1NK5A

Adenine-adenine mismatch at the polymerase active site
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk5A01
4KTZA 2X6NA 1C1BA 1ZQMA 2P5OA 4Z4FA 1UAXA 4CHQA 4F2SA 1Q8IA 3TQ1A 5C5JA 1A77A 5C25A 3RJKA 1QSYA 3ZDCA 1JLGA 3JPRA 3SV3A 3VQEA 4YR2A 3OYEA 1F21A 8ICFA 1QTMA 4NM2A 1VSDA 4FK4A 1ZQUA 1X9WA 4CHPA 4O0IA 4J9OA 5C24A 1TK0A 1KVBA 5I3UA 4M47A 1B92A 2PI5A 1VSJA 3O3FA 3WNGA 3KKRA 4ZH4A 4J9PA 4GW6A 4PHAA 2JEFA 1RILA 3DLKA 4UB5A 4YCXA 3GIKA 5KFGA 2PFNA 3AVKA 5J0XA 4DF8A 1S6QA 3SV4A 4UB1A 4E1MA 4JV0A 3NGDA 5L1KA 4Z4IA 3GFKB 5KRSA 2M9NA 2WONA 4EYHB 3HM9A 3K75D 3KLGA 3BQTA 3ZSOA 2F1JA 3GV5B 3RJFA 3RR7A 4M45A 3U3GA 3ZT1A 4BWMA 2ZD1A 4RG8A 3KHLA 4CEQA 1DLOA 1D9FA 1ZBLA 3U3YA 3D0PA 5D4BA 8ICOA 2ZJAA 4O5KA 2H5XA 2HB5A 4CESA 4ID1A 3OGUA 4O4GA 4N5SA 3HPHA 3AO2A 1S9EA 5C42A 5HMLA 3PW7A 9ICQA 3HK2A 1MQ2A 3V1QA 4CJ5A 4MFAA 4DFMA 3QEBZ 2J6SA 4I2DA 9ICRA 1QSLA 4RW4A 1KFTA 4IDKA 3MEDA 1IM4A 3S3NA 5L1IA 4IG3A 2MUTA 4DQSA 4O44A 4X5VA 1N48A 5K14A 4M6WB 3V81A 4IQWA 1NJZA 5EWFA 4NY8A 1I3AA 1HMVA 5DQHA 1NK9A 4ECXA 3K5LA 1QS4A 4P4MA 1XU4A 4LVSA 4AHRA 4RQ5A 3V7KA 4NCBA 2W9AA 9ICMA 4CJLA 8ICGA 1EXQA 5FDLA 1MSWD 2P6RA 5HRNA 1B22A 4FJ8A 4J9LA 4M3RA 1RT3A 8ICPA 4QWDA 4KPYA 4I2BA 5CYMA 3C5GA 3OHBA 1RT4A 3L3UA 5KFDA 4C8NA 5EOZA 3MECA 4CEEA 4ECRA 4QZGA 5KI6A 4TURA 1C0MA 5DQIA 1ZQRA 4FJKA 3NHGA 3AU2A 4B3OA 4ECQA 2FBVA 1BPDA 4J9NA 8ICXA 2Z1GA 3PW4A 5J2MA 3A2FA 4OLAA 8ICVA 4PHDA 4QWCA 5DG8A 1X1PA 3DM2A 2RDIA 3C94A 1C0TA 3ASMA 2F96A 3MR3A 3HW8A 1VSKA 4FJ5A 1U9LA 8ICEA 4W5RA 5KFVA 2W9CA 1FKPA 2F8SA 3AO1A 5KG1A 3C95A 1NK4A 4CJTA 3V9XA 4ELTA 3DLHA 4CFAA 3O3GA 4RUCA 3HXMA 9ICSA 1QHTA 3I8DA 1WN7A 4QZ8A 1ZQJA 4KLEA 5DDYA 3OSNA 1T4GA 1YTAA 2KW4A 1JN3A 7ICOA 3IS9A 1TGOA 4J2DA 4FJGA 2JEIA 1NK6A 2Y1IA 4F4XA 2Q3SA 3WNFA 3SI8A 4GXKA 1RBVA 4L8RB 7ICUA 2ZUDA 2A1SA 1U48A 3DYAA 4CFDA 1IG9A 2W42A 2FMPA 3OVNA 4KLMA 3V72A 3BQ1A 5DK5A 1ZYQA 2IGIA 5DLGA 4ED7A 2OA8A 3WNHA 3DRRA 3PMNA 4J9KA 2XCPA 3ALYA 4CEAA 1SZPA 1TAQA 1T8EA 3LP0A 4CJ4A 1CXQA 1NJWA 2ZJ5A 3LWMA 3RBEA 3P83D 4QZEA 4QZBA 1HNIA 5DG9A 4E7HA 5KFQA 4KLQA 3LP2A 4DL5A 1ZQVA 1SL1A 4KLFA 5KFEA 4CJWA 4M3ZA 5KFOA 2Z1IA 1B43A 1TL3A 4O3SA 3DOKA 2ZQBA 3RTVA 1FK9A 4OPKA 7ICPA 3SZ2A 1IKYA 4DO9A 2E4LA 3ZDBA 4R66A 4CGFA 1A76A 4NLKA 4DLGA 8ICYA 9ICIA 5J0PA 1EETA 4EP4A 4DTOA 3SPYA 3OYAA 4FLVA 3NE6A 4QWAA 1RXVA 4DTNA 4IRKA 4CCHA 8ICQA 3S9HA 4DLEA 2KZ3A 4O5BA 1RT2A 2W8LA 1S97A 3DLRA 3V9SA 3N4MB 3IAYA 3KKSA 5KFIA 3O4QA 5TZVA 1JXLA 4P4OA 3QETA 2ASLA 3MDAA 3OS2A 2G8KA 4K4GA 5DB8A 1ZBUA 4M3WA 4M3YA 3T19A 1JMSA 3LANA 4CJSA 2ZTCA 5HLFA 3RMDA 3QNNA 3DOLA 4E7IA 3H4BA 3L2UA 4R8UA 1UOCA 1ZQLA 5HROA 2XY5A 4FVMA 3DLBA 2NRZA 1HYZA 3NBPA 2BGWA 3AVLA 5KFKA 2WOMA 4FBTA 2BCVA 4C8OA 3L8BA 1G15A 4AHVA 4ECSA 7ICFA 5KFMA 2BR0A 2HVIA 3B6OA 8ICLA 3OHAA 3KK1A 2V4RA 2XCAA 3VQ6A 3RMCA 3MABA 2YHAA 2BCQA 2IA6A 3TABA 4MF8A 4Y1CA 4KLOA 2OPRA 4DFJA 5HNKA 4DL7A 4IR9A 2IOCA 5J0QA 3UPQA 4GMJB 2E6MA 7ICJA 4CEZA 3NH0A 4P4PA 2I5JA 2UVWA 4IBNA 2JGUA 9ICGA 2EX3A 2YKNA 3THVA 4KLIA 4HUFA 3U6FA 3RRGA 2QK9A 1WSHA 5CR0A 1ZQYA 5DB9A 4GC6A 3TAMA 1LW0A 3RMBA 1Z00A 4LSLA 3HPGA 5EWEA 9ICLA 4YVZA 1UA1A 3M8PA 1WSGA 1X2IA 2AQ4A 1V9PA 4JWNA 4DL6A 3ZT3A 4QZHA 2R8IA 3ISNC 4Q0BA 7ICVA 2NRXA 3OYJA 1HUOA 3ZDAA 3DMJA 1NK7A 1TAUA 1BQMA 4J2BA 4BE0A 4PA1A 4F4ZA 2DPIA 4IFYA 4O3PA 4R5PA 3M8QA 4FLZA 4IKFA 1EP4A 1TL1A 4ED0A 4TQSA 2W9MA 4QZ9A 4YG2A 4E19A 3V9ZA 1ZQAA 1ZETA 2BPCA 4CIEA 4UBBA 4CIGA 3SUPA 4ED1A 1HRHA 1RT6A 1O1WA 4QWEA 4B9UA 2P5GA 4I29A 5BPCA 1PZNA 3HSTB 3C2LA 4NLZA 4HYKA 5IIOA 1U4BA 4FLYA 1ZQCA 1BGXT 1RT1A 1J9AA 3E2EA 4CGHA 3HP6A 1RBTA 2AU0A 5L9XA 4I2IA 4IR1A 3TAPA 4UB2A 1ZQWA 7ICGA 2BKEA 3G6YA 1L3UA 4M0AA 4TUPA 3SUOA 1VSMA 1T3NA 4IQUA 2C2EA 1KSPA 3H8WA 3VN5A 5KG2A 4M9LA 3PV8A 4IRDA 3RJHA 9ICHA 4ECUA 4R65A 1EKEA 2OPPA 3NF9A 5KRTA 4LZDA 3H40A 4PH5A 1ZQQA 4K4HA 1IKXA 4KN7A 4KRFA 4DQIA 2D5RA 3H08A 2HHVA 4RZRA 5DG7A 3MFHA 1NK5A 4B8AB 4OPJA 1WCLA 4DTXA 1XHXA 5KFLA 5KT7A 2XC9A 1JLQA 4CJ3A 4J2AA 4FW2A 4B9VA 1RDBA 2OYQA 4KLLA 3SNNA 1KEJA 3ISCA 3TAFA 2FBYA 4UB3A 2UVRA 3KLHA 5EWGA 2W9BB 2YV0X 3F73A 3JPOA 2PFPA 3SUNA 1ZQZA 1KRPA 5CJ7A 3ZDEA 4YFKA 1BL3A 3AO4A 1UWBA 1IKWA 4KITB 4K8XA 4FLTA 1KVAA 2HHTA 3PMLA 2D0AA 2C28A 4CJQA 1WSEA 3F9KA 3QO9A 5KT4A 1A5XA 4CJUA 3VQAA 3AO3A 1JLEA 1TV9A 1S77D 3HO1A 3TI0A 3OYKA 5DBCA 4M6WA 4MQ3A 1U49A 4E1NA 3VQPA 1ZQEA 1HPZA 3O4NA 4QZIA 4DSEA 1RDDA 1HJPA 2V9WA 3QEAZ 9ICNA 1UT8A 4I2FA 1S6PA 3AVNA 4M9HA 3LAMA 4N56A 4FJ9A 2HHSA 4RW6A 1CZBA 2PFQA 1A5VA 1JLAA 9ICXA 3KD5E 3HPOA 2O4GA 5KFAA 5KG5A 3G0ZA 4QZCA 2IS3A 1GOBA 1Z00B 2HVHA 5J2FA 3PW5A 5CZ1A 4DSIA 2ITGA 3GIJA 5IILA 2HNZA 4NYNA 5IIKA 4J2EA 2FLNA 3PO5A 3PR5B 4CEFA 2EHGA 4I28A 5HRPA 9ICEA 1K1SA 8ICRA 4YD1A 4CGIA 3KTQA 5FRMA 3V1RA 3UQ0A 1XS9D 3GDXA 4JLHA 1XI1A 3Q8KA 3EPGA 1GOAA 3SQ4A 4DEZA 2HHWA 1HYVA 4M41A 2X74A 4Z4EA 2HNYA 3CYMA 3AU6A 4R8UB 3NH1A 4LZGA 4YMOA 4RT2A 4RQ0A 1D8LA 3RB4A 2C22A 2ZUBA 3RJEA 9ICTA 2VANA 1JL2A 1HUZA 3T1AA 1RYSA 2P6UA 4JWMA 2BPGA 4I7FA 4B9SA 