IA 1B92A 3C2MA 4CJRA 4JV0A 5F9NA 4FYDA 1HQEA 1RT1A 3ISBA 8ICOA 4M2YA 5KFYA 1RT7A 1BIZA 2QXFA 3GIKA 5EWFA 4DQPA 1QHTA 4EP5A 1C0TA 2ZE2A 8ICMA 4E7IA 2PFPA 5DG8A 4CHOA 3PX4A 3N97B 3RJFA 3RR8A 5EU7A 4DO9A 2ZUBA 2MUTA 1KFSA 1KRPA 1WAJA 2MAXA 4CGFA 4Q0BA 9ICXA 2OZMA 1IO2A 1NKEA 2V4QA 4DTJA 5J2DA 1KEJA 4FW2A 3ZSWA 2ZJAA 1XHZA 1I3AA 4KKOA 3SUQA 2W42A 3M9NB 2V4RA 2W9BB 2RKIA 3OYBA 3K4GA 3V7JA 3VA0A 3DLRA 2R8JA 9ICUA 1ZQXA 2P6RA 4B9TA 2JLEA 2DFFA 3ZT1A 1JN3A 1XSNA 1D8LA 3HT3A 9ICOA 1HPZA 4AHRA 3PY8A 2X78A 3QERA 8ICUA 5KFZA 4MFCA 3ZT4A 4DTRA 4LVSA 5J2BA 3E01A 3L2VA 4B9NA 4Z4HA 4RNMA 4KN7A 1X9MA 3QZ8A 3G6XA 4Y1DA 5J0OA 1RILA 3HP6A 4HTUA 4EBEA 3OHAA 3TAEA 2VG7A 2A1RA 1NJWA 1VK0A 5KFIA 1B43A 4ICLA 5J2NA 4FS1A 3NAEA 8ICLA 3MECA 4DLEA 3AVJA 4HCCA 3PW0A 1DTTA 2DPIA 2R8HA 4I2JA 2DFLA 2AU0A 3VQPA 1BIUA 4XRHA 4O5KA 2C2EA 1XS9D 3NGZA 3HW8A 3O4NA 3CM6A 4IG3A 5DBAA 1KSPA 4ELVA 3EYZA 1S0NA 3C6TA 1U47A 3NFAA 2KZZA 3K59A 3QIOA 3H08A 3TANA 5KFFA 4OJRA 4F4KA 3U3YA 4HUEA 4LSLA 4F4XA 3V6JA 2RDJA 4EYHB 3VA3A 4W5QA 5KG2A 3GDXA 1HUZA 4OVLA 1L3VA 8ICPA 3MGIA 5BOLA 5DB8A 4FZYA 2NRVA 7ICLA 3I0SA 4YR3A 3E2EA 3B6PA 3RBEA 4AHVA 4J2BA 4ECTA 5IILA 2BCVA 1RT4A 2W9BA 3MFIA 4IQTA 2NRTA 4M6WB 4B8CA 1LWEA 1TL1A 5DLFA 2XC9A 4NLGA 3LWLA 4E7KA 9ICTA 1U4BA 3K75D 7ICMA 2OYQA 1RBSA 4QWDA 3MDAA 4Z4GA 3PNCA 1QTMA 3VQ5A 2XY7A 2DTUA 4J9MA 2XY5A 4DSEA 3OS2A 4G1QA 4DFMA 4I2HA 3NE6A 2IHMA 2ITGA 4DL4A 2BCUA 4KLLA 4KB1A 3C94A 2JEFA 4QZ8A 3DI6A 3OY9A 1UT8A 8ICZA 4ECXA 3HX0A 5C25A 3T5KA 4K8ZA 4I2GA 3MFHA 1J53A 5J0UA 3V72A 2F1JA 5J0XA 4R65A 8ICIA 3HVRA 5FROA 3NF8A 3OSNA 2P1JA 3CG7A 3PR5B 5KFHA 9ICFA 3EPIA 2OZSA 4KLSA 4QWAA 5IIIA 5KFMA 1NK6A 3PW4A 3L2UA 3SQ0A 1DGSA 3PO4A 1JLFA 1X9WA 2VWJA 3NF9A 5DB7A 4FBUA 4JS5A 3P1GA 5KT2A 3JPTA 1UA0A 1NOZA 7ICSA 4F4YA 1C0UA 3QO9A 3JPSA 2BKEA 4F93B 4DL7A 3Q8PB 1XU4A 4TUSA 1ZQSA 4Z6FA 3ZSRA 4J9KA 4CFDA 4NCBA 3WNHA 5CHGA 2BGGA 3OHBA 1LWCA 5KFXA 3Q8RB 4CJEA 4KHWA 2IHNA 1S9EA 2F1IA 3H4DA 3ZSQA 3AVGA 1S1UA 5KG0A 3ZD8A 4KAZA 8ICTA 1S76D 3C1YA 3LP1A 3T1AA 3AU2A 3UQ2A 3NH1A 4DWIA 3TAMA 1RTHA 4N5SA 2KTQA 4QAGA 3ITHA 3RAQA 3M9OB 3G6VA 8ICYA 3HJFA 2AQ4A 3TI0A 5DBBA 4B08A 4I7FA 1QSSA 4FJ8A 4YXMA 3PVXA 1CEZA 1BCMA 4JRQA 2ZUDA 2DPJA 4DQRA 3O3FA 2G8UA 2IA6A 2O4GA 5L9XA 1VSLA 4CK2A 3RJKA 2RDIA 2GV9A 4FVMA 1MC8A 4RNOA 4O3RA 5BPCA 7ICPA 3LZJA 2J6SA 4OLAA 1D5AA 4ZHRA 5KT5A 4CJVA 3KKSA 1QSLA 3HWTA 4B9MA 1RYSA 9ICSA 3NF7A 4Z4EA 1BHLA 3OYLA 1B9FA 5J1EA 3ALYA 2HNDA 7ICNA 4O5BA 4HCBA 4DSKA 2E6LA 3TQ1A 4RW6A 4YXJA 2YKNA 3QLHA 3H8JA 4O0IA 2HVHA 5C42A 4CF8A 3KHLA 1YT3A 1A5WA 3DRPA 3M8RA 8ICVA 3HPOA 4RW8A 1ZBHA 3EW9A 5HRSA 2FMPA 4BWMA 4PGXA 4MF2A 2W9AA 4Q8FA 3B0YA 1B9DA 4FJKA 2O4IA 5KFEA 4FLUA 4DQQA 5J0RA 2BPGA 1RBRA 4TUPA 4E0DA 9ICVA 5HHHA 4MFBA 2P5GA 2BPFA 2PYJA 4ECZA 8ICAA 2XHBA 4J9PA 3RJHA 1LWFA 4KLQA 4P4OA 4F2RA 3N4MB 1NK4A 3AVHA 2VG6A 4PGQA 5HRRA 1ZQRA 2M9NA 4JK1A 4UB4A 4CJWA 4KPYA 1TKZA 9ICNA 4FLTA 3SCXA 5IIOA 2VWKA 5CB1A 4E7HA 3ZDDA 2RN2A 4M3RA 2A1JB 4NYNA 2R7YA 5HBMA 5J0YA 4O5CA 4RT3A 2YNIA 2IDOA 4CJKA 1CXUA 1Z25A 1NKCA 1WSEA 3MXIA 3RMDA 4RG8A 4CCHA 3D45A 2AGPA 1RXWA 1TV6A 5DG7A 4AHUA 1D9DA 2YNHA 2FBYA 3NBPA 4PA1A 3RJIA 4CJTA 1J5OA 1NK0A 1JLCA 5CA7A 3OYMA 1HMVA 3NCIA 1NKBA 3JSMA 1SUQA 4FJIA 4FJJA 3L3UA 4M9NA 2HHSA 2W9CB 4CJ4A 4KRFA 4CEOA 3ZDBA 3VQ9A 1UWBA 1ZBFA 1Q9YA 1SZPA 4FXDA 3OYEA 4E19A 3KLGA 4DL6A 4ECYA 4WE1A 4FO6A 3KHGA 2G8FA 4FJLA 4F2SA 4CIFA 2RPIA 2XCPA 1D8YA 4M9LA 3L2WA 1ZQJA 4KHNA 3V6HA 3MR2A 3QEBZ 3IRXA 4CF9A 1JXBA 4ED7A 5DDMA 2G8VA 1WCLA 3CYMA 3OSPA 7ICRA 1N56A 1CZBA 3EZ5A 1C0MA 3RTVA 4CGHA 3HVTA 2A1JA 1S9GA 1ZQLA 4DTMA 4Z6CA 1KVCA 5KFCA 1WLJA 3VQCA 3LP3A 1Z26A 4TQRA 3NF6A 5I3UA 2F96A 3IS9A 5KFLA 4KITB 1ZQDA 3RRGA 3AV9A 5J0QA 5DG9A 4EBCA 1RDDA 4K4HA 1HYVA 3LPUA 4LY7A 4W5TA 3QNOA 3CM5A 2Y1JA 4M3XA 3BQ2A 4DS4A 3L2RA 3PW5A 4CEDA 3CFRA 3ZSXA 4IG0A 5J2EA 1SL0A 2UVVA 2FPLA 4YMNA 5J2CA 1NJYA 4CEAA 2YHAA 4J9RA 3DRSA 4Z4IA 1ZQQA 4J9LA 2C2RA 3RJJA 3HL8A 2KZ3A 3JPOA 2RF2A 3LAMA 3ZT0A 5DQGA 3HK2A 2IAJA 1LV5A 5D4BA 3SI8A 7ICIA 3KD5E 3AO5A 1L3TA 2VANA 3RJGA 9ICAA 1XHXA 3HP9A 2MUTB 5KG5A 1GOCA 3HSTB 4JS4A 1Y88A 3LP2A 3PO5A 7ICGA 1S6QA 9ICGA 4KMUA 4CIGA 4FW1A 1S0OA 4PUOA 3CFOA 1JLAA 1S10A 4CJLA 3ISDA 2OPRA 3K5MA 5C5JA 3DLHA 1WSHA 4BACA 4UB2A 5EOZA 5KG4A 8ICBA 2HB5A 2ATLA 4YG2A 3TR8A 2H5XA 3PX0A 4E7LA 2AQ0A 4EZ9A 4FZXC 1ZQKA 2B5JA 2PY5A 1F21A 4GC6A 4F3OA 1BI4A 4DOCA 1SKWA 2JGUA 4FLXA 4M3ZA 9ICJA 4KN4A 5BOMA 2HHXA 3M8SA 2FMSA 2VA2A 4YD2A 4YCXA 4CF2A 3U6FA 3DOLA 3IG1A 3O3HA 1KTQA 1LAWA 3HPGA 4RQ0A 3AU6A 1EX4A 4ED8A 2BQ3A 4DTOA 4Q45A 1IKWA 3C5FA 3JPQA 1QE1A 3K5NA 8ICFA 4Y1CA 2ZTDA 4GW6A 2F8SA 4P4MA 4C8KA 8ICQA 3PV8A 5D46A 1WSIA 2W9MA 4C8MA 2XGPA 3KHHA 2WTFA 1EETA 4NYFA 4TSXA 1NK5A 1S0VA 3AVMA 2I5JA 4CHPA 9ICEA 5J2MA 2KFZA 4CJQA 2QKKA 1A76A 7ICOA 3WNGA 5J2FA 3WNFA 5J29A 4OKJA 7ICHA 4TUQA 4Z6EA 4KHUA 3VQBA 4C8NA 3RAXA 1EKEA 4JUZA 5KFPA 3RH6A 3HO1A 1ZBIA 2B21A 