1NK7A

Guanine-adenine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk7A01
4CHQA 4W5TA 1EP4A 4QZAA 5DG9A 3CFPA 4OGCA 9ICGA 4UB3A 9ICIA 4F2SA 1VRTA 3MAQA 9ICTA 3EWAA 2FMPA 5KG0A 4F5NA 1NK6A 4I2IA 3QEAZ 3C6UA 9ICOA 4EYHB 4DSFA 4JWNA 1X9MA 3PW2A 3QETA 1NJWA 4IG3A 3OVNA 3HPGA 1S0MA 4XA5A 2H5XA 5D46A 3QLHA 5L9XA 4FZZA 3HVTA 1YTAA 2Y1IA 1WLJA 2X6NA 9ICHA 4EEYA 8ICHA 2ITGA 5HNKA 2XGPA 1JLCA 4KLHA 2C2DA 3NF7A 4ECXA 3ZT2A 4GC7A 1RBUA 1QLNA 3V6DA 1WSIA 4Z6EA 4AHTA 3MEGA 4B3OA 9ICEA 3O3HA 4BDZA 1NK4A 3AVFA 4RQ2A 2QKBA 2JEIA 4QZDA 4NY8A 1RILA 1BQMA 3NGIA 5DLGA 5CYQA 2F8SA 4FJIA 5KFBA 2XY5A 1ZQSA 5HP1A 2D5RA 1RDAA 4HCCA 4M41A 3PW4A 4PY5A 4JLHA 3VA3A 1XSLA 4I9LA 4J2BA 2G8VA 3ZDBA 4J9MA 1U45A 2YKNA 1UT8A 4HHTA 5KFHA 1PZNA 4F4KA 3V7JA 4GXKA 1HJPA 3H8JA 1ASVA 3B0YA 4R8UB 5DGBA 4KLIA 4FO6A 4MEYA 4CGDA 4RW4A 2NRTA 1XSNA 3NFAA 1JLAA 3GV5B 4RQ4A 3HYFA 4J9SA 2JGUA 1T8EA 1ZQMA 5DDMA 5SZTA 5IIIA 3M8SA 4J9KA 2BGWA 3MGIA 1RBRA 5CB1A 3M8RA 1K6YA 1T3NA 1WAFA 5J2NA 4I27A 4DQIA 4O5BA 1S9EA 4RW7A 4B9SA 7ICPA 3LP0A 1XSPA 3SUQA 1S1TA 3Q8SB 1ZQWA 3MXMA 8ICSA 1TKTA 4RPYA 1C1BA 2ZD1A 4DU4A 1Q9YA 3BQ0A 2ALZA 3SYZA 5KFWA 4F5RA 5CR0A 3V6KA 4I7FA 4KTZA 4MFCA 3PR5B 5JUMA 4CK1A 1LWEA 4KAZA 2GBZA 4NCGA 4FZYA 3T5HA 4F93B 4J9QA 4BE1A 5DB7A 4LZGA 4FJ5A 3NCIA 1ZQOA 4FVMA 4CESA 4OKEA 3PMLA 1JL2A 3V1QA 3WNEA 5J0SA 5HROA 3GQCA 3MXJA 2RN2A 3O4QA 1KVBA 4O3NA 2AQ0A 3M9MB 2P51A 4KKOA 4I29A 3QIPA 1WSGA 1T05A 4EBEA 4CGGA 1S10A 4ELVA 3Q8QB 4GMJB 3THVA 4RPZA 1ZQLA 4RW9A 4BWMA 2FLLA 5DBBA 4I2CA 1X1PA 3JPPA 1J5OA 3VA0A 4ECRA 3T5JA 5J2EA 1BGXT 3DMJA 3AVJA 2VANA 4UB4A 3V9WA 5DB8A 3ZSOA 4CEBA 5J2BA 5EWGA 4TURA 1TVRA 3OS0A 2HHSA 1WNSA 4FW2A 3NF8A 1B92A 1YVUA 4QZFA 1BCOA 2D0CA 3UQ2A 3OSNA 3OYAA 4YR3A 3OYKA 4E7IA 3M8QA 4CJ5A 3V7LA 3NGDA 1D5AA 4JS4A 4DFJA 1CUKA 4QWCA 3DLKA 2FBTA 3RB6A 1RXVA 2Z1HA 2HHUA 3G6YA 3P1GA 3PO5A 4AHSA 1HYZA 4CJ3A 1BPZA 3NH1A 4LZDA 2QXFA 4L8RB 4CEFA 4F4YA 1LB2B 5CP2A 5KFDA 1QSYA 4Z4CA 5J2QA 1NOZA 1ZBIA 2D0AA 4FLUA 4KLDA 8ICVA 4QWBA 3HX0A 1RDDA 2J6UA 4WE1A 3P5JA 3QNNA 3RMCA 4KLOA 3NE6A 4DL6A 3ZD8A 4B8AB 4KLFA 2E4LA 3V4IA 5HRSA 2HNDA 1RT6A 4F4ZA 9ICXA 2P6UA 5KFOA 1JL1A 4K8ZA 4RZRA 1ZQZA 4RQ5A 2R8HA 2ATQA 2ETJA 2ZTDA 1N5YA 4EP5A 5IIOA 2ZTEA 3ZT3A 5E41A 1F21A 2XCAA 4DSLA 1UWBA 3AVCA 4I2BA 4N56A 2KZZA 4M42A 3B6OA 2JEGA 4YG2A 1CZ9A 7ICKA 4RQ7A 3DLGA 2FMQA 2HHQA 1DOQA 1BI4B 1BQNA 4RW6A 4KHUA 2PY5A 1ZQQA 2YNIA 1IKYA 2GWSA 3AU6A 3MR3A 3AVHA 5I42A 1LV5A 3KLGA 1HMVA 3C94A 4IBNA 4YXJA 4CJQA 3VQ8A 2KZMA 2PXIA 2BCSA 2B5JA 1ZQTA 2IMWP 1ZQAA 3QNOA 1EXNA 3C95A 3I8DA 1JX4A 5J0QA 2YHBA 4LD0A 4DQQA 1RDBA 2Z1JA 2KQ2A 1KLMA 4PA1A 2JZBB 4CJLA 1U49A 2KFNA 4NLNA 1WCLA 4ID1A 1TK8A 4UB5A 2F1IA 3K4GA 4QAGA 1U47A 3TR8A 5HMMA 2LYHA 1BVSA 5KFAA 2ZUDA 3C2MA 3IS9A 2W42A 4E7HA 7ICGA 2QKKA 3NBPA 1BPXA 1JLBA 8ICRA 3WNGA 2J6SA 2ZE2A 4CJRA 4I2JA 4AHUA 3V1RA 3TAQA 5J2FA 3GIIA 4OKJA 1HJRA 4IQUA 1BCMA 5EOZA 1C0TA 2VWJA 4AH9A 3LP2A 1VSLA 1VSKA 9ICRA 3S3NA 2R8IA 3DI6A 2PZSA 1IKWA 5J2PA 2ISPA 2W9BB 2JEFA 5CHGA 1BI4A 1RTJA 4DU1A 5KFEA 4MFAA 5KRTA 2G8HA 5L1JA 2X74A 2BCRA 4HUFA 1RTDA 4M3YA 4I9QA 4FZXC 1QSLA 5HRRA 1BIUA 1TV6A 3NF9A 1MSWD 3KKRA 4M9GA 3RAXA 9ICVA 2XC9A 2DFEA 4E7KA 1RBVA 4CCHA 1FKOA 4Q44A 3K58A 3MBYA 4ELUA 2X6SA 3ZSVA 4E1MA 2HMIA 2ZJAA 3MFHA 4CJVA 2ZQBA 1ZQKA 1GOCA 1CLQA 4CIGA 4N5SA 5J0OA 3S3OA 4O55A 2I5JA 2EHGA 2JZBA 1LW0A 3OYEA 3VQ6A 4O9MA 2BQUA 9ICMA 3LWMA 4FCYA 5KT4A 1VK0A 4M3TA 2BDPA 2ASLA 3M9OB 4N76A 5J0PA 4KFBA 4FS2A 1BPEA 3PX0A 3AVMA 3VQ7A 3IG1A 3KLEA 9ICBA 8ICAA 4Z6CA 3ISCA 4E7LA 3HT3A 3C5GA 1S97A 5IIMA 3HJFA 2V9WA 3KK1A 1NOMA 4TUSA 3U3GA 1RYSA 4C8OA 9ICFA 5J1EA 4DTPA 5CJ7A 3MR6A 3ZDEA 4DS4A 1ZQJA 4E19A 1TKXA 4B9MA 1Z3EB 1TKDA 2BANA 3RJFA 3RJIA 3Q8KA 2DFFA 3IAYA 4HCBA 4CF0A 2PFNA 4JWMA 3HK2A 2R8JA 4KREA 4QZIA 4UBBA 5J0RA 2W9MA 5DBCA 5DG8A 4PPXA 1A77A 4KV8A 4O44A 4IRCA 9ICWA 3V9XA 3VQAA 2RDJA 4HUEA 1N48A 3ZCMA 4F3TA 4OPKA 4RUCA 1TK5A 3ZDDA 1S0VA 3V9UA 2HNYA 4FXDA 1D9FA 1SL1A 3OYNA 1SUQA 1ITGA 1Z00B 2KFZA 1C0UA 7ICHA 3O3FA 1X2IA 3ZSRA 3GILA 4FBUA 4QZGA 3ASMA 9ICLA 4O4GA 4W5RA 3ZT1A 4ID5A 3RMDA 3OYBA 3EZ5A 2Q3SA 5FROA 5KFUA 2XY6A 1W9HA 2E6LA 2B21A 3NH0A 4QZHA 4ECQA 3V81A 3SQ2A 4Z6FA 1SL2A 3RBEA 4OKKA 3E01A 4BE2A 2M9NA 5KG6A 3TAGA 8ICIA 3C6TA 4M6WB 1J9AA 3QE9Y 3L2VA 1H38A 3HPOA 2DPIA 4EZ6A 1J54A 1HPZA 3BQ2A 2OPPA 5KG1A 5J2KA 5IINA 3K5NA 2BPGA 3C2KA 1K1QA 3AVIA 5DKWA 2DFHA 8ICLA 1O1WA 3M9NB 2FBXA 8ICWA 1NJYA 4J2EA 1C6VA 1JXBA 5DG7A 4CJUA 2P1JA 7ICVA 4TUPA 3DRSA 1LWFA 5KFKA 3VQ9A 3AA3A 4RQ8A 1CXQA 1W0HA 3OYFA 3QINA 3KHHA 1ZQIA 4G3IA 3JPOA 1S76D 1ZQVA 5KFFA 4DO9A 3KLFA 1XO1A 1TK0A 3OS2A 1KFDA 3JPSA 2KW4A 1RXWA 3SUOA 4M9NA 3EPIA 4J2AA 4N47A 4C8NA 1Z00A 1ZBLA 2A1SA 4M3RA 3AA5X 4DL7A 1TGOA 2YV0X 3T1AA 1LAVA 1ZETA 4ED6A 4YFUA 3DM2A 3TAPA 5DQHA 4YQWA 4UB2A 4OVLA 2BPFA 1MU2A 1XHXA 3KK3A 2KN7A 5HLFA 2NRVA 4M6WA 3AA2A 4LSLA 4IQWA 4F91B 2VG5A 4YD1A 3PW7A 4E3SA 4BDPA 4CJ4A 2X78A 1ZQEA 3N97B 2W9AA 5KRSA 1HQEA 2V4RA 1L3TA 5DDYA 2D0BA 5J0YA 