2KZMA 4NM1A 3IG1A 2XY6A 2GWSA 2HHQA 1XO1A 3G6VA 2NRWA 4KREA 4F93B 4N41A 3B6PA 5KT2A 4CHYA 4Z0UA 1ZQDA 3RWUA 3K57A 2B21A 3V6HA 1C7YA 3Q8RB 1H38A 1RCHA 1L3VA 4ECYA 1JX4A 4MFFA 4DFPA 1BIUA 2W8KA 4KMUA 4DWIA 1Z26A 4O3RA 2IMWP 4O3QA 4C8MA 1S1WA 4I2PA 1XSLA 4IG0A 5J1EA 1EXNA 4J9RA 4JV2A 3JSMA 3GV7B 2KTQA 2V4QA 5KGWA 1CLQA 5HHHA 4DS5A 4FJXA 3MXJA 5CB1A 8ICTA 1S0NA 1LWFA 4NXZA 5KGXA 3NH2A 4JRQA 4HTUA 2P51A 3ZSQA 2JZBA 1KLNA 4HCCA 2GBZA 3I0RA 8ICNA 3ZSWA 4F92B 4KHYA 4YN4A 2PYJA 4HCBA 4Y1DA 8ICJA 3OYLA 5J2PA 4MEYA 5CYQA 2X78A 4EZ6A 1RT5A 4EBDA 2R8KA 5IIIA 4I2EA 2XGPA 1BPBA 4ELVA 3T5HA 4I9QA 4BGDA 4KHUA 4ED2A 1TVRA 3E01A 4FZXC 2AGQA 1K1QA 2C2RA 4W5QA 8ICBA 8ICSA 7ICTA 1L5UA 3BQ0A 3JPNA 2X6SA 3Q8LA 3TANA 4KO0A 4MF2A 4UAZA 2NUBA 4I9LA 4PUOA 3RBDA 3NF6A 3ZCMA 4BDZA 3RB6A 2ZTDA 2DFHA 4CERA 1DGSA 1IXRA 4DTMA 3AV9A 3QEWA 1NKEA 3L2RA 3RJIA 4KLGA 3SI6A 4Z6EA 3AUOA 2HNDA 3AVAA 4H8KA 2ZTEA 3GQCA 3AVBA 4KLTA 4FM1A 4CEOA 2VG6A 4DQPA 4QZDA 2VWKA 3LWLA 4FBUA 3G10A 2A1RA 3HX0A 3FFIA 3UXPA 1XSPA 2UVVA 1JLFA 4OKEA 2PZSA 7ICLA 3PX0A 3NAEA 4CJRA 3EPIA 4CF9A 1XHZA 3SCXA 7ICNA 3PY8A 3RMAA 4GVMA 1W0HA 3IHQB 1ASWA 1BISA 4KB0A 2JEJA 5E41A 3JPSA 4F5QA 3RH6A 3RH4A 3ZD9A 4PPXA 5J2BA 3S3MA 4W5OA 2BGGA 1KCFA 5J2HA 1TVAA 2BE2A 3TAGA 3KLEA 1S0OA 4XQ8A 4J9QA 4DU4A 4IQTA 1YT3A 4B08A 3HP9A 3PR4A 7ICSA 2HMIA 4E7KA 3PVXA 3MXMA 4CGDA 4N76A 1BPZA 5JUMA 4FS1A 3RAQA 2VG7A 2R8JA 4B9NA 4W5TA 3Q8PB 5KG7A 5J0YA 4FJIA 1ASVA 1J5OA 3ZT4A 5CZ2A 3SPZA 4BWJA 2G8WA 2DFLA 3QEPA 4GXIA 1ZQTA 4K4IA 3LALA 2OZSA 2E6LA 4EBEA 2OPSA 4PGQA 4M9JA 3KHGA 2XHBA 3HL8A 1VSEA 2D0CA 4OVLA 3VQDA 7ICHA 3CFRA 4BDYA 1TK8A 1VSHA 4KN4A 5KT3A 4YNQA 4M9GA 2ZJ8A 5J2QA 4M3TA 1BVSA 3SJJA 3S3OA 4DQQA 4KLUA 4YMNA 1FXXA 1UT5A 1I39A 4CF2A 1CUKA 1XSNA 3RB0A 5KG3A 3NGIA 1TFRA 2G8FA 4IFVA 5KFZA 1RDAA 4J9SA 1T03A 3MR5A 4F2RA 1N56A 8ICMA 3VA0A 4CEBA 3AA3A 5J2EA 1XC9A 3TAQA 3LPUA 4YQWA 3P5JA 5DMRA 1S1UA 5L1JA 4JS4A 4PWDA 2GUIA 2C2DA 5SWMA 4UQGA 1LB2B 3G6XA 4CEDA 1WCNA 3KHRA 4DTJA 5F9NA 3K5MA 3H4DA 1S5JA 3AVMA 3HYFA 4M2YA 3T5JA 3KK2A 1S0MA 5HBMA 1NJYA 3NDKA 4RQ7A 4CIFA 5J2JA 3EWAA 1CXUA 5SZTA 1ZQGA 4QOZB 5J0SA 5CY4A 3V7JA 1FKOA 2DFEA 2R7YA 2KZZA 4CJVA 4O0JA 3HWTA 3VQ4A 1T05A 4FJLA 1KFDA 3HVTA 4F4WA 3P1GA 4M3UA 5KG6A 3M9OB 2YHBA 3MAQA 2B5JA 3RJJA 4Q45A 3V9WA 3JPQA 1TKZA 9ICWA 3D45A 4FLXA 5J0TA 4KHQA 1JLCA 1NOZA 4EBCA 3MEEA 4DOBA 4FO6A 4B8CA 3QEXA 2AQ0A 4I2CA 4AH9A 1JKHA 3EW9A 3NGYA 4Z4GA 5DB6A 2JZBB 2VA8A 3H7IA 1WLJA 5J2DA 3NFAA 4E89A 3GIIA 1IH7A 1IO2A 5HMMA 3PX4A 2BDPA 3Q8MA 1L3SA 4KI4A 1DTQA 1SKRA 3BQ2A 1EX4A 4CJPA 2R8GA 5FRNA 1U04A 3DRSA 2QKKA 3K5NA 4Q44A 2PI4A 1NK8A 4R64A 2IDOA 4GXJA 2B6AA 4Q5VA 4KHWA 1SUQA 3M8SA 2IC3A 1WSFA 4KTQA 1NKBA 4Z4CA 1COOA 3JPPA 2OPQA 1JL1A 2OZMA 3PUFA 3V6KA 3O3HA 4I2GA 3ORYA 4NCAA 3UXOA 3M9MB 5CHGA 1VSFA 4B9LA 9ICFA 4RNNA 4ED8A 4O55A 3HJFA 1BCOA 4JV1A 2FMSA 4IQVA 2ASJA 2AGPA 3BGRA 5KFRA 3C23A 4PHEA 1RXWA 3ZSRA 1SL2A 3LDSA 3OY9A 7ICQA 2J6UA 2KFZA 2KN7A 3VQQA 3T5KA 1C1CA 4N47A 1U47A 2FC0A 3NCIA 3OJUA 5KTQA 4DSLA 5HP1A 1RDCA 3OYMA 4OKKA 2BCRA 4ZHRA 1Z25A 5D3GA 4UAYA 7ICRA 5DLFA 3KLFA 1BI4A 4CGJA 4Q43A 3B0XA 3TFRA 3AVJA 4RW9A 2A1JA 1S1TA 1BHLA 3ZT2A 9ICPA 3T3FA 1REVA 3QEVA 4CJKA 4ECVA 3H8JA 4IRCA 1VSIA 4YP3A 5KFWA 4XIUA 1VRTA 3MGHA 2IAJA 2YNIA 2F1IA 4FZYA 2J6TA 2BCSA 1ASUA 3KD1E 4OGCA 3MR2A 4E3SA 5FROA 4EP5A 2G8HA 2XY8A 3L2QA 3M8RA 4K8ZA 4F5RA 8ICHA 1BPXA 4ZTFA 4F91B 5DBAA 4DF4A 1GOCA 3LZIA 5J0WA 7ICIA 1RYRA 4FJMA 4TUQA 3UQ2A 3K5OA 5J29A 5CP2A 5T7BA 3EY1A 4F3OA 4YXMA 2FBTA 3KLIA 4ICLA 1ZBFA 4FW1A 4DSKA 4P2HA 2P1JA 1HNVA 3C2MA 9ICUA 1VSLA 5J2AA 3PNCA 2I9GA 1MU2A 2BQ3A 1RTIA 3L3VA 4BDPA 4EZ9A 1ZJMA 3FYHA 1SKSA 2Q0ZX 5J2KA 1N6QA 5BOLA 2WTFA 3OYFA 3KJVA 4QAGA 1RBSA 4KFBA 4PQUA 3LDAA 1S76D 2ZUCA 4G1QA 4DG1A 3SUQA 3ZSVA 4FLWA 1ZQPA 4KHSA 4DOCA 2F8TA 3AVIA 5CA7A 4CHNA 1JIHA 1VRUA 4GLXA 3QINA 4DL4A 1J54A 5KFHA 3ZDDA 1RNHA 1RTJA 3TR8A 4EEYA 3WNEA 4KLDA 1BCMA 2I1QA 3TFSA 9ICJA 4DQRA 3PW2A 3VQ8A 3K58A 3JYTA 3SQ0A 3ITHA 3CFPA 4YR3A 2GV9A 2BANA 2YNGA 4XRHA 4BE1A 8ICKA 5DB7A 1X9SA 8ICUA 1LAVA 2LSNA 4PHPA 4PGXA 4DOAA 3AA5X 3QIPA 3I0SA 3N97B 2RKIA 2KQ2A 5EU7A 4UBCA 1TV6A 1ZQOA 3PW0A 8ICAA 4XA5A 4YD2A 4KTWA 4HUEA 3OYDA 1LV5A 2ALZA 1MC8A 1KVCA 4DFKA 4CE9A 1TKXA 4RQ1A 5BOMA 1HJRA 3TWHA 7ICEA 4ZTJA 1KLMA 5IIJA 4DL2A 2FPLA 4YXJA 3QEIA 3C21A 5HHIA 3DLEA 3QERA 3OS1A 3NGZA 3AVFA 8ICZA 2YKMA 3ZSXA 1RBUA 4Z6CA 4PY5A 3EYZA 4Z6FA 4QW9A 1QQCA 4FJHA 4ECWA 2Z1HA 1ZQNA 2VG5A 2LYHA 4DTSA 4I2JA 3C1YA 4F8RA 4I2HA 5JS2A 3RAXA 4QZFA 2BCUA 4H4MA 3OSPA 5J2GA 1WSIA 5KFSA 4RPYA 3Q8SB 1BI4B 3K4GA 3LPTA 4KV8A 5KFTA 3QZ8A 1LWCA 1JXEA 4RU9A 2ETJA 4Z4HA 4TQRA 3BDPA 2PY5A 5KFYA 5KFCA 1S9FA 4LD0A 2NRTA 4OGEA 4HHTA 9ICCA 3AVCA 3H8SA 1ZQFA 3RRHA 3V9UA 4KLJA 4DU1A 4RPZA 4DSFA 5DQGA 4O5CA 3VQBA 3QZ7A 9ICAA 2XO7A 4F4KA 4RQ8A 4FCYA 3ZD8A 4KAZA 4M04A 1LW2A 5HRRA 4FM0A 4KI6A 3IM1A 1ZBHA 4BE2A 3IRXA 1DOQA 1ZQXA 4CK2A 5D46A 4I2QA 4F4YA 3ULDA 1KDHA 3C1ZA 4QW8A 1R0AA 2D0BA 4RNOA 3NF7A 4YR0A 4CF0A 3M9NB 