1NK5A

Adenine-adenine mismatch at the polymerase active site
Total Genus 206
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
206
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 206
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk5A01
4I27A 3S3MA 5FDLA 3AO3A 3LALA 4R66A 1TKTA 3UQ0A 3H8SA 7ICRA 3DLRA 3SQ1A 9ICVA 3I8DA 3C21A 4IR1A 2P5GA 3A2FA 3LPTA 3SI8A 3MR3A 1BGXT 3OYFA 2ZJ5A 1U04A 3C2KA 4B9VA 1KVCA 2J6TA 4KHYA 1S9FA 1REVA 4NLNA 1ZQLA 3MEEA 4AHUA 4FO6A 3MXMA 2XHBA 4O44A 7ICPA 3RB3A 1SKSA 2J6UA 3ZDBA 1X9SA 8ICLA 5IIOA 4CF0A 1RTJA 1IKVA 1RBTA 7ICIA 5C42A 4YD1A 1VSMA 2W9CB 3EY1A 5J2MA 5HRPA 3VQPA 3HPOA 4EBDA 3RJFA 4M6WB 8ICMA 4OLBA 4O5EA 8ICHA 9ICQA 1RT2A 1A77A 4FM2A 2F8SA 2NRTA 5HRSA 4IQVA 5DQGA 4IBNA 4M47A 1JMSA 5KT7A 5KFVA 1QSLA 4OVLA 4I2IA 3WNGA 2E4LA 4CGHA 3TWHA 4M9HA 4IDKA 3C5FA 4M9JA 4KTQA 1RXVA 2HNYA 2BGWA 1TKDA 3NGIA 1NK7A 3KLIA 3NGDA 1IH7A 4AHVA 3NAEA 5DQHA 1ZQTA 3DOLA 9ICXA 4I29A 9ICLA 4P2HA 4PGXA 5DBCA 1X2IA 3AVCA 1TL1A 3LANA 4YQWA 2IBKA 9ICGA 1WSHA 4J9KA 2DY4A 4RQ8A 3Q8QB 2GUIA 2G8UA 4JWMA 2X74A 2MAXA 4F4YA 4DS4A 4M41A 4R8UB 3RMBA 3AA5X 4RW7A 3QEIA 4DSFA 4O3PA 2IC3A 3KJVA 2I5JA 4F4XA 4DQQA 3P83D 2PYJA 3PV8A 3OYBA 4ECVA 4Q43A 5HMLA 4QZBA 4RQ2A 4PWDA 4QZHA 4RQ6A 3CFRA 3LP1A 1B43A 1YTAA 2QK9A 3L3VA 4F3OA 3V7LA 8ICWA 3BQTA 4DF4A 1ZQBA 3KD5E 4I2DA 4IRKA 3ISCA 3GFKB 1FK9A 4MF8A 2YNIA 4C8KA 3TQ1A 2HHTA 5KFBA 3SQ2A 3FYHA 4B8AB 5CZ1A 5HHHA 4ELUA 3SNNA 5I3UA 5J2EA 4M2YA 4CHPA 2C2RA 1RT6A 4KFBA 3QZ8A 2AU0A 1RBUA 5J2QA 8ICBA 4DTXA 4AHCA 4ED1A 3JYTA 4YR0A 1U9LA 5KFZA 4CHZA 4JV2A 1GOCA 2OZMA 2E6LA 2BKEA 3EPGA 1S97A 7ICHA 1N5YA 2FLLA 5C24A 3QLHA 4KHWA 4HUEA 3AO4A 1UWBA 2D0BA 4C8NA 3EYZA 2V4RA 5DGAA 1BCMA 1K1SA 3OS2A 3NHGA 3C94A 2HW3A 4N56A 4ECSA 4R8UA 4R63A 2ASJA 4O3QA 4PH5A 2VWKA 4J2BA 3RRHA 3PY8A 5D46A 1UOCA 4XA5A 2HHSA 3RAQA 4EBCA 4ED7A 1JLQA 4J9PA 4KLOA 4ECUA 2DFFA 3T5HA 1KRPA 4RW8A 3Q8PB 3F73A 1ZBIA 3RMCA 3ZCMA 4UAWA 1VSEA 1BISA 5KFJA 4QZ8A 3AUOA 3SUPA 3OYLA 3O3HA 2PFOA 1F21A 5CJ7A 4F92B 4YCXA 3MR2A 4OLAA 4M3TA 4RW6A 4Z0UA 3DRSA 3AVGA 4OGEA 3PR5B 2HNDA 1RBSA 1VSJA 4PHEA 2C2DA 1IKWA 5C25A 4KTWA 3HXMA 5J0PA 3K5NA 1WLJA 4O55A 3TAMA 1BPZA 2FPKA 5IIMA 8ICVA 4CJ4A 1B92A 2P6UA 4CEDA 1RTHA 5J0SA 4Y1DA 2AGPA 3RJHA 4DO9A 1VSKA 2IOCA 1RZTA 4J2EA 3IRXA 3V6DA 4DEZA 5BPCA 1JN3A 5J2BA 3OY9A 1WSIA 4RPYA 2J6SA 2VWJA 3PW5A 3LAKA 4KO0A 3RBEA 4M3XA 2F8TA 3S3OA 1A5XA 2Q0ZX 1YVUA 2AGOA 2XC9A 9ICJA 5CB1A 1ZQRA 5JS1A 2C22A 5DG7A 1VK0A 4CJPA 2RN2A 3WNEA 3M9OB 3OS0A 1WCLA 4O9MA 1NJYA 3AA4A 1QSSA 3QEBZ 4JK1A 1SL0A 8ICFA 3MXJA 4KHUA 4Z4FA 4QWEA 1DOQA 4MEYA 4IR9A 4YN4A 3ISNC 1VSHA 1BQNA 4F2SA 4KITB 2PXIA 4QW8A 3HYFA 4CHYA 2IAJA 3NBPA 3P1GA 4CJSA 2O4GA 3O3GA 1BPYA 4QW9A 1S1UA 3C6UA 4DFMA 1RTIA 3DLGA 4QZ9A 4H8KA 3MR6A 3K57A 2DFHA 1I39A 7ICGA 4LY7A 4LD0A 4TQSA 3THVA 1J53A 1ZJNA 3V9WA 4F3TA 2AGQA 1N56A 4CE9A 3QERA 1ZQPA 5HHIA 2W9AA 3Q8RB 4ZTJA 5DGBA 3HWTA 5D4BA 5EU7A 1D8YA 1AROP 7ICJA 3UPQA 2BR0A 4DLGA 4FJJA 3EZ5A 1TV9A 3CM6A 1S0NA 1ZQWA 5J2IA 4DL3A 4N47A 3AVAA 1S5JA 3WNFA 3KK3A 5KFYA 4BE2A 4N41A 3QEAZ 1VRTA 1HYSA 4DTUA 4UBCA 4DTNA 3JPTA 9ICMA 5KRSA 1JXLA 4QWAA 1C1AA 1HYVA 4DTOA 4Z4EA 4DQRA 4KN7A 1MSWD 4RQ5A 3JPPA 1CZ9A 2VANA 1UA1A 2YHBA 5J2FA 1NJXA 1WSFA 4Q45A 4KAZA 2P1JA 1S77D 2BANA 4LZDA 5DQIA 3DLBA 4CF9A 1D9DA 2KFZA 4XQ8A 2GV9A 4FZXC 1WAJA 3PW7A 4YXMA 4JS4A 4FJ9A 1RBRA 4RPZA 3VQ4A 5FROA 1J54A 3VQ7A 4DSLA 4KLIA 5KRTA 2BCRA 3CFPA 2ZD1A 5KT4A 5DBBA 1RDBA 9ICPA 5KFAA 4I2EA 3QETA 2B6AA 4G1QA 1K6YA 4ECQA 5J0OA 4NCGA 3TAFA 3PX4A 4I2JA 1DTQA 3WNHA 3H8JA 3OYJA 1CXQA 7ICNA 3TR8A 4CFBA 1NK6A 4F91B 3ZSZA 5J0QA 4CF8A 4KB0A 4DLEA 5KFHA 5HMMA 3ZT1A 1BPXA 4K8XA 4K4GA 5DDMA 1XI1A 1JXBA 5J29A 4LSNA 5IIKA 4YXJA 3HVTA 4FW1A 2Z1IA 4FLYA 4KLJA 4O5BA 5KGXA 3O4QA 3HVRA 4O3OA 4MFCA 1A5WA 1FKOA 2YV0X 2W9CA 1JLCA 3K5OA 3N97B 2ETJA 3S3NA 2XY6A 3BQ2A 2JZBB 3AVIA 4RUCA 3VN5A 5KFNA 1GOBA 4KPYA 2FPMA 3FFIA 3QEWA 5L9XA 3RTVA 3L2WA 3GV7B 1S1WA 4DWIA 3GIIA 3SI6A 1RYRA 4FK0A 1UAXA 2JEFA 4B08A 4FLVA 4I2GA 1SL2A 1KFTA 4FLZA 4QZIA 1W9HA 4CIEA 2HVIA 4BWJA 3AVNA 1KVBA 3OJSA 3Q8KA 4J9RA 5DK5A 2FBYA 2O4IA 4NCAA 3AO2A 2UVRA 3VQEA 3GILA 3PO4A 4M3RA 3N4MB 3KLGA 3RRGA 4RQ1A 4BDYA 3ZT3A 8ICOA 1ZQCA 1HUZA 1BI4B 4F5OA 2ASDA 4TSXA 4QCLA 3QESA 1FKPA 4RQ4A 4F8RA 3T5JA 2XY7A 1S0VA 4AILC 8ICPA 1Z26A 4J2AA 1MC8A 2KZ3A 4CEEA 3OGUA 1ZQNA 2W8KA 4UBBA 3TANA 3M9MB 3UIQA 2IS3A 4FLUA 2FLNA 1SUQA 2OA8A 3OYIA 1S1TA 1N48A 1XWLA 2G8FA 3O3FA 1DGSA 4ED3A 4RPXA 1U47A 1KTQA 4LH4A 1CXUA 3B6PA 7ICLA 4CIFA 2OPQA 3RB0A 3DOKA 4DTSA 3HX0A 4DF8A 4K4HA 1KEJA 4KLUA 3ISBA 4I2HA 1S76D 3IM1A 3M9NB 5IILA 1I3AA 3M8SA 3H7IA 4NY8A 4E7HA 1QLNA 1ITGA 3NF6A 1ZQVA 1BIUA 4BXOA 3SUNA 3MEDA 5KFCA 1XSLA 1LB2B 1C0UA 4M42A 3V72A 5KFSA 8ICGA 3HO1A 5TZVA 4YMMA 4FM1A 4PY5A 4EEYA 4NLKA 3MBYA 4ECRA 2NRVA 5DG9A 2PFNA 2HNZA 1RXWA 4ED8A 3E2EA 4CJTA 4F93B 3NTUA 4MFFA 1Z3EB 4AH9A 1TGOA 3RJJA 2PY5A 4NLGA 5I42A 4CGJA 2VG5A 4E7IA 3AA3A 4Q44A 4NM2A 3K59A 1LW2A 4OPKA 3S9HA 3RB6A 1D8LA 3RAXA 5DB6A 4O5CA 