3LZIA 5JS2A 2KFNA 2HNZA 2IGIA 4BDZA 1BPEA 1JIHA 4UB5A 4DQIA 4F5NA 2HNYA 3QINA 4QZBA 5SZTA 2VA8A 4GVMA 1IM4A 4AHSA 2PYLA 3HPHA 1VSIA 4KREA 4YFUA 2Z1IA 2C22A 3V4IA 2I1QA 9ICKA 1O1WA 2IS3A 3SUOA 4P4PA 2NUBA 4F8RA 4RU9A 4RPZA 2Y1IA 4C8OA 4CGJA 3C2KA 4BE1A 4QZCA 4X5VA 1C1AA 4C8LA 2AGQA 5KFDA 4IQWA 2ZD1A 3VQEA 3GIMA 3KLHA 2Q0ZX 4RQ2A 2W8KA 4RQ7A 5DB6A 3Q8QB 1JMSA 4UBCA 4ED3A 4DSFA 4O0JA 9ICBA 3SZ2A 4PGYA 5EWGA 4KV8A 2YV0X 1JXEA 4PQUA 4CF0A 2JEIA 4ED1A 1QS4A 1UT5A 4IRDA 1ZQIA 1JX4A 4W5RA 4MQ3A 1QQCA 2QKBA 5CYQA 4NLZA 4Z6DA 2XO7A 4CHYA 2YKMA 4J2AA 1DOQA 1ZQWA 4O55A 4PWDA 2HHWA 2ISOA 3KKRA 1KFDA 1AROP 4RQ6A 2G8IA 4QOZB 4AHCA 3CQ8A 2FPKA 5DBCA 5DLGA 2WONA 1KDHA 4Q5VA 3SUNA 5KT3A 3TARA 4I29A 3BDPA 3NTUA 4JRPA 4F5PA 5KFKA 4KLHA 4DTNA 4FJMA 4IRCA 4F4WA 3KIOA 4FJGA 2HHQA 4DQSA 4UAWA 3RBDA 4FLVA 3AA3A 4O3SA 1I39A 5HRPA 4IR1A 1TGOA 3VQAA 2ZJ8A 1SKSA 2ZQBA 3VQ8A 3AA4A 3VQQA 1KFTA 1QLNA 1WSJA 2KW4A 4DTPA 3S3OA 5HLFA 2IBKA 5FRMA 1BL3A 4YR2A 3HM9A 1GOAA 4CK3A 3D0PA 3ZSYA 1KVAA 1R0AA 3GQCA 1FKPA 4FJ5A 4I2PA 1UOCA 1ZJNA 4FLYA 2R8KA 5DKWA 4DTSA 4LD0A 4KO0A 4FJHA 4DTUA 1FKOA 4M9GA 3SJJA 4O3QA 3OYDA 3O3GA 5KT6A 3V1OA 1KCFA 1ZJMA 2JZBB 1RBTA 4DOAA 3AO3A 3SI6A 4CJFA 4Z4CA 2ETJA 4W5OA 3G6YA 5FDLA 5HRNA 4AH9A 4DSJA 7ICFA 1CXQA 3KK1A 5K14A 1BPDA 3V9ZA 4H8KA 4GMJB 4CF1A 4TURA 1X9SA 4FK2A 3V9WA 1IXRA 3ETLA 3GILA 1KLMA 1T03A 1S5JA 4QZFA 3ZD9A 1V9PA 4CFCA 4DTXA 3EPGA 2ZTCA 4M3YA 3OYFA 2FBXA 4I2DA 3LP0A 4ECRA 4YMOA 3MBYA 5KFGA 4IQUA 3PMLA 4DFPA 1JL2A 1SL1A 1RCHA 4UBBA 4DSIA 4E1NA 4HUGA 8ICGA 3V81A 2PZSA 1TK5A 4ECVA 4KLEA 3I8DA 5I42A 4DU3A 5KG7A 3LANA 1EP4A 5KG1A 3I0RA 4M47A 2W8LA 1MQ3A 3QNNA 5L1JA 4YD1A 3QEPA 2R8IA 5FRNA 1HYZA 4RW4A 3V1QA 4UAYA 4YN4A 8ICRA 1WSGA 4IFYA 3GFKB 4M9JA 2Z1GA 1HNVA 1C1BA 4FK4A 1MQ2A 5KFAA 5KT4A 4ELTA 3RB6A 8ICEA 4CJSA 4F50A 3P83D 5HNKA 9ICRA 3JPNA 2EHGA 4I28A 3F73A 2DFEA 4NM1A 3Q8MA 4KHSA 1RTIA 5JUMA 1ZQHA 2HMIA 3LDSA 1W0HA 4R8UA 5KFJA 3AVCA 4Z4FA 3V6KA 4Q43A 2FPMA 3SQ4A 3AVFA 3V7KA 2NRZA 4M41A 4QZEA 2R8GA 3DLBA 5D3GA 3QEAZ 1S97A 5E41A 2XY8A 8ICCA 2IOCA 1VRTA 4J9OA 1UAXA 5C24A 1WNSA 1XSPA 3RR7A 5KI6A 4RW7A 4KLJA 4M3WA 4FJ7A 4FBTA 1RBVA 3GIIA 4O3PA 5IINA 1RT6A 3LDAA 3TAGA 2ISPA 4L8RB 4I2AA 3PUFA 1ZQBA 4J9QA 1RNHA 2V9WA 3C23A 4O4GA 2VG5A 4PHAA 4LSNA 1HYSA 3KLEA 3GV8B 3M9MB 3QEIA 1WAFA 1Q9XA 1ZQAA 1U9LA 9ICLA 7ICJA 2G8KA 4QWCA 3DLKA 4DL3A 3GV5B 4ECQA 4CIEA 1VRUA 1NJZA 3V1RA 2FC0A 4N56A 4CHQA 3G0ZA 2A1SA 1ZQOA 2ASJA 5J0SA 1ZQUA 2AGOA 1Y97A 3T5LA 3RWUA 4QZHA 5KFTA 4ZTFA 1BPBA 2FBTA 2P51A 4RQ5A 3G10A 4KFBA 2BANA 1NK8A 3LALA 3SQ1A 1S9FA 1S1XA 4YFKA 2ZUCA 1IKVA 5IIKA 1TAUA 1XI1A 1A77A 1S77D 3AVNA 3H4BA 3P5JA 4NLKA 4DSLA 1C7YA 2D0BA 1RTJA 5CZ2A 3H8SA 1A5XA 2HHTA 2KN7A 2LSNA 4HHTA 1TAQA 4B9SA 3AA2A 4I2IA 2BPCA 1BISA 3T3FA 4CFBA 3MEGA 4J2DA 2UVUA 3UXNA 8ICKA 1NOYA 1MSWD 3T19A 2VA3A 4KLTA 1S1VA 2OA8A 4RPYA 5IIJA 4R8UB 1RT3A 4KI4A 2X6NA 1WCNA 3OJUA 2XGQA 4J9NA 3ZSVA 4XQ8A 3PR4A 2J6UA 5CP2A 2UVWA 1ZBUA 3OYCA 1W9HA 5J2GA 5KRTA 3NGYA 4KLDA 1IKYA 3ZCMA 4PHDA 4DF4A 4F91B 5KFVA 1LW0A 1S6PA 3MEEA 1JLGA 3K5OA 3JPPA 4DL5A 4M45A 1TK8A 3LAKA 1DTQA 3KD1E 1TFRA 3DM2A 2PI5A 4IKFA 3K58A 5KFNA 1RXVA 3C5GA 3NH0A 1XO1A 4KHYA 2NRWA 5KGWA 4CJUA 1ZQTA 4O3NA 4DL2A 2JEGA 2DY4A 1D9FA 5T7BA 4OPKA 1TVRA 2B4JA 3AO4A 4E3SA 4ED6A 5DGAA 1Z00B 5KFBA 4M9HA 3UPQA 1LW2A 2KQ2A 5F9LA 3AO1A 4CHZA 1WSFA 1BCOA 3VQ7A 3KJVA 4MF8A 4FJXA 3OYGA 5DB9A 1IG9A 4LZDA 1HJPA 8ICJA 1VSKA 1Q8IA 2FLNA 4JWNA 4LH5A 3SV4A 2Z1JA 2E6MA 3K5LA 1VSMA 2BHNA 4FLWA 5HP4A 4R63A 4XIUA 1G15A 5DK5A 3BJYA 3BQTA 2LYHA 1H38A 3QETA 2BCQA 9ICWA 3NHGA 4PHPA 1NK7A 1REVA 1U04A 1ZQYA 3FYHA 3QE9Y 1KLNA 2ALZA 4RT2A 4KLMA 4DFJA 5KFSA 3TAPA 4QZ9A 2PFOA 3ZT2A 4J2EA 4B9LA 1Z3EB 5J0TA 3ASMA 1U48A 1C6VA 5KFOA 2ASLA 9ICMA 1JLEA 3B6OA 1ASVA 4KTWA 5J2HA 1YTUA 4YR0A 1XC9A 5KG3A 3ZDCA 4IRKA 4F3TA 3U3GA 1N5YA 1ZETA 1ASUA 3F9KA 3MGHA 5J2AA 1ZQGA 4DU1A 4BDPA 1VSJA 4TQSA 4EP4A 4NXZA 4O44A 4PH5A 5KT7A 4O9MA 3AVAA 5L1KA 2OWOA 5L1LA 3RB3A 1BQMA 4UAZA 4CJ5A 4KHQA 2G8WA 3GIJA 4NCGA 4F5OA 4ZH4A 3UXOA 3ISCA 4QCLA 4KI6A 3MXMA 1TL3A 1BVSA 4B3OA 4FCYA 2JEJA 3LWMA 3OYIA 7ICTA 1T05A 5DQHA 4JV2A 4KB0A 4JWMA 4KLGA 1T8EA 4EZ6A 4CEEA 4HUFA 4CJ3A 4GXKA 4B9VA 9ICIA 4CGGA 3LPTA 3NGDA 1RT5A 3OYKA 4M6WA 4OGEA 4M3TA 4R5PA 3SPYA 4DLGA 4IQVA 4EEYA 4RQ4A 4RNNA 4K8XA 3TAFA 4MEYA 4RW9A 1JXLA 1JL1A 2YNFA 2HW3A 5HMLA 2EX3A 4ED0A 1HQUA 3VQ4A 3AVIA 3VN5A 5HMMA 2HHVA 1UA1A 4I9LA 4R64A 4QZIA 3C95A 9ICPA 5KFWA 3DYAA 4DF8A 4P2HA 4DMNA 2F1HA 4N76A 1DLOA 3TFRA 1RZTA 5KFQA 5J0PA 9ICCA 2X74A 4DOBA 5CWRA 4FLZA 4FM1A 3S9HA 4R66A 4M42A 3L8BA 3PW7A 1X1PA 2GBZA 5L1IA 1S1TA 1GOBA 1VSHA 4DFKA 5J2KA 1N6QA 2C28A 3BQ0A 3C1ZA 4DU4A 3IAYA 1RTDA 3FFIA 4KLIA 4BWJA 4ECWA 4W5NA 4YMMA 4UQGA 2BQRA 1LAVA 2XRIA 5HP1A 3B0XA 4RQ1A 4FS2A 3KLIA 4F5RA 4OLBA 1RPLA 4KLOA 1Z00A 4ID1A 1EXQA 2D5RA 3ISNC 1BPYA 4KLFA 2IMWP 3HYFA 3RB4A 3RMCA 5CJ7A 5J0WA 4K4IA 5JS1A 4QW8A 1A5VA 4M3UA 