1NK7A

Guanine-adenine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk7A01
3IS9A 4Z4FA 2XO7A 3LPTA 2NRVA 5DGAA 2IHMA 4ED1A 3AVMA 4ECVA 4RNMA 4CGIA 3OYMA 4FLVA 3RJEA 2E6LA 4BACA 4KAZA 3SZ2A 1LB2B 3EPGA 1J9AA 3TANA 3GQCA 3D45A 2C28A 2OWOA 3ITHA 3SUQA 1D5AA 3HWTA 1DTTA 3KK1A 4NCGA 1Q8IA 4DLEA 3RMDA 1JXBA 3TR8A 4DF4A 5DMRA 2MUTB 4JRPA 1Z00A 3BQ1A 8ICSA 3ETLA 2ASJA 4HCBA 3EY1A 4CJFA 1Z25A 5D3GA 1ASVA 3PX0A 7ICTA 4F5OA 3RB0A 4TQSA 4UBCA 4DO9A 3VA0A 5KFEA 2Q0ZX 3V9WA 3LP2A 3G0ZA 4F50A 2Z1IA 4FJ5A 1TAQA 1NJYA 3DRPA 1N6QA 4RQ5A 4CEAA 3NFAA 5J0SA 4J9RA 9ICMA 1IKVA 3ZDBA 3SI6A 5L1LA 2XCAA 1C0TA 1SL1A 3AVJA 9ICHA 2VWKA 3HPGA 3HO1A 3QEAZ 1JLEA 2A1JA 1KFSA 4B9TA 3C2KA 2ZD1A 4NXZA 4TQRA 1C1BA 1NK5A 2NUBA 3NGYA 3V4IA 4KO0A 2V9WA 2Z1HA 4UBBA 1YT3A 3M8RA 1Y88A 2UVWA 4Y1DA 3DRSA 5C5JA 1NKBA 3QERA 1B43A 4I2IA 4FM0A 3TARA 1S1UA 3OYJA 3T5JA 4MEXA 2RKIA 2FLNA 3QIPA 4DFKA 9ICUA 1BGXT 1S5JA 4QZGA 4CJ4A 2ZUDA 5CYQA 2BPCA 1WSHA 3CM5A 3HYFA 4HCCA 3EYZA 4M3TA 4DSJA 1WAJA 4QZIA 3K57A 3LZJA 2GWSA 1CZ9A 4AHUA 3FDSA 1IKWA 1YTAA 1ZQRA 9ICVA 4LZDA 1JKHA 3OYFA 4KLQA 3AVKA 4Z6CA 7ICRA 2MUTA 3VQ5A 1TK0A 1NK9A 4N56A 3LDAA 1S1VA 3NTUA 2OA8A 3V9ZA 5KG4A 3NGIA 2FPKA 3C95A 3SJJA 2ZTCA 1CUKA 4M9LA 4M3RA 1XU4A 4KITB 1LWFA 4QCLA 4M3YA 4I2JA 4GXKA 5DB7A 2EX3A 5HNKA 4Y1CA 4PWDA 3SQ2A 4AHSA 5DBCA 1DTQA 3RMBA 3SPZA 3P83D 3K59A 2IA6A 7ICOA 8ICGA 2F8SA 4KLSA 1S9FA 1I39A 4M9JA 4R8UB 3S3OA 4BWMA 3C5GA 5KFAA 1QLNA 4FBTA 5KFDA 3V1OA 3TWHA 4QZEA 2F8TA 2YNIA 3AA3A 1RT7A 4FK2A 7ICLA 1RXWA 1TKXA 4FJKA 2PYLA 4KN7A 4G3IA 4RW6A 3TAQA 2D5RA 4ED3A 1JLBA 3T3FA 3CQ8A 3HVRA 4FCYA 4UAZA 8ICZA 5KT4A 1IKXA 1J53A 1ASWA 4KPYA 4HYKA 4N41A 3OYDA 4EEYA 3S9HA 4KREA 4Q45A 4RU9A 4PHEA 3HSTB 5DLFA 3K5LA 1J54A 4OKKA 1WCLA 3M9MB 3ISDA 7ICPA 4CHQA 4DF8A 4PGYA 2HNDA 2P66A 4FZYA 1ZQMA 3BDPA 3DLBA 1S9EA 3TFRA 3BQTA 2E6MA 3RJFA 2BPFA 3AVNA 4YP3A 3KLEA 4O55A 4IR9A 3NH0A 2O4GA 4NLGA 1A76A 4ZH4A 1HNVA 2HHSA 2A1RA 3L2RA 4F5NA 4DLGA 5J2DA 2OPRA 4BE2A 1JN3A 1S77D 4CGJA 3SUPA 4DL7A 3TAFA 3PVXA 5C25A 1S6PA 5J2BA 4M6WB 5TZVA 4HUFA 3KHRA 3DOKA 5DK5A 4RQ4A 3VA3A 3OY9A 1RT3A 4ECYA 5I3UA 1BI4A 9ICSA 3NF7A 4N47A 2FBVA 1D8YA 4NCBA 4YFUA 3PX4A 4CEOA 7ICEA 2R7YA 2AQ4A 3PR4A 2LSNA 4FXDA 5J2KA 3E01A 4Z4IA 4FJJA 4GMJB 1RBRA 4KLIA 2XHBA 4R8UA 1T7PA 3CFOA 1YVUA 1UOCA 4BWJA 4CGGA 4IRCA 5J0UA 1S6QA 5J0XA 3KKSA 3RWUA 4CEDA 4HVJA 2FPMA 8ICMA 3KD1E 1ZQEA 4EZ6A 3ISNC 3OYBA 4E19A 3TQ1A 1SKSA 2R8KA 4YVZA 2DPJA 5KFQA 4CJSA 4CEQA 4I2AA 3AO3A 5KG1A 5DG9A 1S76D 3MAQA 5IIIA 1C7YA 2FLPA 4PY5A 4CF1A 4I2FA 4FZXC 4ECTA 9ICXA 4CEZA 3OYCA 5L9XA 3RJIA 4J2BA 2OPPA 1S1WA 1XI1A 2FBYA 3TAMA 1JL1A 8ICHA 4BE0A 2Z1JA 2G8UA 1O1WA 3GIKA 4KLMA 2BCSA 8ICPA 1ZYQA 2W9CB 3TABA 3RJHA 3V6JA 4DTMA 4O3OA 3SV4A 4XUSA 1COOA 8ICFA 4FZZA 3FYHA 1XO1A 2I5JA 2AQ0A 2PI4A 4UAWA 1RDBA 4K8XA 1N5YA 3V1RA 5DDMA 4FS2A 3QEPA 3AUOA 3QESA 4FM2A 4M6WA 2IMWP 4ID1A 2PZSA 4F2SA 4FJMA 2J6UA 2HVIA 2HVHA 3M8QA 2KFZA 4MQ3A 4MF8A 2O4IA 3H7IA 4I2PA 4ECRA 3IHQB 1RTDA 1QSYA 4Z6FA 2P5GA 4J9PA 4J2DA 3G6YA 1SL2A 1BCOA 3KLFA 4QWEA 4RQ3A 4M2YA 3C1ZA 1U04A 1RBVA 2ZJAA 1ZQVA 1LW2A 5FROA 3OYNA 2YKMA 1HUZA 5CZ1A 4RQ7A 3LP1A 2PFQA 2C2DA 3GIMA 2NRWA 4B9MA 1IKYA 4KV8A 1R0AA 9ICEA 2GUIA 4O5BA 2R8IA 2LYHA 1T4GA 1IH7A 1X1PA 4DL5A 3DI6A 1KLNA 3KJVA 4RW9A 3QZ7A 1RDCA 2XRIA 1RPLA 4F2RA 3EPIA 5L1JA 3NE6A 3MFHA 4O9MA 3AVAA 1NOZA 2KQ2A 3B0YA 2W9BB 3T5LA 1S0MA 4M3UA 3MFIA 3C2LA 4RQ8A 4ID5A 1WCNA 3KK3A 5KFNA 2W9CA 5KFXA 3DLGA 3S3NA 5T7BA 3C23A 3CM6A 4I29A 5KFVA 3V6DA 4C8OA 3NHGA 7ICHA 4LH4A 4P4OA 5HLFA 5J2PA 3EW9A 1Z26A 4EBEA 1U47A 2J6SA 4CJ3A 2VG5A 4K4HA 1JMSA 4K4GA 1RT4A 4F3TA 3AO2A 2C22A 2JEFA 2G8FA 3NCIA 5KFOA 5J0OA 3KTQA 4DSLA 4IQUA 2H5XA 4MFFA 4DQQA 9ICGA 2FMSA 2RN2A 4I2GA 4P4MA 1DOQA 3UXOA 4RNNA 1WSJA 3SCXA 1BISA 1XS9D 9ICTA 4IRKA 3RRHA 2DFHA 5IIKA 3EWAA 3I0SA 2OZMA 1X9SA 3H8JA 4W5RA 2Y1JA 4EP4A 4E0DA 1NKCA 2BQUA 1HYVA 4IBNA 3RH6A 2PFOA 4X5VA 3HP6A 3F9KA 3T19A 5L1IA 5IINA 4JS5A 2BGWA 4IG0A 4IRDA 1VSEA 2OPSA 4YR2A 1BPDA 3U3GA 4CJPA 1S10A 4OGEA 3HJFA 4NCAA 8ICIA 4E7JA 3G6XA 3FFIA 1ZQYA 3AA4A 4RW4A 4QZCA 4ECQA 1ZQSA 2JLEA 4JWNA 2ASDA 3RJKA 4ELUA 1TK5A 1QSSA 4PUOA 1NK7A 5JUMA 4RQ2A 2XC9A 1EKEA 1VSMA 4QW8A 3SYZA 2ISOA 3NH2A 8ICBA 4CGHA 4AHRA 4Z4HA 2JEJA 4NM1A 4Q5VA 3KLHA 3M9OB 1SUQA 2HHQA 3AO4A 3JPPA 4RPYA 4KTQA 2KFNA 4M9NA 3K75D 3ZSYA 5DBBA 4F5RA 3F73A 3JPQA 1ZQPA 3MEDA 3VQ7A 4OPJA 4DTUA 2PI5A 4LSNA 4RQ0A 4F3OA 1ZQKA 3V9SA 2KZZA 1TK8A 4M9GA 4CK3A 1XSNA 2VG7A 4E1MA 2D0AA 3ZSRA 3MABA 3KHLA 3H40A 2IGIA 3KLIA 1KFDA 3I0RA 4FJNA 3ZT4A 2DFEA 1ZETA 3ZT1A 1RCHA 7ICVA 5HMLA 2X78A 3OYLA 3SUOA 4I2BA 4R64A 3KD5E 1FKOA 4RUCA 1RNHA 4CEEA 7ICGA 5KFTA 4DQSA 2W42A 1BPZA 7ICQA 1RT1A 1X2IA 4DTXA 1UA1A 4I2HA 2HNYA 1GOAA 4JRQA 3ZSXA 2RF2A 4FJ7A 3S3MA 2HMIA 4CIGA 4J9KA 4Z4CA 1Q9XA 3RBDA 3GV7B 2YKNA 4OVLA 4GVMA 2G8KA 4DSIA 4ED8A 4DSEA 3AU2A 4H4OA 5CB1A 3RBEA 1XSLA 4F92B 3V81A 2IBKA 3RAQA 4B3OA 4CJWA 5HP1A 1ZQAA 3PMLA 4DTJA 2HB5A 3HPHA 3JPOA 4E7IA 4M3ZA 4QWDA 4ED0A 4RT2A 