4X5VA 3VQEA 3RMBA 3B0XA 1HUOA 2UVVA 4DQPA 3PW0A 4Q8EA 1IKVA 3EW9A 3MR2A 1CZBA 3SNNA 4FK2A 2ZUCA 5J2MA 1B9FA 1QE1A 2F1HA 4CF2A 3I0SA 4W5NA 2BHNA 4QZ8A 4TSXA 4LVSA 3C21A 3KIOA 3AVKA 4BDYA 3JPQA 5JS1A 4CJEA 5KGXA 2YNGA 5KFJA 3ZSYA 5EWFA 4HTUA 1IM4A 1JXEA 4DTNA 3RH6A 4KLUA 4ECYA 4BE0A 5J0WA 4BACA 3H40A 4FJXA 2FMSA 1UOCA 9ICCA 3S3MA 1B22A 2VG6A 4FLZA 3RBDA 2PFQA 1NJXA 1HNIA 3OYLA 4UB1A 4KN4A 4DF8A 4LH4A 4RQ6A 4Z6DA 4DF4A 4FJKA 4RT3A 4KRFA 3MEDA 4M45A 3MFIA 4E0DA 4Q0BA 4OPJA 4TQSA 3K2PA 4PH5A 5CZ1A 4FLXA 4IFYA 1RDCA 3VQQA 4XQ8A 1JLEA 3KLIA 4RQ3A 3GV8B 1NK8A 4AHCA 1ZQDA 3SCXA 3SI6A 1DGSA 4CGIA 4QZEA 5D49A 3QIOA 3V1OA 3QESA 3BJYA 1SKSA 4UQGA 4M9LA 4ZHRA 1BPYA 1QHTA 3LAMA 4KN7A 3RTVA 2BKEA 4W5OA 4Z4FA 2Y1JA 1L3UA 2ZTCA 3TABA 3RH5A 1TKZA 3SUNA 3AVAA 1NOYA 5CZ2A 1VSEA 4XUSA 1DTTA 1U4BA 1KCFA 4QWAA 2BR0A 1KEJA 1XI1A 5EWEA 4BGDA 5KFLA 4FJGA 2I9GA 4KMUA 2YNHA 3KKSA 1SZPA 3KTQA 4NM1A 7ICFA 2F8TA 3TQ1A 5IIKA 4KI4A 3VQDA 4DQSA 8ICBA 2IC3A 2RKIA 4YR0A 3LDSA 4IRDA 1BPDA 3G6XA 4ZH4A 1S9GA 5KFMA 4M2YA 1AROP 4DSKA 2AGQA 4KI6A 4EYIB 7ICOA 3VQPA 4DTSA 1LAWA 4M9HA 1REVA 4FLTA 5BPCA 4PHDA 4DU3A 1Q8IA 3OS1A 2UVWA 1VSJA 1S1UA 3ZSWA 4O3OA 3OYGA 4FJNA 1D8YA 1YTUA 3T19A 1LW2A 5C42A 4DFPA 3Q8LA 5KFVA 4CFAA 4J9RA 1B43A 1ZQPA 2Z1IA 4Z4GA 5J2AA 2G8FA 4F3OA 2BQRA 4NCAA 3AO5A 3HSTB 4OLBA 2XY8A 4NLKA 7ICEA 3NAEA 5D4BA 3OHAA 1RTHA 1VSHA 3QEPA 3UPQA 2ZJ8A 4IRKA 3PR4A 3OJUA 9ICSA 4Q43A 2FPKA 2IA6A 4CECA 3HVRA 5K14A 4FBTA 4E89A 4I2EA 4CEQA 3TAFA 3MECA 4F4WA 2IS3A 4FW1A 3TAEA 4CGHA 3DLRA 2PI5A 3C23A 1WN7A 1NK5A 4EBCA 1QTMA 5HHIA 1TV9A 5L1LA 1ZQXA 2ASDA 4GVMA 3IM1A 1D8LA 1JXLA 2RF2A 2W9CB 2BQ3A 4RW8A 2HHXA 2LSNA 4NM2A 4RNMA 4QWDA 4KTQA 7ICRA 4MF8A 3LP1A 4BWJA 1XHZA 3DLEA 3L2QA 2IAJA 3IHQB 1HRHA 1RT4A 5KFQA 2P66A 4Y1DA 5J2IA 4IKFA 4ED1A 2IGIA 3TAMA 5J29A 2P5GA 4PHPA 3ZSZA 4NXZA 3RJJA 2XHBA 4FM2A 1RBTA 1RZTA 4H4OA 4CHOA 1BISA 3KK2A 1RNHA 3D0PA 3HP9A 3CG7A 3TI0A 1I3AA 4TQRA 4Z4HA 1B9DA 3ISNC 4OLAA 4I2HA 1NK0A 5KFGA 4IR9A 2XY7A 1BPBA 4YXMA 2XO7A 3LZJA 1T03A 1ZBUA 4B08A 1UAXA 3NHGA 1NKBA 4TUQA 2PI4A 4PGYA 3RH4A 1CXUA 3BQ1A 1ZJMA 1T7PA 3CM6A 3V7KA 3PVXA 2J6TA 4DLEA 2XGQA 3AVGA 5KFYA 4YMNA 1VSMA 2W9CA 2AU0A 5FDLA 2O4IA 4R64A 1HYSA 2IHNA 9ICUA 4RNOA 3H08A 3I0RA 4OJRA 3GV7B 4RUAA 4J9LA 1RT3A 2RPIA 4P4PA 3TFSA 3PW5A 1X9WA 4CEOA 4CHNA 4LH5A 2HVHA 3AO4A 4YMMA 3RRHA 3T5KA 2G8KA 3HP6A 3TWHA 1K1SA 1JIHA 1TFRA 1T4GA 1IO2A 4IDKA 4JRPA 4HYKA 2AGOA 1ZQGA 4J9OA 4I2DA 4DL4A 4KLJA 5I3UA 2BPCA 4DOCA 3QEBZ 4C8LA 3PMNA 4YFKA 4DTMA 4YP3A 1ZYQA 3OYHA 3ZT0A 4CE9A 4PQUA 1XWLA 2HHWA 4RT2A 3N4MB 4ZTJA 3H4DA 3TARA 1ASWA 3ALYA 1C1CA 4DSIA 4P4MA 4UBCA 3TFRA 2BCVA 3RB3A 4FK4A 1WSJA 3L3VA 5KFRA 2DTUA 3NF6A 5T7BA 4PGXA 3FFIA 1LWCA 1Z26A 3LALA 3OYCA 3F73A 3HWTA 7ICMA 3L2WA 4CIFA 3NDKA 3K5LA 5KT2A 2IHMA 4FJ8A 3DOKA 2IDOA 4CGJA 5J0TA 1S77D 4F5OA 1UA1A 4N41A 3QEIA 4O3QA 1S1XA 4CIEA 3WNHA 2QK9A 4KLQA 3UQ0A 1FXXA 4FJLA 2IOCA 2FLPA 1U48A 2NRXA 3FYHA 1EXQA 5KG4A 4O5KA 1RCHA 4NYNA 3CFRA 4ED7A 4Q45A 3UXPA 2DY4A 3LPUA 2OA8A 8ICXA 1KLNA 3LK9A 3DLHA 2A1JA 4ED0A 1ZQRA 5CWRA 4DL2A 2OZMA 3LZIA 3QZ7A 4FJ9A 2A1RA 1TL3A 4ED2A 4M3XA 2V4QA 1C7YA 4KLGA 4KITB 2C2EA 1RT1A 3HPHA 1NK9A 1ZQUA 3G6VA 1RPLA 4B9UA 4DQRA 4PGQA 1IG9A 5C25A 4QZ9A 5KI6A 3D45A 4CJWA 4CFBA 8ICOA 4IFVA 4NYFA 4B8CA 4NLZA 4OGEA 4F92B 3V9ZA 3NGZA 9ICJA 1JKHA 2AJQA 1HQUA 3GIKA 1JLGA 2G8WA 1NKEA 4QZBA 4CJKA 5KG3A 2W8LA 4DWIA 3VQBA 2UVUA 5KTQA 1J53A 3VQ4A 1L3SA 4ECZA 4I2AA 3KD1E 5DBAA 3KD5E 3PO4A 2ISOA 2P6RA 3MDCA 4PWDA 7ICNA 3JYTA 2E6MA 4CHZA 5D3GA 3ETLA 1C1AA 3BGRA 1TVAA 2YHAA 3AVLA 4MF2A 3JSMA 3QO9A 5KFCA 8ICPA 3RJHA 1Y97A 3GFKB 4P2HA 4CF1A 2OPSA 4F2RA 2B4JA 3OGUA 3ITHA 4EZ9A 4LSNA 4DL3A 3L2RA 4CF9A 7ICJA 3LWLA 4B9LA 1NKCA 1L3VA 1S9FA 4LY7A 1NJZA 4R65A 3MEEA 3RMAA 5KG7A 3E2EA 3MDAA 5KT5A 3C2LA 2UVRA 4J9PA 4KHSA 8ICEA 1G15A 4YMOA 4DTRA 3BQTA 4KHWA 4FS1A 8ICQA 3LAKA 4ECUA 3L3UA 2HHVA 8ICCA 3RRGA 1GOBA 1X9SA 3OYMA 4CK3A 3LANA 4FM1A 1KVCA 5J2CA 4YN4A 3GDXA 4E1NA 3CM5A 4DSEA 1BL3A 1COOA 4FLYA 3C1ZA 5DQGA 3DOLA 4P4OA 3ISBA 1KFTA 5C5JA 4UAYA 2ZJ5A 3OYDA 4M9JA 3DYAA 4FJHA 3C1YA 5HRPA 4ED3A 8ICFA 4KLMA 3MXIA 4I2PA 4QW8A 4DEZA 4I2FA 3V72A 3UXNA 3AU2A 3DRPA 4CFDA 2W8KA 4GW6A 4IR1A 3MR5A 5CA7A 4YD2A 1VRUA 2MAXA 4ED8A 4M04A 1XC9A 1TL1A 4CJTA 1D9DA 4CGFA 1WAJA 1QQCA 4W5QA 4DS5A 3DLBA 3RR8A 4DTJA 1Y88A 1IH7A 4FYDA 2R7YA 4K4HA 5F9NA 9ICAA 2Q0ZX 1SKWA 4DFKA 4K4IA 4KLSA 5KG2A 5BOLA 2F1JA 3AV9A 2FC0A 4QW9A 8ICUA 5F9LA 3V6HA 1IKXA 5EU7A 3RJKA 3H4BA 3OYIA 2NRWA 1ZQCA 2OPRA 1XU4A 4Z0UA 3AO2A 3ZT4A 3OJSA 4FJJA 4CEDA 3NGYA 5HMLA 1KFSA 2P5OA 1QSSA 3BDPA 2XCPA 2IBKA 5C24A 3SPZA 4KLTA 2FPLA 3PX4A 4IQVA 2YNFA 3T5LA 1N6QA 3MGHA 1U9LA 3AO1A 4C8KA 4CHPA 3OHBA 5J2GA 4GXJA 4JUZA 3L2UA 5J0UA 1RBSA 3M8PA 4AHVA 3HXMA 2HNZA 4FM0A 1UT5A 4DOBA 2PYJA 4HVJA 4ECWA 4CERA 2C2RA 4B9TA 4KHYA 1JLQA 4Y1CA 4JV1A 2HW3A 4ICLA 3O3GA 8ICYA 1DLOA 4CHYA 1DTQA 4KHNA 1ASUA 2C22A 4JV2A 3GIMA 4B9NA 4K4GA 8ICNA 9ICKA 3AA4A 5HHHA 3AO3A 3KJVA 3KLHA 4F8RA 4KLEA 