4DS5A 2YNGA 1JLBA 2P66A 4AHTA 4N41A 1U45A 7ICQA 4CHNA 3THVA 1RDCA 4I2CA 3Q8SB 3BQ1A 4MFAA 4RQ3A 3WNEA 5KTQA 5DDYA 2Q3SA 4E89A 1SV5A 3ULDA 1BI4B 3V7LA 7ICEA 4Z0UA 5DMRA 5HHIA 3H40A 1T3NA 5IIMA 4HVJA 3SYZA 4RPXA 4CERA 1HJRA 4NCAA 2ZTEA 4FJNA 3MEDA 2PI4A 3T5HA 4DG1A 3UXPA 2D0AA 4YP3A 4OPJA 3TWHA 1L3UA 2PFNA 4QZAA 1BQNA 1ZBLA 4CJPA 1JKHA 3DMJA 1HNIA 3AVKA 4BXOB 3VQDA 4MEXA 1YTAA 2FMQA 1RDAA 3RH4A 3V9UA 5J2JA 4H4MA 1COOA 3DLGA 1T4GA 3UIQA 2KZMA 8ICWA 1BGXT 2JZBA 4OKEA 2C2DA 4QWEA 2BGWA 1SL2A 3L2QA 4OKKA 2PXIA 1TV9A 3AUOA 3NH2A 3ZDAA 1XWLA 4K4GA 2P6UA 1ZQVA 1YVUA 4IBNA 3C6UA 4CGDA 7ICVA 1L5UA 4FK0A 3SQ2A 5SWMA 4EYIB 3SV3A 3TABA 4BGDA 4I2FA 4XUSA 1ZQFA 1ZQPA 1VSFA 2OPQA 4CECA 2BCRA 2BCSA 3L3VA 4PPXA 4N47A 3OYHA 4F92B 3A2FA 4Q44A 4BE0A 4ID5A 4CFAA 1IH7A 3RH5A 1RYRA 3K2PA 1CUKA 4UB3A 5EWEA 4OGCA 3RJEA 1TK0A 5CY4A 4CGIA 1ASWA 4RZRA 3QIPA 2UVRA 3SUPA 9ICQA 4E7JA 3DRRA 1TKDA 1NK9A 1HUOA 3O4QA 5KRSA 2IC3A 4BXOA 3SPZA 1EXNA 4RUAA 3H8WA 2OPPA 4Q8EA 2HVIA 3AA5X 3SNNA 4FZZA 2ZJ5A 5KFRA 1J54A 2W9CA 2BE2A 2ATQA 2B6AA 5CR0A 4PHEA 3DOKA 3UQ0A 3OVNA 4B8AB 3OS1A 4ZTJA 3V6DA 1RBUA 4YVZA 7ICUA 1K1SA 1FXXA 4UB1A 4O5EA 4XA5A 5TZVA 1L3SA 3OYJA 3QEVA 3PMNA 5KGXA 4NM2A 1U49A 4ELUA 1J9AA 1TVAA 1BPXA 8ICHA 3PW2A 3AVBA 3VQ6A 3HXMA 3MDCA 2AJQA 3IM1A 3BGRA 1JLQA 4GXJA 3S3NA 4MFFA 3V9XA 1NJXA 5DGBA 3K57A 1RT2A 1K6YA 1N48A 4YNQA 2E4LA 5HROA 4GLXA 3MR6A 2FLPA 2BQUA 2NRXA 4FJ9A 4IFVA 2XCAA 1ZQEA 4EBDA 8ICXA 3KK2A 4QWBA 1ZQCA 4KTQA 1K1QA 2WOMA 2I9GA 3MR5A 1TKXA 3V9SA 3T5JA 4F5QA 3QEXA 3LK9A 3EY1A 2GUIA 3EWAA 4IDKA 3OGUA 4CEQA 4I27A 1XSLA 3M8PA 4GXIA 2QK9A 4KTZA 5KFUA 5KG6A 2FBVA 4F4ZA 3ZSOA 2DFHA 3MR3A 2ASDA 7ICKA 3QEWA 4LZGA 9ICHA 3ZDEA 3QZ7A 1VSDA 3OJSA 4IR9A 4GC7A 1CLQA 3KHRA 1HRHA 3C21A 4PY5A 3RRHA 4RQ8A 3C2LA 3JYTA 3JPRA 3NDKA 3KLFA 1LB2B 3MABA 4DEZA 4NLNA 3MXJA 4CK1A 1PZNA 1S0MA 1IKXA 1KVBA 3ZSZA 2P5OA 1S1WA 4I2QA 3RMAA 4I2EA 2OPSA 3CFPA 3Q8KA 2F8TA 5DQIA 1CZ9A 8ICSA 2J6TA 2PFQA 2D0CA 4RUCA 4ECSA 4NY8A 3OYNA 3ORYA 2GWSA 4M04A 5J2QA 1FK9A 1MU2A 4FM0A 3AVLA 3GV7B 4JV1A 3M8QA 3TAQA 4CEFA 3ZT3A 4M0AA 4CE9A 1RDBA 4B9UA 4CEZA
chains in the Genus database with same CATH superfamily
7FD1A 3RB0A 3NS5A 5CZ1A 4KBOA 2H5JB 5J2PA 3KTQA 2J0XA 4DV4F 3N7RC 4X84A 1ITGA 1A0PA 4OI4A 1NSAA 5FLXO 8ICNA 4AT1B 3VGVA 3OYAA 4G3IA 1JCEA 1ZA2B 2DNLA 4AILC 2QWRA 1WWVA 2NSBA 5AKXA 4DR5F 4FM2A 3ZZZA 1HKGA 3PIOL 5HO4A 4J9SA 1VQPS 2NLXA 1ZXOA 4GIBA 2K8AA 1Q3VA 4I2BA 1C1CA 2BR0A 1VS3A 4FVCA 2XNRA 4FFDA 3WXLA 1ZQNA 4OZ0A 4JKHA 3PRDA 3RMBA 3O5TB 5J2IA 4BJQA 5F0UA 5KOXA 4FOIA 1X2IA 4CJRA 1T6DA 5F9NA 1O51A 1HQEA 8ICOA 1K8KB 1T02A 3I0SB 2MB0B 4LF1A 2AD9A 4ZVTB 2GZOA 8ICMA 2V2ZA 2UXCF 1N5WA 4P0QB 3UFCX 4PEOA 2XM3A 5LJWA 4HACA 2MAXA 4CGFA 4Q0BA 1Q82T 5C15A 5LJ3Y 1V3SA 2GJ2A 2QKQA 3NGUA 1KEJA 4FW2A 1ZXIA 3OL8A 1HBNA 3OT9A 3QT5A 2JZ5A 2CNOB 3P5TL 2N3OA 4KKOA 2W42A 4NLWA 2RKIA 3OYBA 4C0OC 1JLAB 2DH9A 1JJCB 4RNFA 4DV3J 1Q78A 5G0RA 2WF9A 1BQMB 2AIRB 2MXYA 3ZT1A 1PJ7A 1U26A 3A8KA 3CDUA 1BOTO 1URRA 4AE5A 3HT3A 1UQVA 4USMA 5BYSA 4EX6A 4LIWA 2ZH4A 2MQOA 2X78A 4B3MJ 3MM6A 4MFCA 2YB4A 3ZT4A 3ET6A 2ZM6F 1XNRF 4B9NA 2YX1A 4RNMA 4KN7A 4KX3A 2MKJA 3QZ8A 3WK4A 5AQYA 1G2EA 1Q7YO 3HP6A 4BRNA 1RWUA 2R7RA 2VG7A 2H3EB 1AUSL 1NJWA 2MHEA 3C14A 5F8LA 4MDAA 2EFOA 5KFIA 1BWFO 2RILA 1W2IA 3TW0A 4FS1A 3NAEA 4R0EA 3AVJA 3I5AA 3TX8A 1DTTA 2DPIA 3C3LA 2ASYA 4UTGA 1RK8A 4ES1A 3M5RA 2BOPA 3ZETB 3CJ5A 4XRHA 1WEZA 3LOUA 2C2EA 2DO4A 4PL7A 5JMNA 1XS9D 1YLXA 1VAZA 4IG3A 4FN5A 1X9XA 2Q79A 2YTCA 1VQMN 3O1WA 3TUPA 1FFGB 1GH8A 3C6TA 3F56A 2V8HA 1HMVB 2DITA 4YDUA 2BVZA 3LW5C 3TSUA 3NBPB 4C48A 2XI9A 1M5PC 2WHEA 4B1UB 1HD0A 2V0NA 4F4XA 1H73A 4BVPA 1CQNA 3CJ0A 1CG2A 2YY3A 1HUZA 1S3XA 4ED5A 2VUGA 2ZNYA 2O8DA 3QGHA 4JKGA 5BOLA 2JSXA 1IBLK 1SXDA 4RW7B 4FZYA 2VFSA 1WHYA 3ILJA 3B6PA 2O1PA 2F4VK 3RBEA 3EGVA 5IILA 4AM7A 5L8RC 1IBMJ 2E2NA 3KZBA 2W9BA 3O9QA 1FXDA 1H98A 1M1KO 3CJ4A 1Q8LA 2QB0A 2I2YA 1LK7A 1VQOS 1GAOA 2V34A 2BJ9A 2M2BA 3VQ5A 4JHDB 2HOQA 4JNEA 2XY7A 4DV3K 4OZ3A 3D0IE 4MIAA 2JH1A 1TV6B 1TL3B 3G4SS 2OP5A 5IT9Y 2XY5A 4DSEA 1EQ0A 2OTLN 4G1QA 1HYSB 1K73O 3NP5A 2BCUA 1FWLA 4KB1A 2JEFA 3K89A 3T1YF 4QZ8A 3DI6A 1P9YA 5C25A 4I2GA 3ZNUA 2KXNB 5KL8B 2E1RA 3M8QB 1S6OA 4GKJK 1T94A 5KPZA 3R6GB 4OX9J 3HVRA 2H5EA 1PG5B 1N5TA 3NNHA 1IBMF 1XMOJ 1FO4A 5C25B 2FZKB 4A57A 2KIVA 9ICFA 4C97A 5D15A 1RCXB 2O67A 3HFZB 4QWAA 5TKYA 5F0XA 3VCBA 3FFKB 1NK6A 3L2UA 3PW4A 1N33J 4KSEB 3PO4A 1KN6A 1X9WA 3ED5A 2VWJA 2AJFE 1T9TA 5DB7A 4FBUA 1FVSA 2E8PA 3EXCX 4FWRA 4JS5A 2W6KA 4U7CA 1UA0A 2CQ4A 4F4YA 2FF3B 4ZHRB 2YXLA 3WHIA 2BKEA 4F02A 1HBMB 1VK3A 3Q8PB 1F9EB 3MEEB 3CI5A 5M2UA 5CHGA 2BGGA 2HHHK 1JNRB 2WZ1A 3QUQA 5KFXA 4J7CA 4KHWA 2IHNA 2B51A 2F1IA 4GVLA 3Q89A 2OTLS 3ZSQA 2GQCA 2CJBA 3AVGA 2YX6A 2AXTU 4JV5K 2NV3A 4KAZA 2ZKTA 3MUMP 8ICTA 1RM6C 1RT4B 4KE5A 1NPRA 3FRZA 3C1YA 1KNZA 3CCWA 3TAMA 3T1HF 2X7IA 3ITHA 2EFGA 2FLOA 2VG6B 2A42A 2KXFA 2QE5A 3G6VA 2BUNA 5B0DA 