1NK8A 5KFGA 9ICWA 1DGSA 1CZBA 3VQEA 4M41A 3MEGA 4KLTA 3JPSA 4O3NA 7ICKA 1KDHA 4HTUA 4CHOA 2BPGA 4YR3A 1QE1A 4Q44A 4KLDA 2R8HA 5DGBA 8ICQA 4CJLA 5J2MA 3RAXA 3TAPA 1MSWD 4F4YA 3NAEA 4OLAA 1BVSA 4M42A 1SKRA 9ICFA 4JUZA 2VANA 4M47A 1U49A 4RG8A 4Q8EA 3QNOA 1JLFA 1WN7A 4QZ9A 9ICJA 4UB4A 4DTPA 4BGDA 1KEJA 3C6UA 4CF0A 1SKWA 2YV0X 4FJ9A 3RH5A 4M3XA 2HHUA 8ICVA 3C1YA 2JZBB 4JWMA 1BI4B 3MDAA 4YXMA 2YNFA 3OJSA 4CE9A 4IQVA 1NOYA 1NK4A 4BDZA 3OYEA 4E3SA 5DB9A 5DBAA 4I9QA 1WAFA 1JLGA 1C0MA 2W9MA 3OSPA 2EHGA 1S9GA 2ZUCA 1ZQBA 5KI6A 1ZQIA 2C2RA 3GIIA 3IAYA 2VG6A 3L2WA 4DTSA 2P6RA 4KLHA 1TKTA 4F4ZA 4BDPA 1U4BA 4ZHRA 1TFRA 1JLQA 3AVLA 4CJUA 2ZJ8A 4CHZA 1VRUA 3RB6A 4DQRA 3OVNA 4DTNA 5KG6A 4J2EA 1NJZA 2VA2A 2B6AA 4KHSA 4IQTA 3LZIA 5CR0A 7ICUA 4QWBA 4CIFA 4PQUA 3C94A 4EZ9A 3O3GA 7ICFA 1TL3A 4YD1A 3UXNA 4R63A 1KVCA 4RUAA 1WSEA 3CYMA 4C8MA 3T1AA 2QK9A 4E1NA 1ZBIA 3WNGA 2KZ3A 3HT3A 2BKEA 3OYHA 2WOMA 3RJGA 9ICOA 3QE9Y 3RB3A 1VSHA 4IFVA 1ZQDA 4QZ8A 5KRTA 5D49A 3CFRA 4CGFA 5J0YA 3A2FA 9ICQA 5KT2A 1RT6A 3EZ5A 1RDDA 4M04A 9ICLA 5SWMA 4O5CA 1VK0A 3LANA 4R66A 5HRPA 2JZBA 4CF9A 4DQPA 3QETA 3ZD9A 4GC7A 4ED7A 4CFDA 1FKPA 5KFRA 4KN4A 3ZDAA 1L3SA 4K8ZA 5KFYA 4ECXA 4DL4A 1S0OA 1BPEA 5KFLA 4LZGA 3V72A 4FJHA 4J9NA 1X9MA 3MECA 4I7FA 3VQ6A 2G8WA 1ZQWA 3M8SA 1S0VA 4J9SA 4CGDA 4KHWA 4RZRA 2XCPA 1A5XA 3JYTA 2G8HA 2NRZA 1HNIA 1ZQXA 4I27A 3UQ2A 8ICEA 4ECZA 2HW3A 3Q8LA 3NF6A 3H8WA 1S0NA 2X6SA 5J2CA 2YNHA 2P5OA 2UVRA 1BCMA 4FLYA 2BCRA 8ICJA 4OLBA 4AH9A 4FW2A 8ICKA 4YCXA 7ICJA 1QQCA 1BPBA 2P51A 1BPYA 4TUQA 5BOLA 4UAYA 3HVTA 2BANA 4Q43A 2WTFA 2FMQA 5E41A 3OYAA 4MFCA 3OYKA 2FPLA 1NJXA 4UB3A 1JL2A 1MU2A 3ZDEA 5CP2A 5HHIA 4F4KA 8ICWA 2W8KA 8ICCA 4DSKA 1KFTA 3ZT0A 1UA0A 4JV1A 2ZQBA 4OJRA 3ZSVA 2XY5A 2OYQA 1QSLA 2B5JA 3PY8A 1VSKA 1XHZA 4M45A 4TUPA 7ICMA 4F5PA 4NM2A 2ATLA 1A5WA 3PX6A 7ICIA 4FK4A 3P1GA 4W5TA 3OJUA 4TURA 2AGOA 5CYMA 4KLJA 5KT3A 3DLKA 3THVA 1CXQA 3IG1A 2BHNA 3ZSWA 4Q0BA 3LK9A 2XGPA 4B9LA 1HMVA 1LAWA 4OKJA 2G8VA 4IR1A 1FK9A 5KRSA 1HUOA 4YG2A 3BQ2A 1AROP 3KK2A 2NRTA 1KCFA 3C5FA 2BGGA 5FDLA 5IILA 7ICSA 5KG2A 4CFCA 4FLUA 3L2VA 3RMAA 4M0AA 2W9AA 2VWJA 2PXIA 3T5HA 4YFKA 3L8BA 4DU3A 3PO4A 3MXJA 1TV9A 1HYZA 2BQRA 4M9HA 4YMMA 4AHTA 2KZMA 2F1HA 1HPZA 4O3RA 3GIJA 4ICLA 4QZBA 1ZBFA 3IRXA 3N97B 1XSPA 3BGRA 3KIOA 2FBTA 3QINA 4B8AB 4F93B 4QZDA 3QO9A 3DM2A 1EXQA 4CFAA 4PHDA 1G15A 2RPIA 5KFZA 4RT3A 1FXXA 3JPRA 2J6TA 5KFCA 8ICRA 3ORYA 4RQ1A 1HQUA 3M8PA 3H4BA 9ICRA 4IKFA 2X74A 3DYAA 4EYIB 3OYIA 4I2QA 4O5EA 4H4MA 3PV8A 3TAGA 5J2AA 2ASLA 3VQ9A 4FS1A 1GOCA 3VQDA 4CF2A 4DL2A 5DB6A 1RTHA 4LD0A 4F4XA 3PMNA 4EBCA 4IFYA 1I3AA 3T5KA 2QKKA 4GW6A 3Q8PB 1MQ2A 5F9LA 5DQIA 5IIMA 2AJQA 2RDIA 3OS1A 4CEBA 4DMNA 5DQHA 4KLUA 2HHXA 3AVGA 3RR7A 1KRPA 9ICKA 1ZQUA 3AO1A 3ASMA 4IQWA 4WE1A 4P4PA 4P2HA 2HHWA 4E7HA 1EXNA 4DU4A 4J2AA 1S1TA 1ZBLA 4J9MA 1WNSA 4FLZA 4Z4EA 8ICXA 3ALYA 1K1QA 5DQGA 5FRMA 2ZTDA 3ZSOA 1KTQA 4NYNA 5CA7A 1L5UA 1WLJA 1KVAA 4FK0A 2F1IA 2VA3A 2PFNA 3PW0A 1D9FA 1ZBUA 2Z1GA 2E4LA 2YNGA 1B9DA 4PGQA 1TKZA 4I28A 4F4WA 3D0PA 5HROA 4FLXA 1X9WA 1ZJNA 3ZDCA 5HRNA 2IC3A 8ICTA 1T8EA 4FW1A 3QEXA 4EYHB 1HRHA 1RTIA 4NY8A 2DFLA 1WSFA 4YXJA 1VSIA 2WONA 5KG5A 1QS4A 1MC8A 3AO5A 3VQ4A 5J1EA 3NF8A 3LP0A 4DL6A 1VSJA 5J2EA 1SZPA 5SZTA 1KVBA 4CFBA 5J2NA 1BQMA 1RBUA 4KTZA 3WNHA 5DLGA 4B08A 3TAEA 2PY5A 5HHHA 2JGUA 1WSGA 4ELVA 4O0IA 2W8LA 4KHQA 8ICLA 1JXEA 3LWLA 2MAXA 3SPYA 3JPTA 1BL3A 1K6YA 3PUFA 1NK0A 3NGZA 4QW9A 4FBUA 2P1JA 3AVIA 4KHUA 3NH1A 2JEIA 1KSPA 4RW8A 3RTVA 4ED6A 3GV8B 1ASUA 4R5PA 3QEWA 3K4GA 4DOBA 3ZDDA 5DB8A 1BIUA 1Y97A 2HNZA 2D0CA 4BXOB 3ULDA 3N4MB 1VSFA 1VSLA 4H8KA 4DFMA 4N76A 1B92A 4MF2A 4MFBA 5L1KA 9ICBA 3V9UA 4PPXA 4CJVA 4KLEA 3K5OA 2GV9A 3Q8SB 4CK1A 3ISBA 4QWAA 5DG7A 3L2QA 5D4BA 5JS1A 4FJ8A 5C42A 4CEFA 1ZQHA 1ZQOA 3AU6A 4NYFA 3DMJA 5KTQA 4GC6A 4YMNA 1ZBHA 3K2PA 1BHLA 4UB5A 3C2MA 1ZQTA 3B6PA 9ICIA 4CIEA 1C1CA 2F96A 4KHNA 2AU0A 3AVFA 4PHAA 5DDYA 9ICPA 1BPXA 2V4RA 1JLCA 3AVBA 3OS0A 4KB0A 4OGCA 5KT5A 5J2IA 1UT5A 4CJRA 5KT7A 3K5MA 3WNFA 4CHYA 4PHPA 7ICNA 1B22A 4B9UA 3HK2A 4DFJA 4Z6DA 4DFPA 4DSFA 1S97A 3RRGA 3B6OA 4XA5A 1CLQA 4I9LA 2FLLA 1C1AA 1U9LA 4KTWA 3JPNA 4NLNA 3MXMA 2IDOA 4YD2A 1HQEA 3E2EA 2BQ3A 1REVA 1ZQCA 4UB2A 1J5OA 3VQBA 4DL3A 3NBPA 5KFWA 2XY6A 1T05A 2RDJA 3BJYA 5J2JA 4C8LA 1CXUA 5KGWA 4CJKA 3OHBA 3OHAA 4IDKA 3V9XA 1NKEA 3KHHA 1PZNA 4BXOA 3NDKA 3UQ0A 4MFAA 5KFUA 3RMCA 4JV0A 3OYGA 3PO5A 3DRRA 3LDSA 3LAKA 2DFFA 1HJRA 3L3VA 1A5VA 5HBMA 3GILA 1XC9A 3DLHA 4RPXA 3QNNA 1QTMA 2ZE2A 2R8GA 5J0QA 4HHTA 3DLEA 4J9OA 2ALZA 3PR5B 4CECA 4OKEA 4M3WA 3GFKB 1UT8A 3V7KA 1H38A 4ED2A 8ICOA 2BDPA 3H4DA 5J0TA 1L3UA 1SV5A 3H08A 4BDYA 5KT6A 1IXRA 2YHAA 3KLGA 4G1QA 3LAMA 5HMMA 3VQ8A 3Q8QB 4RW7A 1JXLA 4IG3A 2F1JA 4CESA 3PW2A 4J9LA 4W5OA 2P6UA 3PW7A 2PYJA 4O0JA 2G8IA 4DQIA 2KN7A 3MGHA 1C6VA 4KHYA 3Q8RB 9ICCA 4EBDA 4ECUA 1W9HA 1MQ3A 1VRTA 4O5KA 3HX0A 1KLMA 3K5NA 4DWIA 5KFIA 1UWBA 3TFSA 3RR8A 1L3VA 2DPIA 2DTUA 5KFMA 3WNEA 1RXVA 3UIQA 4B8CA 3U3YA 1ZQFA 4ECWA 4Q8FA 