1WSFA 4KB0A 4F4XA 4R8UA 4B9VA 2OYQA 1KVAA 5DGAA 4FLWA 4EP4A 4QWEA 4YR2A 3LP3A 1GOAA 1JN3A 2EX3A 2F96A 4I28A 4R63A 2VA8A 1FKPA 4AILC 2I1QA 4CEZA 3SUPA 4RQ0A 3CYMA 1VSFA 1S0OA 2DPJA 2YKMA 3UXOA 1S5JA 2MUTB 4F50A 3WNFA 4FJMA 2HVIA 1EX4A 3H8SA 4DSJA 1NK7A 2WONA 4JRQA 3EY1A 3K57A 5DLFA 8ICGA 1A5VA 5FRMA 2JEJA 4KLLA 4E7JA 3T3FA 2O4GA 3IRXA 2HB5A 1TAQA 2GUIA 3P83D 1S0NA 2ASJA 7ICTA 3AVNA 4PUOA 7ICUA 1MQ3A 3MABA 1KTQA 4O0IA 5BOMA 1R0AA 2PYLA 3Q8MA 4UAWA 4J2DA 4FK0A 4CJPA 7ICIA 1L5UA 4RU9A 5DB6A 5SWMA 1KRPA 4CK2A 3HW8A 4O5EA 4RG8A 4GC6A 4XRHA 2FBVA 4M3ZA 8ICJA 4JV0A 1VSIA 4KO0A 1S1WA 4YNQA 1ZBHA 3QEWA 3ZD9A 3VQCA 4Z4IA 1FK9A 2WOMA 4MEXA 4RNNA 1MQ2A 5FRNA 4AHRA 4CJSA 3PV8A 1UA0A 3JPRA 1IXRA 2ATLA 4IQTA 2Z1GA 3EYZA 3K5OA 5KT3A 3A2FA 1KSPA 3QEXA 1YT3A 5CYMA 4IG0A 3C5FA 1S1VA 4JS5A 1CEZA 2VA2A 4O3RA 3RWUA 3AVBA 1WSHA 3OYJA 2MUTA 2VA3A 3ZDAA 4DMNA 1BHLA 1U04A 3TANA 4MQ3A 3PX6A 2B6AA 3OSPA 5KFZA 1ZJNA 1WSEA 1HYVA 3SJJA 4M0AA 4RQ1A 4O0JA 3H7IA 4XIUA 4PHAA 5IILA 5HP4A 4UAZA 8ICTA 2PFOA 1ZQFA 4K8XA 2WTFA 3ORYA 1RT5A 1SKRA 3K59A 3B6PA 5KFIA 3ZSXA 1ZQHA 9ICNA 3KHRA 2FLNA 2R8KA 4M47A 4Q5VA 3SI8A 3PY8A 5J2HA 1ZQNA 1WCNA 3ISDA 1HUZA 4H4MA 5DMRA 5HRNA 2OZSA 3LPTA 1S6QA 4ELTA 4FLVA 1SV5A 5IIJA 1ZBFA 1BIZA 1SL0A 2VWKA 4F5QA 3U6FA 4KHQA 2AQ4A 3QZ8A 1VSDA 4F5PA 2PFPA 5KFTA 4BXOB 2C28A 9ICPA 2JLEA 1RTIA 4DTOA 1TAUA 1Z25A 3DRRA 1KDHA 4I2QA 4DTXA 1HNVA 5J2DA 4J9NA 3Q8RB 3ZSQA 4M3WA 3V6JA 3SQ0A 2BCQA 2NRZA 5KG5A 2XRIA 3RJGA 1A5XA 4DL5A 3SQ4A 4DG1A 3ZDCA 3F9KA 4KB1A 3Q8PB 2FBYA 5CY4A 1Q9XA 1S6PA 2A1JB 5DK5A 2ZUBA 3KHGA 3RB0A 2HHTA 3SZ2A 1QS4A 4YVZA 4FJ7A 3CQ8A 2BE2A 4PHEA 3S9HA 2RDIA 1RYRA 1A5WA 4QZCA 2GV9A 4YCXA 4R5PA 2VG7A 3VQ5A 3RJEA 3RAQA 2KZ3A 2KTQA 3K75D 2G8UA 4HUGA 4CF8A 3SV4A 3KHLA 1I39A 4O3PA 5L1KA 3PNCA 3NH2A 3G10A 7ICLA 4ZTFA 3NTUA 1C0MA 4H8KA 4NLGA 1JMSA 4Q8FA 1RT7A 3ULDA 3V9SA 3HL8A 4M3UA 9ICQA 7ICQA 3SPYA 5J0XA 2OWOA 4BXOA 4KTWA 2G8IA 1RT2A 2R8GA 3CFOA 3EPGA 5DQIA 3UIQA 1ZQYA 3RB4A 5KGWA 4R66A 5J2JA 5HBMA 3PUFA 7ICSA 4KPYA 4ECVA 3OY9A 3O4NA 3HM9A 3QEVA 2W9BA 5KFPA 4MFBA 5KFXA 3G0ZA 4RPXA 4ECTA 5KFNA 4O5CA 5KT7A 1A76A 4DLGA 2OPQA 3K5MA 4QCLA 4CEAA 2NUBA 3LDAA 4GLXA 4CFCA 3FDSA 3AUOA 4CEEA 4DOAA 2BCUA 4EBDA 1XS9D 5L1IA 4NCBA 3GIJA 5DB9A 3RR7A 8ICZA 5JS2A 4DFMA 1N56A 1EETA 2FPMA 2AGPA 3JPNA 1EKEA 8ICMA 3SQ1A 1MC8A 8ICKA 3SV3A 4Z4EA 4MFFA 4ECSA 4CJFA 5TZVA 1JLFA 2BGGA 4DTUA 4QOZB 3L8BA 5KT6A 4O3SA 4G1QA 4GXIA 5KFSA 1V9PA 3JPTA 2DFLA 4C8MA 1ZQBA 3U3YA 3QERA 3HO1A 4JK1A 4I2GA 3VN5A 3H8WA
chains in the Genus database with same CATH superfamily
2NSCA 4QIWF 5DG9A 4KAIA 3OLAA 1HNZJ 3PZPA 4GRSA 2ASPA 4F2SA 2UXBK 4NLCA 9ICTA 1FEHA 1VGYA 1A9NB 2ZIXA 1GK8A 1Y0HA 2FMPA 3UR3C 3GMGA 4I2IA 1N88A 3C6UA 4ZCLA 4DR1F 4I6AA 4JI7J 1DARA 2FZKB 1NJWA 2V69A 4P0QA 2E5LF 3WT0A 4XA5A 1RQLA 4KGZB 5KQ8A 1T9WA 4FZZA 2Y1IA 2X6NA 2GOLA 5J2NB 2ITGA 4US8A 5HNKA 1JLCA 2MTLA 2XTJP 5AXNA 2C2DA 1UVIA 1ZPVA 2BE7D 3V6DA 1W97L 4KX5A 3NCRA 1ZD4A 2MKSA 2B8PA 2MPUA 2DGQA 3D0IE 3L7OA 1TKTB 3AVFA 2ZD1B 4RQ2A 3VEXA 3IDHA 2D3ZA 1SBRA 3AOBA 4NY8A 3EXCX 1RILA 1S99A 4QIEA 1FDAA 3OR2A 3O9QA 3M5RA 1CJUB 2D5RA 4LVOP 2HNZB 4P9SA 3TSUA 3PW4A 4PY5A 4JLHA 2RT3A 3CEDA 4OX8A 3BEGB 1WC1A 1DTQB 1KD1T 2N4CA 2DTJA 2Y0BB 1OYEA 4J9MA 2X51A 1U45A 2YKNA 3WKDA 2BUNA 1PZNA 5HVHA 4AQYF 5C2FA 4F4KA 2XHCA 1VLYA 3H8JA 1ASVA 4NL9C 2W54A 4KLIA 3L4QA 1S12A 1UPPA 4RU2A 3GV5B 3HYFA 4J9SA 1J5OB 1T8EA 3QUTA 1HLUA 3M8SA 1N5TA 2HBLA 2BGWA 3CMAS 4F26A 4CF4A 4LREA 1U26A 3L4BC 2IVFB 1K6YA 4ZIVA 3SLCA 1R8PA 4O5BA 3S41A 4RW7A 2XS2A 4LRCA 7ICPA 3P8BB 4WF9Q 3LP0A 1H2TZ 1XSPA 4JV5K 5CA5A 3SCKE 3CETA 1ZQWA 1PC5A 3PSIA 4MH8A 3MXMA 3IGNA 3Q86A 5B0FA 3TUPA 4DR3K 4E8UA 4CE6A 1RTZA 3DLKB 1FJGF 2JVOA 2C3UA 2V34A 4CM0A 3BQ0A 1V9OA 2PN6A 3P6YC 5H2FU 1K5OA 1X9XA 2RHQB 1LWEA 4FZYA 2HFNA 1R0AB 3KUHA 3E9LA 4BE1A 2DHGA 2FY1A 2OANA 2W25A 3HD1A 1ZQOA 3D4JA 4FVMA 4OKEA 4MIBA 3MWBA 4YDDB 3WNEA 1DQAA 3GQCA 2WCXA 1N34J 2RN2A 4OX7A 1KVBA 2AQ0A 2F8KA 3QIPA 2ZOGA 4LFBK 1KQGB 1T05A 5K8NA 3JTPA 1JNZB 3W66A 3TVYA 4ZVQB 3J81O 4K8RA 1VQNN 3Q7BA 1HJOA 1UQVA 5IXUA 3VA0A 4C97A 4LFCF 2GQ2A 1UWBB 2JZ5A 2NLWA 3V9WA 2ZIVA 1WTFA 1U25A 4CEBA 2IIHA 3UI3A 1ZZFA 3DLGB 1BCOA 2RHKA 2D0CA 5AQWA 2ZVSA 4YR3A 3DCAA 5F41A 4H0OA 3EKUA 4NXMJ 3VAHA 1D5AA 5IOLA 1VQ9S 1QY7A 1CUKA 4MAKA 1YJ9S 2OEKA 2FBTA 2HK2A 2HHUA 4USIA 4CNYA 4LF6F 2RUGA 4B3SJ 4K4UA 1IR1A 4P0PB 4ANDA 2PT0A 1LQ9A 3CP8A 1WG8A 4F4YA 3F53A 1W7WA 2WF6A 1CJKB 5J2QA 4DX7A 1FRKA 1ZBIA 5GAGI 2P9LB 8ICVA 2KEYA 3I6PA 4A8KA 1KLMB 2J6UA 3P5JA 1GO3F 4CNQA 3QNNA 4KLOA 3ILLA 3I9V9 4UY8T 2F9TA 3ZD8A 3H0PA 3SDEB 4I6WA 2F9JA 3C15A 1NPKA 5HRSA 2A3VA 3L7UA 4BVOA 4WK1A 5M2RA 5F8IA 3I96A 4K4WA 3WX4A 1NBWA 2Q2RA 2XMTA 5ALPA 2ZE2B 3NGUA 4UB6U 4FN5A 3IMQJ 4EP5A 3HSZA 1M6YA 1YHQS 3KDNA 4N56A 4JI1K 5HJYA 3W9JA 3B6OA 2QMUB 2W11A 4QQBA 4DCOB 4ZOSA 2D1CA 2HHQA 1ZA1B 2HQGA 5CQGA 3NRBA 1BI4B 3JAMU 2FJVA 4HR2A 1BQNA 4KHUA 1S48A 2QA4G 4CT9A 2YNIA 1IKYA 4DV1K 2DIUA 4XAKA 1KBUA 1IJEB 3KLGA 3MEKA 