4X5VA 1NK8A 8ICTA 1Q8IA 2HB5A 5CP2A 3AVKA 1EP4A 3LP2A 4FK2A 1NOYA 3V4IA 3K2PA 5FRMA 4FJMA 4K8ZA 2ZUCA 3L2VA 1TVAA 4E7LA 4MQ3A 4C8OA 5J2GA 4M6WA 3AVFA 4QWDA 3V6KA 4J2DA 5DB9A 2FPLA 5HLFA 4O3SA 2D0AA 3NH0A 2HHWA 3U3YA 3SPZA 2FMQA 2BDPA 4FZYA 3QIOA 3AVLA 3DLHA 4IQWA 3QIPA 1ZQMA 8ICNA 2FBXA 3HP6A 4RT3A 1VSIA 3JPNA 3JPOA 3KLEA 4O5KA 4FJIA 3OHBA 1EX4A 1SL1A 4IRDA 3SV3A 3VQ9A 2D0CA 3C95A 4RW9A 5KFPA 1KLNA 3NH2A 2MUTA 2PYLA 1EXQA 8ICQA 1S10A 4I9LA 4E89A 2UVWA 2YKNA 2VA3A 4MEXA 3C23A 1S1XA 5HRNA 3UXOA 1NK9A 1BPBA 3ZT0A 2DPJA 1SKRA 1RT1A 1RDAA 4F5PA 5CA7A 3L2UA 1HNVA 1BHLA 4N5SA 5CR0A 4DOAA 1TAUA 2X78A 4FLXA 3FDSA 4J9MA 3VA0A 4O0IA 2ZTCA 4YR2A 2IDOA 3DRPA 1EETA 1KDHA 7ICMA 4FJ5A 3OYGA 4ED6A 3D45A 4KLQA 9ICFA 1C1BA 1C1CA 2EHGA 4GXIA 2BQRA 4ECYA 4CJLA 2VA8A 3V6HA 1ZQQA 1O1WA 4QWBA 1WNSA 2BCSA 3GV8B 4W5RA 4C8LA 1XS9D 2P66A 5DLGA 9ICAA 5SZTA 5KG7A 3NFAA 1LW0A 3QEPA 4QZEA 3ZSYA 1JLGA 5K14A 3V6JA 1ASWA 1XHXA 3F9KA 2OYQA 7ICKA 5J1EA 3H8WA 3K58A 2W8LA 5D3GA 1ZQAA 3AU2A 3ULDA 2Y1JA 3TFRA 4MFAA 3T3FA 2BGGA 4AHRA 1N6QA 1RILA 3SUQA 1QHTA 3UXNA 3ZDAA 3H40A 1HNIA 1KFSA 5KFLA 4XUSA 1HUOA 1ZYQA 1S9GA 4KV8A 4JWNA 1ZBHA 2ATQA 3AO5A 1NKEA 3DLEA 2ZUDA 1RPLA 3MABA 4DQPA 4DU1A 2F96A 3EWAA 5J2HA 2NRZA 5C5JA 1D5AA 4BGDA 4ID1A 5HROA 4B9LA 3BGRA 4F50A 1C0MA 4CHOA 3PR4A 5HNKA 4DSJA 3PUFA 4DL5A 9ICTA 2PI4A 9ICOA 4W5OA 3CQ8A 4ZTFA 3RR8A 2W9MA 1JLFA 4Q0BA 3RBDA 5J2PA 1BIZA 2ASLA 2IHMA 3QE9Y 3QEXA 2B21A 4FLWA 4FVMA 3ZDCA 1JKHA 1LWCA 3OYMA 4CFDA 3Q8MA 3V1RA 4FJKA 5IIIA 2BPGA 4FJ7A 3EPIA 1JIHA 4DSKA 5CWRA 1HQUA 3V1OA 4Z6CA 3P5JA 3BQ1A 5EWFA 2RF2A 3TAQA 4KLEA 5DG8A 5DKWA 4E0DA 3SZ2A 1IM4A 4CFAA 4KRFA 1U45A 2OPRA 1C0TA 4JS5A 1ZQOA 1Y88A 4CFCA 3O4NA 4I7FA 3KD1E 1LWEA 3MECA 4M3WA 4B9UA 5KGWA 2BQUA 4UQGA 4O3NA 3GV5B 1Q9YA 4NCBA 4DFPA 3RJIA 5FRNA 2ZJ8A 1B9FA 2FMSA 2D5RA 4IKFA 3DM2A 3C6TA 4TURA 1BI4A 4Z6EA 3QNNA 2R8GA 4R65A 3LZIA 1S0OA 3DRRA 4CEOA 4B9SA 4GW6A 5J2JA 4GXJA 3PVXA 1SZPA 4IRCA 3LP0A 2XGPA 4QWCA 2BQ3A 3C2MA 1D9FA 1G15A 4PQUA 4ELVA 2V4QA 1ZQKA 1IO2A 1X9MA 3OYNA 2HMIA 3E01A 4XIUA 4J9NA 2P5OA 4IQTA 3GIJA 4ZHRA 1XU4A 4E3SA 2HHVA 4M9LA 1VRUA 1XSNA 1U48A 4IG3A 2ITGA 4B3OA 5KG6A 1ZQZA 5KG1A 4HCBA 3NGZA 4HYKA 1ZQSA 4P4OA 4BDPA 3HPHA 3ZDDA 2KTQA 1S6PA 1CEZA 2WONA 4PHDA 4EZ9A 4CEAA 4J9SA 3RJKA 1TFRA 5DDYA 4RNOA 4R5PA 7ICQA 4HCCA 5KI6A 4E1MA 4M3ZA 5IIJA 2VG7A 1MQ2A 4YD2A 4RZRA 5KT3A 1BQMA 4CJWA 4F4KA 4FJLA 2LSNA 5J0UA 2NRXA 4UB4A 1JLEA 3IG1A 2UVVA 1NKBA 4RQ7A 4Z4CA 4CCHA 4DOCA 4FW2A 4O0JA 3TAPA 4FS2A 3Q8SB 3JPSA 3G0ZA 4CGGA 1K1QA 5KFKA 1EXNA 8ICYA 3OSPA 4QZFA 2NRWA 4PHAA 4P4MA 3TABA 3C1ZA 3OHAA 3ZSWA 3ZSXA 3ALYA 4YMOA 4AHTA 2RDIA 9ICIA 1CZBA 4LH5A 4HHTA 1BL3A 3V81A 2R8KA 4BACA 4J9LA 1UT5A 8ICAA 2A1JA 4C8MA 4Y1CA 2NUBA 3T1AA 3V7JA 4DTPA 3PW4A 3ZT4A 1V9PA 1KLMA 4NLZA 3IAYA 1X9WA 1QSYA 2C2EA 1NK4A 9ICSA 3MFIA 2E6MA 2YHAA 4OGCA 3PX0A 3DLKA 3VQQA 4CK3A 4DQSA 3SQ0A 1MU2A 1VSLA 1XHZA 4RUAA 3B0YA 2DTUA 4ID5A 4H4OA 1L3TA 3UQ2A 3OYCA 3RMDA 3SCXA 3V9UA 1WN7A 4YP3A 3H4BA 3ORYA 5KFTA 2HHUA 3QO9A 3OYHA 4Q8FA 2JGUA 8ICZA 3RH6A 4BE1A 3K5MA 4M3YA 5KFXA 2FC0A 3VQCA 4QZCA 3SQ4A 3HM9A 5JS2A 4CJKA 2W9BA 3SYZA 2ZTDA 3HP9A 5KT2A 5J0YA 5J0TA 4EP5A 4LVSA 1X1PA 4IG0A 1TK8A 3TFSA 3MGIA 4F4WA 3MEGA 3L2RA 9ICKA 2I1QA 1DTTA 4M9GA 4FJNA 4M0AA 4M04A 3T19A 4XRHA 2IA6A 4UB5A 4I2FA 2VA2A 4R64A 4RQ0A 3LK9A 3RH4A 4OJRA 1ASVA 1T05A 5CYQA 2JEIA 3VA3A 3D0PA 1UA0A 4NXZA 5KG4A 1EKEA 4ICLA 5F9NA 3M8RA 2JEJA 3C1YA 4M3UA 4CJQA 5BOMA 3L2QA 4KN4A 4CESA 3UXPA 1COOA 3TI0A 1CLQA 5DMRA 1HYZA 5EWEA 4KLTA 3DMJA 3ZD8A 4FCYA 3CG7A 3HT3A 3U3GA 4CGIA 1ZBUA 4W5NA 3M8QA 1RT3A 3K5LA 2A1JB 7ICOA 1RBVA 3TAGA 5KG2A 4ED2A 1TVRA 4Z4GA 4KLDA 2HHXA 5KFMA 1W0HA 3MDAA 1ZQYA 2G8VA 2IGIA 4W5TA 1YT3A 3OYAA 8ICCA 1J9AA 3MFHA 3HL8A 5KT5A 4WE1A 1ZBLA 4DU3A 4TQRA 1ASUA 4TUSA 4RU9A 4E7JA 1SKWA 1T8EA 1ZQUA 4DMNA 2WTFA 2MUTB 4DSIA 1S6QA 4KLHA 2XY8A 4DL7A 4DQIA 2UVUA 2GWSA 3AV9A 4I2PA 4L8RB 2P51A 1QE1A 2VG6A 1BVSA 5DLFA 4YVZA 4CEFA 3IHQB 4UAYA 4BE0A 2FLPA 1HRHA 3JSMA 5HP1A 9ICHA 5D49A 3AA2A 2HVHA 4AHSA 1A5VA 1HQEA 1XO1A 4DFKA 3OYEA 4BXOB 1KVAA 4KHSA 3ZT2A 1WAFA 1Q9XA 3OJUA 1T03A 1TK0A 2BCUA 5J0RA 4GC7A 2KN7A 2HHQA 1HJPA 3ZDEA 4Q8EA 5J2KA 7ICFA 4RQ3A 2OWOA 4FLTA 4O4GA 2F1JA 4RG8A 1WSJA 2BHNA 3AO1A 4DTJA 1IKXA 1U4BA 4KLGA 4Q5VA 5T7BA 3H4DA 3CYMA 1NJZA 5E41A 8ICKA 1LAVA 1UT8A 4GMJB 9ICCA 2WOMA 2G8WA 1H38A 1ZETA 3PNCA 3SJJA 1S1VA 3L8BA 5J0XA 4I2CA 4KMUA 4CECA 3DI6A 1ZQXA 2LYHA 4J9OA 1JL1A 4DTMA 2YNHA 4I28A 2IMWP 4FM0A 3VQ5A 3KK1A 4QZDA 3LDAA 4FBTA 3PW0A 4JRQA 3JPQA 5KFUA 8ICJA 5J2CA 4M9NA 3RB4A 4CF2A 3V9XA 4FXDA 3G10A 3KK2A 5CY4A 2BCQA 3NGYA 5KFDA 5HBMA 5L1LA 3PMNA 9ICWA 1XC9A 3QZ7A 3SPYA 5KG0A 2ALZA 3VQ6A 4CEBA 4KLFA 2DFEA 4CJ5A 1Z00A 4F5QA 1Z00B 3T5KA 1LAWA 9ICEA 5KFWA 9ICNA 4GLXA 4B8CA 4CERA 1BPDA 5EWGA 3KTQA 3U6FA 2QKBA 1T3NA 3KHLA 4ZH4A 1DLOA 3DYAA 3NDKA 3EW9A 3Q8LA 2ISPA 2C28A 4MFBA 5J0WA 4CJFA 4E1NA 1RYSA 3AVHA 5J2AA 4GVMA 2JZBA 5DB8A 4JV0A 4I2BA 4OKJA 4PGYA 3MDCA 3ZD9A 4H4MA 3MR5A 2XRIA 4FK4A 5BOLA 4RW4A 4PUOA 