3C6TA 2JEGA 1LV5A 2BCVA 4GXJA 5HRSA 4DOAA 3Q8KA 1ZQZA 5CHGA 1ZQLA 5D46A 3H8SA 2KTQA 1S1XA 3M9NB 4DTRA 1RZTA 4QZFA 4W5NA 5IIOA 3PW5A 2ZUBA 4O3PA 1Z3EB 3UXPA 1V9PA 1XHXA 4O3QA 4OPKA 3RJJA 5J0RA 1NK6A 3QZ8A 4CERA 4XRHA 5HRRA 5FRNA 1EETA 2V4QA 1HJPA 4JS4A 3O3FA 4F8RA 1L3TA 1GOBA 5C24A 1LW0A 3TI0A 1Q9YA 4KI6A 3ZD8A 4CHNA 4F5QA 3QEVA 1RT5A 3I8DA 2IHNA 1IO2A 5DG8A 4C8KA 1WSIA 2IOCA 3HW8A 3SV3A 4AHCA 1C0UA 4KRFA 4EP5A 4L8RB 1UAXA 4W5QA 4LVSA 1CEZA 5HP4A 2ZTEA 1TGOA 2YHBA 2D0BA 2ITGA 1TVAA 4FVMA 3GDXA 2ZJ5A 1ZQGA 1VSDA 3ZSQA 3K58A 4DU1A 1DLOA 4AILC 5I42A 2B4JA 4GXIA 5EWGA 2FMPA 1BQNA 5KFKA 3HPOA 2IAJA 2FC0A 1RYSA 3MEEA 4CJ5A 2BR0A 4YR0A 5KG3A 1D9DA 4JLHA 4O4GA 2I9GA 4J9QA 2C2EA 4E89A 3VN5A 2HHTA 4KB1A 2OPQA 4E7LA 4DTOA 2FBXA 3IM1A 4LY7A 3U6FA 2KW4A 4QWCA 4PGXA 4FLTA 5KFFA 5F9NA 1RYRA 3LPUA 1LAVA 4HUEA 3V7JA 3VQAA 1IM4A 4DEZA 1IG9A 4MEYA 3MR6A 5J2FA 3O3HA 3QEIA 3O4NA 2VA8A 2HHVA 1ZQNA 4XIUA 3MDCA 5KFJA 8ICAA 1SL0A 5BPCA 1JLAA 4R65A 3GV5B 5KFBA 1RILA 3SUNA 2ATQA 3AVCA 4YN4A 5EWEA 3B0XA 4FJGA 2Q3SA 1LWEA 4NLKA 4KMUA 3AV9A 1U48A 4KLFA 3JSMA 5J29A 2AGPA 3MGIA 4ZTFA 3V6KA 4C8NA 5KG0A 1JX4A 8ICYA 4YNQA 3ZT3A 4O3SA 5KFHA 5KGXA 2ISPA 3MBYA 3HM9A 4E7KA 3RB4A 4FLWA 4PH5A 2ETJA 3HXMA 2R8JA 4DS5A 4B9VA 4CJQA 2QXFA 4CHPA 4KLOA 4JK1A 3SI8A 3DLRA 4O44A 3VQPA 4QOZB 4GLXA 3MR3A 1JIHA 1EX4A 3G10A 3UPQA 3AVHA 1NJWA 3HL8A 1RBSA 3NGDA 4TSXA 5J2QA 1TAUA 2M9NA 3QIOA 3OS2A 4RQ6A 3AA5X 4DG1A 3DOLA 1TL1A 1HYSA 3ISCA 2OZSA 2AGQA 4YMOA 2Y1IA 3AA2A 3MXIA 5J0PA 2XGQA 4KFBA 3RH4A 3LWMA 1TVRA 4B9SA 4I2DA 1YTUA 5J2HA 1RTJA 5IIJA 1D8LA 5CWRA 4CJEA 3PNCA 4FJIA 3VQCA 3L2UA 1B9FA 3V1QA 4UQGA 5CZ2A 4NLZA 3ZT2A 2UVUA 4KI4A 4ECSA 2PFPA 5EWFA 1TKDA 3KHGA 4KLLA 1LWCA 1ZJMA 3SQ4A 3BQ0A 3CFPA 4CCHA 3PW4A 2XY8A 4PA1A 5CY4A 3QEBZ 4QZHA 4RPZA 4DS4A 1T3NA 3LP3A 3VQQA 4Z4GA 2I1QA 1BIZA 3G6VA 1ZQJA 2GBZA 2BCQA 5CJ7A 5EU7A 1TV6A 2NRXA 4JV2A 3ZSZA 4F91B 3NF9A 4KKOA 4FYDA 1Z00B 8ICNA 4RNOA 3SQ1A 4XQ8A 4LSLA 5KFPA 4K4IA 2IS3A 3P5JA 2UVVA 4ZTJA 1RBTA 1N56A 4I2EA 3L3UA 3O4QA 5KFSA 3C21A 3QLHA 4FM1A 4TUSA 4I2CA 1EP4A 4CK2A 5EOZA 4CF8A 3OGUA 4QZAA 4FO6A 3MR2A 4DOCA 4UB1A 3OSNA 1T03A 1ITGA 1F21A 5K14A 8ICUA 4N5SA 3KKRA 4BE1A 3LALA 4QAGA 1QHTA 4YQWA 1A77A 1RDAA 4HUGA 3Q8MA 2DY4A 3V7LA 3HP9A 5DKWA 2A1SA 4Z0UA 1XWLA 4FJXA 5J2GA 5BOMA 2BCUA 4CJTA 3SNNA 3ZCMA 2B21A 1ZQQA 2A1JB 1W0HA 1N48A 9ICNA 5J0WA 4KLGA 4B9NA 3MR5A 2W9BA 3V6HA 2BE2A 1K1SA 4LH5A 2X6NA 4FJLA 1U45A 5JS2A 2XY7A 3SQ0A 9ICAA 4Z6EA 2QKBA 4ELTA 5KG7A 4AHVA 1RT2A 1NOMA 3CG7A
chains in the Genus database with same CATH superfamily
4PXDA 2WRMA 5DGAA 1UEVA 2IHMA 2O8DB 3QIPB 4PZNA 4Y2IA 5AQUA 4DR7J 1ACMB 3C66A 4R25A 3RJEA 4KAZA 4WK3A 3EPGA 1VQOS 2F44A 2HRUA 3TANA 2OWOA 4RPFA 1D5AA 4AUKA 3HHLA 2UUAK 1XNQJ 3CJ5A 3H1VX 1Q8IA 2ZG6A 1WELA 1JXBA 5ALDA 3TR8A 2RU3A 2DH9A 4FWQA 2JH3A 4JRPA 4OI3A 2VFVA 2DGTA 3GYXB 3M1YA 3KYLA 2J0SD 2BKNA 3JTOA 3AEVA 2RQKA 5ALYA 3EY1A 4X62F 4JV5F 2LBOA 1KQKA 2DNZA 4WFZA 5HVFA 4LUBA 3H1QA 3G71N 4TQSA 2ASPA 1QZ6A 1LWFB 2YX1A 3VA0A 5DZ6A 4YEAA 3VF4A 5LMNJ 3G0ZA 2Z1IA 1TAQA 3W9IA 2W4CA 1DTQB 1N6QA 4RQ5A 2HBRB 2CQ2A 5ELZA 1IKVA 2MDAA 2RP5A 1HL6A 2DNKA 3MM9A 1N62A 3CERA 4EO8A 1NGJA 5HQLA 3KLGB 4ANCA 2XICA 1YRXA 4OX8A 2CJXB 4CH7A 5E5NA 4C23A 2U1AA 3RZAA 1JLEA 2KJVA 2VJ5A 1KFSA 1HQ2A 4ZPWR 2ZD1A 1WI8A 2W11A 1NK5A 2NUBA 4QNLA 3CJ8A 2JZ5A 2X3GA 3V4IA 2VQEK 2Z1HA 1YT3A 1KLMB 4CNQA 3O6WA 4CLZA 1O5JA 3H2LA 3MM8B 5F8JA 3R5BA 3ZX0A 1B43A 2NLXA 3LOUA 3AXKA 1S1UA 4M63A 3BF4A 1U0HA 3BYRA 1WWHA 1CULB 5FLXY 5EE3A 4USAA 5LL6d 3IN5A 1N32J 3UKUB 5M1KA 2YH0A 2Z2ZA 1D0EA 1SIWB 3D9BA 1NUEA 1MMLA 1CJVB 3GOIA 3HYFA 4HCCA 4DSJA 2EH9A 2DNRA 1L6NA 1EQ0A 2BV3A 2GA7A 2O8CA 3FDSA 3CD5A 2U2FA 5EGYA 1JKHA 4KLQA 4DU7A 4NB4A 4Z6CA 1F5BA 2MUTA 3VQ5A 1BU6O 3G4SS 2V9KA 5AKHA 3LDAA 1S1VA 3A8YA 3NS5A 1Z1BA 1NB2A 3FZ2A 2GO9A 2ZTCA 4M9LA 2IDEA 1JJ2M 1YJNN 4OJ3A 4M3YA 2IM2A 3BM7A 4FYXB 4C2MA 2LCWA 1FRHA 3OL9A 2EX3A 5HNKA 3CJ2A 2ITMA 1B99A 2LEBA 4P0PA 3SPZA 4K4YA 2IA6A 3CMEN 7ICOA 1I39A 3FCWA 1HNXK 4M9JA 3S3OA 4B1XB 2DCUB 2ZH5A 2CQDA 1C0UB 4NL9A 2HFUA 3MMCA 3N9UC 5D4NA 1AFIA 3PIPL 4OHXA 1S6QB 1RXWA 4GKKF 4E8UA 2PYLA 2VKQA 3X3UA 4RW6A 1MWQA 1SQGA 1JLBA 2ZZNA 2Y0SD 1YRUA 3FBFA 1ASWA 4N41A 2OIHA 4Q45A 3NGKA 2E8AA 1WCLA 2WAQC 3M9MB 4DF8A 4PGYA 2K8AA 2A10A 1HEKA 3DLBA 2O8BB 3UE5A 5KL1B 2E6MA 2CQIA 1OH6A 1EKRA 3DRYA 2P9EA 3SAHA 4D3GA 2FI1A 1FE4A 2BPFA 3CJKA 4YP3A 3IM8A 3NH0A 5TISU 2W2MP 4NLGA 3CC4N 4ZH4A 1VQ6S 3SJHA 1HNVA 3CJ3A 1O03A 4H5NA 1IBMK 1RLDA 2ILZA 2A1RA 3L2RA 2OPRA 5BN8A 1N33J 1H0HB 3C2PA 1SH3A 2A19A 2CZ9A 3TAFA 3PVXA 1L7PA 5C25A 2QE5A 1YAGA 2JV3A 3DEEA 4AD6A 4QJVA 5IXUA 3QT8A 5AQGA 4RQ4A 1RT3A 3FAHA 4AXJA 2Y1RI 1G2EA 1BI4A 3D67A 3MUVP 3R6LB 1FKAF 1VR6A 2VBWA 2F5GA 2E44A 3WEEA 2B51A 2LSNA 2XYGB 4JI2F 4FXDA 3KUHA 4QIEA 2HFVA 2ZVSA 2XZDB 5ETNA 3IG5A 1RBRA 2K8BB 2XHBA 3CFOA 1YVUA 3NVYA 1UOCA 1PAUB 3CDUA 1LW2B 2HSEB 4JOUA 3ZZZA 3VGSA 2VHGA 2HHHF 5J0UA 4JI3J 3TSPA 2YMLA 2HFSA 4FNHA 2FPMA 4F3QA 4EZ6A 3ISNC 