2ZC4A 4YXJA 2DHXA 4NZ0A 4CJQA 4KHPF 4OHWA 1Y64A 3O9TA 2FE9A 1XNSA 3BKFA 3M6GA 2WB1D 3QAUA 2OJ3A 2LQ8A 4UAUA 2DY9A 3T9NA 2RQ4A 4NO7A 4CDIA 1NNEA 4FWKA 5J0QA 4DQQA 2OHDA 3ZC4A 4PA1A 3ZLJA 4OJGA 4LF4J 2IVMA 1TK8A 2F1IA 4U7CA 4YY3F 2ZUDA 4JKHA 3LDLA 5AM0A 4DV4K 3B78A 4WCEL 3MM8B 5DS7A 1IJJA 4FWMA 3SMSA 3WK5A 1WC0A 3TAQA 3DXKB 2GWJA 2KP7A 1OSCA 1HJRA 4JAXA 5EOZA 3CCRS 3QNMA 1WC6A 2VWJA 4AH9A 1ZRMA 5KAKA 2AZ1A 3C6HA 4MIWA 5CD4A 4MT1A 5MLCV 5GAGU 2HQIA 4WFNQ 2MSSA 5J2PA 2W9BB 2JEFA 1AT1B 1FX4A 2QO3A 5KRTA 2G8HA 5IT9Y 4FPAA 2JC1A 3D66A 2X74A 2HK3A 3R7NB 2HVEA 4YMEA 2IPOB 1QSLA 3VGKA 1DJ0A 2JC0A 3AD7C 1S7IA 5IM0A 1VDVA 4OZLA 1FHTA 4S0MA 4PZVA 4PEOA 5IS2A 3SSQA 3NF9A 2O1PA 3ILOA 4LF8J 2CQ3A 2KN4A 2M8DB 4M9GA 2PKEA 2HNYB 4E7KA 4BRIA 2Z0GA 1RHUB 1RBVA 2PSZA 4DL0C 3MMAA 3MCMA 2A1AA 3MBYA 4H0VB 5AQTA 3WIVA 5F2RA 1SXLA 1GOCA 2AMCB 4CIGA 3A3PB 4JNEA 1OKJA 2EHGA 3SJHA 2F8EX 1LW0A 2Z58B 2GTDA 5CYJA 3BP8A 3VQ6A 1MMNA 3EKSA 5FPNA 3BUZB 3LWMA 4FCYA 1QDUB 3KLVA 4ACOA 4RCHA 1YITN 4O3MA 4KRWA 3UCUP 2ASLA 3HJEA 3PKMA 5J0PA 1BPEA 2OPPB 4GVBA 4UASA 4EX7A 2DO4A 4QU6A 3F2CA 2IDEA 2N4DA 3KLEA 4BC5A 1V4SA 4BRQA 4Z6CA 4X66J 3C5GA 2J0WA 5IIMA 2P6SA 2E7XA 2V9WA 2POKA 3VHQA 3MUVP 1PAEX 1SZHA 4EK2A 3D1OA 2BDUA 3C6UB 3QAEA 1BG3A 7FD1A 4UOCA 5CJ7A 2B9WA 1X0FA 1ZRNA 2VKZG 4P0QB 3DRSB 2DITA 3KVGA 1VQMS 3RJIA 3Q8KA 5M1FA 1K73O 5KL8B 1Q8BA 2H3VA 3KLFB 5FPEA 5J0RA 5DG8A 4KV8A 5AQUA 2W2MP 4IRCA 3VQAA 4ED4A 2RDJA 5DRKA 2Z56B 1YBTA 3V6DB 4OPKA 4FXDA 2KFZA 3VERA 4NLDA 2DISA 2B4VA 4DV6K 2BZ2A 3M2VA 3CJ7A 3ZT1A 4RPFA 3T1HJ 2DB1A 3EZ5A 2VKRA 2VQFJ 4BUGA 5FROA 5KFUA 1W9HA 3C65A 4ECQA 3NS6A 4Z6FA 1SL2A 4LF1A 1LFWA 3MCNA 3TAGA 1RGVA 1NGHA 2NLXA 4M6WB 3QE9Y 2KVIA 3D5MA 3NS5A 1J54A 1S72N 1HPZA 4NLTA 3BQ2A 4ZLLA 2PC6A 4USUA 3J7YP 2YKNB 4X2BA 5LL6d 3C2KA 1OVQA 5DKWA 1NB2A 5IWAF 1OJ4A 3M9NB 2FBXA 2AEFA 5EX3A 8ICWA 3DLLL 4J2EA 5GMEA 2IM0A 1C6VA 1JXBA 5DG7A 2C2OB 2CDQA 3NKYA 4KYZA 1UVNA 5EN1A 4CJUA 4I6YA 1N60A 3KFWX 3AA3A 3MM7B 3CD7A 3DU5A 1G3OA 3OTOK 2K60A 3KHHA 3A13A 3MCPA 2ZHAA 5KFFA 4DO9A 1SC1B 2GVZA 1XO1A 5JMVA 1Q8LA 4P75A 3I5BA 4RW7B 3OS2A 1KFDA 3K9JA 4PL2A 3JPSA 3AHPA 2CYYA 2YVSA 4JI6F 2HHHF 1ZXOA 2W55A 4GY2B 4UW9A 3EPIA 4N47A 3AA8A 2AJFE 4M3RA 1XQSC 4I6MA 2HRUA 4JI8J 2MDAA 3DDKA 3W5XA 4ED6A 1XMOF 4YFUA 2M0GB 3DM2A 5BPLA 3TAPA 5A0YB 3TZWA 1NH7A 4OJLA 1HBNB 4UB2A 1LWEB 1MU2A 1XHXA 3MEDB 2NRVA 1TQLA 3AA2A 2IY5B 1VR6A 5AM5A 2VJ4A 1WC3A 2KT3A 4F91B 1KC8T 2LXIA 2BYCA 4E3SA 3FKBA 4A48A 2HG4A 4IH7A 4JI5J 3VTHA 2ASYA 3N97B 4PG7A 2W9AA 3QIPB 2GA7A 1T05B 1WWVA 1L3TA 3IMXA 4X5VA 3ZZOA 3RMBA 3A1YG 1N32K 4BGAA 1FERA 1Z19A 2HEKA 2KYZA 4R0EA 3EW9A 4GKKJ 3MR2A 2I9SA 4I0WA 5J2MA 4NX9A 1YJNS 4LF5F 4MKYA 2DH9A 2QG9B 2BHNA 3QFPA 2V8DA 4CLSA 2QC3A 1O6XA 2ZIVB 4NA1A 2EK6A 2XSJA 3AVKA 1MN7A 1DURA 5E3AA 2YNHB 4FKYA 5JS1A 2MQNA 4AUKA 4JK7A 1CZAN 1AUSL 4RBVA 1UZDA 2CNOB 4ZJLA 5EWFA 3ENVA 3HSCA 4RBUA 1RHMB 1AXQA 2KJ8A 1QD1A 2VD3A 4YEAA 3R8EA 2IJNA 3F5TA 1B22A 3NGKA 2G2ZA 1K47A 2KNJA 3OYLA 4UB1A 1CLFA 4DF8A 4RQ6A 4FJKA 3VCBA 5E3PA 1S1UB 3MFIA 4ZPWR 3K2PA 2G0CA 5C42B 3TUIC 1H98A 3BBCA 3C15B 3V1OA 2ESEA 4Z2XA 4YDUC 3ET6A 4FNHA 3MMJA 3X1LB 1BPYA 3RTVA 2O66A 2MQQA 4NYPA 2KJ5A 4DPWA 5DO2A 2ZZNA 3SUNA 3KKAA 1VSEA 1YSJA 1KCFA 3GJRB 1DQ8A 2F3JA 1KEJA 2QFIA 3AOAA 4PPDA 1GXTA 4FJGA 1B70B 3DGVA 1SQGA 2V0NA 2I9GA 3KKSA 1SZPA 3ZZTA 1FFGB 2F8TA 4GO7X 1BQNB 2CN1A 1X5SA 4DR5J 2VFUA 8ICBA 1IKYB 1T95A 2D74B 2YNIB 3E9OA 1VQLS 2IOFA 4P10A 5AJ3K 5KFMA 3BYRA 1AROP 3AL0B 2LKZA 2GVDA 2AGQA 2YH1A 4EYIB 1NNDA 3VQPA 1LAWA 4QIVA 2LQBA 1REVA 1F60B 1TP7A 1VQKN 2UVWA 1CI4A 4LF7K 2CQ4A 4KQZA 3ZSWA 4BR2A 3OYGA 2XWXA 3BS5A 1D8YA 3VENA 3TAMB 4FJNA 3QU7A 2R4FA 3TVKA 4BJQA 5E33A 5ALGA 4H4OB 1X5TA 5KFVA 4CFAA 1ZQPA 3ETOA 1TZ0A 2CXYA 3KK7A 3V5RA 4DUZJ 2A6MA 2Z7JA 1U6FA 2IJRA 3HSTB 4AD6A 5CE3A 7ICEA 4URGA 1SWVA 5D4BA 1RTHA 2R7TA 2E2PA 3NAEA 2ZXHA 3PR4A 4IRKA 2F65A 3OJUA 5DM6Q 2CH5A 4Q43A 2JH7A 4C80A 2CG4A 2FPKA 2IA6A 4JD2B 4CECA 5K14A 2ZF5O 4CEQA 4CZGA 5L9NA 3MECA 4F4WA 1R7IA 2IS3A 4FW1A 3TAEA 5G4DA 2V8VA 5J2PB 1SZ2A 4EBCA 1OH7A 5IQQA 1M1HA 2BW7A 2ASDA 5AQMA 1D8LA 4PJ0U 3KHYA 2B4OA 3VALA 2HHXA 4NM2A 5B08A 5B0BA 4MF8A 1IBKF 4JI2K 4DV3F 2PD1A 3AY0A 4DKWA 3GZFA 1FXDA 3MMAB 3AT1B 3L2QA 4B3MK 3IHQB 1WC5A 1RT4A 2I5HA 1CULA 2JJ4D 4IKFA 2P5GA 3ZSZA 1QUVA 2XHBA 5DDQC 1RZTA 5AI4A 3TP2A 4CHOA 4MO4A 1H74A 1BISA 5D78A 3KK2A 3QT5A 5J8YC 2W1BA 3MGVA 3DXMA 4PQUB 2EBGA 3TI0A 4ZIWA 4GVBB 1TFYA 5E5NA 4CO5A 1I3AA 3CPEA 4CH0S 4TQRA 4MLHA 4Z4HA 3KLEB 3O08A 2DR6A 3AJ2A 1NK0A 2ZDOA 5KFGA 3CJRA 4IR9A 3N4QA 1A7GE 1J6ZA 3FFIB 1LWCB 3N7SC 4FVUA 1ZBUA 4L72B 3NHGA 4TUQA 4JP8A 2I6WA 2K8AA 4NMXA 1R59O 4NLSA 3WXLA 3CM6A 1LOUA 3V7KA 2J6TA 4FL9A 4UW2A 3AVGA 5KFYA 3FVYA 1VSMA 2CGKA 3A5LC 2EFVA 1S1XB 1LXJA 4NWIA 2R9LA 5FDLA 2O4IA 1DZ5A 1HYSA 4KV8B 2IHNA 1QZ5A 2JVRA 3I0RA 1X31C 1C4CA 4XH4A 4WIQA 3VEZA 4P4PA 1X9WA 3ZZYA 1M90T 1E4GT 4YMMA 3O6QA 1YK9A 4A2AA 3T5KA 4IO9Q 2XS7A 1K1SA 2MXYA 1N0UA 4NL5A 1TFRA 2CGJA 3M2VB 4C98A 