4OX8A 2DGVA 4DUTA 5DBBA 1KW4A 2XHWA 1NHKL 5GIOA 2EAMA 3FRYA 2DQNB 2FHJA 4OMFG 4JRQA 3Q8VA 4DQRA 2ESEA 2DNKA 3O3FA 3ZFVA 2IA6A 4HTJA 2AF6A 4JI2J 4CK2A 2ZDPA 3NS7B 2A19A 2PMHA 5I9EB 1IQZA 2RDIA 4YMEA 1UCVA 2HHHF 5BPCA 4IYQA 1I3OB 3R6LB 4OLAA 2J6SA 4IJNA 3CJ8A 2YX4A 2O8EB 1A7GE 3S01A 2IOFA 1VQ6N 3HWTA 3SSQA 4NLSA 5AQUA 4Z4EA 1B9FA 5J1EA 5HBMB 7ICNA 2HF4A 3OTBA 1N34F 4RW6A 4YXJA 1NI3A 4JI0K 3WIUA 2E9TA 4P2SA 5C42A 5DDQC 4CF8A 3WK5A 4CBWA 1YT3A 2HWIA 3EVMA 3D2FA 5AI9A 4ZCIA 1SQKA 3MDQA 3QBWA 1WG5A 2JGAA 2W1BA 1FE0A 1RT6B 2D4WA 3LL3A 2J4RA 5B0GA 2CJYB 1P9QC 2W9AA 1B9DA 1QVFM 3ELHA 1IBKF 1SQFA 4FLUA 3O4WA 2BPGA 4NA3A 4H0TB 3IMQJ 2ZHBA 3BM7A 4TUPA 1T0TV 5HHHA 3VF0B 2P5GA 4KH4A 4W4MA 1FJ7A 3EL2A 2KIWA 2X3DA 3N0VA 4ECZA 8ICAA 2DHGA 3HOTA 4J9PA 1LWFA 4KLQA 4P4OA 3SCKE 1G4CA 3AVHA 1NG9A 2OMLA 2K7JA 4NXMK 2HSEB 2ZZNA 3T7ZA 3T69A 3TTCA 2VWKA 4E7HA 3PFOA 1VCTA 2OJ3A 1Q8BA 5KQ8A 4H03B 1FT8A 1SB3C 5HBMA 2M3DA 4DUYJ 1S9EB 1ZAVA 4YHHK 4MKVA 2IDOA 1RWPB 1WSEA 1N36F 4ZVGA 5E3RA 4OV6A 2EWHA 1HNZJ 4B6JA 2AGPA 5M1QA 2DCUB 4KV8B 3TRGA 2YMPA 4Y2IA 1BO5O 4PA1A 1A6LA 4JI3J 1HBMA 3JAMY 5IWAF 3OYMA 1RWNB 4FJIA 4A8MP 2KHCA 2MA1A 1KTVA 2DR8A 4OHWA 4M9NA 2BOAA 2NPIA 2W9CB 2MSSA 1FWKA 3VQ9A 1U1MA 2YWGA 4JI8F 1VISA 3VAGA 3BR9A 1SZPA 2P9EA 4ECYA 2PIIA 3UVJA 4ES2A 1XNQJ 4ICAA 4F2SA 1Z4UA 3Q8UA 3L2WA 4KHNA 3V6HA 3QEBZ 4CF9A 1JXBA 4ED7A 4FPBA 1T9XA 3UQSA 3LVVA 3Q23A 2NR0A 4DR7F 3RTVA 5JJBA 4DDFA 2A1JA 3FQLA 4DTMA 5BR8K 3M6KA 4HKQA 5KFCA 2QN6B 2OEHA 4BVOA 4TQRA 3NF6A 2F96A 3IS9A 4NWBA 3AV9A 4B1ZA 2CQPA 1OVYA 1SB6A 3CCTA 4A5BA 3CM5A 3IG8A 2Y1JA 3BH7B 2E44A 2LXUA 2CA9A 4J91A 3CCLS 3GONA 4CEDA 1WTFA 3DU5A 5J2EA 4Y28C 1SL0A 1U6FA 1T05B 1M5OC 2MKSA 3DRSA 3O0FA 4MHVA 1Y9OA 1CULB 2IIRA 4J9LA 3LAMA 4PPZA 2IAJA 3SI8A 3W9JA 3KLHB 7ICIA 5CE3A 3MAAB 2UUCF 5AM0A 1Q7YT 2CQCA 1HNIB 1XHXA 2DGXA 2HBMA 4JS4A 2YH1A 3DLGB 4DR2J 4IOAQ 3S6JA 3PO5A 4LVOP 3BR8A 4P2XA 5AXMA 5A8RA 4CIGA 1NB7A 2QYGA 1RQNA 1HWIA 2FJXA 3CFOA 2OPSB 5D4NA 1HHSA 2W7PA 2P9IA 4ZPVR 4DR7K 4EHTA 1HBOA 5KG4A 8ICBA 5BRHA 3VGMA 4B3RK 1GXTA 2PEHA 5L39A 3G82B 5AQOA 1DBDA 5ALYA 1UP1A 1WDTA 3ZO7A 3GL1A 3FEYB 2O8FB 5ETSA 4P0PA 4F0KA 1FTCA 1U09A 2CUYA 5BR8J 2KSOA 4V19X 2B5JA 3CIPA 2PY5A 4PHTX 2CPJA 4F3OA 3M6XA 5LSOA 1VJWA 1IBCB 4RWWA 2QA4G 3CETA 2JNJA 2CQ2A 2W2QP 2VA2A 5BPMA 2ALYB 1RKJA 4CF2A 3VWSA 2OELA 2E66A 4JI0J 2OMOA 4DCHA 4ZCLA 2M8DB 2UZAA 3FBFA 4EUVA 2P9KB 4Q45A 1Q0NA 3C5FA 2LYVA 1NAQA 2D0OA 3TOQA 2QLFB 4YY3K 4FYVB 3GJQB 1XNQF 4PZOA 2NXEA 4CLFA 2B4OA 4LMZA 3IFRA 3LP0B 1WSIA 1CJVA 4CLTA 5HP1B 4C8MA 1B3TA 1N63A 4K0KK 2WTFA 1EETA 4TSXA 3RVCA 2OANA 1NK5A 3KMSA 1S0VA 2U1AA 3RW7A 5FIIA 1X0FA 2GH1A 2I5JA 4B3TJ 4CHPA 9ICEA 3BN7A 5J2MA 5C7PA 3GJRB 3ZETA 3HRDD 4CZHA 5J2FA 3WNFA 4OKJA 4TUQA 2QMXA 3M8YA 1PVRA 4PQUB 4UATA 3MECB 5T14A 3HO1A 2B21A 3R1LA 1SV4A 5ELZA 2QWLA 2KFNA 3UKUA 1X40A 4ILGB 2DY9A 2YKOA 2QLJB 2HNYA 2LA4A 4B1XB 4GVMA 3M2VA 1JLFB 4IEIA 4AHSA 1SJFA 1FKPB 3KJVB 3R1XA 1R8CA 4KREA 1VI7A 3EM1A 1Q82O 3PJXA 2B7CB 2CRXA 1NHVA 4US9A 9ICKA 2HFOA 2IS3A 1I5OB 3SUOA 4RPZA 1ULRA 4NZ0A 3THWA 2Y1IA 4C8OA 1S57A 1HWJA 1REGX 2Y8YA 1URJA 3NKYA 2Y9TA 2E88A 2C3PA 2R2TA 5LMUF 3VGLA 2HDOA 2QT7A 1U7LA 3LVWA 2B4UA 4C11A 7AT1B 3SCLE 2Q0ZX 2RQMA 3Q8QB 4IEEA 4ED3A 4F36A 1M5KC 3PIOQ 2F3JA 4O0JA 1IVZA 1VQ9S 5C2CA 3HD1A 3SZ2A 4LQ3A 1KC8T 5EWGA 4BC4A 2YV0X 4PQUA 4ED1A 3UKRA 1CJUA 3J81Y 2HHPA 1SH2A 3CD0A 3RSEA 2W4PA 4NLZA 3DXSX 4Z6DA 4WYLA 3G86A 4KHMA 4TKTA 5EE0A 3OLBA 4CO3A 3HHLA 2CFXA 4IH5A 1Y4ZB 1CJVB 4DR6F 2GFFA 4PWDA 4CD1A 2ZNZA 2V52B 2DGOA 2HS0A 1SQEA 2RSQA 1KFDA 1AROP 1WBDA 2G8IA 2A40A 2FPKA 2WTUA 3VALA 3NTUA 3BDPA 4X62F 1FKAF 5F8MA 5KFKA 1W7AA 1E6VA 4DTNA 4DQSA 2PGCA 2YI1A 2G2ZA 1TYQB 2UXDK 3E51A 1I39A 2XMUA 4JKAA 4PG5A 4I0WA 3VQAA 1NGAA 3A3NB 4K2JA 3VQQA 1KFTA 2O6KA 3S3OA 3NOCA 2IBKA 2YWFA 3VAKA 3HM9A 4K5RA 3BYPA 3U1NA 1U2VB 1FKPA 4WTOB 2Y9HA 4I2PA 4FJ5A 1UOCA 1T9YA 4FLYA 2AP6A 4M94A 1O0PA 3ZTRA 4DTSA 4X65K 1MN8A 4DX8H 1HJOA 5AHXA 4OI2A 4PG4A 3W2VB 3SJJA 3OYDA 5KT6A 4UAVA 1XMOK 2FVPA 4JKEA 2A3JA 2XZWA 2HAFA 2EFVA 4AL5A 5DJBA 1TU0B 4OJLA 4Z4CA 2ETJA 2BBEA 3B8AX 3G6YA 5FDLA 3QO9B 1ZTTA 7ICFA 4YB1P 3KK1A 1P8ZA 3V9ZA 4GMJB 3I5CA 1CBKA 2J9DE 1RA6A 5ALZA 1VK8A 5JTIA 1YJUA 4PKDB 4OYAA 3C6TB 1S5JA 4DR4F 1V9PA 1UWAA 4UOGA 3BGFA 4QOTA 1WDDA 3OW2M 1J5EJ 4ECRA 2GVDA 3KFUF 1MW7A 1SL1A 4HHHA 1ZD3A 2PE8A 1F0XA 4HUGA 4PZVA 1TK5A 2HFSA 4PXBA 4JKGB 5KG7A 5MAOA 2JLGA 2I6WA 2FVQA 1U25A 2K3KA 1Y5NB 2W8LA 4QPXA 4CRXA 4BRDA 2PT0A 3UDCA 4P74A 4WXWA 1X60A 2QFIA 3SQGA 8ICRA 1FKOB 2MQ8A 3G87A 3VEWA 4H5TA 1JLQB 3I55S 1XJWB 5KT4A 3F41A 3RB6A 2A6AA 4F50A 5HMXA 3ZX0A 2O8FA 1RAIB 3P83D 3N6LA 2M88A 1DJ0A 3Q8MA 5ALJA 2PD1A 4QJFB 5CA5A 1JQGA 2Q1NA 1ZQHA 4NLVA 4LF8J 4EFHA 2VJUA 1AT1B 4ZVOB 2FPMA 3OR2B 3V7KA 2NRZA 2AJ1A 1TUUA 3EKSA 4M41A 1DT9A 5CZVA 1JLBB 3QEAZ 1S97A 2GGPB 3BBCA 2KDOA 5C24A 2IVMA 2EC2A 4M1KA 4BRQA 5D4OA 4KLJA 1T3OA 1SH0A 5E3PA 3MAAA 