4E19A 1SKSA 1IKYB 4OHWA 4A59A 3I4PA 2AMCB 4YY3K 5KG1A 4O8KA 3J80Y 2DUYA 4PL7A 5KPTA 1C7YA 4Y2XA 2L9WA 1CPZA 4NEYA 4A8KA 4FZXC 4RW9B 2Z0GA 3IV6A 1XMQK 2OPPA 5K9FA 1XI1A 3TAMA 3KWIA 4Y2QA 2FVRA 2QI2A 2V51B 4JK8A 5HMYA 3WDOA 3THYB 2G8UA 3GIKA 8ICPA 4ID5B 1CS4A 2MKHA 4UOFA 2E66A 4WU2A 4XH1A 4F71A 2CQ1A 4O3OA 3SQGB 5HMZA 5E3PA 4WFYA 5F8GA 4XUSA 3ULEB 8ICFA 3H90A 4JN4A 1U8SA 1LWCB 3ET6B 5F41A 2UUAF 2AQ0A 1RT4B 1RDBA 3BF3A 3CCVN 2YB4A 2FJBB 5JVHQ 1I51B 3AUOA 2KVQE 2ZKUA 4FM2A 3ZLJA 4MO4A 1ZOTA 2UXBK 1TUWA 3AQFA 5C2CA 2FJVA 3GJRB 5DM6Q 3SCIE 2HVHA 3M8QA 2KSOB 2VBYA 1YJ9N 2PIIA 2BZ2A 1IBCB 4M5NA 5C2GA 2A1AA 3IHQB 4J9PA 2MLXA 4IOAL 3NL0A 1G3OA 1WD6A 5JXSA 1DJ0A 1SL2A 2HI0A 4QWEA 2P8IA 4ZPTR 3MCPA 5DM7L 2CQCA 4M2YA 1N5WA 1RAHB 5F8NA 2EFVA 4QPTA 4FYVB 2OPSB 2RUSA 3P39A 3QLHB 4K4ZA 5CEHA 3F2BA 1OYDA 5ALSA 5K8NA 5JLFA 2CWKA 5GADU 2NS1B 2C2NA 2YQ0A 3O9QA 5AQLA 2H3IA 2YB1A 3UN5A 4O5BA 2R8IA 2LYHA 1T4GA 1SJQA 2GELA 3NMAA 5JICA 1IH7A 3DI6A 4KH5A 1KLNA 4US9A 3T6JA 1NNLA 3QZ7A 2XRIA 2KKZA 5AFUH 2ZH6A 3E9PA 2FDNA 3BEGB 1Q81O 4LF9F 3NGSA 3BEXA 2FVQA 4O9MA 3AVAA 2C3PA 2RT3A 1X4BA 2BE2B 3BBFA 1UETA 3C2LA 1JUDA 4LQ3A 1KL9A 1WCNA 3KK3A 4BC5A 1HKBA 2DRDA 2W9CA 3DLGA 5JLHA 3SIPB 4YB6A 3ZETA 3NHGA 3HZ6A 2GJ2A 3KK7A 3CJBA 4P4OA 2VUGA 5J2PA 1Z26A 1LQ9A 4XK8C 4CJ3A 1P1LA 4F25A 1JMSA 3CI5A 3KTQA 4USUA 4DSLA 2QWQA 2H5XA 3OVAA 2NXEA 4NRUA 3BZCA 1WKJA 5AXLA 3FBBA 4XTTA 4EFHA 4P4MA 3CMAS 1BISA 4C97A 1XIQA 3WKBA 4CM0A 3EWAA 3AY9A 3CCWA 4J9VA 2Y1JA 2QC3A 2YCHA 2VODA 5HQMA 2EDUA 4DKWA 4IBNA 3RH6A 1VQ7N 4DN0A 2HHPA 2IVMA 1TELA 3F9KA 1Q7YO 4JS5A 1Q7YT 2BGWA 2CQ4A 1TR0A 1HNXF 2Z4PA 3VCBA 3QJPA 1BPDA 3AM9A 3HJFA 2OAUA 5D4PA 3UN2A 4WTYA 3A4TA 2ZXIA 4HDHA 2Y3YA 4NLCA 4QZCA 4ECQA 4DZ6A 4XPCA 4H4OB 1QSSA 5HMXA 2GEMA 4B3OB 4DPOA 2RUGA 3U4LA 5U47A 1VSMA 8ICBA 2HWIA 2V8VA 4KHRA 5FLXO 4ETXA 4OLPA 4Q5VA 3RUBL 3HKZF 1PJ7A 3FVYA 1XQIA 1BA0A 3JPPA 4H0TB 4YB1P 4IS7A 1WTFA 4FKXA 5DBBA 2RSQA 2DISA 2X1FA 4CQ1A 2VICA 4GVLA 2EBGA 4ZVUB 1QE1B 3GG4A 4DTUA 4TN2A 5CAAA 1U8WA 3MWPA 1Y5NB 1XMOJ 4CP5A 1IBMF 5BPLA 4FNIA 2FXUA 4DPUA 3RVCA 3SDEA 1ED1A 4PWUA 4USMA 2KZZA 4M9GA 4KQZA 3D66A 1I94K 2IA0A 2VG7A 2FD2A 4E1MA 3MABA 3KLIA 1ZD3A 1HI0P 2QSFA 1U2FA 2I0XA 1HWKA 1Q86T 1Q86O 3ADAC 3RFAA 3OYLA 4DR2F 4I2BA 2N1RA 1FKOA 4JB3A 4RUCA 2HAFA 4AP9A 2NXNA 1ESVA 2HCFA 5KAKA 7ICGA 2W42A 3SMVA 4G6VB 2OFGX 5DDQC 2V8PA 3PIOL 1FFWB 3L7OA 4K5RA 4I2HA 3EN9A 4MIAA 1RXOB 2E2OA 3O1WA 3GL1A 2HMIA 4IQMA 4CIGA 4J9KA 2KN4A 3ENBA 2OSQA 1Q9XA 4UOGA 3RBDA 2YKNA 3UQSA 2WUSA 4FPAA 5HSPA 1DQ9A 3DC2A 4ED8A 4DSEA 2I6WA 3RBEA 2D0OA 3UN3A 4F92B 2P9PA 2VG6B 3AGKA 5HP1A 1VS3A 3HMJG 5F8MA 1K5OA 1NO8A 2UUWA 4O4RA 3JPOA 4M3ZA 2N3LA 1MROB 4ZP9A 2M0GB 3IFEA 2D1CA 2BA9A 3AGRA 1N2XA 3MEGA 4KLTA 4TLQA 5KOXA 2B6AB 1QD1A 7ICKA 3VOVA 3C19A 2ZUAA 2EVZA 2UXCF 4Q44A 3BPDA 1IQZA 1FJEB 4CJLA 4MN4C 4QIFA 1HA1A 2WHOA 3PKYA 2ZBRA 3TAPA 3HJVA 1X66A 1UJ5A 1SKRA 2HF4A 3ATUA 1NHVA 4LJMA 2YXLA 4M47A 4RG8A 1U49A 1CJKA 4Q8EA 3QNOA 2WOMB 1VJQA 2UXBF 2GHWA 3P31A 9ICJA 4DTPA 1RWNB 3DOMA 2ZHBA 4CZKA 1KEJA 3CCRS 4IO1A 3T1YJ 3C6UA 1RWUA 2QLTA 1FWLA 2YV0X 2XMWA 4X4QA 1QAXA 1WBDA 1WG4A 1X9JA 3RH5A 4ZITA 2HHUA 4P74A 4CDIA 3A5LC 3C1YA 3AOCA 5I3UB 2GX8A 3G9CA 2JVRA 4EK2A 3P5BP 4OHVA 1VQ5S 2WB1C 1CI4A 4IQVA 1NK4A 4IEEA 3M1VA 4BDZA 3J80O 3OYEA 5DB9A 5DBAA 3OTQA 4X64K 1JLGA 2CH5A 2BYCA 2P5VA 4A48A 2RE1A 1S9GA 2K1RA 1ZQBA 1U2VA 2C2RA 2KVSA 3UD3P 3BPSP 2WF7A 5EX3A 5EOYA 4F4ZA 4BDPA 2J0XA 1U4BA 3N6NA 4YS2A 4ZHRA 1TFRA 3TP2A 3D2EB 3T7ZA 4H4KC 4CBWA 3K89A 3HULA 4CJUA 2AKWB 2YNHB 3OUYB 1VRUA 3AODA 1UVLA 3OTDA 4DV6F 3NOCA 2ZVIA 2F2AB 3J7AP 2VA2A 3QYPA 1GLLO 1N52B 2NZ4A 1T94A 4ZKAA 5HAOA 3EM1A 7ICUA 3RRKA 4PQUA 4X62J 3C94A 3WIUA 4JV5J 4EZ9A 1OSDA 3QNWB 1VQ4S 2J9DA 1HBUA 1X5PA 4QIWD 3N7RC 3KJFB 4GY2B 1WSEA 4FOIA 3ZTOA 2VB6A 1VCTA 3WNGA 2ZIUB 2YY6A 1CBKA 4CI6A 3HT3A 3JAMU 5AM0A 3VAIA 9ICOA 2Y9HA 3LDNA 4ZJQA 1ZQDA 3CFRA 5D49A 1N5YB 4OZ3A 4CGFA 5AQZA 4JI8K 3MURP 3J8AA 2YKOA 5KT2A 4J37A 3VGMA 5KOWA 2ZGZA 5SWMA 4O5CA 1VK0A 3JTPA 4NLDA 3DLKB 2KK0A 4ED7A 3ONNA 3T69A 4LRBA 3QX7A 3E8OA 5A8RA 2MQOA 4FJHA 2HVDA 3KK2B 1X9MA 4I7FA 1ZQWA 1S0VA 4J9SA 4GVBA 4FF1A 4CGDA 4KHWA 4RZRA 2ZBQA 2KT5A 3D2FA 1HIWA 5GAHI 3DDIA 5C0YA 2W24A 1PKUA 8ICEA 4USVA 2HW3A 3Q8LA 2PMWA 3NF6A 3H8WA 3CCMN 5J2CA 1IIPA 4FLYA 4DCJB 4H0YB 4AH9A 1H73A 3BGRB 7ICJA 1QQCA 5B0FA 4WFNQ 3DM2B 3HVTA 4NLSA 2WTFA 5E41A 4MFCA 4PXEA 1JL2A 2GMLA 5AZIA 3DHXA 1JJ2R 3L3FX 3NS6A 2DH7A 3GWCA 2G5IB 1I94F 2O3DA 3HOTA 3V6DB 3GU0A 1HX1A 3DDNA 4IXCA 1KFTA 3ZT0A 3GJSB 3U1MA 1UA0A 4OJRA 1Q46A 4YOUA 3PY8A 4U8YA 1VSKA 1XHZA 1P8ZA 1FFUA 4URQU 2ATLA 1A5WA 4GKKJ 3UPFA 3PX6A 5HATA 2IJFA 2FZKB 3OJUA 2YTUA 4TURA 3O8MA 1T3OA 3I0SB 4PPZA 1FT8A 3WXLA 3LK9A 1PC5A 2E5LK 5THWA 1UKUA 2ZWOA 4WE1B 5FJ4A 5TKWA 2CPXA 3H0RB 4USWA 2NRTA 1NGCA 4FLUA 3L2VA 2VWJA 2KM8B 4YFKA 4HT7A 2BQRA 4M9HA 2VOPA 2GQCA 2KZMA 1HPZA 3ULHA 4LF6K 2ZOGA 4OV1A 2YWGA 4ICLA 4P52A 4ZS6A 3CIMA 2JLFA 3FC9A 4OYOA 4PUOB 4F4AA 3MXHP 1IWAA 