1N62A 5EE1A 1T4GA 2HLUA 4C8YA 1IO2A 4MN4C 1GLFO 2AP6A 3OL9A 1UCNA 1ZQGA 4J9OA 2QLXA 2K3KA 5I3UA 3C28A 3QEBZ 3SENA 5C25B 4YP3A 3D3CJ 3OYHA 2Z2LA 1HPZB 3RAMA 4RT2A 1NDLA 1V5VA 4ZTJA 2NYIA 2VICA 4FFDA 2CJXB 2EXUA 2YHWA 4DSIA 1RFQA 5AKJA 4UBCA 3NVMA 4CNZA 2Y0SD 3RBZA 1JLGB 2OEJA 3RB3A 3UPFA 1Z6RA 2DTUA 3CCTA 1GH8A 4P2FA 3CXCR 1Z26A 2OM6A 1N33K 4CIFA 3K5LA 2DKZA 1FNXH 4NA3A 4PG6A 1EQYA 5CRXA 4AYBC 2W3RA 3FSYA 5IV3A 4XO0A 2IDOA 2D1KA 3MN7A 5J0TA 3MPDA 3PXGa 5JTIA 2NV3A 1HWJA 3KG1A 4OPHA 1UA1A 2Y1LB 2ZGZA 2HOFA 3KFUF 4K5RA 5L1MA 1XTZA 2OPSB 3UQ0A 3AGRA 3ZO7A 5BR8F 2NPIA 3SFGA 1T02A 4Q45A 3UXPA 3LPUA 8ICXA 3MEEB 1RCXB 3LK9A 4XEIA 2A1JA 4EWTA 2CA9A 1ZQRA 2QMXA 1I94J 3CJAA 3FZBA 4BR9A 3R8YA 3LZIA 3AA9A 3DM2B 4X62J 4GKJJ 4OX9J 4KITB 3IC1A 2C2EA 1MU2B 1NK9A 1QUPA 3HFZB 1B3TA 3D6JA 2FJAB 1IBMF 4C8ZA 1KVJA 2Q1LA 1IG8A 1YJ9N 1UMJA 3PRDA 2A42A 3D45A 1F44A 2QW9A 8ICOA 4NYFA 1P7DA 4NLZA 4OGEA 4F92B 2HSZA 5BRDA 1NNLA 4IH5A 3DHXA 2AJQA 3A0IX 3UQSA 5I4MA 4CDGA 3F2DA 4RL1A 2ZC3A 5ALHA 3IUCA 1VJ5A 5JXSA 2UUAJ 4IWVA 3KD1E 5DBAA 3PO4A 2P6RA 1HNZK 3MDCA 4PWDA 5J2MB 3IGVA 2MZ1A 3HJVA 1UFWA 2A2DA 3ETLA 5IV4A 2CQHA 1TVAA 2YHAA 2XSJB 5KFCA 3RJHA 3ED5A 2I7NA 4JYAJ 2B7BB 4WQ4C 4F2RA 2AYBA 4XK8C 1OS5A 4ZCKA 2DEIA 1NKCA 1GX6A 4LY7A 1R27B 1YHQN 4LJMA 4JKCA 2UVRA 1G15A 5JRTA 1VIOA 4DTRA 1KQKA 4FS1A 3NP5A 3VGUA 3RRGA 4WFXA 1A0PA 1RWKB 3CJ3A 3H5SA 2IM1A 2ITMA 4DUYF 3HBTA 2GX9A 3KWGA 3CM5A 5AQYA 3HOTA 3T79A 5DQGA 1ZAWA 3ISBA 5C5JA 3IN5A 5AQLA 3OYDA 3CCVS 3DYAA 1YBUA 2G9OA 3C1YA 2R3VA 4A8YA 3MXIA 1QH9A 5K8PA 3HILA 2V9KA 4OJ5A 2RS8A 4PZNA 2KT2A 2HS3A 2RMLA 4C4RA 3QJPA 3BS9A 5CA7A 2VPXB 2WSEC 1RG6A 4M04A 3IWXA 1JJ2M 1D9DA 4YB1P 2C2MB 3C0BA 3KJVB 1QQCA 5AK6A 5GTHU 4IOAQ 3EVMA 4DS5A 2IVOA 3RR8A 2VJUA 3CJCA 4FYDA 2JL9A 4MTPA 3AGKA 1H2UX 4BROA 3OVBA 1TUYA 4OMFG 2VYPA 1BNOA 2ALYB 1QTNB 2Q0ZX 4K4IA 5KG2A 2F1JA 2B9YA 2N82B 5IFMA 3O8WA 4ZPAA 1IKXA 5EU7A 1FKPB 3CCRN 3RJKA 3GZ7A 2PMWA 3OYIA 3ILIA 5BPMA 2PFUA 3M32B 1P8GA 3OJSA 2DGWA 4FJJA 2GVDB 4ZVTB 1TAMA 4CEDA 2E8MA 1REVB 1HWKA 3Q23A 1QSSA 2HQFA 2GWKA 2YY3A 1HL6A 5C24A 1PGZA 2MZRA 2XYPB 5ALWA 1FFUA 1N6QA 2YTCA 5JLFA 1CJVA 3AMZA 4C8KA 4CHPA 1GLCG 4PUOB 3R5DA 5J2GA 3EMTA 2DR7A 4GXJA 3L2UA 2DCLA 3M8PA 3VAIA 3IKMA 4EEKA 5HQMA 4FM0A 2H65B 4RO0A 3R1LA 4B9TA 1IJFB 1NDCA 1M0SA 4OYWA 3O3GA 1DLOA 3DDHA 1RTHB 2AW0A 2C22A 3GIMA 4B9NA 1RAEB 2WTUA 4K4GA 1VOMA 4ZLNA 5HHHA 2HZCA 5ETQA 3KLHA 4KO0B 1URJA 3O9SA 2GX8A 4KB0A 3BQ7A 4DV2F 2KIVA 3V4MA 4R8UA 4IL6U 1FE4A 1ULRA 3MECB 2D8CA 2IOFK 4RQNA 1KVAA 3G25A 2O8BA 4EP4A 4QWEA 1FDBA 2AA4A 2G1HA 4YR2A 3THXA 3LP3A 5CR4A 5EOYA 2BKNA 1GOAA 1R0BG 2F96A 2ILZA 2VA8A 2I1QA 1F9HA 3VEYA 4DHYA 1S1VB 3CYMA 3HKZF 2MKIA 2UUWA 1C2PA 3UXOA 2O3DA 3D7EO 1Q46A 4FJMA 4R0JA 3UKUB 4YOXA 4ZP6A 1VQMN 2XNQA 1NK7A 1RT4B 3BO4A 5I9EB 1CULB 3N79A 4B3SK 3T3FA 4ILHA 4B1WB 1RAGB 4FPIA 4RLEA 1MWQA 5ALMA 5K9FA 2GUIA 4DI6A 3P83D 2RS2A 3KK2B 3IAM9 1S6OA 2AIRB 4DU8A 4J2DA 2R18A 4PXDA 2LBOA 1L5UA 3DXMB 2MY8A 2E5LJ 1U0HA 3CULA 2IIRA 4HDGA 3CF5L 5CCLA 2QB0A 5AE1A 3WBZA 4RG8A 3OQ2A 2DYAA 3QBXA 4JV0A 1S1WA 1FWLA 4FWOA 4YNQA 1Y5LB 4FZMA 4JI0J 3ZD9A 1JJHA 3O1WA 4C2MA 1DQ9A 5FRNA 2WUSA 2KJWA 2ATLA 1XEZA 4IQTA 2HRYA 4LRBA 3EYZA 3H1QA 5AKIA 4HH1A 8AT1B 3QEXA 1HNVB 5CYMA 1HYSB 3C5FA 4UUXA 3AXMA 3CC2S 2QGFB 2WBNA 4OZ3A 3WEEA 1CEZA 3RWUA 4GIBA 5AI5A 3AVBA 1PK1A 3I0RB 1IQZA 1HBOB 1AB8A 1LK5A 4DCPB 3PHEA 4DMNA 6FDRA 3FQKA 2LDIA 3PX6A 2Y0SF 2B6AA 2UXBF 5ALYA 1TMMA 2WVEA 5KFZA 2AEMA 4OZJA 2QXLA 2R2SA 3UCZP 4HT5A 5AQHA 2HBRB 2H3GX 3Q0AA 3O2IA 2YQ1A 3NOGA 3G2XA 3FZHA 5ITHA 1MW7A 4CGZA 4M0AA 5E7OB 2WAQC 3QSYB 3H7IA 1V38A 3I4PA 1WBBA 2VBWA 3ZZ0A 1ZQ1C 1F5CA 4K8XA 3HFVA 2WTFA 3ORYA 1RT5A 4CTAB 1SKRA 2VPZB 3AQFA 2NSBA 1JALA 3W63A 1BE4A 4CQ1A 3FMBA 4Y2AA 4LF4K 2FZGB 2HFZA 9ICNA 3CVKA 3BDEA 2EVZA 1Y5IB 4UUWA 1WORA 4Q5VA 2VGNA 4H5WA 2KL8A 1DK3A 3PY8A 2JFKA 5M1OA 1ZQNA 3VAJA 4B6JA 3CC4N 1FO1A 3LPTA 3MMBB 4FLVA 2YY6A 1ZBFA 1BIZA 1SL0A 2G5IB 2AQ4A 3TNVA 2X1FA 3D0HE 5ALDA 2VQEF 4F5PA 1Z25A 1K8AT 4K4SA 2J7WA 5KAFU 3G82A 3CO9A 5HBMB 4DTXA 3Q8RB 3HD2A 3V6JA 3SQ0A 2BCQA 2V63A 2XRIA 7AT1B 3HTVA 3A8KA 2N3OA 1YJNN 1N36J 2FVRA 3ZTQA 2AYMA 1J5EF 3AOCA 1T6CA 1VLBA 2A1JB 2CJYB 5DK5A 2GJIA 2DKXA 3A5OC 4LF8K 1Z05A 3DDIA 2BE2A 2EFNA 2OTLS 5GAEP 3K17A 4CF3A 2YWHA 2KHVA 1LCUA 2VG7A 1Q78A 2NXUA 3SMZA 3ILJA 4NXNF 1CSJA 4B1XB 3QGHA 2KZ3A 4LFCJ 2UUCK 3QUCA 1IR0A 2BH1A 2KJVA 7ICLA 2Z2YB 4G1QB 3P31A 4H8KA 3TJAA 3PIOQ 4Q8FA 2ZH5A 2FQQB 3H0RB 5ALFA 2MKHA 1HFEL 1RT7A 3VGSA 3VAMA 3HZEA 3OW2R 3V9SA 4X66K 4IC9A 2DR9A 4QIFA 2ZJPL 4PWDB 2KVQE 3QWPA 4U7UD 3I33A 4M3UA 3SPYA 3BO3A 1COKA 1SC4B 4LF6J 4WTYA 1KD1O 3UIQA 2QL7B 3GCWP 3RB4A 4KB7A 3KJFB 2FVSA 2CPIA 3THPA 1FVQA 2UV8G 4C0HA 1YJUA 5J2JA 1NDKA 3GJTB 2JFDA 2WK4A 5AZJB 5AQXA 1XNRK 3ZTSA 2C3MA 1OH5A 1SXDA 4MFBA 2IA0A 4RPXA 4ECTA 1B7FA 4JI4K 2VBYA 3QLHB 4DLGA 4FPRA 4M5GA 3N01A 1PVRA 1YUWA 2L9DA 3AN1A 2P5VA 2VF3A 4K5SA 2YH0A 5E79U 3LDAA 4GLXA 1D0EA 1HW8A 1NGDA 2BCUA 5D6GA 4EBDA 5L1IA 