1L3SA 3ZSOA 2Y1IA 4BWMA 4FYDA 1MQ3A 4F2RA 2ISOA 1XSPA 2RDJA 4KREA 2W42A 4MF2A 1RNHA 3I0SA 3TARA 2YKMA 2G8IA 2RPIA 4JRPA 2KZZA 2KW4A 2R8IA 3L3UA 7ICUA 3B0XA 2AQ4A 5JUMA 4GC6A 4OKEA 4E7KA 3QNOA 2F1IA 5KFRA 3PW2A 1HMVA 3ZSQA 3PMLA 1NK0A 4CGFA 4EYHB 3NH1A 2XY5A 1ZJMA 4KB1A 3K4GA 5KFGA 2F1HA 3GQCA 4K4IA 3GIKA 3OSNA 4DOBA 4YFKA 1HJRA 2JLEA 3I0RA 5IINA 2EX3A 4JLHA 2PI5A 3NF7A 4DTRA 1YTUA 4J9QA 1KSPA 4M45A 4RT2A 2A1SA 2JEGA 2KQ2A 1T4GA 4ECXA 4F4ZA 3PX6A 2Q3SA 3KHGA 1RDCA 2AJQA 4QAGA 3JPRA 3BDPA 3OVNA 7ICEA 1WSEA 4FJ8A 4YMNA 1GOAA 1A76A 4Z4HA 4GXKA 3VQ8A 4CEQA 4CHNA 1TKXA 1VSFA 5KG3A 3SUOA 4HUGA 3MAQA 2FBTA 2XO7A 2KZMA 3CM5A 2A1RA 2PFPA 3ETLA 9ICUA 3C2LA 5KFOA 1L3VA 4UB2A 3KKRA 2G8HA 2BPFA 1JLAA 4CEZA 2Z1JA 4CJEA 4FJHA 4UB1A 1C7YA 1NKCA 2BPCA 3HJFA 3NF9A 2P6RA 1ZQGA 1RCHA 3MXIA 8ICIA 5L1IA 1IXRA 3RR7A 3M8PA 4IFYA 5HP4A 4KLSA 1CUKA 2ZE2A 5L1KA 1IG9A 3LP3A 3G6XA 5CZ2A 4FZZA 4KI4A 4KKOA 4EYIB 4NYFA 3V9SA 5KT6A 2ZUBA 4QZGA 5F9LA 1U49A 4UB3A 1RTDA 1QQCA 3RMAA 5SWMA 1B22A 5KFEA 4DU4A 1Y97A 2H5XA 3BQ0A 1L5UA 4HUFA 4ED0A 3C5GA 3GDXA 3V7KA 2PFQA 4HVJA 4FJGA 4IFVA 3ZSVA 1TAQA 1ZQEA 3HW8A 4EP4A 4DS5A 4EBEA 2XCPA 2PZSA 2ZJAA 3AU6A 2G8KA 1RT5A 2V9WA 4CHQA 4DL4A 1JL2A 1J5OA 4RNMA 4ECZA 3VQAA 4FS1A 3LWMA 3NCIA 1LV5A 5KFQA 2BCVA 4HTUA 3KKSA 3G6YA 2R7YA 4DL6A 1L3UA 3LZJA 3KHHA 3RJGA 1HPZA 1PZNA 4CK1A 3LDSA 2Z1HA 2B5JA 3CFOA 4CJ3A 4I2QA 3BJYA 4LSLA 2X6NA 4RNNA 4KI6A 4DG1A 2QKKA 1NK5A 4YNQA 2QXFA 2YNGA 2X6SA 1TK5A 3H08A 1KCFA 4O3RA 3GIMA 3RWUA 3ISDA 3V9ZA 4E19A 4IQUA 4I2AA 3QEVA 1LWFA 4B9TA 4B9MA 3ITHA 4ECTA 4LZGA 1T7PA 2OPPA 2FMPA 4Z6FA 7ICSA 4DFJA 5KG5A 1RDDA 2Z1GA 2OPSA 3ASMA 2XGQA 4YG2A 1ZQIA 5HRRA 4B9NA 4YR3A 1TKZA 3SV4A 4ELTA 3MGHA 3KIOA 2R8HA 3AVBA 4OPJA 5L1JA 4BDZA 3T5LA 1ZBFA 4CJUA 4KTZA 8ICUA 3RH5A 2ATLA 8ICEA 1TV6A 9ICRA 1VSDA 1WSGA 5J2NA 4G3IA 4DSEA 3G6VA 1FXXA 4PPXA 2B4JA 4W5QA 4ECWA 4CF1A 5J2DA 3KHRA 4F5RA 3NE6A 1ZQFA 3KLHA 1JXEA 4YFUA 4OKKA 2XCAA 2OZSA 3LAMA 1TL3A 4N76A 4CJRA 4F5NA 4TUQA 2ZQBA 4FBUA 4CIGA 1KFDA 4PA1A 1QS4A 1NOZA 4CJVA 4Z6DA 1ZQJA 3B6OA 2RKIA 3PO5A 4CK2A 5KFFA 2BE2A 4NM1A 3K75D 4CGDA 1Z25A 2YNFA 2DFLA 4TUPA 4QOZB 4KHNA 4PHPA 1SV5A 8ICSA 1NJWA 3KLFA 4NYNA 1BPEA 5EOZA 3OYDA 1ZQDA 2FBVA 1NOMA 3VQDA 5KTQA 3TAEA 7ICVA 3AVMA 7ICTA 2I9GA 1R0AA 2ZTEA 4JV1A 1ZQHA 3OS1A 4DL2A 4P4PA 3LPUA 8ICXA 3IS9A 3LWLA 1C6VA 1S0MA 2DPIA 2GBZA 5CYMA 1B9DA 2M9NA 4KLMA 2AQ0A 3OYKA 1JX4A 2KFNA 2W9BB 3HSTB 1JLBA 8ICRA 2IHNA 4PGQA 2R8JA 3ZSRA 1WCNA 3RJEA 1RT7A 1QTMA 3QINA 4EZ6A 3NF8A 1IKYA 3AVJA 3HK2A 4I9QA 4JUZA 4QZAA 4KHQA 4FJXA 4Z4IA 1RT4A 5DB7A 1BCOA 5DBAA 3VQBA 5KFIA 3HPGA 3V1QA 1S9EA 4KLLA 5CHGA 4UAZA 9ICBA
chains in the Genus database with same CATH superfamily
1X9JA 4M5LA 2K3IA 4R66A 3R2DJ 1TKTA 2YWFA 2Q1LA 4MKYA 3R3LA 5AQHA 3H8SA 2G08A 4B3MF 1YVFA 1X4FA 2GGPA 9ICVA 3P4IA 2P9PA 3BKFA 3C21A 2X51A 4IR1A 2V94A 3A2FA 3LPTA 1VQ5N 3MR3A 5AXKA 1BGXT 3OYFA 3FZKA 3TU5A 3LPYA 2IM1A 1U04A 3BF3A 4K4SA 4Y34A 2WONB 2XMTA 3A4TA 1KVCA 1S9FA 3BZKA 1C0GA 3MEEA 3OPKA 3TACB 3BBCA 3MXMA 2XHBA 4AL6A 2JRSA 3M30A 4P9SA 1F9HA 4O44A 2ZIWA 1WF0A 2LLZA 1SKSA 2K8BB 4CBUA 5IIOA 4CF0A 3Q23A 3TJ9A 1UVIA 7ICIA 4ZVGA 2HVDA 4YD1A 2V34A 2W9CB 1BHNA 2V8GA 5HRPA 4CNZA 3RJFA 4OHYA 2OFHX 4LQ3A 1R8CA 2F8SA 1U1QA 3ZTPA 2HBJA 1GX5A 5AQZA 4I68A 4YY3K 5KFVA 4OVLA 2IM0A 1T3QA 3TWHA 2V8VA 4M9HA 1JLEB 1TP7A 3P38A 1RXVA 2HNYA 1EAYC 1TKDA 3NGIA 3AGRA 3CCJS 1WACA 2Y8WA 4AHVA 1ZQTA 2P6TA 3ZZYA 1JCGA 2XEXA 3GFYA 2VC1A 4NCGB 4I29A 1CG2A 1JNRB 3TUJC 4B1WB 2QLBB 2MMYA 4QIWD 4P2HA 4JP8A 2ROGA 2ZM6J 2XI9A 1X2IA 1TL1A 3LANA 4MO5A 1WSHA 3SBGA 1ZPVA 5F0UA 2L41A 2VYPA 5ALFA 4F4YA 1YJUA 4MDAA 2B43A 4QS7A 4PAAA 1LK7A 2DHGA 2D3ZA 2DKZA 4FZNA 3AA5X 4RW7A 4ZCKA 4O3PA 1M5SA 2IC3A 2QLFB 4NXNJ 3EICA 1AB8A 3MMJA 4DQQA 4X62J 2B8PA 2FY1A 3KUHA 4FZMA 5HMLA 4C4TA 2D0OA 4RQ2A 4QZHA 4RQ6A 2AYBA 4CE6A 1YTAA 2QK9A 5L8RC 8ICWA 5BR8K 4JK7A 3BQTA 1ZQBA 1U1MA 4CLTA 3ISCA 4MF8A 4C8KA 5KFBA 1GMUA 4JKBA 2CUYA 3WHIA 3HT0A 3G82B 4M2YA 2C2KB 4KFBA 3CIMA 4B3TK 3D4JA 1FCAA 1R3NA 1XMQF 3QFUA 2GVZB 4AHCA 1E4FT 4IOCL 3JYTA 2GJIA 2PFUA 4YR0A 1PYTA 4GKKJ 3OR2A 2AXTU 1T9XA 1K0TA 4X65K 2B7BB 1WG1A 4JV2A 2E6LA 3CJSA 3DXBA 2N3LA 1T9TA 3UR0A 3EPGA 4GV9A 7ICHA 1N5YA 3UKUA 3K5PA 4KO0B 3UD5A 1U8WA 2YWEA 4H4KA 3AO4A 1UWBA 2W03A 5DGAA 1K1SA 3WC0A 3VZHA 4N56A 4CO5A 3MAHA 2XZDB 1KC8T 4O3QA 4B1VA 4EGLA 4OJPA 3W3SA 4PH5A 4J2BA 3POTB 3RRHA 4K4UA 3DU6A 4OHZA 2P9SB 2MEWA 3RAQA 2KNJA 2YH0A 4H0VB 1EQMA 2FE9A 4J9PA 3I0RB 1ZD5A 1TZ0A 1NZBA 5ADXH 3KFUF 4I6WA 4DKWA 2HRYA 1VSEA 3VVUA 2CQ3A 2J9DA 4DV5K 1CSJA 3O3HA 1F21A 4CZGA 1D4XA 3P5BP 3DRSA 4OGEA 1PK3A 1QQ6A 1MN8A 3C8YA 2UU9J 1VSJA 3LDNA 3MDQA 1RB0A 5C25A 4KTWA 5EE0A 3KHYA 3MMAB 3FMWA 3FQKA 3U1LA 4JI0J 3H8YA 1HHSA 5IIMA 8ICVA 1X60A 4Y65A 1B92A 4A8OA 2EW9A 1YZ6A 5J0SA 1W7WA 4Y1DA 3Q7BA 2AGPA 3RJHA 4DO9A 1AW0A 2B7CB 3DXKA 1RZTA 4J2EA 1CULA 2E7WA 1Y5LB 4FKXA 2HI0A 3VEWA 2G5IB 2J6SA 2FYXA 2GO9A 2VWJA 1RDFA 1VK3A 4IWVA 4DV3K 5KPZA 2Q0ZX 4NL5A 4Q7AA 2AGOA 2EG1A 5HLFB 4I6YA 