1XNRK 3BKFA 1XSPA 4F02A 4OZ5A 2ZJPL 2YNGB 1RU1A 4QZDA 5IQQA 4N8OA 2M4MA 5CZVA 4K5SA 3VTIA 4CFAA 4PHDA 1V3ZA 4IQXA 4FOEA 2G0JA 3NMRA 5AKKA 2I7NA 3ORYA 2QARB 3KG4A 9ICRA 3OYIA 4JI2J 4O5EA 1RQLA 3EE9A 4H4MA 4ZPCA 5J2AA 3MTJA 4WZQA 4FS1A 5EX0A 4CF2A 2PBDA 2NXCA 1NZ8A 5ADXH 3M6WA 2HHHJ 1BQMB 3QDKA 3T5KA 3SR6A 2QKKA 1VC0A 2AEJA 2DQNB 1TL4A 2MRLA 3HSCA 4CEBA 2VKRA 2Q97A 2YPYA 4OQJA 2FE9A 1HNZK 4L6V3 2MLZA 3L4IA 3QT7A 1ZQUA 3AO1A 3O44A 4HACA 1WOQA 3R3LA 4P4PA 2DB1A 2JLGA 4FN5A 3FUYA 2AJFE 2W7OA 4FLZA 1YI2S 4ZVPB 5IV4A 4Z7CA 4MFBB 4YOWA 3VAKA 5AI8A 4NYNA 5CA7A 1WLJA 4FK0A 5HR6A 2QLXA 2VA3A 2XO6A 3PW0A 1N0VC 4I56A 2UUAJ 1GXTA 2P35A 4DV7K 3AOBA 2DGVA 2E4LA 1V4TA 4OHYA 1CSJA 2HIYA 1YRTA 1B9DA 2QTWA 1TKZA 3D0PA 3NKYA 3CJ1A 4LBIA 2EC0A 2PFDA 3HHKA 3OBYA 5HRNA 2IC3A 1Y3KA 1JCEA 2R18A 4FW1A 5I3PA 1HW8A 3OTOK 4EYHB 3H45C 1RTIA 1WYGA 3A8KA 1IR2A 1XEZA 2IJNA 2DFLA 1CZAN 4KHPF 4HHHA 2YY3A 2WONA 3CCLS 1G6BA 1KAZA 1MC8A 2P9IB 3VQ4A 3DV9A 4AM7A 2RDDA 4DL6A 3C7NA 3MCNA 2EKYA 1MWZA 4DR5J 2MKKA 4BR0A 1SZPA 2MY7A 1Y0HA 5EN1A 2N7CA 5J2NA 2KHOA 1LCUA 4KTZA 2P2CB 1OWXA 1DFDA 4C1NI 4JI8F 4B08A 5AE1A 2RQCA 4IUFA 5HHHA 2DD8S 1HNWK 1WSGA 4O0IA 1IJJA 4KHQA 8ICLA 1B70B 1JLFB 1K6YA 2VPWB 4QW9A 2ROGA 4CLKA 3KWMA 3NH1A 1T05B 5AXKA 1KSPA 3VGUA 4ED6A 5E3QA 4TY9A 1ASUA 1PK3A 2ASMA 4LF9J 5HO4A 1EAYC 3ULDA 3SENA 4IDHA 2F8HA 5BJRA 4ZIVA 2GQ2A 3I9ZA 4CWBA 4NLOA 1V3RA 2YQ3A 3BS5A 1QH9A 1UFKA 1HBMA 4CRXA 4CDGA 2DO4A 4QYZK 9ICBA 1XBWA 3OA9A 5HBMB 3Q24A 4KLEA 1YIJS 2ZZMA 1ATRA 1WKLA 3Q8SB 1VQNN 4NLWA 3EWGA 5DG7A 3LDOA 4FJ8A 1IR0A 1Z2LA 4NYFA 2QKQA 1R3NA 2OHDA 2MQMA 1J6ZA 1JLQB 1ZBHA 4UB5A 3C2MA 1E6YA 9ICIA 2BM0A 4CIEA 3UMGA 2FVSA 2CZVC 1TMJA 2WF6A 1SGGA 1C1CA 3OT9A 4HVZA 4NXNK 4WP3A 4PHAA 3AVFA 2F4VK 3D1HA 3AVBA 1BPXA 2V4RA 3E3XA 4JI6K 2M52A 1NM1A 5FIIA 5KT5A 3TSUA 5J2IA 3BSAA 3QUCA 4MKYA 5E3RA 3WNFA 4CHYA 1HNXJ 1H98A 2DKOB 3KNGA 4CIOA 4DFJA 4JI0K 1ZA1B 4F72A 2NLWA 1S97A 4CTAA 3B6OA 1M5PC 3VEXA 1FIQA 2MMYA 3FKBA 4KTWA 1IBLK 2HFNA 1Q79A 1ZQCA 4UB2A 1REVA 2A2CA 2FJDB 1J5OA 2RQ5A 2LYVA 1N34K 2QW9A 1UWAA 2NZTA 3BJYA 4OD0A 4F0HA 2CJYB 1CXUA 4CLPA 1RT6B 5KGWA 1H2VZ 3UDEA 1RABB 1QTNB 1RAOA 3RMCA 2L5YA 2DNNA 1FKPB 1LNQA 1N5VA 4M5LA 4Y2CA 2PFFB 2CZ4A 2I9SA 2DGZA 1NPPA 2DGOA 4G1PA 1H74A 3F5EA 1S57A 1HJRA 2ESEA 2F3JA 4RPXA 4LF6F 1WC0A 3QNNA 1FNOA 2F7VA 1LW0B 3LO3A 1XNRF 1R6VA 4CECA 4OKEA 4M3WA 4ZOSA 4KR0B 1H38A 1JB0C 1B0PA 4ED2A 2N7YA 3OPXA 2MZTA 3AJDA 8ICOA 3EVWA 3H4DA 1L3UA 2ADBA 3DFEA 4RUBA 4BDYA 4UW2A 2HZCA 2RS2A 4DR2J 3I8BA 3KLGA 3LAMA 5HMMA 4H5VA 3VQ8A 4OYAA 3Q8QB 4RW7A 2Q66A 2F1JA 3S8SA 3BH7B 2HK3A 3PW7A 1DLOB 2CRXA 1JCFA 5I42B 5GAGI 2PDAA 2HQGA 1C6VA 1GAOA 5GIOA 4YN3B 3QU7A 9ICCA 3S1TA 1MQ3A 1VRTA 3J7AN 1ZD2P 1RBAA 3AXMA 1KLMA 5JRTA 4O4GB 2I5HA 3TFSA 3MM8A 2DPIA 4K50A 3H8YA 3GDQA 1BXNA 5AK4A 3QATA 4JP8A 1V38A 1Q78A 3RBZA 3W65A 2HBMA 4B3RK 1CULA 4CE6A 3R27A 4GXJA 4DOAA 3UKUA 3FSIA 4ZMMA 2NPFA 2PMZD 4NOHA 3H8SA 2KTQA 5CYMB 2DEIA 1S1XA 3E66A 1OUQA 4ILHA 4QZFA 3A0HU 5IIOA 4UW9A 3UXPA 5CZXA 1XHXA 5E3AA 4BQLA 4ZPVR 1UMJA 4XRHA 5HOOA 1EETA 2UXCJ 4L73A 5FDLB 4AL6A 5BREA 4OX7A 4NYOA 1NWKA 4DR6J 1KQQA 1U0SA 4DV7F 2LXUA 4CHNA 4F5QA 3QEVA 3LPYA 2GJIA 2VPZB 2ZIWA 3I8DA 5AKIA 4BRMA 4WXOA 2Q1LA 2F40A 2NYHA 2L9DA 1WSIA 2DRAA 3M6GA 2UXBJ 5AKJA 4MDBA 3IRXB 4KC5A 1ZZFA 3D4JA 4HLBA 1C0UA 2GAGC 3OTOF 4KRFA 3NVKA 1KHWA 5HP4A 3M6ZA 3GE9A 1TGOA 2YHBA 4LRDA 4RQMA 2KKPA 3QO9B 2D0BA 2VU5A 4URSA 2ITGA 2FHMA 4FVMA 1KNZA 3C14A 4AILC 3JQJA 4OZJA 5KFKA 3HPOA 3BGFA 5LJ5Y 1RYSA 3MEEA 1SWWA 1SH0A 1D9DA 1PJ5A 1YF5L 1K0TA 5A6PA 1GMWD 3VN5A 2R3VA 4CO4A 1JCGA 4KB1A 3QU9A 1TVRB 1RWKB 2OPQA 2KG1A 1F2GA 5ALVA 5AHXA 2AIRB 1VHIA 5GAEU 3VAJA 2KW4A 4HDGA 1FEHA 1RTZA 3VV2B 4FLTA 1NPKA 1OVQA 3N0VA 1LAVA 4Y6IA 1TU0B 1RCOB 2Q0UA 3PRVA 3MR6A 2A40A 3JTNA 3R5DA 4DV2F 1EB0A 5KFJA 3IBWA 5MLCQ 2APOA 5HL7Q 4DV6J 3EUB2 1P7DA 1RILA 4CF3A 2V4JA 4DPTA 3PIPQ 3AVCA 3VVUA 4YN4A 4GNIA 4OYZA 1N4LA 3O9UA 4IOXA 1L7OA 4P2FA 4CLSA 3IM9A 1LWEA 2M70A 4KMUA 3MCAB 2DY1A 4W98A 4BC4A 3MGIA 3ID6A 3U9ZA 5KG0A 2WW8A 3Q2TC 1QUPA 2KT3A 3GSIA 2X1BA 4LF5K 2NZCA 1RP5A 2MGZB 3A3OB 2BACA 5E79U 4FLWA 4PH5A 2R8JA 2DGWA 1N5TA 4CJQA 3NGRA 1V6HA 3T9NA 4JK1A 1MWMA 3RJMB 3WK4A 4O44A 3PJWA 3WK5A 3C16B 3HILA 2F4VF 2HZVA 3KBBA 1JIHA 2GMHA 4A8FA 4Z7YA 4KGKA 3CO0P 3VF6A 3G10A 2BABA 4EGLA 2DGUA 1NJWA 5DDOC 2ZH9A 3AVHA 3POTB 2G0CA 3H0MB 3NGDA 3H20A 2M9NA 1Z4OA 5B09A 1R8AA 3EMTA 1HYSA 4JI0F 3SCLE 3PCOB 1HR0K 4RO0A 3EGNA 3MXIA 3MX2A 3CETA 3MM6B 4B9SA 1VI7A 5ETQA 5LSLA 3THYA 1RTJA 5IIJA 3OFFA 5CWRA 1X6JA 4JKCA 3QWPA 1N0UA 2FF6A 3ED5A 2YHWA 1TE2A 1ZH5A 4MKVA 5AIBA 4KI4A 5EWFA 4A61A 4KLLA 1LWCA 1ZJMA 3BQ0A 3CFPA 1J2NA 4W90B 4K43A 1WEZA 4Y2UA 1WORA 4FVUA 1HW9A 2JH7A 3NAHA 2J9EA 1NNEA 5B66U 1F0MA 4HT5A 1GLAG 3ALRA 3HHLB 5H2FU 1AQ6A 2KSOA 2HBLA 2XSFA 2GBZA 5C15A 3DGPA 2NRXA 4KKOA 3SK3A 4PZVA 4DV4K 3SQOP 1HJOA 4XQ8A 2VOOA 1WNEA 3PRBA 2ABYA 1WG8A 5KFPA 2IS3A 3P5JA 4ZTJA 1URNA 3AN1A 5KFSA 4ZVOB 2RJZA 2DR8A 3W5ZA 1EX8A 3QLHA 