3RJGA 2AGOA 4AHCA 3ETLA 3MGIA 3V1OA 1YTUA 5I42A 5KFFA 2HHUA 4LH4A 1RT7A 1L3TA 4H4OA 4XUSA 5KT6A 1MQ3A 4DMNA 4RW8A 3GV8B 4R63A 3LP1A 4DTRA 4MFBA 4RNMA 4FM2A 7ICKA 2Y1JA 3CQ8A 4KKOA 2DY4A 3OYBA 1S9GA 4CK3A 4FK0A 4CK1A 4NYFA 5J0RA 1HQEA 1X9MA 2VA3A 3ZSZA 5DDMA 1NOMA 2NRVA 4F5PA 1D9DA 4LSNA 4NLGA 1ZQSA 4B9MA 1ITGA 2VA2A 5IIMA 1RBRA 5DKWA 3SQ2A 4CGGA 3MDCA 1JLBA 4QWBA 1QLNA 4M42A 3FDSA 1ZQKA 1BIZA 4FS2A 1NK0A 3JPTA 1RTHA 2XRIA 4KLSA 2KFNA 2O4IA 4B9TA 3Q8QB 5KFPA 4O9MA 1SL0A 2W9BA 4BACA 4GC7A 2MAXA 5HRSA 1C6VA 4ELUA 4ED6A 2W9CB 2ATLA 1NJXA 3VQ5A 3DLGA 1Y97A 5DGBA 1RZTA 3C2KA 7ICMA 2HW3A 1C1AA 4QZAA 1N5YA 4AHTA 5KFNA 3RB3A 4E0DA 3OS0A 2G8VA 4ED3A 4KHNA 4CFBA 4Q8EA 2MUTB 3DRPA 4BXOA 1WNSA 5IINA 4HUGA 3AA2A 1TKDA 3OYHA 5DGAA 4AHSA 4TUSA 3AA4A 2AJQA 3HVRA 4FZZA 3K2PA 4FJ7A 2A1JB 2RDJA 2G8IA 3SQ1A 2BQRA 1WAJA 1W9HA 4CJFA 4C8KA 3T5LA 3QNOA 4FJNA 1U45A 3MBYA 2IHMA 1BPYA 4FXDA 2FBXA 4FK2A 2OWOA 4ECZA 4F5OA 2XGQA 1XWLA 2RN2A 2R8HA 2FMQA 2PFOA 2YNFA 3TARA 1LWEA 1S1VA 4CF1A 1T7PA 3SYZA 5F9LA 4RPXA 1TK5A 3ZSYA 5J0UA 2PYLA 3MR6A 1ZQIA 4FLUA 5J0OA 2HHXA 4YMMA 1RPLA 2ISOA 1CZ9A 1KFSA 1IKVA 4DU3A 3LZJA 9ICBA 3NTUA 1S1XA 3OYCA 1Q9YA 1JXBA 4RUAA 1B9DA 2XY7A 2IHNA 4DS4A 1S0VA 4BXOB 2VWJA 5J2NA 3VA3A 3PX6A 9ICVA 4JRPA 5KT5A 2BPFA 1SV5A 4AHUA 4O3NA 9ICKA 8ICCA 1BQNA 2Z1JA 4JUZA 1SKWA 4DSJA 4CHZA 3CM5A 4E7LA 4E7JA 3OYIA 2FPMA 4F5NA 2YNHA 4RQ2A 5KFJA 3RH5A 4OJRA 3QE9Y 3V6DA 3C6TA 4FJJA 5JS1A 3V6JA 2DFFA 1D5AA 3CG7A 3ISDA 4RQ4A 4G3IA 2UVUA 5KFXA 2ZE2A 4FYDA 3QIOA 9ICOA 5KG4A 3BJYA 4EYIB 4TSXA 4JK1A 4Z6DA 3DI6A 1ZQHA 4CECA 3GIMA 3V7LA 3QLHA 4AILC 1ZQBA 2BHNA 3LAKA 2DPJA 5KFUA 3NF8A 1Y88A 1CEZA 1K6YA 4MEXA 2BQUA 4HVJA 3K59A 1VK0A 4I2AA 3CFOA 3HT3A 4Q8FA 4CFCA 4C8LA 4RQ6A 1ZJNA 3UIQA 3KIOA 8ICIA 3LP3A 1A5WA 1Z3EB 5J2CA 3ZT0A 2PXIA 3CM6A 1AROP 4W5NA 2G8UA 3GILA 5KFBA 1NKCA 2DTUA 4JS5A 4YFUA 3L2WA 2FLPA 1NOYA 1HQUA 4WE1A 4DTUA 2JEGA 4LY7A 3KK3A 1YVUA 4NCGA 2RF2A 3OJSA 3OYGA 3QESA 4DL3A 1LAWA 1ZBIA 4CF8A 4PGYA 3EZ5A 4ECTA 1C0UA 4OKJA 1QSSA 4UAWA 8ICWA 3PO4A 2JLEA 3LK9A 1TKTA 4M3XA 4UB4A 4LH5A 1RTDA 1J53A 2QKBA 4ID5A 3VQ7A 4RT3A 1KTQA 4M9NA 2FLLA 3V4IA 1DTTA 2B4JA 3VQCA 4O5EA 1B9FA 2ATQA 1Q9XA 4CHOA 4CJEA 4J9MA 4F3TA 2IBKA 3MFIA 2ASDA 4MFCA 2ISPA 2F1HA 4I27A 5KG0A 5D49A 5CWRA 2FPKA 5L1LA 5J2IA 3C6UA 4KB1A 2RPIA 5HP4A 3OYNA 5DBBA 3MXIA 3MEGA 1BPEA 4F50A 1WSJA 2QXFA 3KHHA 1QE1A 1S10A 4KLHA 1UA0A 2P66A 4QCLA 4OLBA 3ISBA 3AVGA 3L2VA 4RQ3A 4RW7A 1WAFA 3VQ9A 4DTPA 1HYSA 3AVHA 4NLNA 3RR8A 3C5FA 4O3OA 3TAEA 3AO5A 3B0YA 3UXNA 1D8YA
chains in the Genus database with same CATH superfamily
4USTA 3SAHA 4Z4FA 2VKZG 3SBMA 2Z30B 1VJQA 1X0PA 2AF6A 3KD3A 1IR0A 1YJ9S 3QXGA 1JLGA 3BYPA 3VQSA 3JPRA 3E9PA 3VQEA 1HD1A 1FO4A 3WEEA 4YR2A 1F21A 1YDLA 4J90A 3CXCM 4DV5K 3GFYA 2KMDA 1HKAA 3SD7A 1VC0A 4O0IA 4J9OA 3THWB 2VJ5A 2O8EA 1U2CA 4X4PA 2UUAK 3RYLA 1Q53A 4RKUC 4UZCA 3O3FA 3CJ8A 4DV2F 2AEMA 1TL7B 2VG5B 5KNIA 2FJDB 3WNGA 3MURP 3KKRA 2E5LJ 4LF6K 4NLPA 4CZLA 2PSZA 4UB5A 1YX2A 2QA1A 4YCXA 3U7JA 3SV4A 3N6NA 5F2RA 2B3TB 1IM6A 3CMAN 3BGLA 1XR6A 2KOBA 4BRFA 4JV0A 3NGDA 5L1KA 2JFDA 2VBZA 3QNMA 4CO1A 2M9NA 4FN5A 3HM9A 3K75D 5JVGL 3DOMB 1BO5O 1T9XA 4K5SA 4IQXA 4QS8A 3GCXP 1AW0A 4FVUA 4CO5A 1X31C 2CJYB 2B0GA 3VVTA 3Q7BA 4FF1A 1ZBLA 2ZJAA 1UFKA 4CESA 3OGUA 4R25A 5C42A 2DGVA 4DR2J 1GT8A 5AQTA 4GKJF 4CZJA 3I1YA 4OZNA 3QU2A 8AT1B 1MQ2A 3H5SA 3O8WA 1N5YB 2CPXA 9ICRA 3TAMB 1IM4A 2QJ3A 3KJFB 2WB4A 2XULA 2XZDB 4X5VA 3RGIA 4XO0A 3QUQA 2GGPB 3NNHA 5DM6Q 4NY8A 1YG0A 1YKWA 1I3AA 3R2DJ 5HR7A 3IWXA 4NA3A 5HBMB 4U67L 3H90A 4LVSA 4AHRA 2O67A 3V7KA 1PC5A 4NCBA 1X4FA 1VQLS 3VF0B 2M52A 3JQMA 2P6RA 3GG4A 2DRDA 4ZVPB 4JI8K 3IR7B 4KPYA 5ALGA 1FCAA 4DCJB 5DDRC 2KHVA 4HACB 2V5HG 3L3UA 3ZYYX 1GEHA 4BX9C 3BBFA 3M6XA 1SAZA 2Y0SF 4UY85 4IL6U 1NWKA 1TKTB 3D2FB 1XMQF 2KIVA 2G9OA 3QUBA 2IIRA 4C7ZA 5DQIA 5HVGA 5ADXA 3CGIA 3DU6A 3PW4A 5J2MA 1F44A 1DXSA 3C28A 4PHDA 5EXWA 3TADC 3WK8A 4LR7A 2QWNA 3BUZB 4OI2A 5DG8A 3DM2A 2RDIA 2OUGA 4RW7B 1C0TA 2CG4A 3HW8A 1LXJA 3DKDA 4DU7A 1VQ5N 3F0NA 2W9CA 3MM5A 4K43A 3FEXB 4DV5J 4CJTA 3V9XA 1P8ZA 4ELTA 2NZCA 3FFKB 3O3GA 2U1AA 1F3FA 5AQGA 4PWUA 3W64A 2XI2A 3G86A 3KDOA 1YLXA 3VCDA 3HXMA 4DR1K 2OLWA 1WN7A 4QZ8A 1VRQC 1DQ8A 4NLTA 3G6EN 2V94A 4R5PB 5M1PA 2KW4A 5A2QY 4N7TA 1KXPA 4EO8A 2HBJA 2R7TA 1YJVA 4FJGA 2NLWA 1N63A 4JHDA 1ZH5A 3WNFA 4MLEA 3MAAA 5AQZA 2POKA 7ICUA 2A1SA 3DYAA 4I2PB 1NMNA 2W42A 2RQMA 3D2EA 3G25A 1IBLF 4A57A 4WFAL 3QMLA 5DLGA 5LSRA 2VJUA 2QT7A 4QR2A 3UCZP 3WNHA 3DRRA 3M30B 2QX0A 4BROA 4DJBA 3CPWM 3PMNA 2ZOFA 5C24B 3C19A 3PNIA 1SZPA 1ACMB 4N77A 2CIMA 2MKSA 4O4RA 4NLOA 1NJWA 3LDLA 3ZC4A 3LWMA 3PHTA 1RWVB 2CG8A 5C15A 5DG9A 5ALFA 2W2NP 1ZQVA 1SL1A 2F5GA 4CI6A 1HQUB 5KFOA 5AI8A 1JNZB 4J9UE 4ERDA 3QT6A 4RNHA 2E1CA 2W04A 4WXOA 1DQAA 2FY8A 4AL5A 2L48A 2HQFA 4F3MA 7ICPA 3J8AA 2ZH8A 4DO9A 2E4LA 4WQ4C 3NBPB 4JV5J 4FP9A 4DLGA 5J0PA 3GB0A 3QB0A 3OYAA 1EO1A 1VRTB 4LF8K 5IS2A 3KHYA 3D0GE 2KHDA 2MY7A 1V4SA 4M7YA 1WTFA 3W7BA 1RT2A 4KAIA 2KT5A 