1RAJA 2MQ8A 3QU9A 4U8VA 2RN2A 4LVNP 3HFVA 1KONA 2E1CA 4KX3A 1T95A 4I56A 1WCLA 4KBIA 2O6KA 2W6KA 5ALHA 3K1ZA 4YUDA 1CS4A 1RBAA 2A3JA 3VC8A 2LA4A 2EFVA 2UUBJ 3QAUA 1DOQA 1FDAA 3T1HF 4MEYA 4NLCA 1WWUA 1BQNA 1W97L 2PXIA 2YKMB 1VQLS 4CLZA 1FVSA 3CCUS 4CHYA 3BEGB 3P1GA 5E0OA 4AF1A 4NV0A 4DR1J 1RTIA 2QZ8A 5AI6A 2XS7A 3HFKA 2DFHA 1J5EJ 2AEMA 1Z19A 4HHJA 3ILOA 1KQGB 5AI5A 1NH8A 4LY7A 4LD0A 3RYLA 4LFAF 1LWEB 4C11B 3T1YK 2ZH1A 4F3TA 2OSRA 4CE9A 1S72N 2V2QA 3QERA 3O5BA 2W9AA 3GYXB 1T6CA 3WQUA 3Q8RB 4ZTJA 3AMZA 5DGBA 1SC3B 4DU7A 5ALWA 4F3QA 2DD8S 5AKIA 1RISA 1WOOA 2BEFA 5D4LA 1AROP 2MYFA 3ET6A 5JVGL 1SV5B 1Y0HA 7ICJA 3E1YA 2B6GA 2XM3A 2YKQA 2BR0A 1IV0A 1HX1A 2LBOA 2BOPA 3CM6A 1DRZA 3BB5A 4LRDA 4DL3A 4ZPBA 1RT1B 3SIPB 2Z2YB 3AVAA 1S5JA 4WCEL 1ZZNA 3H90A 3KK3A 4N41A 4BE2A 2LYAA 3D2SA 1YITN 4TYBA 5J1NA 4B6JA 5FPDA 3JPTA 3CB4A 2VC0A 5KRSA 2RHFA 1JXLA 1H98A 2A10A 1C1AA 4CD3A 2R7SA 5KPTA 4B3MK 1BE4A 3AAQA 5HJXA 2W4CA 3ENHA 3THYB 4Z4EA 4KN7A 3CJ4A 4OZ5A 3AQEA 1CZ9A 1UA1A 1NJXA 2CPEA 4Y2MA 1WSFA 3GWCA 2UXCF 4KAZA 4WXOA 2DBYA 2B51A 2BANA 4LZDA 4AP9A 4CF9A 5IQQA 3OL6A 3R9KA 4XQ8A 4NYPA 3IGVA 3EVWA 1REVB 4QU6A 2GV9A 1RHMB 4CF5A 3PW7A 4YXMA 4QNLA 1RBRA 4FF4A 2BCRA 2ZD1A 4CZCA 3LYSA 1YJWS 4DV4K 3ZEUB 3E58A 3OYJA 3CCES 3QMQA 3I55S 3MEKA 1M5OC 4U95A 4F91B 3CMQA 3QGHA 5J0QA 1ZOTA 3Q8YA 3OTOF 4OI3A 2RS8A 2D41A 3MPYA 1RJJA 1CVJA 1Y9OA 1XI1A 4IEIA 2QN6B 2ZF5O 4LSNA 4FW1A 4UB8U 1EZZB 1PBAA 4FLYA 4O5BA 1Y7PA 2XSFA 2Z2LA 3A5LC 4MFCA 2NLWA 2YV0X 5J2MB 2HEKA 3GOIA 2JRZA 2KMDA 2XY6A 3VETA 2K7KA 3BQ2A 2JZBB 4URSA 3AVIA 3E3XA 3VN5A 4KPYA 1UVMA 3MD3A 4RW7B 4C8YA 3LM9A 4J8FA 3O6QA 2FPMA 2AIRB 1MWQA 4YOTA 2ZFHA 1S1WA 1M1KT 2DNQA 3GIIA 3MC1A 1RYRA 4ZPWR 4X4SA 4M7YA 2FVQA 4I2GA 1EHWA 5E7OB 5EVZA 2VWBA 1YITS 1W9HA 2HVIA 4BWJA 2AF6A 4NLDA 1XNQF 5DK5A 2O4IA 2EH9A 2UVRA 2D9PA 5B5EU 2HHPA 4YS2A 1T9VA 2NO5A 1RTDB 1CJUA 2FJBB 3GP9A 3MWPA 8ICOA 4DR4F 1ZQCA 2CXYA 3QESA 3W8PA 1H2VZ 1RAAB 3WC2A 1J97A 1KP6A 2DJWA 3EKSA 2XY7A 2LEAA 4AILC 8ICPA 2Y0SF 1VQ8N 2KZ3A 3R6LB 4DV2F 2E2NA 3I8BA 2HBLA 1ZD3A 3M9MB 4NASA 4WIIA 3CCMN 4K5SA 4NYOA 3O3FA 4ED3A 2HS4A 3B6PA 1S1WB 3HSGA 3CO9A 2C3PA 4F9OA 3RB0A 4DF8A 4K4HA 1Z1ZA 4IG3B 1VQMS 5KL8B 1MN9A 1I3AA 2IM2A 3H7IA 1RYUA 3TZXA 1XNQJ 4QYRA 2OD4A 3KJNB 1YRTA 2KI2A 4B3TF 3R3TA 1GTEA 1FXDA 2P9UB 3V72A 4DV6F 3IC1A 5LOQA 2VZ9A 2A40A 5ETLA 5ETVA 2FVCA 3CF5Q 2MKCA 2AWZA 4ED8A 4OYBA 5BR9A 1XNQK 4A5BA 5C42B 5AI8A 3EGWB 3KBBA 3NTUA 3RJJA 4NLGA 1SV4A 3GG1A 1Z05A 1HI1A 3UCUP 4JI6J 3C6HA 5B8HA 4JI8F 4K5RA 3I5AA 5AQYA 1EWQA 2BM0A 3RAXA 5J2QB 4O5CA 3R7SB 1N5XA 2HB5A 2V2KA 4M5MA 3MPWA 4G1QB 3OUYA 1WWVA 4NOHA 2C2MB 2FB0A 5DM6Q 2YY6A 2ZUCA 4IKAA 3L2VA 2UUCK 3Q2SC 3ZC4A 1PIEA 2WSCC 5HR7A 3AVFA 3V6KA 3M2VB 5AM4A 5HLFA 3NRZA 2XWXA 2HHWA 2BDPA 4FZYA 1HBUB 3M1FA 4IQWA 3DU5A 2M9KA 2RD5C 1ZQMA 1F6TA 2CQ1A 2FBXA 4U67Q 4PXBA 4RT3A 1KHWA 3THXB 2CPJA 4O5KA 2QIFA 3KLEA 2ROEA 1S59A 4CLYA 2W1BA 1NSPA 1SQGA 4BRAA 4BRNA 2YJEA 2D4WA 3MPUB 3N5BA 3KK1B 3F0NA 4ZJQA 2EC2A 2P9IB 3C23A 1S1XA 2U1AA 1H6KX 3ZT0A 3OPXA 1RDAA 1WC6A 5CA7A 2P6SA 2KVSA 1HNVA 2WAQC 4ILJA 4P0PA 3ELHA 4JB3A 3J7AP 3N79A 1YJ7A 4DV3F 5GAGI 4J9MA 4CLFA 1KOHA 4WYLA 2CQHA 2G0CA 1F3VA 2DNPA 1EETA 2Y9TA 3QU5A 5C10A 1FRMA 4LFCJ 4JKDA 4CLKA 1C1CA 2BQRA 2VA8A 3V6HA 4W98A 3GU3A 3LO3A 2BCSA 1RQLA 4G9BA 3EXYA 2MKKA 5LXYA 4WFBL 4YHHF 2NLXA 9ICAA 3NFAA 3OV7A 4JI4F 3MUVP 2ZBRA 5K14B 2XMJA 1ASWA 1RAGB 3JXUA 5AQOA 5THWA 2OYQA 3IKMA 2Z2ZA 1Q4RA 3GJSB 1TAMA 3CMAS 1NDPA 5TISU 1APSA 2NYVA 3N4WA 3T3FA 4EX6A 1HNWJ 3AOBA 3LOUA 3NEKA 2P9PB 1N6QA 2EANA 1QHTA 2WBNA 1JROA 3HJVA 1U0SA 3ZDAA 1GLAG 4ACOA 1EARA 1RHUB 1URRA 3C66A 3WKDA 1S9GA 4DUYJ 1X0FA 5ALUA 3J81O 1T03B 4DU1A 3KK2B 2F96A 5HROA 1Z2LA 3EDRB 3OTEA 4M95A 2VFRA 4H4KC 5B66U 1VAZA 3PR4A 4PCQA 5HNKA 4DSJA 4B3SK 3FGVA 5AQRA 1YG0A 2HVEA 3FBEA 3TTFA 2W9MA 4C0ZA 4NA2A 2E8MA 5J2PA 1UPPA 3MWBA 2H3EB 3ZDCA 1WKLA 1N4LA 5DJBA 3JAMO 2MZQA 2LQ8A 4DR3J 4CFDA 2A3VA 5ALEA 4IYQA 3DLEB 2DISA 1NSAA 4FFDA 3F2DA 2BPGA 3P96A 4FJ7A 5DO2A 4TVAB 1JIHA 3BBBA 3ULHA 1C20A 1B99A 3HHDA 5HL7Q 2F8LA 4AD6A 4DCCA 4Y2SA 5EWFA 2BXJA 4GKJK 3FBFA 5AM2A 2DVIA 3K7RA 2LMIA 2H5EA 2P9IA 2ZJPL 2XS2A 2GMJA 1IM4A 4CFAA 3HKZF 2KKPA 2DNKA 1KNZA 2DUYA 5E79U 1E6VB 1Y88A 4I7FA 1GMWA 5ALOA 4RBUA 4JYAF 1ZS6A 1OW5A 2MDAA 5DM7L 2YNFB 2KJ9A 4B9UA 4O3NA 2R7UA 3AQOA 3S8SA 4LF2A 2A6AA 3RJIA 5FRNA 1SQKA 2D5RA 3ZO7A 4WU2A 4R65A 1SH2A 2CAJA 4GW6A 4UF4A 5J2JA 5BPMA 1QTNB 3LP0B 1HWJA 2RSQA 1QVGR 4CDGA 5ITHA 1F5CA 3KJFB 1PGZA 3M8ZA 3BO3A 2J76E 1S79A 3NMUA 4LF4K 3KG4A 2DHAA 4KQZA 2H48B 2J9DE 4IQTA 3GIJA 3OTOK 3QB0A 5D0GA 2EWHA 1UPHA 4M9LA 1S48A 4KAIA 1IBLJ 1U48A 1A6SA 3V5RA 4B3OA 1QCKA 2JOQA 2XB2D 2ZXIA 3NGZA 3D1QA 3VAKA 4BDPA 2ACYA 1N61A 5AK3A 2DCLA 1CEZA 2WONA 4AL7A 1M90T 1AZSA 3OL9A 4KX5A 3IM8A 1FRKA 2B0GA 4XAKA 4HCCA 1FFGB 4E1MA 4LF7K 4W90B 4YOWA 4YD2A 4RZRA 1J2MA 5ALKA 3L3FX 3FVYA 1I94F 1P27B 3OFHA 4DI6A 3CJ8A 3PIOQ 2KHDA 2NRXA 2FPHX 1NKBA 1EO1A 4F7VA 4Z4CA 5JLHA 4DPUA 1J5EK 4DOCA 3MM5A 4OJ5A 3SDEA 4FW2A 4O0JA 