5IQ6A 5JVHQ 3PDNA 1XNQF 2BBEA 2FJEB 1EETA 4WFZA 2CG8A 3T1HK 3CIZA 1HEKA 1VQLN 4WZQA 3SQ1A 3W8GA 4L6V3 3RYLA 4QJVA 5TZVA 3POTA 2ILYA 4Y3CA 4QOZB 5CYQB 5KT6A 1M5VC 4Y2SA 5KFSA 3L95X 2E2QA 3H0MB 4KGXB 3LPYA 4JK1A 3I1YA 1Z2LA 1W7AA 3TO8A 2W6KA 4NRUA 1Y5NB 1MWKA 4TXSA 3OHRA 5AXLA 4OJ1A 4OGCA 4UB3A 9ICIA 2MZTA 4KHPJ 3SR6A 3CCZA 4H0XB 4B17A 3EWAA 5DZ7A 1FXLA 2V4JB 2XZWA 3IWLA 3NRWA 1NK6A 1VBKA 2K06A 4EYHB 1B0PA 1X4GA 5AFUA 1ZAXA 4TYAA 4IG3A 3GTYX 3HPGA 1S0MA 1IKXB 1FDNA 5L9XA 4U9RA 3ULHA 1U2VB 3VGTA 1YTAA 4FO0A 1WLJA 2F8HA 4P52A 2XGPA 1VLOA 4KLHA 1SJQA 3RBXA 2J9CA 3TOQA 1YJWS 4JI8K 2WB4A 4JK9A 4AHTA 3MEGA 3G71S 2WHOA 4B3OA 9ICEA 3O3HA 1CJVB 3B9JA 2D0PA 4A59A 2ERRA 4KH0B 2AWZA 4JKGB 3MPYA 1BQMA 2MLYA 2F8SA 3C14A 4H54A 4DV1F 4UY85 2CAJA 3SBTA 4M41A 2DGZA 3MPWA 3VA3A 3AQOA 4J8FA 3SCIE 2XMJA 4J2BA 1DLOB 4JI5K 5AI6A 1X4EA 2DNPA 4F3QA 3ZDBA 2CKWA 4A8SA 3QJJA 1UT8A 5KFHA 2B4PA 2ZITA 2QTWA 1NJIT 3CCLS 1FJEB 4LQ3A 5AQNA 4R8UB 5DGBA 4GKKK 3M8YA 2ZBPA 4UY8O 1XO0A 2O8BB 4RW4A 2NRTA 4J03A 4DPXA 4KBIA 3IP0A 1JLAA 1IIPA 2JGUA 3CD6S 3OTDA 5DDMA 3THXB 5SZTA 2DNHA 4CH1A 4C9DA 1FD8A 2DRDA 5CB1A 1T3OA 4Y2UA 3WQTA 1ZXIA 2KE7A 4KX3A 1FF2A 4I27A 3MMCA 1S9EA 3R5AA 4B9SA 2LYVA 2FUG9 3CRXA 2H48B 3H45C 4XTTA 1YKWA 3QYYA 2J7UA 3M8QB 2G06A 2Z2ZA 3HHLB 8ICSA 4TLRA 4JV5J 3DNCA 1FFVA 2I1RA 3GWCA 5LMUF 5DDPC 3IP4B 2CFXA 4OLOA 3DEEA 4DU4A 2MU2A 2MZJA 4F5RA 5CR0A 4M5JA 2VWBA 5BN8A 3NMUA 3C6AA 4KAZA 3KZIU 4NCGA 3T5HA 3BPDA 1VBYA 1UP1A 1WYGA 2ACMA 2GCFA 4B1YB 2DF4B 2KXHA 2NXCA 2H3QA 1U0HB 4CESA 2DVIA 3PMLA 2YJEA 2QB0B 4CP5A 5HROA 4X4TA 1IXKA 2E7VA 3O4QA 2IRUA 2XVTA 4O3NA 2P51A 2ZFHA 4AP9A 4HH0A 3D2WA 1YXQA 4CGGA 1WEZA 3Q8QB 1RLDA 1UW4A 1HI0P 3OL8A 3THVA 4NRTA 4RW9A 4BWMA 2FLLA 1B0VA 1RJJA 3UD4P 2MQPA 4MHVA 2XG8A 2EBEA 4FYVB 1BGXT 4IZ9A 1ATNA 4NB4A 2ZEJA 4A57A 4PPZA 4UB4A 2D6FC 4FSVA 2OMLA 1NGFA 5J2BA 5EWGA 4TURA 3VVUA 5ALOA 5LOQA 1NGAA 3BR9A 1B92A 3BF1A 4QZFA 4Z37A 3UQ2A 1O5JA 2CJQA 3B4DA 2IRYA 1HR0F 4H0YB 2B6AB 3F5AA 2KHCA 4CJ5A 3NGDA 1K0VA 3I9ZA 4ILRA 4BRAA 1KN6A 3RB6A 3ULEB 1VQPS 1RKJA 5C2CA 3U7JA 4DZ6A 3PO5A 1HYZA 4CJ3A 1N5VA 3OTQA 2ATCB 2P9UB 3VGMA 2KG0A 1N5QA 2YMPA 2ZH9A 3GONA 4DR7F 3NXZA 3GSDA 1E6VA 3ZTRA 1F9FA 4CEFA 5CP2A 3NEKA 5D0HA 4RKUC 2KT5A 2LXUA 4KLDA 1HPMA 1R8CA 3HULA 1UEKA 3NE6A 4DL6A 4OYXA 2VIHA 4DUZK 2E4LA 1EKRA 3V4IA 2HNDA 3IS9B 2DBBA 1RT6A 2E2NA 5AM4A 9ICXA 3MM5A 2P6UA 1SQKA 1JL1A 4JI6J 4RZRA 3MM6B 4RQ5A 3BH6B 2HMPA 1MWMA 2DUYA 3D9BA 1GX5A 1N5YA 1NCLA 4OJ3A 3EE8A 3VZHA 1SB3C 2WBRA 5E41A 2OH2A 4WFAL 3CNHA 1F21A 2XCAA 4DSLA 1DHMA 3AVCA 3CUNA 1C0TB 3THYB 2RVJA 3LP2B 3J81Y 4YG2A 3HLUA 1T44A 4QPXA 5FLXY 7ICKA 2DCUB 5M2PA 4RQ7A 2IBOA 5KQDA 2DNZA 2CQ1A 1RTJB 2KO1A 2PDAA 4KPCA 1WUAA 3THWA 4RW6A 2DR5A 1ZQQA 3CD0A 1RTDB 4C3LA 4ZVEA 2OO4A 1OUQA 3QT6A 2GWSA 3AU6A 1VQ5N 3WU2U 2NCKL 4FZNA 1V3SA 2JSXA 3JSRA 4PABA 5I42A 3ATVA 1FKAF 4ALZA 2RQCA 2BE2B 3M8ZA 1HMVA 4DV7F 3C94A 1GLDG 4IBNA 3JTOA 1UHUA 4OYZA 3GU3A 4UOGA 3T41A 4CO2A 1WB9A 1XIQA 2B5JA 1P90A 2MSTA 2VG7B 1ZH5A 2Y9UA 3TZZA 3LGNA 1QCKA 2NRRA 1D8BA 4LD0A 1LFPA 4QU7A 2CNNB 2I5JB 4JI3F 2JZBB 4CJLA 2W7AA 4M7YA 3MOJB 4NLNA 4ID1A 4UB5A 2ZM6F 3IO1A 3K4GA 5BRHA 3TR8A 3PYEA 2W42A 3NBPA 4WYWA 4BX9C 1VI7A 1RT7B 4TNOA 5ELZA 2D9OA 1X9JA 3WNGA 2J6SA 4K50A 1Q18A 5GADP 1Q4RA 4I2JA 3CPWM 3AH6A 2OP5A 3V1RA 3CCVN 5J2FA 5AXMA 5LSRA 5E26A 1HNWF 2KHOA 5KPZA 3UNGC 1G1XA 1ZBSA 1NSPA 3S3NA 3CJ1A 2R8IA 3DI6A 1IBLK 1IKWA 2PZSA 2H4WB 5J1EB 2XHWA 1SWWA 2ROGA 4MFBB 4J37A 1TKXB 3TUZC 4A8XA 3W7BA 2A5XA 1B0TA 1L8LA 4FZXC 2GHVC 4HAIA 3DRXA 4I69A 3VQSA 4DN0A 2K7KA 1MSWD 1JJ4A 1HKGA 1FWKA 3RAXA 5AKEA 2DFEA 2YMMA 3VAFA 1N8RT 1EETB 1FKOA 2E5IA 9RUBA 4Q44A 4OI4A 4CRXA 3MFHA 1ZQKA 3BSNA 1TELA 3SQOP 2HFOA 3I55S 3ZEUA 5J0OA 5F8HA 3POTB 4O55A 3F5EA 1MROB 2N7CA 1T0TV 3OYEA 2QB1A 1RISA 2HBMA 5AR0A 4FVCA 3BS7A 4USVA 4A8FA 3DKDA 3C6TB 3HM8A 1VK0A 5IT0A 4PYDA 2BDPA 4K0KK 2BEFA 2QMWA 4N76A 4CIOA 5T41A 4KFBA 4FS2A 4CI6A 3A0BU 3IG1A 2KG1A 9ICBA 4BG8A 1SIZA 5LMNF 4DV0F 1HNXF 3M6XA 3QXGA 3HJFA 1KC8O 1L7OA 1Q5VA 3KK1A 1KL9A 1NOMA 2XSFA 5H1SV 3T69A 1SV4A 3NMRA 2NZTA 4DTPA 1Q16B 2J9EA 3GCXP 3IM9A 4DS4A 2GGPA 4PCQA 4IG3B 3BF3A 3FNNA 3I31A 4OJOA 2DKOB 1Z3EB 3OVAA 2BANA 3G8QA 1RDUA 2DFFA 3HK2A 4HI2A 4OJ6A 2ZJQL 2EZYA 4KREA 3EDRB 2ASMA 5DBCA 1A77A 4DPYA 4NV0A 9ICWA 1N48A 3NY0A 4IXCA 5F8GA 4RUCA 1TK5A 2OXOA 1NM2A 3NAIA 1SL1A 1I94K 4HT7A 1ITGA 1Z00B 1C0UA 2NRHA 1F3FA 4OQJA 3O3FA 1X2IA 3ZSRA 4OX9K 1RACB 4QZGA 4O4GA 2R2TA 4ID5A 2EFQA 3X3UA 2Q3SA 2LQJA 2B21A 3M30A 5ALLA 2NXJA 4QYRA 3V81A 3C14B 4X4QA 2Q3PA 5KG6A 2V2KA 4LSLB 1NXIA 1J9AA 5JJBA 1M1GA 3HPOA 2DPIA 2HQ3A 4QS9A 2OI2A 3K1ZA 1NLKL 3TEHB 2CRLA 1U1LA 1X0PA 4F3MA 2UXDK 1DEJA 3AXKA 1HQEB 4ZLJA 2FD2A 3T1YF 5EUHA 2UUAK 3DFEA 3PFEA 1Z4NA 5D4PA 2XIDA 4RW4B 3H2VE 2G13A 2H3EB 2VCPA 1UL3A 1LKYA 3QU5A 2YHYA 4KH6A 1QE1B 4TUPA 4NMLA 3O44A 4TLQA 1S22A 4RQ8A 2LECA 4JYAK 3OYFA 3D68A 1ZQIA 4E1JA 2JWKA 1N61A 4G3IA 2ZBRA 3VVTA 4G9ZA 1ZQVA 3W5YA 3WQUA 4EGLA 4OZNA 4IOBA 2KW4A 