3HHEA 3PIOL 3WQTA 2BZFA 1J5EK 2W11A 2GMLA 3V9SA 1BA1A 4IFEA 4F4AA 1FE0A 3KKSA 3Q86A 3O4QA 1WC5A 3PG9A 4NWBA 3CCRS 2QEXS 2E44A 3QLHB 1RAOA 3PJXA 2VL1A 3MEDB 2HWIA 4M3WA 4M3YA 2XMVA 1Q4RA 3UNGC 2BDUA 2ZTCA 2E5LF 3RMDA 5AE2A 3CJBA 3H4BA 3U9DA 2RQCA 2N7CA 3THYA 3RAMA 3HRDD 3NMUA 1MN7A 2BOAA 1TV6B 3DLBA 1YTYA 4C11B 1NH7A 1HYZA 4DV0F 3AVLA 3CJAA 1A9NB 3WHIA 4C8OA 2J9CA 3OHAA 2XCAA 2R2UA 5AIAA 3MABA 4PYAA 2P6TA 3MMBB 4RBUA 3F5EA 2LLZA 3OT9A 5AQHA 2KVQE 3B54A 3UPQA 1X5TA 2E6MA 4QYRA 7ICJA 3BEGB 2GNKA 3H0MB 2I5JA 1NM1A 3GR1A 2UVWA 3EICA 4X4OA 1N33F 4RWXA 2RSQA 2AEJA 1FWKA 4JYAJ 3U6FA 3D3BJ 1NG9A 4XAKA 5CR0A 2IRXA 5DB9A 2KVSA 3RMBA 1P27B 3HPGA 3NVKA 1G4CA 5EWEA 3VGUA 4ACOA 3KFWX 3R3TA 4X65J 1X2IA 3I55N 4IOXA 4CLYA 1NGDA 4CO2A 2P9KA 4KGVB 2QI2A 4IDHA 3WKDA 1XMQK 7ICVA 2NRXA 3VETA 2DCLA 1HUOA 3DMJA 4J2BA 3VAKA 2OPPB 4XH1A 4IKFA 4HTIA 1EP4A 2W4CA 2FD2A 3GSDA 4AYBC 3V9ZA 1ZQAA 4KFBB 4UBBA 3CI5A 2YTUA 2CWXA 2KXFA 4Q7AA 1IIPA 1VQ4N 5GAEI 4P72A 2P5GA 4I29A 2WAQF 1PZNA 2Q36A 2VB6A 3L9ZA 4HYKA 1U4BA 4FLYA 1T6CA 1ZBTA 3VEWA 4BRAA 3HP6A 1TL3B 2VYPA 3HD1A 4IR1A 1X8DA 5JMVA 3BKFA 1Y4ZB 4M7XA 1R6YA 2BKEA 3G6YA 3US5A 4M0AA 3ZO7A 2W2OP 3MX2A 4TUPA 2MQQA 5KG2A 2G1HA 2XHWA 4ZPVR 2I1RA 1L3KA 2DR5A 4IRDA 3RJHA 1EZZB 3FEYB 9ICHA 3VPZA 3M1VA 3QBCA 2OD4A 3H98A 2DNGA 3O8MA 3W8GA 1YK9A 3T9NA 1N52B 2FSNA 2XIDA 4RZRA 3MFHA 2LQ9A 1NK5A 4OPJA 1WCLA 1S6PB 1PO6A 1XHXA 5KFLA 4M63C 2KLAA 3DDNA 1KL9A 4EELA 3FBBA 2OYQA 1OSCA 2V63A 1DLOB 2QC3A 3SNNA 3W2VB 3EZWA 3TAFA 2DQNB 1URJA 2FBYA 4BGBA 4AYBD 4UB3A 2UVRA 2W7OA 2HZVA 3UNYA 1RHRB 2W9BB 1LKZA 4BUGA 1DZ5A 3THYB 2PFPA 4EHTA 3HD2A 3LP0B 1ZQZA 2R3VA 2R7QA 1RQLA 1SJFA 1VHIA 4RL1A 2PA3A 3AO4A 1PYTA 2HHTA 2D0AA 4CJQA 2C28A 2QLXA 3BBCA 1QVFR 5KT4A 2DXDA 1A5XA 4WP3A 1HR0F 3KJNB 1T44A 2DITA 1JLEA 3E8OA 3VALA 3HO1A 1A6SA 3D2NA 5DBCA 1WDDA 3A8EA 3CDBA 2C1EB 1MMLA 5IV3A 4QZIA 4DSEA 1UAWA 1RDDA 4NZ6A 3NNAA 4JI6J 3U02A 2XI3A 1N5WA 4PXCA 4I2FA 4PG8A 2CQCA 2MQNA 2NSBA 3LAMA 4ICAA 4YDDB 1D1UA 4YORA 2PFQA 1NGBA 9ICXA 3KD5E 4C1NK 2H48B 3J81j 3T79A 4QZCA 1GOBA 1RKJA 4DSIA 1LQ9A 3OFGA 5IILA 2HNZA 2BBEA 4NYNA 5IIKA 3GLJA 1XNRF 5FPDA 1NEEA 4M63A 4Y2QA 4DDFA 4CEFA 2EHGA 4NYOA 3SDEB 4RWWA 4IG0B 5J1EB 4DV0K 3DV9A 1K8KB 3QJLA 2XICA 1JLEB 1F9EB 1X0FA 5EY4A 2VG7B 1OIAA 1GH8A 2X74A 2HNYA 4Z4EA 3M8PB 4DV3F 2E8OA 2OI2A 1N34K 3UMBA 1D8LA 1TL1B 5EX3A 2IRUA 3ZZPA 5F8JA 4H4KA 4JYAK 5LJWA 2CH5A 4FNHA 2L9DA 1NHUA 2VANA 3D2QA 1JL2A 3OXFA 1EETB 2KVIA 3FC4A 4FPIA 1RYSA 3S7RA 3SFGA 3VAHA 1OPZA 3MMCA 2YX7A 4B9SA 4NM1A 3IG1A 2XY6A 2GWSA 1XO1A 3G6VA 5K8OA 2NRWA 3IC1A 1Q79A 4KREA 3I5AA 1TUYA 5AE3A 4N41A 3B6PA 4FO0A 3VERA 3MOJB 4Z0UA 3RWUA 2F44A 3K57A 3V6HA 5JVHL 1HNZF 4DPYA 2Q6BA 4KMUA 3JSYA 3IUCA 5C2DA 1Z26A 4O3RA 1YRTA 4ANCA 3FM9A 3THTA 4JI3K 1XSLA 4IG0A 5J1EA 4J9RA 5AJ3K 5DM6L 2PMHA 1CLQA 2ZZTA 3MXJA 3JQKA 5CB1A 5KAIU 1RT1B 4JRQA 1HEKA 1BNOA 1RE1B 4DXLA 2M4MA 1KLNA 1CJKB 3IFRA 3UD5A 8ICNA 1T9YA 1BNPA 3UR0A 5J2PA 4C11A 3L5KA 2X78A 3KK2B 1RG6A 2LBOA 4BREA 2R8KA 1FJCA 2OANA 1NU4A 1OS5A 4C3KA 4KHPK 2E8MA 3CD5A 4BR5A 2YHXA 3E01A 2JOQA 4M1KA 1Q8LA 3I32A 4C4TA 1I94F 1FX4A 4PABA 3TANA 3M8QB 3LDOA 4UAZA 2NUBA 3CC4S 3NF6A 2QE5A 3C7NB 4BR7A 5CZXA 3H2UB 3IWLA 3HHDA 4Y65A 3D1OA 1G99A 2P9SB 3L2RA 3WXKA 5M2UA 2YTCA 2QLJB 3AVAA 2HK2A 3CHWA 2ZTEA 2B8PA 1SS6A 4G1PA 2J0XA 5AQIA 3C6HA 4CQ1A 2VWKA 1S72S 2PFFB 2FDRA 3LWLA 2JV3A 4F0HA 2CPFA 1S3XA 3HX0A 1FT8A 3H0RB 1NAQA 5A0LA 1XSPA 4YHHF 3QO9B 4OL8A 2GOLA 4OKEA 5LMNJ 3ZTOA 3PX0A 2E66A 3E01B 1LFPA 3NAEA 4DR3K 2F3NA 5EDWA 2A2DA 3SCXA 1Q78A 2MKIA 2GIRA 4U7UD 1Y7PA 3PY8A 2ZH7A 2BUPA 4GKJK 1RHUB 4Y0WA 2BKOA 3RH4A 3ZD9A 1URNA 5J2BA 3S3MA 4PJ0U 4W5OA 5M1FA 1KD1T 2ZJRL 1TVAA 3KLEA 2C2KB 1YT3A 4B08A 3NCPA 2LU1A 5IWAF 1FF2A 1IBMK 4DV3J 3SQIA 1X6IA 4W5TA 4FJIA 3OPXA 5ALRA 3ZT4A 4ES2A 1Y11A 4JKBA 1UHUA 3SPZA 1VCTA 2G8WA 3WXJA 3G4SS 3QUCA 5MAOA 3GE9A 1ZQTA 4ZS6A 3LALA 2OZSA 4IS7A 4URGA 2OPSA 4PGQA 1KVIA 3O9TA 2ZC4A 3M1VB 1BOTO 2RKIB 3B6BA 3SEIA 1IUJA 4Y3CA 3VQDA 7ICHA 3H6EA 3D1QA 3ONQA 3LYSA 4X4QA 4AD6A 4KN4A 5KT3A 2RILA 1REVB 2Q31A 5HJYA 3CJRA 2BV3A 2IM2A 2NPFA 3U1MA 3KLEB 1IQTA 3CCMS 3S3OA 3H46O 4C3MA 3AY9A 2IA0A 4KLUA 3QJPA 5K9FA 1ZTTA 3WC0A 3GDQA 3AJ1A 4IFVA 5KFZA 3CMQA 4NL9A 8ICMA 5BN8A 4CEBA 2YWWA 3AA3A 1CJTA 3KUHA 2AP6A 1XC9A 4KX5A 2KRRA 5AJ3F 2W7AA 2ZBPA 3D1HA 2VDIA 4DV5F 4DR1F 1UVJA 3PIPL 3CPWR 5BJRA 2VBWA 4JV5K 4USVA 4PWDA 2V52B 4HT5A 2C2DA 1K9MT 5SWMA 1DHMA 1C0GA 1G7CB 3TWZA 4DTJA 2VDHA 3AD8C 4U7BA 1HNWJ 2UUWA 4Y2IA 3H4DA 5A6PA 1HW8A 3HYFA 4M5NA 2QLBB 5ALSA 4B3RF 4BC5A 4PG7A 4AL6A 2V4JB 1FXLA 2O8DA 4ZN1A 4CIFA 1RM6C 4DR2K 1EAYC 2QB0B 2KYXA 2ZH5A 4BLGA 4CDGA 1HNXJ 1FKOA 3L3FX 1VDHA 2CQ4A 1KFDA 4PUOB 3IFEA 2KRBA 3TKAA 3F41A 4M3UA 3MECB 1URRA 2B5JA 2Z7JA 4OYBA 2VV5A 4Q45A 2XI9A 3HX9A 5GMDA 3GONA 3ZNJ1 4KHQA 4B8CA 2WMMA 2AQ0A 4KHPF 2YWKA 1CULA 5K14B 4Z4GA 5GINA 2GTDA 2IDEA 2H5JB 5IC4B 1BU6O 5AHXA 1UFLA 4E89A 3GIIA 4YDUC 1IH7A 3PX4A 2BDPA 3EE9A 1UL3A 3NVVA 2MRLA 1C1CB 4CJPA 1U04A 2YX1A 