1NK7A

Guanine-adenine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
molecule keywords DNA PRIMER STRAND
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk7A01
4CK2A 5HRPA 1LAVA 4F50A 4E7KA 4ED6A 4K8XA 4RQ8A 3CFRA 1S0NA 4F8RA 1ZQBA 9ICNA 5HP1A 4NY8A 1S9EA 1VSKA 1WLJA 4ECRA 1XC9A 5I42A 3JYTA 4FBTA 4DS4A 1TKZA 5J2HA 1TK5A 4H8KA 1CXQA 4FJMA 4YQWA 1EKEA 1A5VA 4FM1A 4LSNA 3EWAA 3MFIA 4CJQA 3OHAA 2F1JA 1T4GA 1RTHA 3AVJA 1S1WA 2OZSA 5DDYA 3Q8PB 3SV4A 5HHHA 3VN5A 3B0YA 7ICMA 1HYZA 2C2DA 9ICFA 3UQ0A 4TQSA 4FJGA 3DOKA 3NH1A 4KMUA 4I29A 3TI0A 4DLGA 4M3XA 3KK2A 2OWOA 3EW9A 1RTJA 3Q8LA 3HJFA 1L3TA 4FBUA 4JWMA 1VRTA 4CGHA 1AROP 5KRTA 4ECYA 3TAMA 2BPGA 1Z26A 5KFQA 4O9MA 4F92B 4GLXA 3BQTA 3P83D 2MUTB 1IXRA 4KO0A 3OYJA 4I7FA 3RBEA 3NDKA 4F5OA 3ISCA 4DFMA 2D0BA 3MFHA 1QSLA 4CEDA 4MF8A 3GILA 2W9CA 3K75D 2OYQA 3V6HA 3QE9Y 8ICXA 4KB1A 4UBCA 1EXQA 4K8ZA 4QZHA 1ZBFA 4FLWA 1HJRA 1WCNA 3QNNA 3OYBA 4QWEA 3ZDCA 4CEBA 5J29A 2HVHA 2BHNA 4ECUA 1Z00A 4IFYA 4YP3A 3I8DA 4RZRA 5EOZA 4JRPA 4FLXA 4H4OA 4M3WA 4YG2A 3AA4A 3HT3A 4M3UA 3SI6A 4Z0UA 5J2EA 3THVA 4E19A 3K5MA 2XCPA 4EP4A 3OYIA 5KFMA 2NUBA 5DLFA 3TARA 5K14A 3K2PA 4HTUA 1NKBA 4CF2A 2AQ0A 3LZJA 3RMAA 1BGXT 4F3TA 2KFNA 5BPCA 4FW2A 4DMNA 4RQ1A 1V9PA 5J0PA 3CFOA 4RUAA 4KHNA 4EEYA 3VQEA 3PR4A 1JXLA 1C0MA 4FM2A 1BL3A 4PGXA 3O3GA 3QERA 2H5XA 1XHZA 2R8HA 4DU4A 3T1AA 2ZJ5A 1BPYA 2F8TA 3BQ2A 1BISA 4XUSA 5DBAA 4E1NA 1JN3A 3VA0A 4QZIA 4P4PA 3HVRA 3SJJA 2KTQA 3WNHA 4QZ8A 1CLQA 1IM4A 1HRHA 2PXIA 3HK2A 4KLUA 1RILA 4I2GA 2W9AA 4DFJA 3P5JA 2ZQBA 1K1QA 1DLOA 4RQ3A 1S6QA 3ZSOA 3G6VA 3KKRA 3S9HA 1UT8A 3AO1A 3L2RA 4CERA 2IHMA 5IIKA 1WNSA 1XO1A 1NOMA 2NRTA 3OYKA 2DFEA 2FLLA 2BANA 4Z4HA 