3KLGB 1VQ9N 4FS2A 2YMMA 1KD1O 3D0GE 3AHPA 2B56A 2OEJA 4DBQA 3OSPA 4QZFA 2NRWA 4PHAA 4P4MA 2P9EA 3C1ZA 4IDHA 2UUBF 4K42A 3D3CJ 2EVZA 4RU2A 3ZSWA 2MY8A 4CF3A 2RDIA 4O8UA 5A8WA 4OO1J 2CPHA 3VTIA 2CQIA 1UT5A 4F04B 4CO3A 4NXMJ 2A1JA 1CZAN 2MQQA 3DEEA 4ALZA 4H54A 3PW4A 3TJAA 4OHXA 1V9PA 4DR7F 3OBWA 3IAYA 2OPPB 3BSNA 5ETMA 1VHFA 4A59A 1XMQK 4ZK7M 1HBNB 1U6ZA 9ICSA 2E6MA 3RAMA 2CFXA 2FJXA 1RHQB 3BQ7A 3SQ0A 1MU2B 3MPDA 4RUAA 4RUHA 2AA4A 1V3SA 2Y9HA 1MROB 1ZXOA 2CIMA 2JFDA 4IO1A 1XNSA 3DFEA 2RHKA 3DOMA 1WN7A 2AP1A 4B3TJ 3CE8A 4LF7F 1S4FA 2RE2A 2H4YB 2YQ3A 4DR2J 8ICZA 1WD6A 3RH6A 3K5MA 4OJGA 4M3YA 2ZEJA 1LWXA 3TA1A 3SYZA 2W41A 1F2HA 3HP9A 5J0YA 5HI7A 1WI6A 4XEIA 2RRNA 4IG0A 4QBUA 3W2WB 4LVSA 1X1PA 3TFSA 1GMWD 4O23A 3KLVA 4PKDB 4F4WA 3BSOA 3L4BC 9ICKA 2I1QA 5KQDA 1YZ7A 2KB2A 1L7MA 2NYHA 4CZHA 1R89A 4M04A 3HDSA 4XRHA 4LIWA 3M6VA 2IA6A 1B0PA 4R64A 1FKAF 4RQ0A 3BDEA 3RH4A 5GADP 3VEVA 5ETSA 5AR0A 2UUBK 2FDNA 3BPSP 2HQDA 4X84A 3SQOP 4NE9C 2K8GA 3S6JA 1M5VC 4PZOA 1FF2A 4CJQA 5M1OA 4CESA 3FM9A 5GMDA 4OJ1A 2QFJA 1LWCB 1PG5B 4KRWA 1RACB 3CG7A 4EMDA 3F2BA 1ZBTA 4IOCQ 1ZBUA 2QKQA 1RT3A 3K5LA 4HI2A 5D78A 5D4OA 3CCZA 3R1LA 2YNGB 3N7RC 3TAGA 1BQNB 4QS9A 3UN2A 4K2XA 2YI1A 1H74A 4RL1A 1KQSR 4DR5K 1MWZA 2ZBCA 4J90A 2VJUA 1FNOA 4PG7A 1UCNA 4WP9A 4JI7F 3HL8A 1FEHA 4MIWA 4LFAK 4TY9A 3ATUA 2XMMA 4EHUA 5CCMA 4PG6A 1Q3VA 3L3CA 1NMNA 1FKPB 3WK6A 1T8EA 1OY6A 4LF9F 4IOBA 4DV7F 3UMGA 4KLHA 4BR9A 3MHYA 3IG1B 2ZOMA 2EAMA 3AV9A 4I67A 2P51A 3LDQA 4DR2K 1QE1A 3DRRB 2G2YA 1AYEA 3SAFA 3IHQB 4UAYA 2DH7A 4BE0A 9ICHA 1KR4A 2D3OR 3DLGB 4BXOB 2EQYA 5AXMA 1HNZK 1MWKA 2D74B 1T03A 1TL3B 1SKUB 3ZDEA 2CG4A 2OWOA 2CPDA 4FLTA 4PKIA 3G71N 5M2UA 4PXCA 2BHNA 3AO1A 5CYQB 1Y10A 3MMBA 2VIHA 3SAHA 1HMVB 3NCRA 3MAAA 3H4DA 3T1YF 1NJZA 8ICKA 1UT8A 2GELA 4CZIA 1X5PA 5KL1B 2G8WA 5A6PA 3SJJA 2ZVIA 5J0XA 4I2CA 2CJYB 4EI2A 5H9EJ 4KMUA 1TUVA 3WXJA 1ZQXA 2LYHA 4DTMA 3FJ2A 3VF6A 4BR4A 3TX0A 3VQ5A 4V1Ak 3FZHA 2VFUA 2IOFA 1F9EB 2BUNA 1SIZA 3HILA 3LDAA 2W40A 3QT8A 2UUCF 3JPQA 3TUPA 1M5PC 2RUSA 1NGBA 5J2CA 3EE3A 3RB4A 4CF2A 5A0LA 2CZ4A 1OH7A 4OMFG 4IEEA 4B02A 2ZH9A 5CY4A 1ILYA 2BCQA 3IRXB 5KFDA 2N7YA 5L1LA 1S12A 5ALPA 4UZCA 9ICWA 2WB1C 1XC9A 1E6VA 4DUTA 3MMBB 2CPZA 1RTHB 5HMXA 3QLHB 4DXLA 3VPZA 3VQ6A 3ZLJA 2LXIA 4LSLB 2GO8A 2C3UA 1LAWA 3HZGA 3PSIA 2V51B 5KFWA 9ICNA 3IAS9 3D5MA 1H72C 3N7SC 3UE5A 1FJ7A 2UXCK 5J1EB 2KVIA 3F5EA 2I38A 2XBPA 1Z4OA 1XNRJ 3NDKA 3AD8C 4NXMF 2MTLA 1HNZF 3G82A 3BS5A 4KR0B 2O67A 4RPFA 1YRXA 3ZFVA 1FRLA 1F5SA 4GVMA 2CJBA 2LU1A 3CW2C 2JZBA 4JV0A 1EB0A 4OKJA 5G0RB 4WFNL 4PGYA 1AT1B 3W62A 5JMNA 2R7QA 4NL9A 5BOLA 4HEA9 4NLVA 4RW4A 4PUOA 2OJ3A 4DJBA 3ZSOA 2Y1IA 4F2RA 2ALYB 2YWGA 2RDJA 1VQNS 2J0QD 2YKMA 4QIWF 3DRPB 4Y2CA 2RPIA 4JRPA 1JALA 2R8IA 3L9ZA 2E44A 2AQ4A 4OKEA 4Y00A 4V19X 4OYWA 1VBKA 2R2SA 3PMLA 5K8NA 2ZIVA 4FWKA 4CGFA 2L9DA 5AKEA 5AQUA 3NWGA 3JSBA 2XY5A 2IRXA 1RXOB 1IXKA 3J8AA 3H0LB 3GQCA 4C1NK 6FD1A 2LA6A 4K4IA 1W2BM 3GIKA 3OSNA 4DOBA 4ENOA 4YFKA 2EG2A 4MKAA 3I0RA 5IINA 1NLKL 4JLHA 2PI5A 4DTRA 2UUAK 1YTUA 4J9QA 2OO4A 1VDVA 3BH6B 1S1TB 2I7NA 4K43A 3OFEA 5B08A 2JEGA 2ASMA 3V6DB 2KQ2A 1Q1KA 1WORA 4ECXA 1HBUA 2GLEA 1WF1A 2AJQA 4JI7J 2VKQA 7ICEA 1LOTB 3QGIA 4P73A 2L48A 2GMLA 3M1YA 1A76A 2DKXA 1GLDG 5KG3A 1F0XA 1HPMA 4HUGA 1WI8A 2UXBK 4NLXA 1F5BA 4BJQA 3C2LA 1YJWN 1GQEA 3OR1A 2KIVA 4UB2A 5ALRA 2G8HA 5I42B 3TEGA 3F53A 2VBYA 2M2BA 1P7DA 4P2SA 3AY9A 4UB1A 2HVZA 2V63A 1X8DA 3J81Y 3HJFA 2P6RA 3O5TB 5BREA 2BM1A 3OLBA 3RR7A 2CQDA 4FNIA 1JJCB 5HP4A 4PXEA 1HI8A 1HW9A 3IFEA 2ZH3A 3W60A 4FZZA 3WBZA 1WYGA 2OYYA 4KKOA 4EYIB 1U2CA 3U9DA 2B6AB 3KZIU 4OI4A 2X1BA 1QQNA 1QQCA 4FWMA 5A2QO 4LBHA 2H54B 1H2TZ 1WB9A 1L5UA 2B3TB 4HUFA 3C16B 4DQ8A 3QPIA 1V4TA 4HVJA 3ZSVA 5HBMB 4HACB 2RQKA 4DS5A 1FERA 4TLRA 3M7VA 2XCPA 1QAIA 2PZSA 3MCPA 1FXRA 2PO4A 2YBVA 2KT2A 2UUAJ 2VJ5A 4HWIA 3SSQA 2ZJAA 2V9WA 1JL2A 2W2OP 3THWA 4RNMA 1L8LA 1QD1A 3KWGA 4FS1A 3LWMA 1HYSB 2ZZTA 5KFQA 2Y1LB 4JI0F 4YOUA 4AM7A 1OY8A 4YY3F 3KKSA 3QWUA 3P8BB 3G6YA 3A13A 2YMPA 2E1PA 3TRGA 3MUMP 1O0PA 2E8PA 3KHHA 1NJIO 1PZNA 5C12A 2QL9B 4CM2A 2D1CA 3BJYA 4LSLA 4S0MA 4DG1A 4N77A 3SLCA 4ID5B 4YNQA 2KU7A 1IBMF 2X6SA 3C6AA 3MEDB 1KCFA 5IT0A 3RWUA 4MIBA 2GQ2A 2H9ZA 1LWFA 5D3GB 4PRFA 1NSKL 1L3KA 1P6TA 3ITHA 4ECTA 2ZOGA 3CC4S 1UHUA 2IVYA 2FMPA 2FJEB 1X5OA 3C7NA 2A1AA 2XGQA 1AXQA 5HRRA 4YR3A 3SV4A 3O80A 1ZA1B 4H0XB 1RQ0A 4OPJA 3C14B 4BDZA 3T5LA 2LYVA 1RBLA 3TAMB 3VQSA 4NWBA 4X66K 2UU9K 4KGXB 9ICRA 1TL5A 2WC9A 1T9WA 5E3PA 4G3IA 4DSEA 5E3CA 5F0XA 2R7WA 4LREA 4ATNA 3RW6A 2XZTB 2Z58B 1UMJA 4ECWA 4UQTA 2RUGA 3VCDA 2G1HA 2VBXA 4UUWA 2YKOA 1SH0A 3CTRA 3NE6A 2UUWA 3KLHA 5IM0B 4YFUA 1Q53A 4YEAA 1MWMA 2OZSA 1X9XA 4N76A 1RDRA 3C14A 2R9LA 1JRPA 5F2RA 2N4DA 1VDHA 2CQCA 3I82A 5DM7Q 1KFDA 3SQIA 3M8YA 2X3GA 4H0YB 4TLQA 3ZZRA 4CJVA 2W2PP 4NMXA 2XLKA 5H9EK 2V68A 4DX6A 4GKKK 4NM1A 3B8AX 3SR6A 3JSYA 3W66A 2RHQB 1CULB 4DV7K 4XH5A 5D77A 4FPBA 4QIFA 1SV5A 2HLUA 8ICSA 1NJWA 3KLFA 5GTIU 1HKGA 2DCUB 2XMVA 4BRQA 1UJ4A 4I1TA 3UNYA 3AM9A 3PLAA 5FLXO 