4FBTA 5LM7E 3GIIA 4P0QA 1RT6A 4NL5A 2KJVA 1KVIA 3CJ2A 1QUVA 5AXLA 4P10A 3CW2C 2OEJA 5CD4H 3C23A 1V38A 2VG5A 4IFEA 4DUZJ 3DCAA 1JXVA 3GV8B 4J8FA 2GWJA 4FPIA 3R7SB 1VR6A 5AQPA 3QEIA 1Q9XA 1YQHA 1U9LA 7ICJA 2K60A 4LF7F 4NASA 2F2AB 4I67A 2LEBA 1WYGA 3OHRA 3EEQA 4JI7F 2MGZA 1NM2A 2EWSA 1NJZA 4OD0A 4FDFA 1IXKA 2FC0A 4N56A 1RUSA 2ZM6J 2R2UA 5GMDA 5D78A 2WB4A 4CH1A 1DXSA 5K14B 2E1AA 5MLCV 3KWMA 2AYMA 3OBYA 5K8PA 3FSYA 1HW9A 5J0SA 1Y97A 3BV8A 3J7A1 4ZTFA 4O8KA 1P1TA 4CT9A 4RQ5A 2KG5A 3ZTPA 4KFBA 1T9UA 4LF5J 5AJ3F 3DOKB 3LDLA 1S9FA 4M63A 4DU7A 2G08A 4N8OA 3JB9k 4CF3A 3FJ2A 4OFZA 3KLIB 1A77A 1QQ5A 1I6JA 3NAIA 4DSLA 4C0BA 4U7BA 3EDQB 2D0BA 4RNHA 3SSSA 2CNLB 3WC2A 5AFUH 2G13A 3DKDA 1IG8A 2KN7A 4HHTA 4MKAA 1TAQA 4Y2AA 1SCJB 4OO1J 4P73A 2BPCA 2LQ9A 4GV6A 3ZZYA 1T95A 4CFBA 4YOXA 2Z2LA 2EDUA 2VIHA 1NOYA 2VKQA 4D3GA 3M8WA 2VA3A 4KLTA 1S1VA 3N9UC 1HKAA 2NZ4A 4CI6A 2VDHA 1WCNA 4CLWA 1KQSR 4X62J 1N0VC 3PR4A 3AJDA 5H1SQ 4BHQA 2JWKA 5DETA 3WBZA 5KRTA 3NGYA 2UU9J 4WYWA 1BG3A 2K4PA 1RDFA 4F91B 2PC6A 5KFVA 3GYXB 2I9SA 1FFUA 1LW0A 1S6PA 3MEEA 4DR4J 4M7XA 3CP8A 1JLGA 3JPPA 5HI7A 3BO4A 5I3QA 1DK2A 5LT5A 5ALTA 5KGWA 4CJUA 1ZQTA 4C3MA 5IC4B 4JI4K 3UM9A 2JC1A 2KJ9A 4OPKA 3G71N 6FDRA 3AO4A 1WELA 4E3SA 3J80Y 1O13A 3UB5A 3UPQA 2KQ2A 4OI0A 3GFHA 1OH8A 3LGHA 3JYTB 3KJVA 3QGIA 4UZBA 3L7UA 5DB9A 1IG9A 1IV8A 3J7ZO 4LZDA 3SMSA 4KT0C 5AI0A 2FLNA 3IC1A 1D4XA 2GJFA 3BO3A 2Z1JA 2E6MA 3ICLA 3K5LA 2XMMA 1TFYA 4C4RA 3LDPA 1VSMA 5J1NA 2BHNA 2HI0A 3QXGA 5HP4A 1HARA 3ZTQA 1G15A 3BJYA 3DN9A 4LIRA 3BQTA 1HR0J 3QETA 1HR0F 5FPMA 4JHDA 2IVYA 4QIGA 3NHGA 1HHQA 4WWSA 3NLCA 1QDUB 2XI3A 3NVMA 4USVA 1DURA 1OY9A 5EVZA 2A18A 4RT2A 2M0GB 4QZ9A 1SV5B 2KO1A 3AFGA 4AYBC 2D74B 1XERA 3I5BA 3P6YC 3D6JA 4BS2A 1ATNA 1NNDA 1DQ9A 2XSJB 4DX7A 3VC8A 2CH6A 1YTUA 4LR9A 1FFWB 4RQNA 3T41A 5HSPA 2MKKA 5AKLA 1QTNB 3U3GA 1KOOA 1MMLA 4R0JA 2F9WA 3MGHA 5J2AA 4BRHA 2NUUG 2WMMA 1YGYA 5EXWA 3W60A 4BDPA 1HKCA 4EP4A 4ZP7A 4AFFA 2KD1A 1OJ4A 1S1XB 5KT7A 4O9MA 2KE7A 3AVAA 5L1KA 5L1LA 1BQMA 2GO9A 1Z1VA 3W5XA 3BREA 3MPYA 4Y2CA 3GIJA 2E5LF 3VF4A 3WUHA 2YMMA 4QCLA 1ZS6A 3VETA 2HOIA 4KR0B 4KI6A 3MXMA 3U9DA 2M9KA 2RHFA 2CPZA 2AKWB 3M6VA 2JEJA 7ICTA 2V4JA 3F9MA 3ONQA 2P9SB 3U26A 2GIFA 4QIWD 2VDIA 2KYZA 3DLJA 4HEA9 4KGVB 5T7LB 1WC4A 1VQLN 1FRXA 4LJMA 3FMWA 5ALGA 2ZJRQ 4IQVA 4ETXA 3QX7A 1X5SA 2ZE2B 5HJYA 4K8XA 1FFVA 5BXIA 3THYA 1CJTB 4RW9A 5HMLA 4FL9A 1Q8KA 2IVOA 2VG7B 3TZYA 4ED0A 5L1MA 2ZH9A 3VN5A 4CJ7A 4X4UA 1U1NA 3MOZA 2QL5B 4I9LA 2ZIXB 4QZIA 2MEWA 3X3UA 3DM2B 4DV4K 4DF8A 4DMNA 3DV9A 3TFRA 2V7ZA 2EK6A 1RZTA 5KFQA 1VOMA 3AY9A 4DCCA 1Y00A 9ICCA 4UB6U 3SAHA 4CLUA 1K0TA 4M42A 2DGSA 2A5XA 3VEYA 5HANA 2GQQA 3OR2A 4EK2A 2EQYA 4DX6A 4DV7F 2IVPA 3EZWA 1PBUA 4YY3J 1KWMA 1CZAN 2E5JA 4JD2B 1KONA 4W5NA 4YMMA 2X3GA 2BQRA 1MLAA 2G1DA 2JLFA 3F0NA 3SAGA 4KLOA 3IBFB 2H1YA 4HT7A 3FBCA 1BPYA 4KLFA 1KKHA 3CCUS 3R5AA 2VFRA 3CO9A 3RB4A 2F40A 5J0WA 4H54A 4M3UA 4DS5A 3MAHA 3PTWA 2E1PA 2HKEA 4ED4A 2P66A 2BX6A 4AHTA 1U45A 2HOEA 3THVA 2OUGA 2YNFB 2HZVA 3WK7A 4OYPA 2YKMB 5KTQA 5DDYA 3I4PA 1R0CB 4DV0K 3G82A 7ICEA 1RB0A 3QB0A 3UKRB 4I2PB 4P0PB 4NLOA 3W64A 3H40A 4NLRA 1T3NA 2UV8G 2ZXIA 4H5RA 3CC7N 1HJRA 5A76A 3WQTA 4B3OB 4W92B 2PI4A 4Y00A 4ZJQA 3T5HA 3GR1A 2DL0A 4BRKA 2HSZA 3TWHA 3QUBA 3UR3C 5CCLA 2PFNA 1SC6A 1JKHA 2QWNA 5BR9A 1F1BB 2WSFC 4BXOB 4CNQA 1HA1A 2QLXA 2E1CA 4MEXA 1RDAA 2B9YA 4V19J 3BPSP 4A8WA 2KZMA 2GW8A 2H51B 1JCFA 3ZX3A 2AJ4A 2AZ1A 2MZTA 2P9PA 3CTRA 4OYWA 1VDVA 4QWEA 3O1LA 1OYDA 1TV9A 3KHYA 4QNLA 3ZDAA 2CXYA 3D2NA 4K4GA 3UNYA 4A62A 3A8EA 1TL5A 3MCSA 4GV3A 2EZYA 3W9HA 5KAKA 2BUPA 1NPPA 1F5BA 4LF4K 1UFKA 4BGDA 1ZQFA 2OPQA 2BCRA 4PPXA 3AQEA 4OI6A 4Q44A 4K8RA 3VF6A 4CFAA 1KQFB 3ICXA 4LFBJ 3QDKA 1RYRA 1KC8O 2P2CB 2B0CA 1RT3B 1TK0A 5CY4A 3VESA 3SMVA 2DISA 2OLWA 5AI8A 3SMZA 4E7JA 3AQFA 5ETKA 1UFLA 1R0AB 2OPPA 3RBZA 4BRFA 4AXJA 2HVIA 2AJ2A 3AA5X 1WF2A 3ENOA 3QAUA 2VODA 1YF5L 1TUGB 2Y0BB 3OR1B 4ZCKA 4UF4A 2HG4A 3QGPA 4ILJA 1WC3A 4B8AB 4ZTJA 2FD2A 3VTIA 2IDEA 3NGTA 3CPWM 3PMNA 2VZ9A 2JVOA 1MA9B 1TVAA 2VOPA 1BPXA 4B17A 3CRXA 3MOJB 1ICEB 4FXWA 4X4PA 3HXMA 3MDCA 2QV6A 3IM1A 1T9VA 5B0BA 4OZJA 1EJ7L 2WW4A 3RYLA 5ETOA 2I38A 4JI4F 1JJ4A 2X1FA 1J97A 5EX0A 4QBUA 4OL8A 4QQBA 5DGBA 3BSOA 3SQGB 3IAM9 2I5HA 5AKJA 3FVYA 3BF1A 3BPDA 3NRWA 2FJ6A 2BQUA 4IFVA 2XCAA 3HKZD 2FI1A 1ZQCA 4KTQA 2OIHA 2WOMA 3HHLD 1X31C 3CULA 3O8MA 2IM3A 3T5JA 3DJCA 3LK9A 3GZFA 2G5IB 1VIXA 2FSKA 1HUXA 4CEQA 4L76A 3H42A 2KP7A 4GXIA 4WFZA 2XIDA 2FGOA 3G4SN 5FLXU 2QC3A 3EUNA 4NLQA 4O44B 1YJ9S 3ZSOA 4EAHD 1NSPA 2DFHA 4MT1A 1NJIT 3J7Z5 3QEWA 4U96A 3OJSA 4GC7A 4FF1A 3ID8A 1CLQA 2R3VA 2Y0SC 3U02A 1NGGA 4G1QB 3GLJA 5HVHA 3C21A 4ZP8A 3RRHA 3AEVA 5G5GA 3TUZC 1LB2B 2X1BA 2HBLA 4CO2A 4NLNA 3HT0A 4MYTA 4DV6K 1ZM9A 4A59A 4CK1A 3AJ2A 2XLIA 4I2QA 1CJTA 4RW9B 1F5CA 2PFQA 2V8DA 2HGNA 3POTB 2ZBPA 3ORYA 2GWSA 1FK9A 3TA0A 2HFNA 1AQ6A 5EOYA 3IA0A 3GDQA 2V50A 4M0AA 3RJMB 5FLXY 3QESA 3S3MA 