1KVCA 2I9GA 2ZE2A 3HXMA 3QEBZ 3OYAA 2BKEA 4FJJA 8ICTA 9ICQA 1IO2A 4LH4A 4CK1A 3TFRA 4CHOA 2F1HA 3OSPA 3AO5A 1U4BA 4CF0A 3PNCA 4JRQA 4R64A 4EYIB 1RXVA 3AVBA 4MFFA 3RR8A 1RT3A 1UA1A 3PY8A 4QWAA 3HPHA 2PY5A 4TUPA 1ASVA 1S9GA 4E7JA 4TSXA 4YR2A 2FPMA 2M9NA 3SZ2A 4CJ5A 1RT1A 3VQ4A 3V81A 5FDLA 5L1KA 1C1AA 4NLNA 4WE1A 5KT7A 4E1MA 3BQ1A 4FYDA 3ZT0A 7ICEA 4K4HA 2IBKA 1LB2B 5EWEA 4CJUA 2P5GA 2YKMA 1JLAA 3QIPA 3ZT4A 4PHDA 4XQ8A 4M04A 5J2FA 1VSMA 1MSWD 3VQQA 1RT6A 4MEYA 9ICAA 2NRWA 3GIKA 3T5KA 1L3UA 3LP1A 4AH9A 1T05A 4OLAA 1JIHA 3CM6A 4Q8FA 3NH2A 2GUIA 2ZTCA 3MDAA 8ICRA 3K58A 4NXZA 3C1YA 1YT3A 3DLBA 4PHEA 4M9GA 4FJ9A 1FKPA 3ZSZA 2D5RA 4FXDA 3MR2A 3UPQA 2NRZA 1D8LA 3PR5B 1U49A 4CHNA 1ZQKA 4PHPA 1NJZA 1TL3A 3VQDA 1L3VA 5KFEA 3C2LA 1UWBA 3MABA 1KDHA 3PX4A 2C2EA 4ECQA 3KHHA 2DY4A 8ICJA 3AVCA 2KZ3A 3E2EA 4C8KA 2RN2A 2D0AA 2HHXA 4RQ2A 4MFAA 2C28A 4P4MA 2BR0A 8ICNA 2RF2A 1DTQA 4P4OA 5KFUA 4KTZA 2VA2A 4KLMA 3LZIA 3NHGA 3OSNA 1BPZA 2FBTA 2G8FA 3O4NA 4O4GA 4OKJA 1S76D 3PUFA 7ICOA 5J2DA 5KFTA 4AHCA 5DLGA 4F4KA 1ZQVA 1K1SA 3TAFA 2UVWA 2DFLA 1RT4A 3DOLA 3O3HA 5J2MA 1ZBHA 3TABA 1KFTA 4ELUA 3RB0A 4O3RA 4E89A 4MF2A 2UVVA 1RBTA 3QNOA 5DMRA 1VSEA 1ZQRA 4JS4A 4PA1A 4EP5A 4R65A 2BGWA 4Q8EA 1IKYA 4R8UB 3MGHA 3S3NA 3GV7B 1X9WA 4IR1A 4CHZA 4XA5A 4CCHA 1ZQUA 5KFAA 1J53A 1XWLA 4JV2A 4C8OA 7ICFA 1GOAA 4FJ5A 3RR7A 1T8EA 3M8RA 4ZH4A 4YD2A 4GC6A 4CF1A 1BPXA 2P1JA 3SI8A 4KLIA 3LPUA 4FJ8A 3OS2A 2P6UA 2X78A 4PUOA 5KFNA 2AGPA 5J2PA 2A1JA 4DTJA 1SV5A 3B6PA 4LZDA 1TVRA 2R8GA 1ZQOA 3S3OA 4DTPA 4CJVA 2OPQA 4K4GA 4KLQA 4FK4A 3KLFA 1J5OA 9ICIA 1Y88A 3RH5A 5HBMA 1X9MA 7ICRA 4JK1A 3PW7A 3ZSQA 3L2UA 4OVLA 1DGSA 2XCAA 4QW8A 4I2QA 3JPOA 3M8SA 3G6XA 4CJFA 