3R7BB 2QB1A 1YJRA 5E26A 3R9PA 5DDQC 3LPUA 3PYGA 4K2JA 1C6VA 4JI1J 2HSZA 3QSIA 2W9BB 3O44A 1D09B 3RJEA 2DRDA 3LDLA 1NEEA 2ZNZA 4CNYA 1S3XA 3BUZB 3NF8A 1RAHB 3AVJA 2RQMA 3SMZA 2V4JA 4FZVA 3WK5A 2E2QA 1VJ5A 1UEKA 1RT4A 2MRLA 2ZBQA 2GHWA 2KDOA 1BCOA 4E2FB 3T1HK 3G96A 3JSRA 2WOMB 3HPGA 2F7TA 3V1QA 4P2MA 3VESA 9ICBA 4DR4K 5FDLA 5FLXY 3D6MB 5G4DA 3WEEA 3I8DA 4USWA 2GOLA 1YUWA 2P5GA 3SI8A 4A8EA 2XHWA 3D66A 2ZJ5A 1NZAA 4ES2A 1BG3A 4A8QA 3UN5A 3CCLN 4B9VA 3CCUN 2J6TA 4DMZA 1VQLN 1RT3B 3O8WA 1ZQLA 1DAXA 4AHUA 1U1OA 1RHKB 2MZTA 2ZIUA 1QH9A 2QWPA 2BJ9A 2P9LA 3HRDD 3EE9A 5H9FJ 2UUCJ 2K8CB 1SB6A 3J80U 1NPPA 1RTJA 1O13A 1RWNB 3H8MA 5C42A 4OI6A 5J2MA 3EY1A 4LF9K 3VQPA 4EBDA 4U7BA 4M6WB 4BUGA 4Z7YA 4NO7A 8ICMA 2KRRA 1WKKA 4WF9Q 4OLBA 3TADA 4O5EA 4DX5A 1RT2A 4GY2B 4UW9A 1FESA 2NRTA 4MHVA 4OV6A 2NPIA 3CJ1A 4M47A 1QSLA 4WK1A 4WXWA 1K73T 4H03B 1VMBA 4HHHA 2E4LA 4CGHA 4F02A 1XBWA 3KD3A 4QYZJ 1XO0A 2J0SD 3O1BA 1UKUA 2QL5B 1K73O 1NK7A 1MMLA 1U02A 3NAEA 5DQHA 1U1PA 4WYBA 4WQ5A 1A9NB 3ICXA 2F9WA 1TR0A 4FPIA 5CXTA 1LCUA 1NGEA 3S1TA 3TSPA 4IOAQ 3AQFA 5DBCA 4LF4F 4YQWA 1AA1B 4ZP6A 3FZBA 2GUIA 5LMUF 3AN1A 4M94A 2X74A 3FMBA 2CH5A 3ZZPA 1NGDA 2IHR1 1MMNA 1UVLA 1RTIB 4DSFA 2FJDB 3KJVA 3P83D 1BNPA 2PYJA 2DEIA 3VHQA 3NS7B 3IV6A 2B8QA 2F9DA 2HGLA 3L3VA 1R8PA 4OZ2A 1VLYA 4UASA 3GR0A 4ZDNA 1NI3A 4A62A 2HBQB 4F67A 2VJVA 2YX1A 5AQTA 3OR2B 5AM1A 4ELUA 3SNNA 2FF3B 1DTTB 1RT6A 4KFBB 2J7WA 3QZ8A 3THWB 8ICBA 5IWAJ 4KJIA 4DTXA 5HR6A 4ED1A 3QO9B 1Y5NB 5EHHA 1VIXA 2PEHA 2XO6A 1GOCA 3HHLD 2BKEA 2LFVA 2ZG6A 4KGVB 1JQGA 2GWKA 4UB6U 1A0PA 2J8SA 4Y2UA 3RF9A 1U25A 4DPXA 4KHWA 4MN4C 4HUEA 4P2XA 3BPDA 2D0BA 4C8NA 1CJTB 2V4RA 3K8WA 1MROA 2CPIA 3OS2A 3W64A 3E9LA 5AQMA 4A2BA 1WC5A 4R63A 5A2QY 1RGIA 2ASJA 4Y3CA 1K9MO 1VQ9S 3PSTA 2VWKA 3HHLA 3CCLS 5J2PB 1HKBA 3VENA 2X1AA 4TNOA 5MLCV 4EBCA 1JLQA 3KMSA 4KLOA 3PSPA 2DFFA 1KRPA 3DOKB 4I0WA 3LGHA 1Q8BA 2K4HA 3T6BA 3ZCMA 2NS1B 4P72A 3WQPA 3QMLA 1RWPB 4GKJJ 3M6GA 3SUPA 1VLBA 2PFOA 4JKGB 3C2PA 4JI4J 3NNAA 4F92B 3J81j 3MN6A 1CQNA 2HS0A 4RW6A 1SB3C 4M5IA 1KVJA 3PR5B 4LF6F 2NQPA 1RBSA 2D1KA 5LSOA 4PHEA 1RAEB 1IKWA 2KXNB 3ZXWA 5J0PA 3K5NA 5BN9A 3TAMA 1BPZA 4K25A 1X4BA 3CJ5A 3AA8A 4CEDA 2M88A 5E84A 1UTAA 1VSKA 4DR6F 4JYAK 2HLTA 4H0PA 3U4LA 4OYMA 1QQ7A 3PYFA 4XPEA 1WSIA 3PW5A 2EBEA 1N32F 3QWPA 1NB2A 2YMQA 4KO0A 2VQEK 2ITMA 2XC9A 9ICJA 4AT1B 1U8SA 2LQ9A 2AEJA 1ZQRA 1KEKA 5CYJA 4CLUA 4DG1B 3SCIE 3WXKA 3B4MA 1QHAA 5DZ6A 4CJPA 1W2IA 3HOTA 2WSEC 2AJ1A 4OX6A 1RG6A 3HKZC 1NJYA 3CRXA 3O8MA 3AQPA 8ICFA 2HRUA 2PFFB 3IG5A 4KSEB 1HIYA 3CQXA 1FVQA 4OX9F 2VONA 4IR9A 3ISNC 1JB0C 1LW2B 1IBKK 4F2SA 2HRTA 4QW8A 3M8WA 3WX4A 1FKOB 2O4GA 4ZVSB 4AYBF 4QW9A 2QWMA 4JI7K 2XMKA 3BR9A 4DFMA 1QAYA 3MR6A 4OL8A 1U1KA 4TQSA 5C0YA 1GLJO 2MZJA 2DNHA 1JNZB 2E5GA 1GLCG 2P2CB 2I9SA 2YX8A 1X4GA 4X4NA 2JVRA 5HMYA 4LFCK 2NXNA 4G1IA 2GGPB 2YQEA 2IJNA 4YORA 3DV9A 1R0BG 3ZZOA 3ZTRA 3UPQA 4DZ6A 2PN6A 1N32K 3VF2A 4FJJA 3PG9A 2IM3A 4RQMA 2YHWA 2IVPA 4B1UB 1FT8A 5J2IA 1AFJA 4C48A 3WNFA 4JI0K 3JSMB 1E6YB 1GLBG 1HYSA 1A7GE 1K8AT 1ZD2P 3Q24A 4HH1A 9ICMA 1R6YA 4A8KA 3CCMS 1O8BA 4QWAA 4MT1A 2WVEA 2XMWA 1XNRK 2BVZA 1K8AO 1C1CB 4IJAA 4DQRA 4KH6A 1VGYA 4RQ5A 2BJDA 5J2FA 3CXCR 3S6EA 2FJWA 1HNWK 4J5OA 3FZFA 2ADCA 1JUDA 4O8KA 2P1JA 1S77D 2KFZA 1EKSA 4ZVEA 4DX8H 4JB8B 3HRGA 1P9QC 5EE1A 4OJLA 4PHTX 4ZVFA 4FZXC 4RWXA 2WW8A 2QEXS 4ISEA 2VKRA 5ALJA 4FJ9A 1MG7A 4JKEA 2YTCA 3EDQB 4WIQA 5JICA 4MJKA 1FJCA 3VQ7A 4F36A 4KLIA 5KRTA 2BJ8A 2RIJA 3S7RA 5DBBA 4LFBK 1RDBA 1TL1B 4USTA 2RDDA 4UY85 3QETA 2B6AA 4G1QA 5AKHA 1G99A 1N6QB 3M4XA 5AQLA 5J0OA 4NCGA 3BSCA 3PX4A 3SMSA 5KAFU 4H0OA 3GFZA 1TMJA 1MNEA 1CXQA 2PGCA 5F8IA 1DY3A 3ZSZA 4CF8A 4KB0A 2P35A 1JI7A 5HMMA 1BPXA 4K4GA 1KTVA 5D0EA 1T9YA 4JKFA 5J29A 1IUJA 5IIKA 3HVTA 4FWQA 1YHQN 3GCXP 2MQMA 4I64A 3TEHB 1R31A 2DWQA 4E98A 2WF7A 3ENQA 2E29A 4O3OA 1DQ8A 1FKOA 2W3RA 2XI2A 3SENA 2W9CA 1X42A 3K5OA 1GX6A 2ETJA 3MF5A 4M63C 4C3KA 1N5TA 5IOLA 4ER8A 4OHVA 2GIQA 4KH5A 2CQ4A 5AKJA 4XDDA 5F1XA 4RUCA 5HO4A 2E5LF 2EI5A 3QT7A 4CLPA 2HZVA 3R5DA 5E2QA 5GAHI 3DDNA 4LF5K 3U9ZA 2OUGA 2DRBA 2ZJRL 2ZIXA 3GV7B 1J5OB 3ILIA 1NHKL 4YDDB 5FJ4A 3SI6A 3KUGA 5FD1A 2IOHA 2HOFA 3W9HA 2DITA 4B08A 4DV1K 4FLVA 2PBDA 3CUNA 3D1OA 2EC0A 3CETA 1KVBA 3OJSA 3Q8KA 3H7HB 4OYOA 3D6JA 4NCAA 2XULA 3AO2A 3JTNA 2O8BA 5FLXU 2QLXA 1IG6A 1U1NA 3P49B 5AQWA 2WHEA 3PO4A 1RBOB 2KVCA 2CNKB 3N4MB 3E0FA 3H3OB 4I4BA 3NVYA 4NPOA 4BDYA 3ZT3A 2HHHK 2CNLB 3OHRA 5BR8F 2ASDA 4DPYA 4TSXA 4QCLA 1EP4B 4JI3F 2RHSB 1SV0A 4ZLNA 1SI9A 2ZIWB 1KL9A 2W8KA 1FX2A 3AA9A 2K4PA 4TKTA 1RKIA 1SUQA 1MWYA 3AAPA 3OYIA 2DNMA 1VRQC 1EQYA 5BXIA 1A0OB 1LFWA 2VG5B 2MKIA 3DHXA 2YX7A 1N5WA 3ONNA 3N6MA 5AIAA 2HWIA 2OP5A 4LH4A 3VEZA 2WCXA 2OPQA 3KYLA 3DOKA 4DTSA 2MKJA 1U09A 1RE1B 4KLUA 4L72B 3KJQB 1S76D 1NBEB 3IM1A 2RJZA 3CCRN 5DS7A 4JI5F 1HKAA 4E7HA 2V69A 1QLNA 4CF4A 3R5BA 4QZVB 5IZHA 4JKHA 4HTJA 2CG8A 1E4GT 5GIOA 3F5TA 4BXOA 3MEDA 4DFDA 2DNZA 1XSLA 2QFIA 3Q83A 1C0UA 1VQSA 3HO1A 3TUZC 4DHYA 4FYVB 2QL7B 4PY5A 4A8WA 4JK9A 