3G6EN 3OQ2A 5EOZA 4CF8A 2DVIA 2Q1NA 3OSNA 2JXJA 2CPYA 2MPUA 1ITGA 3C8YA 3U7JA 1F21A 5K14A 4N5SA 3KKRA 2J5AA 3MM9B 2GX9A 5KL8B 1JJHA 3ZNUA 4KJIA 3ZEUA 1A77A 3A12A 2DY4A 4WF9L 3I56N 2BCUA 4CJTA 1JLEB 3AAWB 1CQMA 3TZZA 2RHFA 1N48A 5ALFA 2ZD1B 3SBMA 2VDHA 2LA4A 2LLZA 3V6HA 2BE2A 1Q7LB 1RBLA 2JFKA 3TX0A 5JS2A 2DNGA 1O51A 4JI1K 5K4LA 4Z6EA 3FCHA 2QKBA 1HIYA 5KG7A 5JMVA 2QFJA 2IIRA 3R9PA 3D3BJ 2WK4A 3CG7A 3IS9A 3BGOP 4IOAQ 3PYDA 3B6BA 4CVNE 2O8EA 4ED1A 4FXVA 5DM7Q 3HBTA 5ALHA 4ZVEA 5ETPA 5AK3A 4HI2A 4PRFA 4BACA 3SZ2A 1LB2B 1NU0A 1DBDA 4V19S 2C28A 3SUQA 2RD5C 3HWTA 3C29A 4NCGA 4DLEA 2IM0A 3NVZA 1JKHB 1O6XA 2QYCA 2E2NA 3P45B 1UL3A 5DMRA 2MUTB 2Y8YA 4DXLA 3CJ0A 2Z58B 1S1VB 1SC3B 5AM2A 2WVDA 4E1JA 3ETLA 2RHKA 2ASJA 3B4MA 4HCBA 4CJFA 3G82A 4ZCIA 3VAFA 1ASVA 1APSA 2HOEA 3PX0A 2H48B 7ICTA 4F5OA 3W3DA 3CT9A 3CPWM 2JOQA 2JDJA 2QA1A 1NJYA 3CCEN 4IC9A 3WK8A 4P0PB 1R8HA 3I5BA 5ETTA 4XPEA 3NFAA 2RB7A 9ICMA 3JSRA 3QIDA 2KG0A 1JRPA 2GIQA 5IZHA 3UKRA 3MMCB 5L1LA 4X65J 3K1RB 1HD1A 1EWRA 1XN9A 3KKAC 1X8DA 4CNZA 4BGBA 2YX4A 3DWLA 1VISA 5A0LA 2V34A 3HO1A 1JLBB 3AQEA 1AT1B 2R7XA 2V8DA 4ID8A 2A1JA 4G9ZA 5GINA 4EAHD 1FX4A 3NGYA 4LREA 1VOMA 1KC8O 1OPZA 3G8TA 3E51A 3M8RA 3HX9A 1Y88A 2UVWA 1X0FA 4CGZA 1URRA 3D28A 4RLEA 3P6YC 1U1NA 3NMUA 4I2IA 3TVKA 4F0MA 3OYJA 3HI9A 2RKIA 2X3DA 2MQQA 2QL5B 3Q8VA 3IBPA 2QB0A 9ICUA 3O80A 1BGXT 3CJKB 2V50A 4NPOA 1S5JA 2ZUDA 1WSHA 5G5GA 3F41A 1IG8A 3EYZA 4M3TA 1WAJA 1HNVB 3K57A 2CNNB 3R7SB 4OYWA 2OPRB 4AHUA 4E2FB 5LMNK 2ZFHA 3ZZTA 4QR1A 3J7ZO 1CLFA 7ICRA 4KHPJ 3IWNC 4F0KA 2JRSA 2AYBA 3CCJN 3MM7A 4LF5F 4PL2A 3TEGA 3E0FA 1NU4A 2FPKA 4Y2PA 1RT3B 3WK9A 3KOOA 2CPEA 3O2IA 1JMTA 4M3RA 4KITB 1IG6A 4CNYA 2CJKA 1J97A 4BRCA 1FVSA 2DCLA 4JI5K 2GOLA 4GXKA 3R97A 4DV1F 4JI8J 4PWDA 4OMFG 4KH4A 4AHSA 3WIVA 1NPRA 3P83D 3K59A 1U1QA 2AT1B 8ICGA 5CRXA 3QUTA 3MX5A 2F8SA 5F0UA 4BWMA 3C5GA 2SXLA 4FBTA 5KFDA 4QQBA 1Z6RA 2YNIA 1RT7A 2IBOA 1Y64A 4FJKA 5DM6L 4KN7A 5B0GA 5L39A 5F8LA 5LMUF 4ED3A 2DBYA 1HR0F 1EJ7L 2OEHA 4BROA 4FCYA 8ICZA 1WUUA 1X4DA 1UJ6A 4KREA 1N32K 2Z57B 4C7ZA 5DLFA 3S01A 4BRQA 3ISDA 2WAQF 1RI7A 2OPPB 2HNDA 3TAMB 3UDLA 2MJUA 3UFCX 3W66A 1GMWA 2OD4A 2W54A 3MN5A 3BQTA 1HI1A 1XO0A 4UOHA 3RJFA 2XS7A 3PIOQ 3OLAA 4P0QA 3AVNA 3KLEA 5GAEP 2EFGA 1CS4B 2B4UA 4UZBA 4O55A 3M05A 4HR2A 4CBXA 2KO1A 2F8LA 1SXLA 3UCUP 1BE4A 1A76A 1S7HA 3O4WA 1KVIA 2HHSA 4DLGA 3UDCA 4HI1A 5AXMA 5ETSA 5E26A 4MH8A 4UASA 4DMZA 2UP1A 5DDRC 1LXJA 3N01A 5T41A 1S6PA 5D78A 5TZVA 4HUFA 1H3DA 3KHRA 5DK5A 4OX9K 2LM4A 4OZ0A 4QBUA 1K9MT 3OY9A 2LXIA 3D0IE 3TACB 2JJ4D 5I3UA 3N7SC 2V94A 2GHPA 4XH4A 4X4PA 1Z05A 4N47A 3NF7A 2FBVA 4YFUA 3CB4A 3MPDA 7ICEA 4U7CA 1QDUB 4PXCA 3IMXA 1FNMA 1T02A 4WKYA 4JI7K 4OI1A 1ZM4A 4ZCKA 4R8UA 2QA4G 1T7PA 4CGGA 4IRCA 1KAXA 2HEKA 1RAEB 4B02A 4ZCLA 2IY5B 3NWGA 4HVJA 4WYBA 4V1Ak 8ICMA 3EGZA 1ITPA 2HMPA 3D2EA 2R8KA 2DPJA 5KFQA 3OUYA 4CJSA 5DG9A 6FD1A 4CF1A 2XWYA 3OVSA 1VC6A 1YGYA 3DI6B 3NWRA 2H5JB 3I4HX 2QA2A 3A8EA 4JI1F 4J2BA 4TXSA 4ZPDA 2OTLN 3DN9A 4ZLNA 3AHPA 1UPMB 2FJ6A 1Q5YA 1N33K 2QWPA 4C98A 4X66J 2VIHA 1D1UA 3MWBA 1O1WA 2DNMA 3HFKA 3VEYA 4KLMA 2BCSA 3KK3B 5BYSA 1SJ4P 1OY6A 1SIJA 2W9CB 3DLGB 1H1VA 4I1TA 2CRLA 3ZETB 5GAGP 5C2FA 4FZZA 3FYHA 1V3SA 5J2PB 3F2CA 2I5JA 2ROPA 2EZYA 3C65A 1WEYA 1S48A 3CC2S 1N5YA 2DWQA 1KQFB 4EUVA 4CF5A 1RLCL 4ID1A 1L7NA 4KY3A 3CEDA 1ZM2A 3CPEA 2J6UA 2HVIA 4USTA 2KFZA 1Q8BA 4RWXA 5AQHA 3NVVA 4JI3K 3A13A 5CH7B 1VFJA 2X1GA 3CIZA 1RTDA 2E1PA 2KM8C 3E58A 3G87A 1WDDA 1WWVA 1BCOA 1Y00A 4RBTA 1I6JA 1RBVA 4H5RA 4Q7AA 3H2VE 2ZJAA 2EXUA 5J8YC 4ZP6A 3CCSN 2IJRA 2YKMA 1HUZA 1NAQA 1UZDA 4RQ7A 2LP4A 5M2RA 5ALEA 1U6ZA 3QUBA 1D4XA 4ZVRB 1R0AA 1XTZA 2W4DA 3AD7C 2R2TA 4C3KA 3A0BU 2VV5A 1EARA 1WTBA 3KJVA 4YHHJ 2H65B 1RDCA 2CJQA 1Y7PA 5AQJA 4BR4A 3EPIA 4NLUA 1RA7A 3ICXA 4CLWA 5L1JA 2GS8A 4ZLLA 3M1FA 1GQEA 2KQ2A 1TZ0A 4M7XA 3QYYA 2QG9B 4DV7J 1H72C 1XJWB 2KNJA 4PKGA 5KFXA 3FRYA 3LUYA 3V6DA 4C0OC 7ICHA 4L72B 4XAKA 3GLJA 5HLFA 1U47A 3EVOA 2CQ3A 2VG5A 4K4HA 1YVNA 4OI4A 4K4GA 4F3TA 3AO2A 3SDEB 5BPNA 2OXOA 2JEFA 5ETLA 3NCIA 5BRHA 2AP6A 4IQUA 2L48A 5J1NA 9RUBA 1R6YA 3KLIB 3K1ZA 4I2GA 1IM6A 1DOQA 3UXOA 1WSJA 1MMNA 4IOBA 4I6MA 4ZK7M 2QWLA 3RRHA 2DFHA 1KR4A 1KKHA 4L3NA 2QMXA 3I0SA 4AE5A 1X9SA 3VMFB 2ZBIA 3K8WA 1FKOB 4M5IA 5H1SV 4E0DA 1WF0A 4ZN1A 4JI5F 1SS6A 3Q7BA 4K4XA 4NLQA 2GTDA 3FNNA 5ALKA 3ENAA 1N60A 5ALUA 5AKYA 3K7RA 4YR2A 4B3SK 2LKZA 3BDEA 4OGEA 2HSZA 3GFZA 8ICIA 1ZQYA 4I68A 3SCJE 2YKNB 1ZQSA 3UWTA 2JLEA 4JWNA 1EWQA 3RJKA 1QJHA 1DQAA 4ELUA 1TK5A 3O9RA 4PUOA 3J7Z5 2P9PB 4DV2J 2KICA 4DR3K 2ISOA 2LQ8A 3CDAA 4CGHA 5H9EJ 1E4GT 2J9DE 2LXFA 1M5SA 5IS2A 2A2DA 3KLHA 3M9OB 5FPDA 2B0CA 2HHQA 2LQ5A 3DXBA 3MEGB 5ETKA 4KTQA 2KFNA 3K75D 1RHUB 3DRSB 3M7VA 1Q4RA 3WC0A 3IDHA 3AL0B 2FJXA 3MEDA 3VQ7A 1UCVA 1NM2A 3M8ZA 3U1NA 4LSNA 4F3OA 1UVIA 2YX7A 2DL0A 3TZXA 2QV6A 2DF4B 2BJ7A 3AD9C 3L5KA 1XSNA 5CYQB 2EI5A 4IYQA 3ZSRA 2MSNA 3F44A 2IGIA 1KFDA 4NJ8A 3N6LA 1N54B 4OX9F 3ZT4A 3ZX3A 2B9XA 3C3LA 7ICVA 2A6MA 3M8YA 3C6UB 3J7YI 