2MMYA 3O6QA 4WFZA 1E4FT 3W3SA 2B6AA 4BG9A 4C97A 4KHWA 1OH7A 2AP1A 3D9BA 1UQVA 2AV5A 4DFDA 1J2MA 2EAPA 3M8SA 2MHNA 5AKHA 4KO0B 3JPPA 1T3OA 2XVTA 3GE1A 1FIQA 4ZIWA 1NM2A 1WEXA 4I2GA 2ILYA 5D4NA 1AUDA 2IOFA 2B0CA 4FOIA 1G6BA 3BGFA 2NXJA 1VSFA 9ICFA 4RNNA 5IM0A 2VQEJ 3HJFA 4JV1A 2FMSA 4IQVA 3SBTA 4NMXA 5KFRA 2LKYA 3C23A 2KB2A 3AAPA 3ZSRA 1SL2A 3CDEA 1XUPO 4EFHA 2J6UA 2KFZA 4WKRA 4J8FA 3J7AN 2ROEA 2FC0A 3DRSB 5KTQA 1FTRA 3CB4A 4DSLA 1J2VA 5JJBA 2XMMA 1LXNA 1Z25A 5D3GA 7ICRA 1EB0A 4HI1A 4Q43A 3B0XA 3KVGA 1DJ0A 3AVJA 1TL4A 3BGUA 1N6QB 1TUGB 2JVOA 5I3QA 2E7XA 2BM0A 4KH1B 2KKHA 5M1NA 2IMOA 3LPYA 4HVZA 4F72A 1SBRA 4K7QA 1VSIA 4YP3A 2QLTA 3W5YA 4XIUA 1MLAA 3O1WA 3FQLA 4YY3F 2IAJA 4US8A 3KD1E 1JQGA 1N32F 4E3SA 4J03A 3UDLA 4WXWA 3GL1A 4CF5A 2XY8A 1AZSA 1M1KT 2OXOA 2ESEA 4F5RA 8ICHA 1BPXA 4F91B 2UXBJ 1U8SA 3A5LC 3K9JA 2CXEA 3OTCA 1HBUA 1FRLA 5IWAJ 3TUIC 1RYRA 4FJMA 3CMEN 3MMVA 5T7BA 3DLGB 1ZA1B 4F3OA 3VAGA 4OZ2A 2ZXHA 5AE1A 1ZBFA 4JK8A 2MY8A 2YX4A 4FW1A 4UW2A 2CKWA 2EBEA 2P1JA 3BS5A 1V3ZA 5D8HB 1EKRA 2IDLA 1MU2A 2BQ3A 1RTIA 3L3VA 4BDPA 2GHVC 3FNNA 2EAMA 3THXA 3FYHA 1VQNS 4JNEA 5AKKA 1F5CA 2WTFA 3OYFA 3GZFA 2YWGA 4YN3B 1S76D 4KH6A 4PQAA 1R8AA 4OMFG 4FLWA 3P45B 5HN0A 4CLUA 2OELA 3AVIA 5CA7A 1SQKA 4CHNA 3JAMY 1P8GA 3D0HE 4BC9A 3EVWA 4O0NA 4OZ3A 2P6SA 3JS9A 2UV8A 3P5TL 3WNEA 3ZX2A 1RSCA 1R31A 3HKZD 3WK4A 1MA9B 5AZJB 3JYTA 3ITHA 1S59A 2GQCA 3CULA 2Y9UA 2M8DB 3NVYA 4IH6A 2KKPA 1AT1B 1EARA 4XRHA 4BE1A 8ICKA 2KD1A 8ICUA 2DYAA 1LAVA 2LSNA 2ZF5O 4PHPA 1HBMB 2DGSA 4H4MB 5GTIU 5ALOA 2LCWA 2HCFA 1B3TA 3PW0A 2C3MA 2P9UB 3G82B 4LR8A 2JXJA 1SXEA 4HUEA 1SC3B 2KNJA 1KVCA 5BREA 2YB1A 4CE9A 2C42A 4GVBB 2XBPA 3C6TB 1KLMA 4Q2LA 4YXJA 1PBUA 3AXKA 3DLEA 1VRUB 2GFFA 3OS1A 3NGZA 3TO8A 3ZSXA 3L7PA 5AQLA 4I6WA 2YN4A 1U02A 4YY3J 3EYZA 3W1YC 4QW9A 5E0OA 3MPDA 3BQ7A 1ZQNA 1FO1A 1IKVB 5DS7A 2BM1A 4DPXA 2CRLA 2CPIA 1FA0A 3N4PA 1RWXB 2BCUA 4H4MA 1ZZNA 2WAQD 1WSIA 4RPYA 2E2QA 4FWPA 4DUZJ 3K4GA 3LPTA 1ED1A 5KFTA 4DN9A 3NVWA 4JB8B 1PUZA 1OYEA 3IGVA 4ZOSA 4G65A 2HHHJ 4NE9C 1ZD5A 4BG8A 3LA0A 3KK3B 3V4MA 3PYFA 5CR4A 4LFAJ 4I6MB 3RRHA 1B7FA 2GQ2A 4JK9A 3PZPA 3BB5A 4DSFA 4AUKA 2CUYA 3VQBA 1UEKA 3LDNA 2JSXA 3IMQJ 1W26A 4E8UA 4OX9K 1LW2A 2UUBK 2PFDA 1CQMA 3QQCD 3SR6A 1HBUB 3GU0A 1VQ8N 2IFXA 4BE2A 2DY1A 4J9VA 3GP9A 4I2QA 1FVSA 4K42A 3A8KA 4RBVA 1R0AA 1S7HA 5H9FK 3DWLA 4AHCA 1RCXB 2F40A 3G87A 3DEEA 3F5AA 3KLHB 2YJFA 3VGLA 3BGRB 2ADCA 3KZIU 1YRUA 2WVFA 4EI2A 1MQ3A 5CABA 3TVZA 1H1VA 3GV8B 3OTEA 3LP1A 1XQIA 1FD2A 1OKJA 2V8DA 4ANDA 7ICKA 1HPMA 5LJ5Y 4KKOA 4LJMA 4ZP9A 5H1SV 1VISA 1QM9A 1ULRA 4PYDA 2KJ9A 1HQEA 3BO2A 2VQEF 1X9MA 2VA3A 1Q3VA 2LXUA 5DDMA 4C1NI 4F5PA 1D9DA 2R18A 4B9MA 2J9DA 3AQPA 2CQ0A 3MDCA 1JLBA 1L8LA 4ZJLA 1VQKN 2Y3YA 3DDHA 3PLAA 2IAJB 4UF4A 4FWMA 5JMNA 3TZYA 4B9TA 2V51B 3NMRA 3JTNA 4KYZA 2MGZB 4ILLA 2B8QA 2MAXA 5F41A 4JI4F 5HRSA 4CLSA 1C6VA 1KS2A 4ZPDA 4NOHA 2W9CB 3RG6A 3WKEA 2L08A 5DGBA 1WWHA 4PL7A 1N5YA 1C1AA 4AHTA 4GKJJ 2JWLA 1F60B 3D6MB 4X64K 4V19X 3K5PA 3OS0A 2G8VA 4CFBA 3GJQB 1WNSA 5IINA 3ZZYA 3FSIA 4TUSA 2E1EA 1NPKA 2AJQA 2RDJA 2G8IA 3R9PA 2BQRA 4Z37A 4M5JA 1W9HA 3O2IA 4CJFA 1WWUA 5RUBA 4ZPAA 3DYAB 2A41A 2F9DA 1TUWA 2KN4A 3CNHA 2FBXA 4ZVSB 1GLBG 4ECZA 2A6AA 4GRSA 3NP5A 2Q1NA 1V3RA 4GKKJ 4KMOB 1JLGB 1VK8A 3SYZA 2HBRB 2FGOA 3SEOA 2PE8A 3HLUA 3ZSYA 3G71N 4CIOA 5J0UA 2ZWOA 1BY9A 1S9EB 2UUCF 4O5FA 3O1LA 1VJWA 4FLUA 4JI1K 2QSFA 2HHXA 2ISOA 1KFSA 5ALKA 2E5GA 1N5QA 2XYHB 4YOUA 5CCLA 4M95A 2ZH3A 3A5OC 2G08A 2LKZA 4CT9A 3S41A 3T6JA 5J2MB 2GZOA 3Q8UA 4M5IA 2D0OA 3OYCA 1O6XA 3CCSN 1Q9YA 5A6WA 2W03A 2XY7A 2VWJA 3VA3A 3PX6A 1SPBP 2Y8WA 3B9JA 3THXB 3ICXA 2A3VA 2XLKA 2JHEA 1T0TV 2BJDA 2YWEA 4W4MA 5L8RC 3V2UC 1PC4A 4CHZA 1VQPS 4FPAA 3MAHA 1FDNA 3MTJA 4DR4K 3RH5A 3QE9Y 4LBIA 5JS1A 1FNXH 2HAFA 1UVNA 1TVRB 5AT1B 2YQEA 2WW4A 2WZ1A 4XDCA 3T1HF 1Z1BA 4RQ4A 5GAGU 3KWMA 5KFXA 5B08A 4FYDA 2DPNA 3BJYA 4TLRA 3QWUA 2B7CB 4DX6A 2EFVA 2I38A 1PVRA 3P5BP 3NWRA 3DI6A 2HHHK 1ZQHA 4EAHD 5F8GA 5CE3A 2IVMA 2MLXA 3BF4A 1M5PC 2K4EA 2WHEA 3QLHA 3SLCA 3OXLA 1ZPWX 1P9YA 3F5TA 2ZH2A 3V4IB 2WW8A 1CLFA 2KIWA 4B17A 3N7PD 2GELA 4HVJA 1TUVA 3K59A 2KE7A 4DHYA 4NLXA 4Y6IA 2YWFA 4Q8FA 2QYGA 4C8LA 4RQ6A 2XS2A 4PKHA 5LMUJ 2BZ2A 4MT1A 3ZT0A 4W92B 5AR0A 4OLPA 1AROP 1TR0A 4W5NA 1UWAA 2WF9A 3TVKA 3DGPB 1VQ9N 2F4VF 1RAFB 4WE1A 1NOYA 3KK3A 4DN0A 4ZVEA 2DH7A 3A8YA 3QESA 4ETXA 4DL3A 2VPZB 3AA8A 3ILJA 1RKIA 5AQQA 4NYZA 2DEIA 5AQUA 3O44A 2Q97A 3W63A 2I2YA 2J9EA 4F36A 3PO4A 2MKJA 5F1XA 1SIJA 2JLEA 1ZXIA 4ISGA 3LK9A 4JV5F 4ID5A 3VQ7A 1KTQA 4M9NA 2FLLA 1R3NA 1FJGF 2CVIA 4P2MA 4F3TA 1L7PA 2QW9A 2XMWA 2V2ZA 5D49A 2Y9TA 1XTZA 2JNJA 2FPKA 4CO3A 1HKGA 5L1LA 5J2IA 2DNHA 3EM1A 1N62A 2HGLA 5DBBA 1QAIA 1TYQB 4DCPB 3U1LA 4F50A 4LF1A 2QXFA 3CEDA 4E1JA 5FJ4A 1O0PA 2LDYA 3AVGA 1Q81O 4QU6A 3P38A 3EJMA 3BM7A 3SBGA 4ZITA 2G5HB 4H0VB 1CJKA 3AB2B 2W6LA 2E3TA 3SCLE 3TAEA 2MPUA 3AO5A 3UXNA 1D8YA 3R5GA 2CGKA 1B7YB 4KTZA 1C1BA 1PAUB 3S1TA 3R6LB 3CDUA 3CQYA 5IQ6A 3MCSA 2GX9A 4CYUA 5C5JA 3HVAA 1GMVA 