2E1MC 2KJ5A 1H7WA 3MBYA 3OVSA 2YH1A 4ECRA 5I3QA 3L0QA 5DG9A 2PFNA 2HNZA 3E2EA 4LR8A 2FVRA 4F93B 3VWSA 4C0BA 2PY5A 1KKXA 3F2CA 2QB0A 1BLUA 1FO1A 2BUPA 4JYAJ 4IG0B 5I42A 2VG5A 2M8HA 4NM2A 3NY0A 3TWZA 5LL6d 2C3YA 2P9KB 4CNQA 5LY3A 3KDNA 5DB6A 5ALVA 4QIEA 8ICTA 3LP2A 4KPCA 5D0HA 3H2LA 3I9ZA 2E5LK 3V4IA 3K2PA 4OPHA 4Q2MA 5FRMA 2GV1A 2H5JB 4C2MA 3J81U 4E7LA 1FDDA 4KIAA 4MQ3A 2JWKA 1B3TA 2HKEA 4WFYA 3SDEB 5DB9A 2EDUA 3IRWP 4G6VB 1PILA 4O3SA 2D0AA 3NH0A 4X66F 3K17A 2WVFA 3SPZA 2FMQA 1SJQA 2WMMA 2KYZA 3QIOA 3DLHA 2A18A 1CQMA 2GHVC 2PA3A 8ICNA 1QDUB 3ATVA 1VK8A 2LHTA 3K9KA 3U02A 3HP6A 3MMVA 2E9TA 3C29A 2KHQA 3N4PA 4IRDA 3NL0A 2B4OA 4K4ZA 3LTOA 5I3PA 1I94K 3NH2A 4OX9K 2MUTA 2FC8A 5AM5A 4I9LA 2UVWA 4IH7A 5BYRA 2BYCA 2XSJB 2YKNA 2EK1A 3L4PA 3NBPB 3GE9A 5LSRA 1BPBA 2QI2A 1RT1A 1V3RA 3K8VA 1MA9B 5BN8A 4F5PA 1KQSM 3L2UA 3PKYA 3PACA 1I94J 4N5SA 5CR0A 4DOAA 5CEHA 2DR9A 2X78A 4FLXA 4A47A 3D54A 1HNIB 2IDOA 1ZOLA 2WW4A 3T7ZA 7ICMA 2LCWA 3OYGA 1JJ2R 4ED6A 4FF3A 3THYA 4CJLA 1WEYA 4QOTA 4M5KA 4Y2YA 5JJBA 1O1WA 4QWBA 2QLTA 3GV8B 1Z4NA 3PYEA 1WOSA 2QWLA 2VHGA 3SJHA 2ZHAA 1LW0A 4X62F 3QEPA 1JLGB 3CC2N 2YB4A 5E3AA 2MB0B 4NLRA 2P9NA 5A8RB 4WQ4C 5J1EA 3H8WA 2P9LB 1ZQAA 1KW4A 3R5GA 4ZVTB 3M1VA 4MFAA 2DGXA 2B4VA 2G0IA 4ZOHC 4L73A 5F8JA 3EX7B 2G1DA 1RILA 3SUQA 2KJVA 3C46A 1HNIA 4G9ZA 5KFLA 1IVZA 1ZBHA 2ATQA 3L09A 3AO5A 2PSZA 3KKAA 2ODGA 3MABA 3GCWP 4DQPA 3EWAA 5C5JA 4ID1A 5HVFA 5H1SV 3DRYA 4F50A 1VBZA 4CHOA 4WFXA 4ID8A 3TZZA 1QAJA 4DL5A 2PI4A 4W5OA 3BZCA 4N8NA 4P0QA 1NMDA 3TTCA 4YB1P 1JLBB 1BIZA 3OTQA 2IHMA 3QEXA 5CYMB 2FUG9 4F0KA 2KJWA 4FLWA 3EUB2 2GNKA 3DOMB 3CNHA 1GAOA 3Q8MA 4X4PA 4XK8C 4FJKA 1Q82O 3NCPA 5IIIA 3WX8A 5CWRA 4Z6CA 3P5JA 3DLKB 2BKPA 2DTJA 3TAQA 4KLEA 1ULRA 5C2CA 5DG8A 3SZ2A 2VPZB 1ZRNA 4KRFA 1FE0A 1IN0A 2ZZMA 3CD6N 1HARA 3I55N 3A8IA 4HKQA 4CFCA 4ZS6A 3KD1E 1B64A 3A1YG 1DHMA 3C3LA 2FJ6A 3GV5B 2RNEA 4P52A 1ATNA 2ATCB 3DM2A 3C6TA 4TURA 1BI4A 3QNNA 3TYTA 2YNIB 2IBOA 2YHYA 4EO8A 1SZPA 3THTA 3OTCA 3LP0A 1WBBA 2XGPA 4MYTA 5A8KB 3D1HA 4QWCA 3QRRA 3C2MA 1G15A 5RUBA 1X0PA 1ZQKA 1LK5A 1VQ6S 2MSNA 3OYNA 6FDRA 2BV3A 3PHEA 4DUYK 2HMIA 1X3MA 3UKRA 3E01A 4A8FA 4ZHRA 4P6QA 1BDGA 3G8QA 1ECWA 4ITSA 2CDRB 1U2VB 1VRUA 4KHPK 2YVSA 1ZQZA 3CPEA 3PJXA 5AM0A 4HYKA 4P4OA 3GB0A 1S6PA 2AEFA 4EZ9A 4HTIA 5ADZA 3GJQB 2A1BA 4CEAA 3H46O 2OKQA 2DXDA 3AOCA 5DDYA 4RNOA 1VBYA 4PKGA 3NOCA 1PYOB 1N52B 2HQFA 4X64K 5KI6A 4BRIA 2AX0A 5IIJA 2FZGB 3L7PA 4B3OB 3DCAA 4U8YA 3WKCA 5KT3A 1BQMA 2XNRA 1P8ZA 4CJWA 2ABYA 2GUPA 3MOZA 5B7WA 2BKOA 5J0UA 1V5VA 4AE5A 3IG1A 1IBMK 2DHXA 4I2QB 2UVVA 1XK8A 3GYGA 2KD1A 4RQ7A 1IJFB 3B78A 3SCKE 4TU9A 2HBMA 4O0NA 2JLGA 1SZ2A 1WC1A 3OUYB 2DEJA 4FF1A 2BTFA 2X1FA 3JPSA 2VASA 4HH0A 5EGYA 3PEHA 1EXNA 3HX9A 3OBYA 2CKWA 3HD1A 1PVRA 1E6YA 2U2FA 2EEYA 2OGUA 3N5FA 4URGA 3OHAA 2BRLA 4M1KA 5KPRA 3H2VE 3ALYA 1C4CA 2Q6BA 1W7AA 4AHTA 3BEXA 1CZBA 4LH5A 4HHTA 1Q5VA 4BACA 3MGVA 4BVOA 1S9GB 4C8MA 4Y1CA 1D9AA 4JD2A 2E8AA 1DLOB 2E9ZA 3V7JA 3IR7B 3W1YC 1KLMA 1QUPA 4WF9L 1ZAWA 3UPFA 1JCEA 1Z6RA 2ZH2A 2CNNB 4LFAJ 4ILGB 3MFIA 4M7XA 4CK3A 3VQQA 4JK8A 1VSLA 2QSFA 5F8HA 2HBKA 4DPOA 4Y6IA 2LDIA 3GZ7A 4H4OA 1JJ4A 2YB1A 3FZLA 5CZVA 3RMDA 2DNNA 2FF6A 4JN4A 2GAGC 3H4BA 2NR0A 5AQVA 4GO7X 2HHUA 1N34J 3PSFA 2B9EA 5ELZA 2FC0A 2IY5B 4QZCA 3HM9A 2QTDA 3R2CJ 3JYTB 2YHXA 1YKWA 1VC6A 3NLCA 4EP5A 2HNYB 4I7FB 4Y2RA 3MGIA 1QM9A 2QMWA 4DUYF 3L6QA 4HAIA 3CT9A 1DTTA 4M9GA 5E3QA 1VQON 3IA0A 2HFOA 5AXLA 4X64J 4WQ4A 1FHTA 3L4IA 4OJRA 1N5QA 2HZAA 5AI9A 3CGIA 4ICLA 5D4NA 1GO3F 2VIXA 1WOPA 2EPIA 2JEJA 5F8LA 1I3OB 2LEPA 2H5IB 4LJXA 4QYZK 4M3UA 1TFYA 2MQPA 4GV6A 3BKTA 3TI0A 4BRHA 1VC0A 3ILJA 1CC7A 4USKA 4NXNF 2A6OA 3HT3A 3U3GA 1CPZA 2J5AA 4W5NA 4GVLA 2A1JB 3O4WA 1FTRA 4CZEA 2ERRA 4YN3B 4ED2A 1NCLA 1TVRA 4Z4GA 5KOXA 4CZKA 4WP8A 1VI7A 3TVZA 3F2KA 2VGNA 3IR5B 2XHCA 1SC4B 5HROB 4W5TA 3BH7B 8ICCA 1Q86O 3P3DA 1J9AA 3PFEA 4WE1A 1YF5L 4WTYA 3EJMA 1UCVA 2WF5A 3SAGA 4ZHRB 1SXEA 2GVDA 3UD4P 1HNVB 4V19J 3KNAA 1M5KC 1ZQUA 4DMNA 4LF5J 1JKHB 4MLHA 3HVTB 3AD7C 2MGZA 2WB4A 1CJUB 2WSFC 5HVHA 5IC4B 4DL7A 4BC7A 3CULA 4DQIA 2GH1A 3UFCX 5E5NA 3KJVB 4I2PA 4L8RB 2VG6A 3FLCO 1NNDA 1HRHA 5HP1A 1TUUA 5D49A 2XLIA 3AA2A 1A5VA 1HQEA 3W9JA 3OYEA 1KVAA 1YJNS 3OL7A 5K5MA 1FFVA 1WAFA 2F40A 1BA0A 1M6YA 2P8IA 1TK0A 1K44A 4BS2A 2HHQA 4Q8EA 4LC9B 2X7IA 4ZPAA 3MEEB 4U7UK 1WSJA 4KMOB 4H5NA 1Z4UA 4DTJA 2D3DA 1U4BA 4NI2B 2ASPA 1AQ6A 2G09A 5T7BA 1OH8A 1G4CA 5J8YC 3AL0B 3NAIA 1VBXA 4GMJB 2C2ZB 4DV2K 1W2BR 1UQVA 1H38A 1HNWF 4CP5A 1NDCA 2AMCB 1S1VA 3UN3A 5HQLA 2WB1F 3L8BA 1KVIA 3VALA 4AL5A 2FJVA 5ALQA 4BRKA 3TW0A 4DV4J 1JL1A 2YNHA 2UU9F 2ROPA 1ICEB 4JI2F 3KK1A 2R18A 3PM9A 3U27A 4RCHA 4FBTA 2IYGA 3H45C 3UO0A 3DI6B 3AJ1A 1XMOK 2I1RA 2GIFA 3TX8A 2QJ3A 3V9XA 4WJBA 3G10A 5FPMA 3KK2A 4WJ3B 2A0FB 3VGLA 2ZKUA 5HBMA 4ERDA 5MAOA 2MPUA 5LMUJ 4M8LA 2QMUB 3EEQA 4WFNQ 3CMEN 3QZ7A 4GKJF 1S5LU 2ALZA 4CEBA 2Q2RA 4KLFA 3ETRA 3HHEA 2HG4A 3T5KA 4UAVA 1Z00B 4F5QA 1LEOA 3UB5A 4GLXA 2NZTA 4B8CA 1BPDA 3KTQA 5AI4A 3WZ0A 3KHLA 4AYBC 2E5HA 2H3QA 