1FJCA 3DHWC 1RHRB 3WK6A 3QBWA 7ICQA 1IV0A 1RT1A 1X2IA 4DTXA 2BW2A 2ZJPQ 2B43A 1YHQS 2R2SA 1GOAA 4JI7F 2RF2A 3D7SB 2LYAA 1S5LU 1WC6A 4BG8A 4I67A 2HWHA 3GV7B 1NRKA 3M1VB 1QVFM 1G99A 4DSIA 2NRRA 1JLGB 2K1RB 2IBKA 2UZAA 1U2VB 3L6QA 3RAQA 4F7VA 1P6TA 2NSBA 1ZQAA 2F1FA 4AT1B 4DTJA 4DX6A 1OQ6A 1NXIA 2HKEA 2E1CA 1XMOK 3CD6N 4WTOB 1N33F 1VRUB 1DGSA 1CZBA 3VQEA 4M41A 2E5IA 3BS7A 4YUDA 1MLAA 4ZP8A 2HF3A 4O3NA 2GIFA 2YPZA 2NYVA 2R2UA 3UB5A 4CHOA 1H7XA 2CUYA 2BPGA 1KN6A 4ZVGA 1S9EB 4PQUB 8ICQA 3GB0A 5AXNA 2AHOB 1KP6A 4WZMA 1MSWD 4F4YA 3SXLA 2R7SA 6FDRA 2XMUA 9ICFA 1QCKA 3D2WA 2VANA 3HSZA 1FDNA 1QQ7A 1JNZB 1U1MA 1JLFA 1WUDA 4AQYK 3MPVA 3OXGA 3FK4A 4JYAF 3QAUA 3CCMS 2DHXA 5M2PA 3PACA 2BDUA 3HLUA 2A3VA 4LJXA 3W60A 5C12A 4FJ9A 1NZPA 2W25A 2V7YA 8ICVA 3SSRA 4BQZA 1K8KA 3VAMA 4AYBC 2YNFA 4FWKA 3OJSA 2WB1F 1S4FA 3QFWA 2DPNA 2IOFK 5A8RB 2O67A 3GG1A 1ZD4A 1KD1O 2XMAA 2QWOA 1G1XA 3E01B 1UVJA 4E3SA 4DDFA 4I7FB 2VPYB 1GLFO 4I9QA 4GVBB 2EHGA 2H1YA 2DRBA 2B7BB 5KI6A 5LSOA 3D2FB 1HPMA 3I5CA 4KLHA 5DO2A 1LOUA 1RA6A 3KNAA 4U8VA 2GLEA 2CNLB 1JLQA 2BOAA 3DU6A 1RUSA 4QR0A 4DHVA 2D3OR 4OYIA 1HKGA 3RB6A 5KG6A 2PFUA 1NJZA 3IR5B 4UB6U 1QUVA 2QA4S 3HKZD 1MMDA 1S72S 1F9EB 2DGXA 3BGLA 3HVTB 1WC4A 1NJIT 3F53A 1GO3F 4FL9A 3MMBA 3RBXA 5T14A 4KPCA 5AZIB 1WF1A 3T1YK 4R63A 3UXNA 2XI2A 1NHUA 2XBPA 4P2SA 3AOAA 4C8MA 1XNSA 1KWMA 1CJUA 3UR0A 2YKAA 4DOZA 1SQFA 2BKEA 2NCKL 3JS6A 3CUNA 3GU3A 3QE9Y 4IFVA 1F60B 3PYGA 3CWJA 1X40A 4BRHA 4CZLA 3UDVA 3A2FA 4BC9A 2XG8A 1J27A 1RT6A 5MAOA 2QB1A 4ER8A 2R7VA 9ICLA 2ZITA 2LYBA 3LANA 4R66A 1X4AA 4TU9A 1QQMA 2JFDA 3RYLA 1K73T 1LWXA 4CF9A 1RQNA 3ZD9A 4OYMA 1C2PA 1NSPA 1FKPA 4B3SF 4KN4A 1L3SA 4MDAA 3HJEA 2LU2A 2MJNA 1S0OA 4LFCF 3RGIA 5KFLA 3TQEA 2YMMA 2Y8WA 3KLFB 4J9NA 2G8WA 3A5NC 5AI9A 4F9OA 1VQ9S 2ZM6K 2ZJRL 3R1LA 2F9WA 2CQ0A 3W62A 4I27A 4DR3F 4FWPA 1U6BA 1HPZB 2FB0A 2IRUA 4JV5K 4C4WA 2JL9A 4ICLB 2WBMA 1S0NA 2DIUA 8ICJA 4NEZA 2UUBF 5L9NA 3G4SN 3Q2SC 3HTVA 4WQ5A 2OD6A 1BPBA 2P51A 4UAYA 4LF5J 3WC2A 2FMQA 3OYAA 3OYKA 3BKTA 4UB3A 2FVCA 1SBRA 1H7WA 2KJ9A 1S6UA 1M1KT 3TNVA 1VBYA 2KRBA 4EENA 2ZDPA 3W9JA 4DV1J 8ICWA 8ICCA 1WHYA 1WG1A 2ZQBA 5HR7A 4HTJA 4WIQA 2MQPA 3RW6A 4P73A 2B5JA 2DYAA 2Q6BA 1HBOB 4M45A 4F5PA 3R9LA 4NM2A 4MK8A 5F1XA 2E1EA 3CQXA 4FK4A 2QTDA 1DHMA 5LMUJ 4BBYA 3P1GA 1HR0J 4W5TA 2MHEA 4GV3A 5CYMA 1NGAA 2V52B 2KHVA 2ASOA 4ANDA 2BHNA 2XGPA 1HMVA 2XMKA 4OKJA 2G8VA 2XYHB 1QHAA 2H5EA 4IR1A 1FK9A 3QMLA 4PJ0U 4HACB 2NUHA 4CLYA 1AROP 2HGMA 3C5FA 2BGGA 5FDLA 7ICSA 2V63A 1YK9A 5ALTA 1COKA 3THPA 3RMAA 2W9AA 3ZTSA 3MD1A 3T5HA 3PO4A 3MXJA 3VALA 1VQ6N 3IG8A 4PR6A 2LM1A 4YMMA 4AHTA 2ZGYA 3SSSA 2C1EB 4HEA9 1XMOF 1LKYA 2VZ9A 1ZBFA 3IRXA 1PAEX 1SJRA 4ES3A 2HAIA 2P9SA 4F93B 1UTAA 3QO9A 1IR1A 1TKZB 4ANEA 2COLA 5HQ8A 5AQVA 4GV6A 4P7TA 3O6QA 2IC3B 3O5TB 3L4QA 1G15A 4RT3A 2QFIA 2DY9A 2J6TA 2ZKTA 4DR4K 3TUPA 4RQ1A 1Z2ZA 2OTJN 3ICLA 5B5EU 2VJ4A 2WONB 4FF4A 2X74A 2F3NA 1UW9A 3TAGA 2FVPA 3GTYX 1BUPA 1OVYA 2ASLA 4X4TA 3C7NB 3SCKE 1GOCA 5LT5A 4AQYF 2MKYA 3VQDA 4DL2A 3R3TA 4U67Q 4LD0A 4F4XA 1HWJA 5J2NB 4FFDA 7FD1A 2H4WB 2RRDA 2CPRA 3MHYA 3Q8PB 1MQ2A 3I0RB 5IIMA 2RDIA 3JQKA 3BSOA 1L7MA 3HHLC 5DQHA 2F65A 4KLUA 4JKGB 2E3TA 1M6YA 1WOOA 3RR7A 1YBUA 4FZNA 5D0HA 9ICKA 2X51A 5FP0A 4YB5A 1HLUA 4JI1J 2XSJA 1C4AA 1RDFA 2HHWA 4E7HA 1EXNA 1SXEA 4MJKA 4J9MA 2UUCJ 4M95A 4Z4EA 2J4RA 3BS5B 4N8NA 1K1QA 5DQGA 2ZTDA 3O9SA 1ROFA 2KOBA 2ZEJA 5BPMA 2MGZA 1KTQA 2C2KB 4H54A 1KVAA 2LQBA 2A5XA 4ZCMA 3UD4P 1YJVA 3R1HA 1IBKF 3C16A 2RRAA 4PGQA 3Q23A 3HOSA 4EMDA 5HROA 3H5XA 3W63A 4UATA 2DITA 4FLXA 1UVNA 2RHQB 2QN6B 3IDWA 2R42A 4EIAA 1T8EA 3QEXA 1C1CB 4FSVA 2QO3A 1HRHA 2D0PA 2HHHK 2KKVA 4I6WA 1WSFA 4LRAA 3FFKB 4OJ6A 5A2QY 1YJWS 1X4FA 2QXLA 3MM6A 1UEKA 4P75A 1Y10A 2HS3A 1VSJA 4M1KA 5J2EA 2WVFA 1NDLA 1OH8A 4JB8B 4C0BA 4M63C 4J91A 1R0BG 2HIQA 2RVJA 1IWGA 3TAEA 5CCMA 4CTAB 3LL3A 2J0WA 3KXDA 5GMDA 2MAXA 1CC7A 2KJ5A 3JPTA 1NK0A 3NGZA 4FBUA 3H5SA 4X4VA 1REVB 1VQPS 1J5OB 3G8QA 1BWEA 3V5RA 2OI2A 1RYUA 5EX5A 2JGAA 3RTVA 3K4GA 2A18A 4US8A 4BY9C 3V2UC 3ZDDA 3EE8A 4A8WA 3M2VB 2D0CA 2L3MA 3NEKA 2ZM6F 2HGLA 1P9YA 1VSLA 4H8KA 1HHTP 2HMXA 4Z94A 1GLEG 4MF2A 4FWNA 5L1KA 5HN0A 3V9UA 4CJVA 3K5OA 3LW5C 2LDIA 3MMAA 4DHYA 5HMWA 4CK1A 4CYUA 3ISBA 2IRXA 3FMBA 4LF4J 5JS1A 3VGKA 5C42A 2NYIA 1ZQHA 4E98A 4NL9C 3AU6A 3DMJA 3CMAN 5B0EA 3VEVA 5AQXA 2BJDA 3B6PA 5BRDA 4DR5K 4KHNA 1R8BA 2C42A 9ICPA 4RW7B 4JI5J 3DXMA 8AT1B 3KLVA 1WF2A 3FSXA 1ICEB 1RACB 1UQVA 3BS9A 3K5MA 3D6TB 7ICNA 4B9UA 3HK2A 3D2NA 3IKMA 1VRTB 4Z6DA 2QYGA 3KG0A 2HFOA 5B0DA 3RRGA 2VWBA 2GWJA 1CLQA 4LF9K 4I9LA 2FLLA 1U9LA 4ZVTB 3TJ8A 1TFWA 3MXMA 2IDOA 3E2EA 3VQBA 4K8RA 2XY6A 1C0GA 2RDJA 4C8LA 5J2JA 1MN7A 5IT9O 1HUXA 4YDUC 3FC4A 1KHVA 5BXIA 4PKIA 3OHBA 2LKYA 4OFZA 2B4OA 2X1AA 4Z37A 1NBEB 1S1XB 1NKEA 4WIIA 1D8BA 1J2VA 1PZNA 5KFUA 3TRGA 3OYGA 2EFOA 2ZH7A 2DFFA 4TY8A 4CBUA 1FDAA 3L3VA 1NHKL 2DNQA 2DHHA 1EETB 4BVOA 2GV1A 1QTMA 1QVGM 2F7TA 1FFSB 4LT6A 4WF9Q 3G8SA 2R8GA 4HHTA 1TL7A 3DLEA 2FHJA 3J7YP 4J9OA 8RUCA 