3SUOA 4M9NA 1JCEA 2E29A 3AA5X 2YV0X 3GR1A 4HVZA 3CC2N 3ID8A 3DLJA 1B99A 5HMYA 3NASA 5DQHA 4YQWA 3AJDA 2BPFA 2VUGA 2KN7A 1RZMA 1EARA 5HLFA 5HJXA 2D3O1 4Q0BB 3FM9A 3NAHA 3CJBA 4IFYB 5T7LA 2DH7A 3KLIB 1DT9A 4L74A 3TADA 3LGHA 5HROB 4USMA 1ZTTA 1RA7A 4CJ4A 3S01A 2KRRA 4DMZA 5KRSA 4P71A 4JB3A 2D0BA 5J0YA 5CCMA 1HUOA 2UVVA 4ZPDA 2CADA 4FWRA 4DXLA 1IKVA 1K0TA 1VQOS 3CT9A 2JH1A 1DTTB 1Q95G 2ZNYA 2E9TA 3I0SA 2NO4A 1JXVA 3OL6A 1LNQA 4LVSA 1GQEA 4FXVA 3KIOA 3FSIA 4OD0A 1GXUA 2DEJA 1I1GA 5GMKa 1U7LA 2WBMA 1NZAA 1U6BA 4CJEA 4C11A 3FUYA 2YNGA 4FWNA 5KFJA 2X3DA 2DNKA 4U8YA 4IJNA 2B56A 4WYLA 1Q7LB 4DTNA 4FKXA 2U2FA 6AT1B 5J0WA 2DHHA 1HBMA 5ALJA 3PSTA 4CBUA 1UOCA 1OQ3A 3KDOA 4MK8A 1HQ2A 2VG6A 3RBDA 1QQ6A 3US5A 2PFQA 1EQ0A 4KN4A 4H0PA 1VQ8S 3IXQA 1RAOA 2RHFA 4DF4A 4RT3A 4DOZA 1NPRA 3P96A 5BXIA 2GUPA 2C42A 4OZ5A 4TQSA 3ZI4A 5CZ1A 5EXWA 1RADB 1RDCA 1JLEA 4DR4F 2BJ3A 1XJWB 4RQ3A 2OTLN 3RVCA 1ZQDA 4JOUA 3SI6A 2DT9A 5BR9A 3O6WA 2JX2A 1UEVA 2JDJA 3BJYA 4ZHRA 1PBAA 1CPZA 2W40A 5BR8J 1A6SA 1PJ5A 1JMTA 2BJDA 1L3UA 2XZDB 3TABA 5D0RA 4GNIA 3AVAA 1N5YB 1NOYA 1KHVA 3R6GB 4ES1A 1CQMA 1U4BA 3M6ZA 4UF4A 3S1TA 4KH5A 1XI1A 5KFLA 4YOTA 1SIWB 5ETNA 5SUHA 3C46A 2DD8S 4BC3A 3EGNA 1IBMJ 4NM1A 7ICFA 5LL6Z 3NVKA 1BU6O 3THWB 3TQ1A 5IIKA 1SQEA 4RW6B 3VQDA 2A19A 2EANA 4DQSA 3LDPA 4IJAA 2RF2B 1U1MA 4J90A 2RKIA 5J1NA 2W2OP 1ATSA 3LDSA 2WFBA 1BPDA 4ILLA 5GAHP 3OTCA 3OUYA 5EE0A 3NVWA 1HMVB 4M2YA 1LOTB 2UXCF 4FWQA 4DSKA 3T6BA 4KI6A 2PA3A 5AJ3J 3ICXA 2B5JB 4YN3B 3SFUA 5BPCA 4PHDA 4ZMMA 1FFWB 1H2VZ 4C6AA 5U47A 1VSJA 2ZWHA 4WQ5A 2JLFA 1V5IB 4K43A 2E66A 3H7HB 1M90O 1MNEA 2H3FA 4BRPA 3IRWP 4DR1K 2Z1IA 1YLXA 2E5LK 2EW9A 2E1ZA 1WSVA 5E3QA 2Y9HA 4MLEA 3NBPB 4L3NA 5J2AA 3AO5A 2QYCA 4OLBA 2DBYA 1YJVA 3IDWA 5ETOA 5AI0A 3OHAA 3QEPA 2ZJ8A 2YWEA 2D3OR 4TY9A 3HVRA 4FBTA 2IVYA 4E89A 4BRNA 4I2EA 4Y2XA 5A2QY 2GNKA 5IT9O 4A4JA 4CGHA 1IKWB 3DLRA 4AXJA 4CZHA 2PI5A 1TFWA 3DV9A 1WN7A 1YQHA 5JICA 4ZCIA 4GVMA 2KLAA 3QRPA 3OXLA 5HOOA 1UPMB 3AD8C 2W9CB 5DM7L 3CERA 4DPOA 3KUGA 2FJBB 1W26A 2GEMA 2IRXA 2OCEA 1T9UA 4RNMA 4KTQA 2LCWA 3ATUA 2PEBA 1TMJA 1ZA2B 3HDSA 2WVCA 1XHZA 1FKOB 4AQYK 4JI2J 4C3KA 4WCEQ 2IAJA 3KG4A 4UZBA 4JI7F 4OIXA 1YF5L 5J29A 3ZEUB 4J9UE 2Y8YA 3ONNA 3MI7X 5H9EK 4FM2A 5ETPA 1O03A 1YJWN 4EX6A 1JJCB 2M5YA 4AM6A 4X4NA 2J5AA 3G71N 3CG7A 4ZVOB 2YHXA 2LU1A 4DX5A 3IG1B 3QU2A 1UZHA 4UB8U 2W24A 4OLAA 4I2HA 3RRKA 3P45B 2XY7A 3PACA 5AT1B 4RNFA 3LZJA 1WNEA 1MN9A 2MYFA 2W6LA 4B08A 1X40A 2YKAA 1NKBA 3OTEA 1KDNA 4PGYA 1L6NA 3OFFA 4FOEA 4OO1J 3CCES 4DLEA 2BANB 2XGQA 1R89A 1TTHB 4YMNA 3CCLN 4A8WA 1SGGA 4H4KA 3I82A 3SQGB 4Y2PA 3TSPA 9ICUA 4LR9A 3R1HA 1WSRA 4RNOA 3CD6N 2GS8A 4RUAA 4J9LA 3TFSA 4CHNA 3LM2A 4OYBA 4LH5A 2E3TA 2GMHA 4C1NI 2G8KA 1JIHA 2FGOA 4Y2MA 2VPYB 4IDKA 2QL9B 1XN9A 2QLTA 4DV2J 1Y10A 5ALTA 3R3TA 3V81B 4DL4A 3HMJG 2LYBA 3D6FB 4LFCK 3PMNA 5JLHA 1ZS6A 4Y2JA 2E9ZA 1VBZA 1Z4OA 4ETXA 1SJ1A 1XWLA 4AM7A 2HHWA 3UN5A 2EC0A 1ASWA 3CDWA 1C1CA 3CDBA 2D3DA 1TYQA 5B0GA 2FJXA 3AQEA 3TFRA 5AI9A 2BCVA 1HQUB 4DX8H 3GYNA 4HL9A 1WSJA 3L3VA 2O8CA 4DFDA 1VHFA 3UO0A 5T7BA 1NBEB 3D6MB 3LALA 3F73A 2JRZA 1Y7PA 4EFHA 3GYXB 1LKYB 4LF6K 3A5NC 1PYOB 2LPEA 2W43A 3PEHA 3O1BA 1MA9B 3TRGA 3RZAA 2B0GA 3R9KA 4FJ8A 3DOKA 3D54A 3PYFA 4B3RF 4QS7A 1J2MA 2CWXA 4N41A 1N34F 4CIEA 3GSIA 2VOPA 2GIQA 4BBYA 4KLQA 2LA4A 3ITHB 2IOCA 2FLPA 2ZBCA 5AQVA 1HD0A 3H3NO 1VHXA 4C4WA 1RCHA 1VAZA 3H2LA 3CFRA 2G08A 4ED7A 2DY4A 1SH0A 1RHKB 2OA8A 1TL4A 4ATNA 4OI0A 3P3DA 3DDNA 4TYBA 5CWRA 1CC8A 2OZMA 3C3LA 3QZ7A 1VK8A 4I67A 4OL8A 1CVJA 4LRAA 4FJ9A 2OTJS 2A1RA 1BHNA 2QN6B 2Z30B 1TL3A 5M1NA 4M3XA 2V4QA 2KICA 1SQFA 4C7YA 1RT1A 1Q7YT 4EI2A 3DLLQ 2V6AA 3O1LA 5HLFB 1Y00A 3SMVA 3L09A 5BYRA 2B3TB 3BZQA 1OMSA 3F0NA 3W1YC 4CJWA 5F8LA 1VQPN 1TE2A 3B82A 4IFEA 5T7LB 4IFVA 4NXMF 4B8CA 3O5BA 2HGLA 2LEPA 3V9ZA 1MWYA 2RQ5A 4GO5X 2HCFA 1UETA 2P9EA 5BJRA 1X3NA 3SK3A 2PMZF 1NKEA 2COLA 2OD4A 2HAFA 5C12A 4I2PB 4B3SF 3DRPB 3VQBA 3SSRA 2UVUA 1GT8A 5KTQA 2JOQA 1J53A 3QFHA 3VQ4A 3MX2A 2GQQA 1ZOLA 3VESA 2ROEA 3PHTA 4M63A 1TL1B 3H5XA 3KKFA 2D4WA 2ISOA 2P9PA 2PFFB 4O4RA 5AK5A 3JYTA 4U67L 3GFYA 1NGIA 5D3GA 4KHPK 3I0SB 2KIWA 3DOMA 3G86A 3AVLA 2VJ5A 3JSMA 3PKYA 2E8NA 4P2HA 4ILMA 4CF1A 1FVSA 4LSNA 5AKLA 3L2RA 3D6HB 3QYPA 2GMJA 3CIPA 3UVJA 2YNGB 4PKGA 2A40A 1OSDA 4MO5A 4RUBA 1SJRA 4R65A 2FC9A 1KOHA 2FHJD 5KG7A 5CZVA 3W60A 5KT5A 1HBMB 2KSOA 1J2NA 2QFJA 3ZXWA 4ILJA 4HKQA 3IBFB 3HKWA 2MGZA 3VEOA 4YMOA 4Y0FA 2RUSA 4P73A 3EVOA 4ECUA 2JH3A 2J0XA 8ICCA 2KU7A 2V8PA 1GOBA 3SAGA 4CK3A 2OYYA 4FM1A 5J2CA 1F1BB 2O8FA 3GDXA 4OLPA 3FZFA 4KH4A 4DSEA 1WHVA 1COOA 2VQEJ 4FLYA 2VL1A 1QVGM 3C1ZA 3DOLA 3BKTA 1S5ZA 3C2PA 1NU0A 2IM2A 2GV1A 2BJEA 4Y00A 4HHUA 5F0UA 5AE2A 4YOWA 1Y9OA 4EFAC 4ZHRB 1VYAA 2H4YB 3HKZC 3UXNA 3AU2A 1JLQB 1VHIA 3JQMA 2E1CA 1WWUA 4WP8A 4IO8A 2FDRA 1VRUA 1J5EJ 2VASA 1TL7B 1XC9A 3HHLD 2QWQA 2HBYB 2VOOA 1TUUA 3LQVA 1KTVA 1WI6A 3KMSA 2DQNB 5ALXA 4B1ZA 4AT1B 2R7YA 3D3BJ 4C3MA 4CI0B 2KHQA 3EZUA 2CQIA 4YOVA 1FWPA 2HFVA 3AV9A 4P7TA 2K4IA 