2E1EA 4FWPA 4QZDA 4ECUA 4KLUA 3L4QA 2FLLA 1RHMB 2XICA 4MFBB 4LF7K 2GQ2A 2KN4A 2A2CA 4ED2A 8AT1B 2HHUA 2XMAA 1VSEA 1OY6A 3JQJA 4YB7A 4JYAF 3M32A 1YITS 5D3GB 2D41A 4PKHA 3W62A 4LH4A 3FDSA 3KK3A 3MAQA 3VGKA 1NOMA 1TQLA 1FEHA 4Y2TA 4M5IA 2MQQA 4CEBA 2X6SA 4IWVA 1PC4A 3SLCA 4Z37A 1QSYA 1ELOA 4JLHA 3T6BA 4DV1J 1TUVA 4BE2A 2F3NA 4CBUA 3QLHB 3CHWA 4H0PA 5M1PA 3C2MA 1RT7A 3QBCA 4QIWC 1V97A 3GIKA 1QHTA 4NLXA 5GAGU 1C0TA 2ZE2A 5DG8A 3PNIA 3PX4A 3BEGB 2LECA 1HHTP 2J7KA 3N97B 3RJFA 3RR8A 4BRPA 4H4KA 4BX9C 2VC0A 5EU7A 4EO6A 1WSVA 3ILOA 3DRXA 4KYZA 4CD3A 1RABB 1S79A 5LSRA 4P6QA 2VASA 1UETA 4Y2YA 2KKPA 4H0VB 3IRWP 1UWBB 3OL6A 1D3WA 2YHYA 4O8UA 1XHZA 3ENVA 1CULA 1A6SA 4HVZA 3VMFB 1IBKK 3VQTA 4DBQA 3CCVN 3DLRA 1BA1A 3CJ3A 2IM2A 4B9TA 2JLEA 1X4HA 3FR0A 3CNHA 1DGKN 2P6TA 3MEGB 2VQFJ 2MMYA 1VBXA 3CMEN 2ZZTA 3CWJA 5BRDA 3E9LA 3A0HU 9ICOA 1HPZA 1SPBP 2MU2A 1H3DA 4AHRA 3PY8A 4JK9A 8ICUA 4FYXB 5KFZA 3CJKA 4DTRA 4LVSA 4DXLA 3E01A 5AZJA 3L2VA 3G71S 1SJ4P 5TISU 1X9MA 2GNKA 3AB4B 3TJ8A 3G6XA 1UVNA 3BBFA 2CPDA 4EBEA 3OHAA 2WAQD 3DOLB 3TAEA 2KT2A 2RF2B 1KHWA 4OIXA 3GYGA 3TTDA 3IWXA 2A1RA 4LR8A 4CZJA 1J5EK 4ICLA 4U9RA 4ERDA 4OJGA 4DLEA 4IOCQ 5M1FA 1ZD4A 3MMJA 3PW0A 2QA4N 2GUPA 4X64K 4L73A 4C6AA 4A8EA 3OFFA 2AU0A 4WK1A 1LWEB 1RISA 4DHYA 1BIUA 4B02A 2RNEA 4UY85 3HILA 3I55N 1VGYA 4FPRA 3FM9A 1X8DA 2BXJA 3O4NA 3CM6A 4OYOA 1CQMA 4UZCA 1VRQC 1V3ZA 1S0NA 4C3KA 1VBZA 2NREA 1VYAA 4FNHA 2NZTA 4EIAA 2V8GA 5CHCB 4B1WB 4F0HA 4OJRA 5IWAK 3U3YA 2VPYB 3GG1A 2HBJA 2RDJA 4H0YB 3M1FA 3GDXA 2DGUA 3GBTA 4OVLA 5LL6Z 2NRVA 7ICLA 5ALMA 2O8CB 4LQ9A 3QU7A 4J2BA 3Q8YA 1RHUB 4FZMA 2EVZA 2J5AA 3RU0A 3GYNA 1OUQA 4CZLA 4I56A 1KQQA 1ZAWA 3PEHA 4C7QA 2KU7A 3BBBA 4QR1A 3S8SA 2O66A 2HNZB 2QRRA 4U8YA 1RBSA 3MDAA 4Z4GA 3PNCA 3GJTB 4XTTA 3I1YA 2UXCJ 3O9UA 4TU8A 3MPDA 3BS7A 3CCRS 3LPEA 4DV6J 3OS2A 3SDEA 3QRQA 4J5OA 3NE6A 1UVLA 1VQON 5GAHP 4WFBL 1FRMA 2A3VA 1YDLA 5AFUA 2IHMA 2ITGA 3IBWA 2W41A 3BDEA 4CYUA 4KLLA 3E01B 2HVDA 5A8RB 3VVUA 1HQEB 3EGWB 4KGMA 1MWQA 1UT8A 8ICZA 1X4EA 1OQ3A 3NMRA 4KH5A 1HX1A 5LXYA 3V72A 5J0XA 8ICIA 2XMWA 3MEKA 2HBZB 5FROA 5ALNA 1H0HB 2P1JA 3ZZRA 1U2RA 4M7YA 3CG7A 3Q2SC 4U7UK 3PR5B 5D0EA 1IM6A 4LF9J 5KFHA 2QA2A 2PMZF 3EPIA 4KLSA 2CQGA 1UCNA 5IIIA 5HVFA 3KG4A 1PO6A 5KFMA 3SQ0A 3BGRB 3IDHA 1Q18A 3NF9A 3D6HB 4H4OB 5KT2A 3M6UA 1NOZA 3JQMA 3GPAA 4DV3F 1TL7B 2HGMA 4F93B 4OJHA 1MMDA 3SXLA 1ZQSA 1X6IA 4Z6FA 1WKKA 1ZRNA 3CDBA 3CJ9A 1FVQA 2HRTA 3L4PA 3DDNA 2VONA 3VAHA 3MCNA 3OHBA 1U1LA 1LWCA 2C3YA 4A8FA 3FBBA 3Q8RB 1UEUA 1S9EA 1S1UA 5KG0A 1J2NA 5AQNA 2MRLA 2HCFA 1VQ5N 1S76D 3EMTA 3THTA 2RJZA 2WK4A 5BREA 4DR1F 1IBLF 4ANCA 1QCKA 2B6AB 1N8RO 3CPWR 4RWXA 3JAMU 4MLHA 5G4DA 2IA0A 8ICYA 1IKVB 1GEHA 2AQ4A 4H4MB 4B08A 1LKZA 4CT8A 1U1KA 4IH7A 2Q1LA 3PVXA 4X4NA 1BCMA 3CC2N 1RT2B 4DR6K 1PC5A 4ANEA 4OQJA 5DZ6A 3S7RA 2G8UA 5B8HA 4P7TA 3AY0A 1VC0A 1VSLA 3Q7BA 4DV7K 4NWIA 4JV5F 3RJKA 3K9KA 9RUBA 2GV9A 4OJ1A 2B6GA 3EE9A 3GZ7A 4U67Q 3WXMB 1E3MA 3JS6A 3N5BA 3NCRA 4XDCA 3W0LA 7ICPA 3CC7S 3S41A 3MPUB 3UW1A 1WEXA 1HWUA 3KKSA 2GS8A 4ZK7M 3D68A 3WXJA 4B9MA 4C9DA 9ICSA 2XYHB 5AK3A 3P38A 3ALYA 4HCBA 4DUZF 5KAIU 3QLHA 3H8JA 1M1KT 1P7DA 2Q4TA 1SWWA 3AL0B 5DS7A 3M8RA 2AYGA 4PR6A 4RW8A 3IBCB 1KQSM 5HRSA 3M1YA 4ZN1A 2E1ZA 4BWMA 2O8EA 4EELA 2D1CA 1YK9A 4MF2A 4BRMA 2N82B 3M05A 4CLPA 3WK8A 4IO9Q 4DQQA 5J0RA 3WQPA 1I94F 2QWPA 4E0DA 1YZ6A 4CZCA 4MFBA 2F8EX 5CH7B 2OHDA 2IRUA 2PYJA 4JI7J 3N28A 1HKBA 2XHBA 2K8BB 5JLHA 1J2MA 3N4MB 4DPYA 4FOEA 3LYSA 3G96A 1HPMA 2OEKA 3RGIA 3OBIA 4KPYA 9ICNA 2G2YA 3SCXA 5B0EA 3MUVP 3T1HJ 4PWDB 4RUHA 3L5KA 1I94J 2N3LA 4B3MF 5K20B 4M3RA 2A1JB 3O6QA 4NYNA 3MCOA 3NL0A 1UEKA 4HWIA 4J37A 4B1YB 5H1SV 2GVZB 2HEKA 3GCXP 3MMAA 5J0YA 4O5CA 3CC2S 4CZFA 4YDUC 1CXUA 1AZSB 4CLZA 4A2BA 4RG8A 1A0OB 3OVSA 3D45A 1RXWA 4YY3F 1TV6A 1PYTA 3H2LA 4MIWA 1B4FA 4GMKA 5H9FJ 2CPRA 4CJTA 1JALA 3B4DA 1NK0A 4K0KJ 4UB8U 2GGPA 3NASA 2DIVA 3JSMA 1SUQA 3BZCA 1QVGM 4MK9A 2EFNA 4CJ4A 5EHHA 2NUHA 3ZDBA 4JYAK 1UWBA 3VHQA 1H2UX 1SIWB 3KYLA 2YQ3A 4PXDA 3OYEA 3AHPA 5T41A 3KHGA 2G8FA 1IR0A 4X4TA 2XCPA 1ZQJA 3ITHB 5CYJA 2MLYA 2VV5A 2L41A 2SXLA 1RAAB 3CPEA 5DDMA 2G8VA 3CYMA 2IC3B 1M1GA 1QH9A 3QPIA 2LDYA 4HACB 3CMES 4ZOHC 3PYEA 1CZBA 3EZ5A 2HURA 1C0MA 1BWVA 4NLTA 1S9GA 1NEEA 3D6FB 4MK8A 3VGUA 3VQCA 1Z26A 1XNRK 5SUHA 4EBCA 1EP4B 1LCUA 4B3RJ 4C7ZA 3OL9A 5FJ4A 2CPHA 3LPUA 2PDAA 4M3XA 3BQ2A 1RACB 3OFEA 4DS4A 3AN1A 1V5VA 3PW5A 2DR9A 3CFRA 2C2MB 5KNIA 2I1RA 1FRKA 4CBXA 1YRUA 2FPLA 2V4JB 4I6WA 1NJYA 2QWOA 4J9RA 1FWPA 3RJJA 4AL6A 3JPOA 1HNVB 3L0QA 3HK2A 3LH2S 2HMXA 4JKDA 4P75A 4ZMMA 3KLVA 4LFBF 3KD5E 2OO4A 1L3TA 1M5HA 3IN5A 3RJGA 1ATRA 1UJ6A 4MLEA 3IXQA 4QR0A 4H5NA 5HL7L 1YIJN 3IKMA 3HSTB 2QO3A 1OIAA 1Y88A 3DRYA 2B4VA 1VQ4N 1S6QA 1VJQA 4Z7YA 2RU3A 4KMUA 1RWOB 2BM0A 4DOZA 4HTLA 1X4DA 1J27A 4PUOA 4ER8A 2HBRB 3W2WA 1S10A 3K5MA 1K44A 3DLHA 1WSHA 4BACA 4CLYA 2DKZA 2HB5A 1ITPA 3JSBA 2EBGA 2A2DA 2FHMA 3HDSA 4TY8A 2E7VA 4WXOA 3O6WA 