1B70B 2C28A 5HL7L 3VV2B 1QQ5A 4WK3A 1UAWA 5J0WA 4ILRA 2V5HG 4GMKA 5IS2A 1RYSA 1FRHA 3AAWB 4Q2LA 4CVNE 4I2BA 1VJQA 2QYGA 2D0PA 4LF8J 3ZD9A 3MM5B 1P90A 4BRDA 2HNZB 2HAFA 2QV6A 1T3VA 4BWMA 2HWHA 2YXLA 1PKUA 1Q8KA 2W42A 1MDUB 3A5NC 2D6FC 1X5SA 3GPAA 1BOTO 1WBDA 1AUDA 3TARA 3TPQA 4DZDA 2VG7B 2DGOA 4K50A 1RA6A 1EWRA 2WF6A 4FVCA 2KW4A 3L3UA 4KBOA 2DHHA 3B0XA 1ZPWX 5JUMA 4E7KA 3QNOA 5BRHA 2F1IA 5HVGA 3ZSQA 4ZVQB 3P5TL 3D2NA 1H7XA 4EYHB 5EUHA 3NH1A 1DQAA 1UJ6A 2BW7A 1ZJMA 2F1HA 4OX9J 3HTVA 5EOYA 2DK2A 2NSBA 2BW2A 3THXA 3NF7A 3CPWR 3DGPB 2A1SA 2OXOA 3CPWM 4BLGA 5SUHA 3RRKA 3BGUA 1LXJA 3MOJB 1RDCA 3JPRA 3BDPA 2POKA 2RILA 1YK9A 3C16A 5GVQA 1HD1A 3AGKA 1FXLA 3GG0A 3QUCA 3OVNA 4A8XA 1RDWX 1WHWA 5HANA 2O8CB 3OTBA 1L8OA 4GXKA 4CHNA 4LR7A 4LF6J 3CVKA 3O3LA 2DYAA 3HI9A 4ILMA 4YHHJ 3WK7A 1VSFA 4OFZA 5TKYA 3FFKB 4ICAA 2HIQA 4RKUC 3CM5A 3FSYA 1UP1A 2A1RA 2PFPA 3HHLC 3CJQA 3CCSS 3A3NB 3PIOL 2NV3A 4DU8A 4J37A 3ZZUA 4ZITA 2M8DB 3RFAA 3CCWA 3H0RB 4MFBB 4DV3J 2Y0BB 4DCJB 3KZXA 5AE2A 2F9JA 4K8RA 1ZQGA 1RCHA 4YDUA 3MXIA 2HHHF 1N63A 8ICIA 5L1IA 4P75A 1IXRA 3UWTA 4NX9A 4ZPCA 1CUKA 3JQKA 4ZN3A 1HI0P 3LP3A 1HWLA 4H0TB 3LDOA 5CZ2A 2QEXN 1XR7A 2JSXA 5KT6A 2G06A 5AQNA 3BF1A 4UB3A 1UL3A 1YTYA 3RMAA 4BC4A 5KFEA 4DU4A 4MKVA 1ED1A 3J7YU 3I0SB 2A2CA 3C5GA 3GDXA 3V7KA 1X4AA 4IFVA 1PAEX 1TAQA 4JOUA 3FSIA 4OHWA 3R8YA 2CXEA 4FN5A 3QIDA 2MKYA 3D0HE 5T7LB 3MTKA 1CRXA 3PCOB 2CN1A 4RO0A 4XDCA 3PIPQ 3QBCA 3GIRA 4NYZA 3W2VA 2G8KA 4ECZA 4BC2A 2VFVA 4UARA 1NZPA 2HOIA 2B0CA 3NCIA 4GVEA 2MXYA 2BCVA 1NU4A 1N36F 4PPZA 4HTUA 3BGRB 1S1VB 4DL6A 3RJGA 1HPZA 5C2DA 4FWLA 3M6XA 4NRTA 4O4GB 4M5DA 4GO5X 4NRUA 2B5JA 2NSCA 3CFOA 1FK9B 2DR6A 3B54A 5LJWA 1Y5IB 2QKKA 4Y2KA 3NMAA 2BZFA 2HDOA 4WQ5C 4CYUB 1VIOA 3CD0A 3IBPA 2L3MA 2QMXA 1F3FA 3V9ZA 5G0RA 4RWTA 4E19A 4I2AA 3QEVA 5B0CA 4X64F 4K4YA 3MN7A 2LP4A 2DNLA 4LZGA 3L7OA 3R7NB 1Q82T 2YPZA 1FD2A 1QJHA 3BY5A 2OPSA 3MM9B 4XO0A 1ZQIA 3MMCA 3KIOA 1U6BA 2Q0UA 2DT9A 4DR4J 2VJ4A 1N54B 1ZBSA 5L1JA 1SQFA 3P45B 3D6TB 2NXJA 3MMAA 1OY9A 3RH5A 3QU4A 1CJVB 4ZP7A 4OYXA 5CHCB 2LXUA 5J2NA 1URJA 3C15B 1FWPA 1SH3A 1WKJA 1M1KO 3ZYYX 4PABA 5BJRA 3OA9A 3CJ0A 2QLWA 2F8MA 3W65A 3TTDA 3BV8A 4WFAQ 4F5RA 1ZAXA 4RR5A 3TVYA 1IJJA 4B17A 1OS5A 2IPOB 1URNA 3ZX2A 5A8KA 2W11A 3VERA 4CBXA 4CT9A 5AIBA 1IBMJ 1V5IB 4ZMMA 4F5NA 2B9WA 3BS9A 3DM2B 2MSTA 4MIAA 2WBRA 1NOZA 1ZQJA 2J4RA 3IS9B 3PO5A 2AX1A 2LQBA 1SZHA 1X40A 2DFLA 4FO0A 4TUPA 4AYBD 4KHNA 4PHPA 1S6QB 4ISFA 1RKJA 3SBTA 4A46A 4ZCIA 5EOZA 3HKWA 3SFGA 3U7JA 4JI2K 3OYDA 1ZQDA 2FBVA 3VQDA 5ETPA 5KTQA 4BRFA 4NL9C 2ZC3A 2Q79A 5JU5A 1ITPA 7ICTA 3MURP 1L7OA 3FNNA 3IWNC 4JV1A 4DV7J 3D7EO 3OS1A 5AZJB 4DL2A 2UV8A 5U47A 2FC9A 2R7XA 3L5KA 4BQLA 3LWLA 2FVSA 1S0MA 2E8OA 2LQ5A 2GBZA 4YOVA 1DK2A 3HSTB 2QA4N 1WUUA 3RBXA 8ICRA 1HFEL 1FD8A 1W26A 2CQPA 4PGQA 2R8JA 4B3RF 2FQQB 1RT7A 4EZ6A 4OLOA 9RUBA 4I9QA 4JUZA 4KHQA 3VVTA 4EU0A 4FJXA 3DMJB 2DBBA 2JH3A 3SD7A 5L9NA 5KAKA 1Q3UA 4X66J 2CQ0A 3JTPA 1NSQA 3M6KA 4KLLA 3I4PA 4UAZA 3L95X 4I27A 4DR6K 3OXLA 3AO3A 3WKAA 3KWMA 3LALA 3UQ0A 1OUQA 1N33K 3CCVN 3SQ1A 4MH8A 1OIAA 4Y0FA 2Q31A 2VOPA 1ZRMA 2W54A 5ALTA 2VQEF 4OD0A 2GEMA 3SEOA 3QT6A 3C2KA 1NM1A 3OTOJ 1S6PB 4KHYA 5HATA 3HSZA 4K4TA 3O9RA 1IG8A 1REVA 2ASOA 1RLDA 2EZYA 4QR1A 3MZIA 3BR8A 4KH1B 2BDUA 4MTPA 1O5JA 2KKZA 3DWLA 3I76A 4KE5A 3LA0A 2CGKA 2P9CA 3CD5A 4ZCMA 3ZDBA 4DX7A 1X9SA 2E8NA 1FX4A 1IKVA 1NZ8A 2ZH6A 3WIVA 3NGUA 1WDDA 2DF4B 3ZX0A 2ZWOA 1VSMA 4YDUC 2K89A 3OT9A 4WKYA 8ICHA 1YBTA 4WPAA 5AQKA 5HRSA 1UZDA 4IQVA 5DQGA 1CS4B 3PTWA 2A5XA 1JMSA 5KT7A 1TL7A 3WNGA 4I2IA 3QGPA 5K4LA 4JI5J 4IDKA 4KTQA 2JFKA 4OYPA 4PL8A 1DGJA 1FWLA 3BGFA 1XNRF 1IH7A 3D2QA 3FAHA 2YN4A 1PK1B 3MWTA 1NAQA 2N7CA 3G9CA 4FWPA 9ICLA 3C7NB 3FKBA 4CLSA 4YOEA 5BPLA 4FYWB 1XUPO 2IBKA 9ICGA 4LFCF 1EX8A 4DPTA 2VB6A 3Q8QB 2HQCA 1WG8A 2D9OA 3FGUA 2VPXB 4KH4A 4JWMA 3NVVA 4KHPF 2R7VA 3LL3A 3HM8A 3RMBA 3QEIA 3M2RA 2I5JA 3PV8A 3BZQA 3OYBA 4Q43A 1FE4A 2F3JA 4PWDA 1Q16B 3LP1A 2KT5A 2G07A 4F3OA 3OXGA 5L38A 4U96A 3PNIA 4DF4A 3FQLA 3MDFA 3KD5E 4I2DA 3DKDA 1H3DA 4IRKA 3GFKB 3AT1B 2YNIA 3KFWX 2HHTA 4H4MB 3MCSA 2UXDK 4FZLA 1RAOA 4B8AB 5CZ1A 5HHHA 3EVOA 4CHPA 3R6MA 4L6V3 4J9UE 2QE5A 1C0TB 2V8DA 5J2QA 5AJ3K 1RWMB 2KRBA 1G6BA 4AQYJ 4OX7A 5IC6B 1HNXJ 1U9LA 3G25A 4CHZA 2OZMA 3R6GB 4LRFA 2J7KA 1S97A 2ZM6F 3HVWA 3JQJA 2M52A 3CP8A 1RQNA 4PR6A 3KG0A 3U8XA 1RADB 1BCMA 4LVOP 3Q7CA 2FVPA 3C94A 4J03A 3I31A 3D68A 1MA7A 1R8HA 4R8UA 3HSJA 4EEKA 4O5FA 2LDYA 4OI0A 2V4JB 3QRQA 4JI1F 3VR1A 3PY8A 2VG6B 5D46A 1UOCA 4XA5A 2HHSA 4UOGA 4R0JA 1DZ5A 3O9SA 3ENOA 4ECUA 4RW8A 1GFWB 3IMXA 3F73A 3KK3B 1VQKN 1ZBIA 1CI4A 3NS1A 4NLBA 2WF9A 3H5UA 4Y2XA 4A61A 1KN6A 1BISA 4ZKAA 5KFJA 1PSDA 3EO3A 2IMOA 3OYLA 3VAGA 3ZNUA 1G7CB 1N88A 3MR2A 4A4JA 4M3TA 3T9ZA 1X66A 4WYWA 3AVGA 2HNDA 4NLPA 4NI2A 2DKOB 2W25A 4WU3A 2C2DA 4NXNK 3GE1A 3HXMA 2Y1RI 1RZMA 1WLJA 2F4VK 3MM8A 4O55A 2FPKA 4YB5A 3N9UC 3CCEN 2HMXA 1N60A 3VGUA 4LF8K 1NBWA 4P74A 3HCXA 2P6UA 2ZGZA 1RTHA 1NHVA 2QSWA 3R27A 2IOCA 4Z94A 2W6LA 2W55A 3E8OA 3CJTA 3V6DA