2CQGA 3ZDCA 4WPAA 4NXMJ 3D6JA 2M3DA 3C0BA 1N5VA 1IBLK 3MTKA 1VSDA 2L9WA 2MKKA 2DJWA 1ZQUA 3DRXA 4WCEL 4CHPA 5C24A 1HJOA 5K5MA 3OW2R 5I3UA 5C2FA 4M47A 2PI5A 1X4CA 2F4FA 5BPMA 4RNFA 3L7OA 3M1YA 4DR5J 2JEFA 2Z8QA 4LIRA 2KFYA 2YNHB 1LFWA 1XNRJ 3IKMA 2RH3A 2GVDB 2YKPA 2EW9A 4EIAA 4OHWA 2UU9J 3MZIA 2DH8A 4NLRA 3R27A 2RRNA 2YXLA 2AJ4A 2NUHA 2MKCA 4YOXA 3P4IA 2ASMA 4Z4IA 3GFKB 4QIEA 2D69A 1L8OA 4LF5F 1OQ6A 5KRSA 2LI6A 3KLGA 1CBKA 2JHDA 3U8XA 3BQTA 1NCLA 3ZX3A 4JOUA 3RJFA 4M45A 4IO8A 4BWMA 5BR8F 3GJTB 2MXYA 1RBOB 4RG8A 5AXKA 2GMHA 1DLOA 2PEHA 2G13A 5D4BA 2MLYA 1ZRMA 4O5KA 1VI7A 2H5XA 1EJ7L 5GIPA 2NPIA 4ID1A 5CZVA 1VQ4S 3HPHA 1S9EA 2MJUA 2WF7A 4N8OA 2DNKA 1XMBA 3HK2A 3FLCO 3FJ2A 4DFMA 3QYYA 3IV6A 4K0KK 1FDAA 1KEKA 3MEDA 2FJAB 2FXUA 3RSEB 1Z4OA 3ATVA 3ULHA 2VKQA 4FDFA 3GCWP 2ZIVB 3DRPB 4DQSA 4O44A 1N48A 1ICEB 5J8YA 4M6WB 3V81A 4IQWA 1NJZA 4WQ5C 2GHPA 2VZ9A 1JNRB 4OPHA 3GPAA 3SSSA 3CD7A 4P4MA 2B9WA 3C14B 7FDRA 2H3VA 9ICMA 3AFGA 3DMJB 8ICGA 1L7OA 5HLFB 3FZ2A 2OP5A 2FJEB 2RU3A 1MSWD 4ZLLA 3VTHA 4J9LA 4M3RA 1JLAB 1RT3A 1S1VB 4C0OC 4I2BA 3FCHA 1RT4A 1UZHA 5EOZA 3PSIA 3FCVA 4RX6A 4UZBA 4TURA 3ICLA 1ZQRA 4FJKA 3MCOA 1IQZA 1NU0A 8ICXA 3D5MA 3UCGA 3NGKA 4OLAA 1CS4A 4LF4F 5AK6A 3CCTA 2RMLA 4YMEA 4NXNK 4C7YA 4QWCA 2ZIVA 2CJKA 1HNXK 2NZ4A 1DK3A 2HNYB 5GADP 3CJ5A 2HWTA 3M2UB 4DOZA 3RFAA 1U9LA 1CJTB 2YPYA 5C10A 1FKPA 3AO1A 1WOPA 1S48A 3SMSA 4LBHA 2QMXA 1ZRNA 3S6JA 4CFAA 5ALEA 1LW0B 1QHTA 4I68A 3BSOA 3VF6A 4WQ5A 2RD5C 2QWRA 3VOVA 4DR7K 3IRUA 2ZOGA 2A5XA 2FTRA 3DOKB 2IYIA 4FSVA 2MQPA 2RQ4A 1FK9B 2ZZNA 5GAGI 1IJJA 3J80Y 5K8PA 5GAEU 4GXKA 5B0CA 4L8RB 4X4UA 4CZHA 3N6LA 1U48A 1GX6A 3CDAA 2FMPA 2FVPA 3V72A 3BQ1A 5AM4A 3CD0A 4PRFA 3GBTA 2AYEA 4HT7A 2KHOA 2OA8A 3CSKA 4J9KA 7FD1A 3ALYA 4CEAA 5A2QO 1T8EA 1ATRA 3ILOA 3LP0A 1ZZFA 4EENA 2P9EA 4CJ4A 5AQJA 2CPYA 3P83D 3CIPA 4OJPA 4YS2A 1QQ5A 2N3OA 4WYLA 1VQMS 1HNIA 4DV3K 4MAKA 5KFQA 3CCEN 3AOBA 3T1HK 5KFEA 4WE1B 2NSCA 4CJWA 2Z1IA 4WJBA 5EVZA 4B3TJ 1TU0B 1PSDA 3CDWA 4O3SA 3E58A 3DOKA 5FLXU 1X4BA 1HHQA 4UY8T 1FK9A 2OFGX 3IMXA 1OY9A 3SZ2A 1FRJA 3B8HA 1HHSA 3ZDBA 4R66A 5BPLA 1FVQA 4USIA 4JEPA 3Q83A 3R6MA 2C3PA 1CG2A 4DV2K 1EETA 5AI9A 2P9SA 2K4PA 2I8EA 2DNPA 2GV1A 3NE6A 1RXVA 3NGUA 4DTNA 3HSJA 4CCHA 4ED4A 4O8UA 1RDWX 5LMUF 3IP4B 3P8BB 1S97A 1FX2A 4DR6F 3E0FA 3BKTA 4JI3J 1HBNA 3G8SA 1N32J 2MKHA 2UU9F 1ZOTA 3IAYA 1YQHA 3C6UB 5LOQA 4UQTA 5ALZA 2CNNB 3FMWA 3PCOB 4YHHJ 1NUEA 3QETA 2ASLA 3J7YU 3OS2A 3EVOA 3BKUA 5DB8A 1ZBUA 1H2UX 3T19A 4DX7A 3DLKB 2L5YA 1NH8A 5DO2A 1F6TA 3CJ4A 2P9NB 5LJ3Y 3QNNA 4E7IA 2X51A 1DURA 2A1BA 1NDPA 3GFXA 1YIJS 5DDPC 4BQLA 4NL5A 3PFEA 1GLDG 2XY5A 4FVMA 2CQPA 4LFCF 1HUXA 2HWHA 2NREA 1C1BB 2K3KA 1BHNA 2BGWA 2BCVA 3G71S 4C23A 3W66A 2BR0A 8ICLA 3TNVA 3CC7S 4H0XB 3VQ6A 2HIYA 3RMCA 4A8XA 1RHJB 4P74A 4ZP6A 1C0FA 3C16A 4Y1CA 4KLOA 1KN5A 4DL7A 1UZDA 2IOCA 3I56S 3EO3A 2XWYA 1C0TB 3TZWA 2BOPA 3H45C 2VC1A 2YKNA 2EX3A 3THVA 1U24A 4HUFA 3L4BC 2QK9A 1WSHA 5KOWA 1VDVA 1ZQYA 3BSCA 4EUVA 3QATA 4IOCQ 3DGVA 4JMUA 3AJ2A 2EFNA 3GG0A 3LPEA 2R42A 4LSLA 1S6QB 9ICLA 2D7SA 2IHR1 1Q0NA 3DAWA 3M8PA 1WSGA 3BZQA 1LWCB 4JD2B 3BBBA 3FSYA 4QZHA 4KHMA 1S49A 4JHDB 2LQJA 4TNOA 3OYJA 5JRTA 1R59O 3CJ9A 1RTIB 1X9XA 4CD1A 2QARA 3M8QA 3HFZB 4FLZA 4TU9A 4USMA 4FF4A 3CC2N 4NZ0A 3BEXA 4ED0A 2BKNA 3PXGa 4TQSA 4E19A 2BPCA 4ILMA 4LJXA 4CIGA 2R2TA 4B6JA 2WVBA 5EX0A 4QWEA 4B9UA 3QRPA 3WX8A 2F8KA 3UN2A 5BPCA 1SB3C 2E7VA 3C2LA 1P9QC 3W2WA 1ZM3A 4LSLB 4DCCA 4C48A 2GVZB 2IJFA 4TY8A 2DEJA 4DV4J 3ULEB 2ZM6J 5L9XA 2ZIXA 4P2FA 1ZQWA 1L3UA 3S6EA 3SUOA 1T3NA 4IQUA 4OJ6A 1S5ZA 1Q82O 1X4DA 2WB1D 2QB0A 1Y5LB 1U09A 5KRTA 4R65A 1EKEA 3NF9A 4LZDA 1O13A 3SQGA 4A8QA 5GAHP 4PH5A 5AI6A 1ZQQA 4K4HA 3JXOA 3P4UB 4KRFA 4JI2F 1S57A 5H9FJ 4KC5A 2HHVA 4ZVOB 3VESA 5DG7A 1RDUA 2RAQA 3QPIA 3BR9A 2GLEA 5B0AA 4FYXB 4P0QB 1JLQA 1H6KX 3A0IX 4JN4A 4FW2A 4B9VA 1RDBA 1SQFA 1RTHB 1HNWK 3UQSA 4A8MP 1X5SA 5ALMA 1NSAA 4PZVA 5EWGA 2M9KA 1S7IA 3UVJB 3JPOA 3M2UA 2ZIXB 1NNDA 1BQNB 4NA2A 1F5SA 3SUNA 1KRPA 2J5AA 2P8IA 1IKWA 4KITB 4FLTA 3SDEA 2UXCK 2E5SA 4FYVB 5KPZA 2A1AA 1WC6A 1OYDA 2XQCA 1VQ7S 2Y1LB 4IH7A 3VQAA 3AO3A 1D09B 2FJBB 3CWJA 2QWQA 5DM7Q 2EH9A 3TSQA 1X4AA 3W3DA 4DR3F 2BJ7A 3OYKA 4ER8A 4MQ3A 2VGNA 2VIXA 1ZC6A 2W55A 2COLA 3VQPA 4L6V3 3ENWA 4PXEA 3O4NA 2NZTA 4OV6A 2E88A 4MLHA 1M1HA 4US9A 4CH1A 2B9EA 1UT8A 3CJTA 4NEYA 4NL9C 3AVNA 3JAMU 3AOCA 5KQ8A 2HHSA 1PKUA 2W1BA 3ONNA 1A5VA 1FKOB 3D6TB 3HPOA 1N5XA 2O4GA 3W62A 1N4LA 1YJNS 1EIYB 5J2FA 5CZ1A 2ITGA 2B5JB 3PO5A 1RUSA 5AFUA 2CXYA 2MZQA 5AM0A 2WVCA 3POTA 1K1SA 8ICRA 4YD1A 4CTAB 3KTQA 5FRMA 3QFWA 1ECWA 4NV0A 2EC2A 4ZA1A 1XI1A 1UEUA 2ZHAA 3Q8KA 2E20A 2WTUA 3SQ4A 2RF2B 2DD8S 4M41A 1CULB 3A8IA 2OSQA 2AMCB 4F04B 3NH1A 1NZPA 3IM9A 4ZCKA 3SCKE 6FDRA 4RT2A 4RQ0A 2W4DA 1WC0A 1IBKK 2MTLA 3DN9A 1UJ5A 4WP9A 2ROPA 2O8DB 1GLAG 5FP0A 2YH1A 2P6UA 1QUVA 3B4MA 4C9DA 4B3MJ 3WKCA 5C2GA 4USUA 1X5PA 3KMQA 4WF9L 3MN6A 2QTWA 3Q0AA 3C46A 4WFNL 2CQ3A 2D9OA 2HS0A 3ET6B 4OI6A 4LQ9A 1H38A 3ULEA 2QZ8A 5L38A 4DFPA 4MK8A 