1PYOB 2G1DA 4ZA1A 5FD1A 3I55S 3GFKB 1UT8A 5F8IA 3V7KA 2ZIWB 1WB9A 2CJBA 2Z8QA 3OHRA 4B1WB 4CZCA 2G9OA 5HL7L 3HRGA 4A46A 2BDPA 3CHWA 2GZOA 4OX9J 1SV5A 3J81Y 5AJ3K 1ZPVA 5KT6A 4DR4F 2F8KA 1FCAA 2YHAA 3BR9A 3NVMA 1Q53A 4G1QA 4PKHA 2G09A 1JXLA 2BOPA 5AM5A 3D6HB 3PW2A 5AQRA 3LQVA 2XIDA 4CLUA 4J9LA 3C14B 3PFEA 2CYYA 3O1LA 2EC2A 2PYJA 2A3ZA 3HD2A 1DZ5A 8ATCB 4JI7J 4UZCA 2KN7A 2HS0A 3Q8RB 3R5CA 3MEEB 4GKJF 4A2AA 2O6KA 2VC0A 2QL7B 2UXDF 2KG5A 1QQNA 1TYQA 1MN9A 3WNEA 2OPQB 3W2VA 4EI2A 5A8WB 3R2CJ 3HI0A 4PL8A 3NRZA 2JEGA 2NR0A 3DDKA 3FLCO 1ZQLA 2ZWHA 3UCGA 3IR7B 2KJWA 1D3WA 2OLWA 4DTRA 1FXRA 4A47A 1BO5O 3G96A 5ADZA 3CO9A 1NH7A 5G4DA 4OJ1A 4YDUA 2ZUBA 2AXTU 2V4JB 1V9PA 4O3QA 1NK6A 3FEYB 2EWHA 4CERA 2ZIVA 5FRNA 4LSZB 4JS4A 1LWEB 4B6JA 4DR2K 4LIRA 4LC9B 1ZD5A 3TI0A 1Q9YA 2K7KA 3TZYA 4C4RA 2J8AA 3N5FA 2E7VA 2B8PA 4FYYB 1RT5A 1R59O 2DHSA 5DG8A 4M5DA 5EE0A 2IOCA 3CCRN 2VONA 4NWIA 3EDRB 3TVYA 1X6IA 2AH5A 4O44B 4JYAJ 2DNYA 3ENOA 4QZVB 1ZOLA 4OYXA 1AYEA 1ZPWX 3QMQA 1TVAA 4OL8A 3W7BA 1ZQGA 3ZSQA 1YG0A 5BN9A 1YQHA 2B4JA 4GXIA 1VQ5N 4BRPA 2M8HA 4B1VA 1HQUB 2LHTA 4CJ5A 4LF7K 1HYSB 4YR0A 4IJAA 4GRSA 4I2QB 2I9GA 4LFAF 2C2EA 4LQ9A 3FZFA 2H3EB 3NLCA 1EHWA 5A76A 1NNDA 3GFHA 3DCAA 1CG2A 1RTJB 4LY7A 1GLDG 3W1YC 1X5TA 3W9HA 1SZ2A 3D5MA 4M8LA 1BUXA 5F9NA 2AJ4A 1ATNA 4K42A 4HUEA 3V7JA 3G6ES 2UXCK 2JVOA 2O5DA 4DCPB 3ENHA 2MQNA 3CF5Q 1IG9A 1SH2A 2XZWA 3QU5A 5J2FA 2R7QA 1RB0A 2VA8A 3MUTP 3R7BB 1B0TA 4DR6K 1SL0A 5BPCA 3PSTA 1JLAA 2BEFA 2W6LA 4R65A 1X4EA 2CKWA 2LA6A 5KFBA 1TUUA 3CCQS 4MYTA 4USHA 5IT9U 3PLAA 1VQ4N 5EWEA 4H0PA 3I56S 3MGJA 5JJBA 1U48A 5HVHA 5B0AA 4J5OA 5J29A 4URGA 3DGPB 4EX6A 4C8NA 3W64A 2ZH2A 2V5HG 4B17A 4YNQA 3ZT3A 4KKOB 4O3SA 2L41A 1VC5A 4ZVHA 3MBYA 2KLAA 3P38A 3HXMA 4DS5A 1DQ8A 3I31A 1S22A 4CHPA 4RNFA 4KLOA 4DR5F 1DEJA 1PJ6A 4IH6A 5A2QO 1URJA 3UE2A 5EXWA 2C2OB 4BLGA 4CZFA 2BH1A 4GLXA 4RR5A 3AMZA 5LL6Z 1NMDA 3UPQA 5K14B 3H7HB 5J2QA 2YKQA 1TAUA 2OGUA 2MEWA 4ED4A 1T9UA 3ZEUB 1QZ5A 4B3SJ 3DOLA 4OI0A 4ZN3A 2IVPA 3AA2A 3L4BC 4L75A 4LFCJ 3L3CA 1U1KA 3RH4A 4B9QA 2GHVC 2E9RX 4IFEA 3KJQB 5AR0A 4DV6K 1D8LA 2EQYA 2HOQA 3VQCA 1B9FA 4NA2A 1N8RT 1EQMA 3M2RB 2W01A 2WW4A 2JR5A 4UQGA 1RWOB 4DR3J 1T9VA 2BUPA 2OP5A 4ECSA 3VC8A 1DK2A 2PKEA 1TKDA 3IS9B 4ZJOA 5CCLA 2MSSA 3M6KA 2W2NP 2O8EB 2GIRA 2UUBJ 1Q82T 3PW4A 2J7KA 1EIYB 3B4DA 2I38A 5CY4A 4RW8B 3QEBZ 3PSFA 3QT5A 3LP3A 2LVWA 2KV2A 1W97L 2HNZB 1ZA2B 4Z4GA 2D3DA 4NCGB 5AKLA 3G6VA 4TU7A 2BCQA 5CJ7A 3PJXA 3PSIA 5HI7A 4IEIA 5M1PA 2BUNA 4C3LA 4EHTA 4JV2A 2K8CB 2ZH4A 3ZSZA 1MWYA 4FYDA 4QS8A 4M5JA 1ATSA 3GPAA 3L7UA 1ZRMA 3PEHA 3G82B 1M5HA 2E29A 2OMOA 2YHYA 1KQSM 1RBTA 4I2EA 3O4QA 3CULA 2Q6CA 4EHUA 1X4HA 4O23A 3C21A 1QM9A 4FM1A 5AJ3F 4PYDA 4IO9L 4QZAA 4FO6A 1YZ7A 1RAJA 2KMDA 1T03A 3MWTA 5EY4A 1VQ8S 1RWXB 4B3TF 4KYZA 2GWKA 3UKRB 2AP1A 2Y0SC 1HHQA 3Q8MA 3ISZA 3V7LA 1SJ3P 2A3JA 3C6AA 1ZXIA 3SNNA 3ZCMA 4AF1A 3R7NB 2W6KA 2FJAB 2A1JB 3NVWA 3A5MC 2DNPA 5J0WA 2Q43A 4KLGA 4B9NA 2AX0A 9ATCB 1K1SA 2IDLA 4LH5A 2FY1A 2X6NA 2Z7JA 4FJLA 2C3UA 1U45A 1VDHA 3ZZ0A 2XY7A 3NGUA 4CLFA 1U1PA 2M0NA 9ICAA 4ELTA 3K9JA 2VJVA 4AHVA 2KFYA 5ITHA 5CHIA 2CQPA 1PBAA 4Z4FA 2RKIB 3LPTA 2WB4A 2YTCA 2QB0B 2MQ8A 3NBPB 4RNMA 3S6JA 3OYMA 1V9OA 1AZSA 2E6LA 2G13A 1Y5IB 2C3YA 2G2YA 2QZ8A 3FEXB 4WYWA 1S12A 1HHSA 2CNOB 3RMDA 1Z4UA 2V2ZA 3DRRB 3SMZA 3NCPA 4PG8A 2VASA 2MU2A 2JC0A 1Z00A 3BQ1A 1MW7A 2PA3A 4U96A 3MM7B 3CRXA 3J81O 3HFZB 1R27B 3FR0A 1Z25A 2ZE2B 3BZKA 2IM3A 3BSNA 3DXKB 4RX6A 4M5MA 3RB0A 4UBCA 4AQYJ 3AJ2A 5KFEA 2PSZA 5BR9A 3V9WA 3LP2A 4C7YA 2HBJA 4WK1A 4PWDB 2B0GA 4IH7A 2KHDA 2HFZA 4J9RA 3ZDBA 2B56A 2H3ZA 1NDPA 4M5KA 2B4PA 1FI4A 2YNIB 3US5A 1RT7B 1SL1A 9ICHA 4LF7F 3H59A 3QEAZ 2IIHA 4A8XA 1LFWA 2BJEA 1DY3A 1YI2N 4NXZA 4TQRA 3NXZA 4H5WA 1T9XA 4Y0FA 4HHJA 2V9WA 1S7IA 4UBBA 4NA3A 4OI2A 4Y2YA 1WOPA 4Y1DA 1WKKA 2HNDB 1UWBB 3DRSA 5C5JA 1NKBA 1H6KX 2BXJA 4FM0A 4U6PA 3TARA 3T5JA 2XS2A 1HBNB 2FLNA 2ZUGA 3N4WA 4DR6F 4P0QB 2ERRA 2VDIA 3M6VA 1IBKJ 2VYPA 4TYBA 3KLEB 4CJ4A 5CYQA 2BPCA 1M90T 2YJFA 4UY8T 2M7SA 4QZIA 1RG6A 1ZAVA 1S49A 1IKWA 3CCLN 2OH2A 4NA1A 4LZDA 2LI6A 3CP8A 3HSJA 3NASA 1FEEA 1B64A 1S6PB 1UFLA 4AXIA 3GBTA 2LEPA 3NTUA 3V9ZA 3KZIU 3NGIA 4FKYA 4KH0B 3C95A 1U25A 2QLBB 1U1OA 1CUKA 4X65K 4NLPA 4DR1F 1ZS6A 2JWNA 4I2JA 5DB7A 3VERA 4PZOA 4PCQA 4N77A 5DBCA 3N5BA 5I3QA 4FO0A 5L8RC 3KKFA 4R8UB 1OO0B 1QLNA 2HBQB 3ZX2A 3V1OA 4QZEA 3AA3A 4Y65A 3MAHA 4FK2A 1TKXA 1K47A 3TAQA 4FYWB 2D5RA 5KAIU 3SEOA 1UVKA 3T3FA 3BN4A 5KT4A 1SPBP 1IKXA 1YJTA 4KPYA 4HYKA 1NZBA 1Q3VA 2ZM6J 2AD9A 3S9HA 4RU9A 3Q22A 3K5LA 2KP7A 1J54A 7ICPA 3CTRA 2XLIA 4A2BA 4CHQA 4FZYA 1Y5LB 4GIBA 4WQ4A 1S9EA 1NZAA 5FLXU 2YH1A 3TFRA 2DHGA 3QQCD 3DGVA 4I4BA 1IVZA 5F3TA 4KHPK 5JMNA 2IVFB 4ILMA 2V67A 2DXFA 1ZC6A 2O4GA 2M5YA 5EE1A 2IM1A 5J2DA 3VQTA 1F44A 2I5JB 4OJLA 4UAUA 4CGJA 3SUPA 4DL7A 2CIMA 1PK1A 2CN1A 2G5HB 3K0SA 4A5BA 3ZTPA 9ICSA 5AM1A 2H5IB 1D8YA 4JHDA 1VQLN 4NCBA 1YTYA 1RTDB 1X3MA 3QFUA 2R7YA 2AQ4A 3PR4A 2H54B 3E01A 3A8JA 4Z4IA 4FJJA 5LJ3Y 4WFAL 3MAAA