1WG4A 2WHOA 2DO0A 1F21A 1C0UB 3TSPA 4JI8K 1UPHA 4FLXA 5BOMA 3WKCA 2KVSA 3N01A 4H4KC 2R2RA 2DF4B 2HS3A 5AKYA 2QI2A 3M8PB 4YD2A 4UAUA 4K4VA 4F0MA 3R9LA 5FPDA 3DOLA 1F3VA 2GVZA 2YX8A 3P31A 4JBCA 4H5WA 3KNGA 5A2QY 2ZH8A 4ED8A 4DTOA 4ZS6A 8ICFA 4Y1CA 3D2FB 4C0ZA 2VH7A 3VF2A 2AZ3A 4C8KA 1RP5A 1FRIA 4NLBA 4YOUA 3KHHA 3H0LB 2E1YA 3MM9B 2A6OA 2D7SA 3JSMB 3J7YP 3PHEA 1GLBG 3MZIA 5D0HA 4CJQA 1A76A 4LFCF 7ICOA 5DM6Q 3WNGA 1QVGR 7ICHA 2FQQB 2QARA 3A5LC 1NHUA 4C8NA 3RAXA 2ACMA 3GCWP 3R1HA 2HQCA 1YZ7A 4JUZA 5KFPA 3LZIA 1ZM4A 3BGOP 4ETZA 1VRUB 1JJHA 3CCZA 4UOHA 3MC1A 2YVSA 2VWBA 4DR1K 2ZIXA 2L08A 3PSTA 3EE3A 1JIHA 4UB5A 2BKPA 4FF3A 2RMLA 3FC9A 2V8PA 4QZBA 2DYAA 5SZTA 3K0JA 2FXUA 2RS8A 1WHWA 2UUBF 1WTBA 2UUBJ 2GO8A 1VSIA 4DJBA 1SGGA 4YFUA 2JRSA 2C22A 2IIHA 3M8ZA 1H2VZ 3MM5A 1NMNA 4WK3A 2CQ3A 3PSPA 2KOBA 2NUBA 3LDNA 3H2VE 3FZLA 5ALSA 2B43A 4XAKA 3C2KA 2G09A 3ZZOA 3ATUA 4X5VA 3QT8A 2Y8WA 4C8LA 2AGQA 2ZD1A 3KLHA 3ADAC 4OX7A 2W8KA 5DB6A 1F9FA 4UBCA 4DSFA 3W65A 1DAXA 2CQDA 1FNOA 1CS4A 1VDHA 2W11A 4LFAJ 1JXEA 4MJKA 1WORA 2C1EB 4CF0A 5A0LA 3H46O 4IRDA 4DV0F 4DV1K 2DRAA 3MXHP 2PAVA 3QSIA 5CYQA 2G06A 1YJ9N 2YKMA 2UUWA 2WVFA 4J2AA 1ZQWA 4CH7A 4O55A 2V2VA 3H5XA 3B8HA 2Z0GA 1HNXF 3KKRA 1F5AA 3BYRA 4QOZB 3CQ8A 1DEJA 1RTJB 2YKQA 2KYXA 3SUNA 4I29A 1IJEB 2KNJA 3D2EB 1Z05A 1P6TA 4AYBF 4F4WA 3RG6A 4UAWA 3RBDA 4EFAC 4LF2A 5CYMB 4JI2F 2Q66A 4A4JA 4HHJA 1F2HA 4DU8A 3WZ0A 5ETMA 1SKSA 2IMOA 2F4VF 3AA4A 3CB4A 2UXDF 4MO5A 4DTPA 5HLFA 4DV2F 5ALRA 1BL3A 3RF9A 2D8CA 2KICA 1XNQK 4OZ1A 4CK3A 3D0PA 3ZSYA 3HTVA 1YTYA 1NZ8A 2V94A 2EFPA 1ZJNA 5CR4A 4IFVB 4DPXA 2R8KA 4TY9A 1LOTB 2E7WA 4B1VA 3W9IA 5IFMA 4DTUA 3POTA 4KBIA 2B9XA 1FKOA 2HBKA 2QXLA 4IOCL 3J80U 2EG2A 8RUCA 1PJ5A 4IL6U 1NPKA 2KHOA 3V1OA 2W4DA 5B5EU 1RGVA 2OM6A 1ZJMA 2L9DA 4AQYJ 1RWXB 4FNIA 1W25A 3AO3A 2ZGYA 1BHNA 3RBXA 4ZKAA 3HHEA 3MI7X 2BKNA 2VCPA 4DQ8A 1CXQA 4LF6K 1UJ5A 5K14A 4CH0S 2KEYA 1S6PB 3KLGB 5AQTA 4TURA 1BMQB 3HLUA 2P9SA 1X9SA 4J03A 4FK2A 3V9WA 3GILA 3BQ7A 4DR7J 3ZD9A 2N4DA 4DTXA 5HATA 2E5LK 4YMOA 2E20A 4OCZA 3THXA 3MBYA 3PMLA 4UBBA 4YDDB 4KX5A 1LFWA 4Y34A 3DGVA 1QZ6A 3V81A 2ZWPA 4OX9F 1R27B 4DU3A 5FDLB 2WB1F 3D3BJ 3W8PA 2B56A 3M1VA 2EXUA 3EZUA 1RHRB 4M47A 3N4WA 2UUAF 4PZNA 2H48B 4FWNA 3P49B 2ASPA 5FRNA 2FHOB 4NO7A 2FTRA 4YN4A 4CP5A 4F04B 3D1QA 4IFYA 2Q97A 4DB3A 4A8OA 3H0RB 2QIFA 4LRBA 5KFAA 4PYAA 1X4CA 1R8AA 2EZXA 2GHPA 5J8YA 2ZH3A 3P4UB 2KLAA 3KDOA 3WEEA 1SAZA 4P71A 1U2CA 1VQ5S 2EHGA 3A8YA 3DLLQ 4I28A 3F73A 2DFEA 4ES3A 4NM1A 4PWUA 2C2OB 2IM1A 2HMIA 3C65A 3HF5A 4R8UA 5KFJA 3D6TB 3AVCA 2ZDOA 1WWUA 4HH0A 3V6KA 4FWOA 1Y10A 5BR8F 3KK3B 2ZXHA 3AVFA 4JYAJ 1S5ZA 4J9OA 1WKLA 3NG8A 4CZKA 4MMOA 1WNSA 4LSLB 2L5YA 4RW7A 5HAOA 1XR7A 1Z4OA 5KAFU 1B0PA 1WEYA 5ETTA 3QRRA 4L8RB 4HDGA 3PUFA 1RNHA 1RT7B 2V9WA 4M95A 1FEEA 3TA1A 4PHAA 4LSNA 1HYSA 3KLEA 2J0SD 3M9MB 1R6YA 4QS8A 9ICLA 2G8KA 2LMIA 3GV5B 1WOOA 2WVCA 1C1CB 2GV1A 3I32A 4KHPK 1G1XA 1KAYA 2HWHA 2CQBA 3G0ZA 1FDNA 4BBYA 1JJ2R 1IBKJ 3U9ZA 4OHXA 4WU2A 1LKYA 1VQPN 1MN9A 2AGOA 4QZHA 2P51A 3NGKA 4PYDA 2NLWA 2EBEA 2XS7A 4ZOSA 1KXPA 1SVDA 1NK8A 2BKOA 3LALA 1UFWA 1S1XA 4YFKA 1EETB 1IKVA 5IIKA 3TUIC 1TAUA 1XI1A 3CQXA 3PLAA 2PFUA 1S77D 1WACA 1CJKB 2E2OA 3P5JA 5AI4A 4NLKA 2DNNA 2WOMB 5CXTA 2XVTA 4DX5A 1C7YA 4U95A 4FWKA 2VPZB 3H8SA 3KXDA 1DRZA 2LSNA 3NCPA 1CJKA 3EX7B 1BISA 1VC5A 3T3FA 3EJMA 3GB0A 1AA1B 4KKOB 2UVUA 3UXNA 4NL9A 1JB0C 2OA8A 4RPYA 4R8UB 2R7UA 1BDGA 2X6NA 4LF8F 2MSTA 2XGQA 1FW6A 4XQ8A 2J6UA 2UVWA 4L3KA 3ZZUA 2KL8A 2E7XA 2V63A 2A1AA 1XMBA 1IKYA 4DF4A 3I6PA 1U6ZA 2FPHX 4DR1J 1X3MA 4R79A 2CJQA 3O44A 2JWNA 4KRWA 4N8NA 2QM1A 4LF5K 1KAZA 4DR5K 1WG1A 1VFJA 3SSRA 1TK8A 3P45B 1DTQA 1IKYB 2ILYA 3KD1E 5KPRA 3DM2A 2PI5A 2DRDA 2DNGA 5BN9A 5KFNA 5F0WA 3WKAA 3C5GA 3GFZA 2AWZA 3D9BA 2NRWA 4NYZA 5HQLA 3WKEA 2KV2A 5J2MB 4O3NA 2JEGA 1YBAA 1U0SA 2LYBA 2L9WA 4X4VA 1IUJA 3I76A 2WAQC 2DNOA 1Z00B 2BDUA 5KFBA 2W7AA 1JWWA 4A8YA 3D66A 2F8MA 3UWTA 4M9HA 2HFZA 3DHXA 4CHZA 2FE9A 1BCOA 5AM5A 1LWFB 1K9MO 3VQ7A 4MF8A 4FJXA 1VQ7N 5EUHA 3D6MB 3ENWA 3ONNA 1HD1A 3KNAA 1HNWJ 2RT3A 1VSKA 3FE1A 1K8AO 1Q8IA 2CQIA 4JWNA 4LH5A 4RWTA 4DI6A 3SAFA 5IOLA 1KD1T 1VQYA 3F5AA 2KT5A 1IBLJ 1ZRMA 2ODGA 4XIUA 1SC1B 5DK5A 3C8YA 2ZD1B 5A8KB 5KOWA 2LMRA 2J8AA 1KP6A 1NK7A 3CJ1A 2P9LB 3FSXA 5JRTA 3FYHA 3QE9Y 4USIA 3R7BB 5D6GA 2QSWA 4YB6A 2PFOA 2HIQA 4X4SA 1F6TA 1FERA 4J2EA 3T79A 1Z3EB 5J0TA 4AQYF 3ASMA 1C6VA 1Y0HA 9ICMA 3B6OA 3C14B 3D67A 4YHHF 4KTWA 3T9NA 2ZH5A 3QYYA 3M2UA 4YR0A 3M2UB 4WFNQ 2UUCJ 5KG3A 1NGCA 2HLTA 1OSCA 2WFBA 1Q86O 2YMQA 1ZQGA 4NOHA 4DU1A 2FJWA 1H1VA 5F3XB 4NLUA 3M6ZA 2W4CA 1VSJA 2EKYA 4X4OA 3VAMA 4NXZA 3DI6B 5I42B 4O44A 4F72A 4PH5A 3A3PB 2DKOB 3K7RA 2FGCA 4ENOA 5LMNJ 4ZJOA 4EU0A 2BE9B 1L7PA 4Z7CA 3M7DA 4ZH4A 1F3FA 2KRBA 3OXLA 3UXOA 3D28A 1NRKA 4B3OA 5GAEP 3R2DJ 3LWMA 3KOOA 3GG4A 5DQHA 4JWMA 4GNIA 4WQ4C 4EZ6A 4USKA 1FDAA 4IOAL 4EX7A 4CJ3A 2RHKA 4B9VA 4X4RA 3C2PA 3FUYA 1ZM2A 2IDLA 3KMQA 