2BXJA 1WELA 2RQ5A 3ISND 1Y5NB 4DWIA 3N5FA 3BSNA 4BQZA 1E4GT 1X5OA 6FD1A 3BH7B 4PG6A 1SXLA 3GV7B 1YIJN 3VZIA 3CCVS 2V50A 3JTPA 2V4QA 1HNVB 5HHHA 2V0NA 1R0CB 1S0NA 1V5VA 3IR6B 3P96A 4NXZA 5KGXA 3ZSQA 4HCCA 1VLYA 1VC6A 2ZZMA 3GFHA 3CJKA 1M6YA 4Y1DA 4HWIA 2I6XA 1WOSA 5AKGA 2ZUGA 2EPIA 5AQRA 4GVLA 4H0OA 5AKXA 1BUXA 3PEHA 3FZBA 4MDAA 2JR5A 2XGPA 4MN4C 2AD9A 2V4JA 4FYWB 4CBWA 1V9OA 4KHUA 2FZCB 3NS7B 4ED2A 2I5HA 4IOCL 2AGQA 3FAHA 4I6YA 8ICSA 5M2RA 2O8CB 1IKXB 3M6WA 3W2VA 8RUCA 2X6SA 4JI2K 4IUFA 3Q8LA 2DNMA 4KO0A 4I9LA 2QM1A 3OTDA 3IAM9 4BDZA 2ZTDA 4IEIA 4U9RA 4DTMA 3AV9A 2BVZA 1XERA 4A46A 1VBYA 4KLGA 3AOAA 1HW9A 4F26A 3SI6A 4H8KA 3MC1A 1U0SA 4OYIA 3QGGA 3FRYA 3IWNC 2AJ1A 4KLTA 4DUZF 1WI6A 2HBKA 3QU7A 1QQOA 2UUAJ 5J1NA 5ETSA 1AUSL 4MJKA 2A1RA 3FFIA 2ZXIA 3UXPA 2D6FC 3I33A 3ZETB 3LGNA 4BRMA 3IRWP 4HLBA 2XNQA 2EAOA 3J7YI 2PZSA 3DOLB 2N7YA 4CJRA 1DK2A 2CPZA 3OTOK 3DXBA 9RUBA 2EEYA 2HK3A 5AQNA 2E5LK 3OTOJ 3KXDA 4KJIA 3KYLA 2HRTA 3CCLN 3IHQB 2OD6A 4BGAA 4KB0A 2JEJA 2FGCA 5E41A 4JKGA 2IC3B 1ZS6A 3NGRA 3JPSA 2HNZB 3W0LA 4CNZA 1SV0A 1KHWA 2AKWB 1KW4A 4IO9L 1KCFA 4TYBA 5J2HA 3FKBA 3TAGA 1KKXA 4XQ8A 1N8RT 4DU4A 4IQTA 4C8ZA 3HP9A 1YZ7A 2FYXA 1YRXA 3I31A 3EL2A 4CBXA 4E7KA 2DO4A 3PVXA 1T9VA 1ZOLA 1BPZA 5CQGA 4FS1A 4CGDA 4WFAQ 3OBYA 3R5DA 2VG7A 3THWA 4B9NA 5B5EU 1R6VA 4LF4J 2Q1LA 2V8VA 3R9LA 5CZ2A 4BWJA 2DFLA 4X62J 3HSDA 4U8YA 5FDLB 1KQGB 2E6LA 4EBEA 2I7PA 4K59A 4FF3A 2HI0A 4WTYA 3QFUA 4NRTA 3O9UA 1VSEA 2D0CA 5AKZA 2IRYA 4CLWA 2JH1A 1JRPA 4BDYA 3KZBA 4NWIA 5HJXA 1XNRK 1XNQJ 2ZKUA 4K41A 3HZGA 2J76E 1BG3A 4I2QB 5J2QA 2IVNA 3SJJA 5AIBA 1U1MA 4J5OA 2F4VK 4DQQA 1TUUA 2YHYA 4YMNA 2B4OA 3OBWA 2W2PP 2HMIB 1KHVA 2FIUA 1DQ9A 2HMXA 3WQUA 2CQ1A 4GV9A 2VOPA 2QA2A 2FY1A 2E1PA 1SXDA 1T03A 4J9SA 4U7UK 2AYGA 4P6QA 3VA0A 1PVPA 4DV4K 2HQCA 2M8HA 1V3SA 3VV2B 3CVKA 5L1JA 3J80U 2KJWA 2OHFA 1FNMA 4CLKA 3DXMA 2MKYA 4UQGA 4WFXA 3T69A 2N82B 3G6XA 4CM2A 3KHRA 1GX5A 4NLUA 3K5MA 2FJVA 3ILLA 3MR7A 4E98A 1U8WA 4LRDA 1JCEA 1S0MA 3ZTRA 4EX7A 1Q81T 4PL1A 3U26A 2MHEA 4DPWA 3VEXA 3TVYA 1KBRA 4LF9K 4KH5A 5AJ3J 4JI8J 3N01A 3J81Y 2CZ9A 3E66A 3NXZA 1TL5A 2R2SA 3EEQA 4O0JA 3HWTA 4M5LA 3LW5C 4ZKAA 5F0WA 3M9OB 3MD3A 2CJAA 3RF9A 1KVJA 1UVMA 3JPQA 1S4FA 3HFKA 3ETMA 3BPDA 2HSTA 2ZBIA 1JLCA 1RABB 4EBCA 2VKRA 2HOQA 4DOBA 3BY5A 3QEXA 4ZLNA 2M70A 5IM0B 4Y28C 4Y2AA 3ADAC 2QWLA 2UYTA 3R5JB 2VGMA 4KGMA 1Z4NA 3AM9A 3H7IA 2CPRA 2V8PA 2FUG9 2A40A 5ETPA 1SGGA 4JKGB 2XMUA 3G82A 4KI4A 4UT4A 1BE4A 1EX4A 3CC2S 2PGCA 2R8GA 2HVZA 3DRSA 3KWGA 3LGHA 4Q44A 2PI4A 3FBEA 4GXJA 2A6OA 3NS5A 1QVGM 2OMLA 4Q5VA 3TW0A 2LYVA 4EWTA 5CXTA 4X66K 1WG8A 5D3GB 1COKA 3DLEB 4PEOA 3SSRA 1SUQA 2XTJP 4KTQA 3ET6A 4Z4CA 1COOA 5GAHU 3R3LA 2OPQA 4NLVA 3WXMB 3OHRA 1OPIA 4F7VA 3PUFA 3V6KA 1K9MO 1JJ2R 2NCKL 3GOIA 4ISEA 3O3HA 1FI4A 3ORYA 3MMAA 3EN9A 4HKQA 4NCAA 5CHGA 4YOYA 4DR2F 3MPVA 3UFCX 2ASJA 2VC0A 3GSIA 3QGPA 3BGRA 2BRKA 2SXLA 2NYVA 2E7WA 2ERRA 3D54A 2YCHA 3T5KA 4N47A 1WBBA 4C0ZA 5HP1A 2HSEB 4WBFA 4V19J 5J2QB 4OKKA 1FFUA 1JUDA 3WBZA 4ZHRA 4UAYA 4I6MA 4HEA9 4CGJA 4KPCA 3TFRA 1LNQA 5EE9A 4RW9A 3WXIA 3CO9A 1UW9A 1IG8A 2BMBA 3NS6A 2B4VA 1X3NA 4K4TA 3H3OB 3ZT2A 4P52A 3T3FA 4NLWA 3QEVA 4OYPA 3H8JA 3OLAA 5HK4A 1PK3A 2Q43A 2ILZA 2A3JA 3SFUA 1WD6A 1VRTA 1SCJB 2YNIA 2F1IA 2W40A 2J6TA 1TELA 2BCSA 4O23A 4OGCA 3MR2A 2KHQA 5FROA 2OH2A 2MDAA 2G8HA 2XLIA 4EFAC 4K8ZA 4ZTFA 5DBAA 4DF4A 1GOCA 1ZAWA 7ICIA 2OAUA 3B78A 1NJIT 5AQFA 1TTHB 3UQ2A 2QYCA 2PDAA 4H4OB 2DGUA 2FI1A 5ALHA 1J5OB 2FBTA 2K8CB 1KQQA 3F9MA 2YHWA 4ZP7A 4DSKA 4QR0A 1Q5VA 1H72C 3N5BA 1RWMB 3E9OA 3G96A 9ICUA 3IBPA 4DV6J 2QA4G 4FNIA 3SCIE 2NXCA 3ZEUA 3EE3A 3VCBA 2D3UA 2BE9B 1ZJMA 3Q2TC 4RW9B 3HKZC 5J2KA 4CH0S 3ETOA 3KJVA 4CLPA 4Y2RA 2XZTB 3MCMA 2OFHX 2AHOB 5AKEA 1YHQS 1N5SA 2ZUCA 4G1QA 2WOMB 4B1YB 3ZSVA 1DEJA 1VQNN 3I4HX 2R7XA 5ALNA 1ZQPA 4KHSA 1KLMB 2YNFB 1WHXA 2BW7A 1JIHA 4LREA 3PRVA 1VRUA 4Y2JA 4DUYF 3QINA 4DL4A 3RBZA 5KFHA 4B3RK 1RNHA 2UXBF 3TR8A 4EEYA 4PXDA 5IZHA 4KLDA 1WSVA 4RO0A 2I1QA 4HTJA 4JI4K 9ICJA 1XC3A 3PW2A 3M05A 3K58A 3BP8A 1GTHA 3ENQA 4OZ5A 4YR3A 2GV9A 2RS2A 4PXBA 3CCQS 1YSJA 3NGSA 3FZMA 1X7VA 3CCMN 2HZCA 2F65A 1B0VA 3DXMB 3I0SA 2FHJD 5JVHQ 8ICAA 2KM8C 4XA5A 2JLGA 1LK7A 4WFNQ 2AIRB 4MH8A 3W9JA 3W9HA 1MC8A 1WUUA 4FWKA 1GO3F 2CAJA 4IQMA 5ETLA 1HJRA 1OJ4A 1NGCA 3OVSA 3EZOA 1CVJA 5IIJA 3CPEA 2FPLA 4ATNA 3TACB 2HHPA 5HHIA 2RHSB 4OYZA 2Y9HA 3QGIA 1X42A 1S6OA 5LJVA 2V34A 1S4EA 4C7QA 4Z6FA 1VJ5A 1QQCA 4ECWA 2VG5A 1NGAA 4Y34A 2O1PA 2Z4PA 4DTSA 5ALPA 3NKYA 4MIWA 2YJEA 2L41A 2W41A 3N6MA 5ITHA 2NYIA 5JS2A 1RGVA 4FPBA 1RT2B 2YKAA 2FJWA 5D4LA 2WF8A 3IGNA 1T3QA 4MK7A 4QBUA 4IOAL 5GIOA 4F3QA 2ETJA 3ZNUA 1YUWA 3KLGB 2K4HA 4C0BA 2RT3A 4TQRA 3UO0A 2PY5A 5IT0A 1S9FA 5K20B 3N4QA 2NRTA 3CERA 3QNWB 3AGRA 4HHTA 9ICCA 3AVCA 3H8SA 4KLJA 1X60A 4DU1A 2F1FA 3A3PB 2B51A 1WC3A 2O8BB 4FCYA 3ZD8A 4M04A 3J7A1 3UDVA 2VASA 3KWIA 1SJ4P 4FM0A 1R7IA 4NI2A 5BRFA 2LEAA 1DOQA 4CK2A 1JLBB 1FJ7A 3QBWA 2ZITA 1XMQJ 2XNRA 4WU3A 3C1ZA 3WK5A 2G1DA 4QW8A 2D0BA 5JXSA 4BRHA 