3CDEA 4IS7A 5JVGL 4JKDA 1I5OB 1XU4A 4Y2QA 3MCOA 4Z0UA 3OUYB 4IOAL 3A4TA 2CJBA 1XMBA 3IR5B 5HMLA 4USJC 2ZOMA 2IYGA 3SPZA 4N8NA 2IDLA 4ZN1A 3PX4A 2NNWA 4IQVA 4DV5J 1RXOB 3N9UC 1PVQA 4USHA 3OHBA 2YBVA 2LU2A 4EUVA 3LYSA 1A6LA 1KVIA 1U8WA 2J76E 3EUNA 5IZHA 4DBQA 3N4WA 3BZKA 2DNMA 4KHYA 4Y1CA 2V8GA 4CHYA 4KHNA 1ASUA 2VFTA 3I55N 4BR5A 1Q81T 1GLAG 2E1RA 3AA4A 2Y0SC 1ACMB 1PK3A 4CM2A 3AO3A 3VEVA 3JQKA 3QRQA 4M5DA 1S5LU 1WHXA 2M7SA 2W04A 2R7WA 2ZGYA 1XNQJ 5DGAA 5EX5A 1I3OB 1NHVA 5HR7A 2Z4PA 1H3DA 5A8RA 2C3PA 1JN3A 2KM8C 4R63A 5D4LA 5GADI 3FMWA 4AILC 2Q1NA 2XLIA 3IBCB 2M3DA 1DRGA 3SUPA 2UUTA 2J7KA 3EZOA 3P4UB 1E6YA 2YKMA 3DHWC 2R7VA 5LSLA 2YQ0A 1S5JA 3DU6A 1T11A 3U9DA 1K8AO 2HVIA 4OI1A 2HBKA 1OWXA 4LR8A 1T6DA 2CPXA 2IAJB 5CHIA 5IWAK 4JRQA 3K57A 5DLFA 5FRMA 5B0CA 2P2CB 4ZN3A 3IRXA 2O4GA 5HMWA 1TAQA 3OXFA 5CXTA 5HI7A 1IVZA 3VGLA 2ASJA 3CCQS 1FIQA 2CH6A 5AXKA 3MABA 3HF5A 1K8KA 1KTQA 4O0IA 1Z4UA 2PYLA 4UAWA 3EGWB 4K4VA 7ICIA 2KKZA 1OXJA 4RU9A 1GMWD 3GPAA 3ENOA 3MOZA 4DJBA 3HW8A 2BV3A 2HOIA 1NZ8A 2E1PA 4JI6K 3FK4A 2HHHK 1VSIA 2MQOA 2VQFF 4M95A 2JR5A 1FK9A 1S6QB 1XK8A 1MQ2A 1XMOK 3Q83A 3TU5A 4CO0A 1HI1A 1RWWB 2FIUA 2KRBA 1BOTO 3AFGA 1IXRA 2ZH6A 1TUWA 2Z1GA 1C0GA 3VGVA 2V94A 3K5OA 5KT3A 4X64J 4AFFA 3MXHP 1EQMA 4IG0A 3MHYA 1IN0A 2XULA 2A41A 2QWPA 2MUTA 3MUTP 1U04A 4Y2VA 2V2VA 4BRGA 3TANA 4MQ3A 5AI8A 3OSPA 2FF3B 3QBWA 5AQQA 1GAOA 2EEYA 2RQKA 4I64A 2QWMA 1ZJNA 1HHTP 5AKHA 4MYUA 4IDKB 3SJJA 2BM0A 1XMQF 3NGTA 3J80Y 2G07A 4XIUA 1RWVB 2G4BA 4OCZA 2QI2A 3UKRA 4F0MA 4L73A 4FF2A 3B6PA 2DRBA 4O23A 1Z1ZA 1ZQHA 2EI5A 2NUUG 2FLNA 1TYQB 2RQMA 3MAAA 1S8OA 3Q24A 4OI2A 5F8NA 2FPHX 1CG2A 2WRMA 2KHDA 3CJ5A 2XMAA 3QMLA 2O8CB 4H4MA 5DMRA 2W4DA 5M1QA 3RJMB 1RDFA 1RDRA 3KJNB 4ELTA 1WELA 1SV5A 5IIJA 1ITPA 4MYTA 3VAKA 2UU9F 4JHDA 1X5OA 1UTAA 3E8OA 2VWKA 4KHQA 4N77A 1SV0A 3QZ8A 3MZIA 2PFPA 3DOKB 1RT2B 2JLEA 3TVZA 1RTIA 3CPWR 4DTOA 4IUFA 2ZBIA 1X5PA 3K0JA 3DRRA 2ZIUB 1ZM9A 2DNRA 3MGJA 4I2QA 4M3WA 1AQ6A 2G09A 5A8KA 3TJ9A 4ISGA 5KG5A 1VQON 3O4WA 1JCGA 1QAXA 5GAGP 4ER8A 3ZDCA 3QX7A 4ZS6A 2R2RA 2FBYA 5F3ZA 5CY4A 1S6PA 2P9GA 1JK9B 2WSFC 1TU0B 2MLXA 4O8UA 3NWRA 1CJTB 1H7WA 5FPDA 2B51A 3SXLA 5FD1A 3CQ8A 5BYSA 4PHEA 2RDIA 1UWAA 2HSTA 3K0SA 2KJ9A 4DN9A 4YCXA 2W01A 1U0SA 4UOFA 4C7ZA 2C3YA 4ZVHA 4UZCA 3VQ5A 1R6YA 3RJEA 3D7SB 2LM4A 4TY8A 3AEVA 2K8CB 2B6GA 2YX7A 2ASOA 4IFVB 3W62A 3G6ES 4HUGA 3SV4A 5KAIU 3KHLA 1SH2A 3KZBA 4O3PA 5L1KA 2UUCJ 1OQ6A 2DY1A 3G10A 1VQ8N 2EZXA 2E9RX 1UPHA 5FP0A 4ZVFA 1D4XA 3OW2M 5HL7L 3LOUA 1V85A 1KVKA 2P9PB 2H3ZA 2PMHA 1U09A 3JYTB 3M6UA 1T3QA 2CXEA 5J0XA 4BXOA 3CJ0A 4IOCL 3CFOA 1V3ZA 4YHHJ 3J7AN 4R66A 4PXEA 2ZIXB 4LSNB 1HD1A 4KPYA 1F0XA 3O4NA 3QEVA 1Q3VA 1NJIO 4G65A 3ELHA 2XM3A 1XNRJ 2OPQA 2W2PP 2HIQA 4CEAA 2RD5C 4JI4J 1JLCB 2MGZB 4NL9A 3AUOA 2M4MA 1V3RA 4KBOA 4CEEA 2QIFA 3BREA 1XS9D 2UUBJ 2B4UA 1YZ7A 2LHTA 4CVNE 3FE1A 4NLVA 3RR7A 4TVAB 4DFMA 2O8FB 4ZVGA 3D2SA 4FYWB 2YWWA 1JNRB 4J7CA 2FPMA 2RRBA 2VJVA 3BPSP 3W3DA 8ICKA 2D69A 3DOLB 4DR5F 4Z4EA 1JLFA 2K89A 4BG9A 4XDDA 4NLXA 2CPRA 3VMFB 3OR2B 2QLBB 3IM8A 4J5OA 3FCHA 3HT0A 2V51B 3JPTA 2VGMA 4C8MA 4DR6F 1RHRB 4U8VA 3SEOA 3HO1A 1B7YB 4I2GA 1WKJA 4CHQA 1EP4A 4QZAA 4XH1A 5A6WA 1JB0C 2M88A 1FX2A 9ICGA 1VRTA 4HHHA 1B4FA 4L75A 4X4SA 4F5NA 2BRKA 2D7SA 3QEAZ 3CJTA 3CCMS 2VPWB 1X9MA 3QETA 1RU1A 4OHZA 3PCOB 1REGX 2H5XA 1UVLA 5D46A 2R7XA 5LXYA 2CZ9A 3NCPA 2FC8A 1L3KA 4JI3J 3HVTA 4MJKA 4QOTA 2L9WA 4USKA 1P9QC 2E20A 9ICHA 2F63A 2GHWA 2ZM6J 1RU2A 2PIIA 3NF7A 3LP0B 1EIYB 2GJ2A 3W9HA 1QLNA 4KHMA 4BR7A 1NGCA 1RA6A 1ROFA 3MUMP 3PFOA 5B8HA 1XR5A 4NLYA 3ENHA 2A2CA 4BDZA 1NK4A 3HFKA 2QKBA 2JEIA 4QZDA 1CQNA 4FJIA 5KFBA 4PQAA 2EK1A 2XY5A 5AKZA 3L3CA 5HP1A 4BGBA 3H59A 2J0SD 3W3SA 3WKEA 2P9NA 4BRMA 3PYDA 3MC1A 3I5AA 2E88A 2KVCA 2X1GA 9ATCB 4CW7B 3V7JA 4GXKA 1HJPA 1OW5A 2ZG6A 1WD6A 5CD4H 2AYEA 4FO6A 5ADXA 2BE9B 1XERA 1XSNA 1FRLA 5D15A 4RQ4A 1IQTA 1ZQMA 5IIIA 4FP9A 4J9KA 5A8RB 4FWLA 3LGMA 2NZ4A 2QV6A 3M8RA 1T3NA 1WAFA 3QRRA 4Y2IA 3M1VA 5J2NA 4IEEA 3RW7A 1ZTWA 3A8IA 3WXIA 4Y65A 1S7HA 3BV8A 3M2RA 3MPUB 3CCEN 4B3TF 4IO1A 1VS3A 3GBTA 4ZLPA 2L9NA 3U9ZA 1W25A 1EWRA 3ZX2A 4LF2A 3ZZRA 1TKTA 3IRXB 4P74A 2VKQA 4RPYA 4ES2A 1C1BA 2EFPA 2ZD1A 1Q9YA 4OHXA 5LMNJ 2XO6A 1MMLA 4DV0J 1HNXJ 1KW4A 1EAYC 5KFWA 3V6KA 4I7FA 4KTZA 4MFCA 2HHPA 3PR5B 1K8KB 1U8SA 1Y4ZB 5J2QB 1PVPA 4K59A 3GIRA 4J9QA 2CPJA 4JMUA 4QYZJ 4P6QA 1KONA 3V1QA 1N52B 1TL5A 2G0JA 2AJ1A 2Z8QA 4JKBA 1WG4A 5BR8K 2YX1A 4KKOA 5THWA 1N5SA 4NLBA 2IVNA 1S10A 4ELVA 1FFSB 3MN5A 4GMJB 3JAMY 4RPZA 4M5NA 4OHVA 4BS2A 5DBBA 4I2CA 1WUUA 4BRCA 3J7ZT 2CQ0A 1J5OA 1ZD3A 2E8OA 4ECRA 3T5JA 5J2EA 4F04B 2VANA 5KNIA 5DB8A 3ZSOA 2IFXA 1NMDA 1TVRA 4IG0B 5AZIA 3OS0A 1IBMK 2HHSA 1WNSA 4FW2A 1YDLA 3NF8A 1YVUA 1QM9A 4E7IA 2EKNA 4WXOA 2GJFA 3CJ9A 1X4DA 3FQLA 2WHEA 4YB7A 1GTEA 4JS4A 3CF5Q 4QWCA 4K41A 3DLKA 1RXVA 2Z1HA 3SBGA 3G6YA 2RAQA 3VV2B 3KLGB 2MKJA 1BPZA 2DL0A 1RCOB 2AHOB 4LIRA 4NYOA 1F2HA 2RU3A 3JB9k 3VTIA 4Z4CA 4HHJA 3QUBA 4QWBA 5G0RA 1RDDA 3RMCA 1N8RO 2OTJN