3OYKA 3A0IX 2JOQA 4OGEA 4M3TA 5GAHI 4DR3F 1RQ0A 4K4YA 2BTFA 3R2CJ 4RNNA 4HL9A 3TAFA 4MEYA 1JL1A 3B54A 3H59A 2YNFA 4KH0B 4U67L 2P9PB 1DY3A 5AR0A 3M30B 1HQUA 1TTHB 4K43A 3VQ4A 3UDLA 5ALOA 3AVIA 1XNRJ 1S5LU 1L3KA 2GHVC 1N32F 3GSDA 1UA1A 3VGSA 4ALZA 5C2GA 3E9OA 9ATCB 5KFWA 1H7WA 4ZPDA 1WI8A 5CHIA 2F1HA 4N76A 2QWQA 1HNXJ 3QRPA 1UJ4A 5J0PA 5LSLA 4WQ5C 4FM1A 3CCLN 5IWAJ 4W90B 2DNYA 4JMUA 1X1PA 2FVCA 5L1IA 1S1TA 1GOBA 1VSHA 2MKYA 1GMVA 4DFKA 4NMLA 3AMZA 2C28A 1JLCB 5DRKA 3PCOB 3U1MA 3IAYA 2G1HA 3PXGa 1RTDA 2JWLA 2LKZA 4ECWA 2QEXS 4BC5A 3VPZA 1JI7A 4OHYA 3GE9A 2JFKA 1U02A 2H4YB 3UD5A 2MYFA 4N7TA 3JTPA 3KLIA 4F5RA 4OLBA 2VFVA 5F3TA 1Z00A 4ID1A 5F41A 3ISNC 3QT6A 3BN4A 1ZOLA 2OSQA 3HYFA 3RMCA 4CZEA 4Z2XA 4YUDA 3MWPA 2ZIUA 1FXRA 2ZBRA 4LREA 1JLBA 4DV4J 2PKEA 3AJ1A 4JI1K 1PJ6A 4I2CA 3Q8SB 3BQ1A 4MFAA 4RQ3A 3WNEA 4WFAL 1X4AA 5JU5A 4NA2A 4E89A 1RG6A 1SV5A 3V7LA 3DLLL 2XMJA 2ROPA 1YJ7A 4TY8B 5DMRA 2P9LA 4WYBA 1Q86T 4HVJA 3SYZA 1CS4B 4NCAA 3CC4S 1VHXA 2ZTEA 5HR6A 3MEDA 4IS7A 1X66A 4FVUA 4F25A 2D0AA 4YP3A 2H5IB 1L3UA 1ZBLA 1BQNA 1E6YA 4UW2A 2RQCA 4LF5F 3WX8A 4Y0WA 2Y1RI 2MY7A 5ALLA 1B99A 2JJ4D 3AVKA 2FMQA 3RH4A 5J2PB 4BRIA 1SXEA 1JNZB 3N79A 2XS5A 3PRVA 4WCEL 2N7YA 2FSJA 3NOGA 2LFVA 4UUXA 3QU4A 4G6VB 1SL2A 5EN1A 3NVVA 3L2QA 4OKKA 1MWKA 2VKRA 2ZH2A 2XS2A 1X4BA 2KFYA 1RAHB 2GA7A 1R89A 3CCEN 4OPHA 5AK4A 2X1GA 1LWCB 1VQKS 2J0WA 3SQ2A 2V2KA 2PSZA 3TABA 3MWTA 3SFGA 4I2FA 5BPLA 4XUSA 2HZCA 2MKCA 5GMKa 4I1TA 2H3VA 4F92B 1F9HA 1L8OA 3A2FA 3FC4A 3DXBA 4ID5A 2R7SA 3FSIA 1IH7A 3RH5A 5EWEA 2O8CA 1TMMA 4OGCA 2EANA 3THYB 4RJVA 3QIPA 2CDQA 2F63A 2CVEA 2ZBCA 2W2PP 3DRRA 1UTAA 1TKDA 1SXLA 1FDBA 2IC3A 1EXNA 3GIRA 4ZVSB 3H0PA 4Q8EA 2GVDB 3DRRB 4FZZA 1LW2B 4D3HA 1UAWA 1ESVA 2JX2A 5EX5A 1J54A 2W9CA 2K2PA 5ADXH 1HNWF 1TE2A 2RQ5A 1CSJA 1C0GA 1RBUA 1RAGB 2K8CB 4A2AA 1K1SA 2HNYB 3P4IA 3NVKA 3RZAA 1FXXA 2K89A 1U1PA 1SQGA 2E5HA 5AQGA 1L3SA 1CLFA 3UKUB 3ENQA 3QEVA 2VQEK 4NM2A 1U49A 2E8AA 1DFDA 1Y5LB 1J9AA 4JK8A 5AXNA 4DUYK 1GLDG 1D09B 4B3RF 3UI3A 2MZSA 1JLQA 3P96A 3S3NA 5KPTA 2QLBB 4K7QA 3KZIU 3K57A 2Z57B 4QJVA 1YI2S 3R3LA 2E4LA 1RT5B 3G8TA 1PILA 2ZWHA 4ISEA 2OPPB 2FLPA 2QLTA 1HNZF 4FJ9A 2W03A 1WOQA 1ZQEA 4CNZA 4EBDA 3Q24A 1V4SA 4F67A 3IO1A 1K1QA 1RSCA 2I9GA 1QQMA 4NXNJ 3DXKA 3V9SA 3CNQP 4ID8A 4PL2A 3QEXA 3EY1A 2GUIA 2A1BA 2UUCK 3A12A 3RAMA 4M5KA 3WXIA 3DMJB 2CVIA 3MCPA 1BUXA 2PA3A 4DN0A 4DPWA 1NZBA 2NXCA 2FBVA 3CCQS 2AW0A 2RE1A 4DV5F 4JI5J 4IR9A 2WFAA 3KOAA 5EE3A 3KHRA 4ILLA 1HRHA 1F0MA 3ALRA 4PY5A 3P5BP 3C2LA 2NSCA 2MLXA 3JYTA 3PKMA 2FZGB 3KLFA 3TU5A 4DEZA 3T6JA 1S0MA 2FHKA 3V6DB 1YAGA 3FZBA 3AOCA 3RMAA 3NY0A 4I2EA 2OPSA 4DR6J 3CFPA 1DQAA 4XK8C 8ICSA 3D3CJ 3L4BC 2J76E 4NY8A 3C16B 2LXIA 1U8WA 2FJBB 1TAMA 3A0BU 4LSNB 1EQMA 3AVLA 3EVOA 3GV7B 2F8LA 2N7CA 4CEFA 2YN4A 3ZT3A 2DXEA 4LF7J 5KQDA 4BUGA 2B8QA 4CEZA 4ZIWA 2UXBJ 3FLCO 3Q8LA 1LOUA 3UE2A 1B22A 3CDWA 2H3FA 5GINA 1NU4A 3MCAB 2UV8A 4H4OA 1BPZA 2Z58B 3D54A 5CYMA 1MNEA 3AO2A 4X65F 1VLYA 2BDPA 3UN5A 2QLWA 1TKTA 4DR3K 2O8BB 4HYKA 3I31A 2P6SA 4Y2RA 3NGIA 3UMCA 2ZHOA 5D49A 3HMJG 1VHIA 2XSFA 1L7MA 1YVNA 3PX6A 1R31A 4NRTA 4X66F 1ZQMA 4YQWA 2K8GA 3J7YU 4E1MA 2RUSA 1T7PA 4DCOB 3MN7A 2G8HA 3HHKA 2KJ5A 4ZPCA 4CLSA 4E2FB 2D1KA 2HHHJ 4ILHA 3QIPB 1ZYQA 1T6CA 1FE4A 4FYDA 1RDUA 1F5SA 4BROA 3ISBA 4JI3K 5KFYA 2CRLA 2RRBA 4M5DB 5EWFA 5L46A 5AXKA 4NA1A 4NE9C 2PFPA 3O2IA 4CHOA 4RLEA 3JS9A 4M5JA 2ZUBA 2MUTA 1KRPA 2XWYA 4BC9A 1WAJA 3I4HX 9ICXA 2B5JB 5ALVA 2F7VA 1NKEA 1KBRA 2V4QA 4YDXA 5J2DA 2ZOMA 5AKHA 5HQMA 3HCXA 3IUCA 2ZJAA 1F2GA 4AXIA 3UVJB 3LF0A 2AA4A 2V4RA 2W9BB 3KKFA 4PKGA 5HVGA 3VA0A 4KGXB 4NXMJ 1PYOB 2DH8A 1ZQXA 2DFFA 4ZVEA 1JN3A 1S6QB 1RLCL 3UCGA 1XSNA 1D8LA 2AV5A 2YH0A 4BC3A 2KRRA 1RJJA 1TZ0A 2MKHA 1EIYB 3QERA 4NLCA 5G5HA 2H4WB 3PYGA 1XR5A 2VBYA 2H3GX 3WKBA 1VQ9N 1KEKA 2B9WA 3FK4A 5CQGA 4JI0F 1M90O 3CJSA 5CZXA 4USUA 3DWLA 2DHXA 5J0OA 1RILA 4HTUA 4RBVA 4AM6A 1NMEB 2NCKL 1S59A 1VK0A 1X42A 2U2FA 5J2NA 1HQ2A 1KQKA 3MECA 2Q43A 4HCCA 2HVEA 2R8HA 2ZKUA 1O5JA 5GADI 4K4SA 2ZJRL 2EH9A 1UVIA 1E4FT 4HHUA 5CAAA 4LRFA 1PAEX 1PVQA 1YX2A 4O5KA 3O5BA 3VGTA 4I68A 4GKKK 4MDBA 3HW8A 4CO4A 3NGSA 3OTOJ 1KL9A 4ELVA 3EYZA 3NFAA 2KZZA 2IRYA 3MM7A 3K59A 3FZMA 4A8SA 3H08A 3R8EA 1Z1ZA 5K8NA 5AZJB 5KFFA 4F4KA 1YJRA 3H7HB 1VLBA 3OLAA 4HUEA 3J7ZT 4LSLA 3VA3A 2UXDJ 5F3ZA 5KG2A 4V1Ak 2QX0A 1L3VA 2BA9A 5D0GA 3MGIA 2IYIA 1C20A 1N2XA 2W3SA 5DB8A 3OD2A 1D8ZA 1HLUA 1XQSC 4YR3A 3E2EA 1VQNS 3OVBA 2F8HA 2BCVA 1RT4A 2RKIB 2DIUA 3A5NC 3GOIA 4ACOA 2NRTA 2GIQA 4B8CA 1LWEA 2GAHC 3EO3A 5DLFA 2XC9A 4PPDA 4NLGA 3LWLA 1YHQS 9ICTA 4DV2J 4OLOA 5JVGQ 5LY3A 7ICMA 2OYQA 4C2MA 2HQGA 1QTMA 4WP3A 2R18A 1WB9A 2VBXA 3HZGA 2ASMA 2KVIA 3V2UC 4UY8T 4J9MA 1NLVA 2DKXA 3CERA 2MY8A 3DOMB 2IVNA 2P9NA 3CJCA 3ID6A 4LT6A 4DL4A 1TELA 1EHWA 2ZIVA 1WOSA 2YBVA 3W66A 3D2QA 4NLPA 4I69A 4F3MA 3IR6B 3OY9A 1HWLA 1NB2A 4QYZK 3GWCA 2OCEA 2LPEA 4K8ZA 5J0UA 1QAJA 1OS5A 4R65A 1ZD5A 4AP9A 2K1RA 3NF8A