4YR0A 4LRCA 4XK8C 4CF0A 4GV3A 3M9NB 3RJGA 2AGOA 1VAZA 3G2XA 3ETLA 1FRHA 4NMLA 3MGIA 4F25A 5JVGQ 5I42A 5KFFA 2BJ8A 4NLSA 1V97A 3EXCX 3JTOA 2Q66A 5L39A 1RT7A 3SIPB 1JJ4A 5F3ZA 4OI4A 4XUSA 3KJVB 4DTRA 3HF5A 2F76X 3DU5A 4RNMA 1YJ7A 4URSA 1VQ8S 3HBTA 1Q5YA 4OHYA 2P9LB 3R1XA 3OYBA 5FIIA 4CK3A 4DKWA 1N34F 3D7EO 4LFBK 2QMWA 4H5NA 2EXUA 3ZSZA 4KRWA 5AXLA 4LSNA 3TEGA 2D3O1 3IBWA 2QLWA 3LDPA 4DG1B 4CGGA 1S5LU 5D77A 4EHUA 1RAIB 2K8AA 3N4WA 2DUYA 2CADA 1QLNA 3ITHB 1MN8A 2B9XA 1CS4B 2CPHA 2UUBJ 1BIZA 4FS2A 4ID5B 2DNNA 5CH7B 4KLSA 2YNIB 3BN7A 3DM2B 3Q8QB 3QMQA 5ETNA 3TRGA 4BACA 1FWPA 3TA1A 2D74B 3VAJA 4TY9A 4J91A 4DBQA 4C3LA 4ED6A 2GUPA 4JBCA 5IQQA 2VPWB 4CRJA 1UWBB 4OJ3A 3VQ5A 4A47A 2CPDA 4OX9F 1RZTA 3UKRB 3C2KA 7ICMA 4L73A 1TMJA 5KFNA 4ICLB 2YWHA 4E0DA 3LTOA 3MN9A 4CBUA 1K8KA 1M5KC 3MM6A 3THPA 1WYGA 1BUPA 4ED3A 1OWXA 2W54A 3DRPA 4BXOA 3KUGA 5I4MA 3AA2A 1TKDA 3OYHA 2IVYA 4FZZA 4ZOHC 4EO6A 3K2PA 5CAAA 4LFAF 3ILIA 1WAJA 1OW5A 4C8KA 4BR9A 5J1PA 3T5LA 3QNOA 1UTAA 2NV3A 1TAMA 1T94A 2H4WB 4FJNA 3MBYA 2IHMA 3A5NC 4L3KA 1NNEA 4Y2TA 2OWOA 3HT0A 2CNOB 4F5OA 3U9ZA 1XWLA 1KDNA 2RN2A 1SQGA 1I94K 3OL8A 2YNFA 3TARA 4ZPBA 1JJCB 3SQGB 3CP8A 1S1VA 2RDDA 4CF1A 3SCJE 1X9JA 5FLXO 4X65F 3MR6A 1ZQIA 5J0OA 1XN9A 3OFHA 1XIQA 4UW9A 1WNEA 5I3UB 3DI6B 1ZM2A 1C2PA 4MTPA 3MUVP 2H3GX 1C20A 4ID8A 1RADB 5HQLA 3B82A 3M8ZA 4P75A 1KQSR 3AD9C 1JXBA 1QD1A 4X2BA 1J2NA 1GLEG 4DS4A 2KV2A 1LKYA 4BXOB 1PCAA 2HMPA 3EKUA 9ICVA 3OR2B 1KQFB 5KT5A 2BPFA 1I6JA 5FLXY 3VGVA 4AHUA 4O3NA 8ICCA 2QN6B 3NVZA 3OV7A 2U2FA 4JUZA 2A3ZA 3C14A 5AI0A 2ACMA 2J0WA 2VD3A 2DR6A 3CM5A 4E7JA 4XDDA 4ALZA 4CZFA 3OYIA 5A76A 4CGZA 3QSYB 5KFJA 2UP1A 3PEJA 1HWIA 3MMCB 3V6DA 4FJJA 4WFBL 3V6JA 1J5EF 2FPHX 2QA4N 2ASPA 1R0AB 3CG7A 2NYHA 3QGHA 4RLEA 2BX6A 2UVUA 2Q6CA 4R79A 3QIOA 2W24A 2DIUA 3PYEA 3WIUA 4LT6A 1U2FA 2DNRA 3M6ZA 3VEOA 5KL8B 2N3LA 3O5BA 5BR8J 5A8RB 4X4VA 4BRLA 3WQPA 3LAKA 1KC8O 2DPJA 5IFMA 5IT9U 3HULA 3H5XA 1Y88A 1CEZA 5IWAK 1PG5B 3UE2A 4H0TB 2BQUA 1VK3A 1M90T 1UVLA 1H7WA 1HNZK 2H65B 4CLTA 3CFOA 2KG1A 2X1BA 2YQ0A 4CFCA 2ZH4A 1ZJNA 5J2PB 4RW8B 3LP3A 4CZEA 1NSPA 1HNIB 2G8UA 2KT3A 4RW4B 3HHLA 4YFUA 2XB2D 3SMVA 5IV4A 3V6DB 2JEGA 4NCGA 3OYGA 1DT9A 4HH0A 1S79A 3QT7A 1NLVA 3MMBA 1IN0A 1LAWA 3VR1A 1XR7A 3EGNA 3VF2A 2HKEA 2MGZA 3HSGA 1WWVA 3RW6A 4OKJA 1QSSA 1K0VA 8ICWA 5E84A 5K8MA 3PTWA 1MWMA 2YKNB 1N8RO 4NXMF 3KJQB 1TKTA 4Y2MA 5FPNA 4LH5A 1YI2N 1RTDA 1J97A 1J53A 2QKBA 4RT3A 2F4VJ 1VHXA 4ED5A 1DTTA 1S1UB 3IG1B 3VQCA 1B9FA 2RRBA 4QIVA 1RLCL 1RWWB 1A6LA 1Z2LA 4J9MA 3LM9A 1UJ4A 2YVSA 3K7RA 2DBBA 3VMFB 2ZWHA 4OYOA 3EXYA 3C6UA 3BO4A 2UXDF 1X6JA 2DKXA 1FEHA 4YB1P 3MXIA 1FKPB 3MEGA 2B6GA 2X1FA 4KLHA 2P66A 1HLUA 4OHZA 4OLBA 1B70B 1Y5IB 3ISBA 3PJWA 3TUZC 5F8HA 4RQ3A 2VONA 4HAIA 1GMUA 3AVHA 2VFVA 1RAAB 5F8LA 2OEJA 1S22A 2V67A 4EEKA 4WTOB 2Z56B 1RJJA 2X6NA 3CJ7A 3HHLC 4DUTA 2DB1A 3VHQA 2E5HA 4F2SA 3TQ1A 1FE4A 3P39A 1A77A 4IEEA 5C25A 1QSYA 4X4NA 1OVYA 1LWEB 5F8NA 3SV3A 3OYEA 8ICFA 5KQDA 4NM2A 1L6NA 5E3QA 3ZZTA 4FK4A 3R6GB 2FHJA 2E9TA 3G9CA 4IKAA 1TK0A 2K3IA 2PT0A 1KVBA 1HR0J 1B92A 4FE3A 2J0SD 4RUHA 2HVEA 4ZH4A 1LOTB 3D7SB 3CC7N 3L4PA 4GW6A 2DHHA 1KAXA 3DLKA 3HDSA 4Y2PA 4GKKK 4TXSA 1WKKA 2PFNA 2O8FA 3AVKA 5J0XA 4DF8A 4R0JA 1S6QA 4ENOA 2ZJQQ 3OW2M 3RW7A 2PA8D 4UB1A 5E3PA 2KSOA 4KV8B 4UOCA 1R8BA 2XZWA 1EQMA 3MCNA 4EYHB 1VQ6S 1NSKL 2HOEA 2GO8A 4EK2A 1FFGB 4B9QA 3GV5B 2ZM6K 2WFAA 4P0QA 3TTDA 3UMGA 4WK1A 1JK9B 1PJ5A 4AXJA 3U3YA 1FKAF 3D0PA 8ICOA 3AD7C 1VR6A 2QIFA 4N5SA 4A2AA 1I3OB 4OJGA 3H3NO 3MWTA 2LYAA 1VQON 5HMLA 1Q8KA 9ICQA 4H5VA 4NO7A 3I87A 4FYYB 4NRUA 1FNOA 2J8AA 3V1QA 3CW2C 2V7ZA 3X3UA 1PK1B 3QEBZ 1RWUA 5LL6Z 4I2DA 3IG8A 3CMAS 3KFUF 2XO6A 3A0BU 4IDKA 5B7WA 4PWDB 3S3NA 5L1IA 2ZGZA 4IG3A 2MUTA 3MM7B 2LXIA 3LVVA 3OR2A 2OKQA 5DQHA 1NK9A 4ECXA 5G0RA 2HIQA 2Y0SD 4OYMA 2W9AA 2H4YB 3KKAC 5FDLA 1EXQA 5HRNA 3UWTA 5FPEA 1F5BA 1KC8T 2B6AB 4WJ3B 2P35A 8ICPA 2M88A 4JKHA 3WK7A 3HKWA 1HBOA 5HROB 3PIPQ 5CYMA 3C5GA 3OHBA 4I56A 4C8NA 3VTIA 4G1IA 2F8LA 2JRZA 1EHWA 5E3CA 4CEEA 5D6GA 4QZGA 3RUBL 4ZJQA 4K4WA 5KI6A 3FQKA 5GMEA 1TKZB 2MZTA 4UB8U 1C0MA 1MDUB 4P7VA 4ECQA 1PK1A 2FBVA 1BPDA 4J9NA 4P0PB 4PL2A 1VBZA 1TP7A 3L3CA 4LF7K 2H54B 5GAGP 2GVZA 4F0KA 2D1KA 2HF4A 2I7NA 2P9PA 1PJ7A 3C94A 3CQXA 4U95A 3ASMA 2F96A 3MR3A 1R89A 2W6KA 1N0UA 1MWZA 2ZBCA 4IJNA 1HMVB 5HMWA 4FJ5A 4UY8O 4W5RA 5KFVA 1NHVA 3H2LA 1H3DA 5KG1A 1B4SA 4A8EA 1ZA2B 4BS2A 4WWSA 3U1NA 3DLHA 2LECA 4BC3A 9ICSA 3OPKA 3TX8A 3I8DA 4DCOB 2Y8YA 4KLEA 5DDYA 5B0BA 1YTAA 1HKBA 1HLWA 1HWKA 4DR3J 1RTJB 2YBVA 1NGFA 2RE1A 3F44A 3D28A 1QCKA 2Y1IA 5CHCB 2Q3SA 2RB7A 1RBVA 2ZUDA 2FF6A 4P0PA 1IG9A 4KLMA 3CCRN 5GAHI 5DK5A 3FC9A 1YHQN 2IGIA 4X62K 2OYYA 6AT1B 3N0VA 1B64A 2YPZA 1Y10A 1TAQA 3DDKA 4MKBA 1CXQA 4USWA 2VJVA 4DR4F 2CA9A 1WACA 4D3GA 4BRDA 4QZEA 1RT6B 1FD8A 1DBDA 4QZBA 1R0BG 3POTB 4E7HA 3JQJA 4WIQA 4KLQA 2D41A 3LP2A 4QZVB 5AK5A 4DL5A 4KLFA 1YXQA 4M3ZA 3GZ7A 2F3JA 3QFPA 1B43A 2AJFE 2XSFA 5J2NB 4B3TK 1EKSA 3HCXA 4L75A 2JC0A 1WC4A 1WF0A 2AX1A 2ZQBA