1D5AA 4E3SA 4FLVA 1LWEA 3CG7A 1G15A 4J9LA 3Q8RB 3RWUA 2KZZA 4NLGA 3HO1A 4M9LA 1CZBA 4UB3A 3PMNA 4E0DA 4I2JA 1BPEA 2X74A 1KFDA 3V7KA 1S6PA 4BE0A 3GDXA 4FK2A 3T5JA 3OYCA 4KN7A 5DDMA 4YMOA 3AV9A 3QETA 1BI4B 4DTSA 1DTTA 2YNGA 9ICVA 4BXOA 2VG5A 1B9FA 5JUMA 2F8SA 4UB1A 4M2YA 4UBBA 4KAZA 5EU7A 1XSNA 1JKHA 4J9NA 3TFSA 3SPZA 8ICEA 2IC3A 4DL5A 3ZSRA 1HNVA 4I2IA 4B9SA 8ICLA 5KFJA 2KW4A 5L1IA 4I2EA 4QAGA 4KI6A 4F5PA 2J6TA 4NCAA 5KGXA 1ZQJA 3IS9A 1IKVA 1ZQGA 3L2QA 2UVRA 1A77A 4CF9A 2WTFA 3ISBA 1NK7A 1TAUA 1Q9XA 1RDBA 4FLYA 3RAXA 1O1WA 1CEZA 4RW6A 3MXJA 3PO5A 1TL1A 2ISPA 4FO6A 3OYGA 3NGZA 3VQ7A 2DTUA 2BE2A 4RPYA 3SQ1A 4IQTA 3TANA 3QINA 3HM9A 4N56A 1QHTA 2IOCA 1KEJA 1YTUA 1FXXA 4B3OA 5DB8A 1S97A 3ALYA 4QZGA 3ZSYA 1ZQIA 3PX6A 1SUQA 5KFVA 5IIJA 3SNNA 5CP2A 3T3FA 1X2IA 1LW0A 5FRMA 4QZAA 3K57A 4IFVA 1HNIA 4CJSA 4W5QA 5D49A 4KLFA 1WSGA 3C5FA 2O4GA 1U48A 1C1BA 3L3VA 3QEIA 4DTMA 5HLFA 4FZZA 4AHUA 1HPZA 3DLGA 3CM5A 3DM2A 4NM2A 5C42A 4B08A 3OJUA 5L1JA 3SUPA 3OVNA 2BCSA 1S0OA 4EZ9A 2D0CA 4YVZA 1VSIA 3L3UA 2JLEA 5KFCA 3MR6A 1RT7A 5J0SA 4AHSA 3ZCMA 9ICMA 2J6UA 4Z6FA 4CFDA 1IH7A 5KFPA 2YV0X 1HQEA 4I2FA 3I0RA 4KLLA 3V9SA 2ASDA 4RG8A 8ICOA 1WAJA 9ICTA 2MUTA 4DTOA 4ID5A 4N41A 5DQGA 1RBSA 4NLZA 4QZCA 4XRHA 4OKKA 4QZEA 4ED3A 4BWMA 1QTMA 3RJHA 4NCGA 4KFBA 3QEAZ 3DMJA 2GWSA 1D9DA 2JEJA 1ZQPA 2BQUA 3OS1A 3GFKB 3K4GA 4O5BA 4HVJA 4BDZA 5D46A 4CEFA 3G6YA 4YR0A 4CFCA 4NM1A 3AVLA 4DQPA 4M9HA 4O3OA 5KT6A 3HYFA 4YNQA 4M0AA 4GXKA 4CESA 2P5OA 3L2VA 5JS1A 4ED8A 2W9MA 4J9PA 2G8IA 4RUCA 1U47A 4I2AA 4MEXA 4O3PA 2W9CB 1Q8IA 2AGOA 4IRCA 4J9OA 5J0RA 3C6UA 3DYAA 3MECA 2LYHA 1S9FA 3L8BA 3RMBA 4I27A 1TKTA 3DLHA 1YVUA 3LDSA 2G8VA 3AVHA 4CJRA 5CY4A 1KVAA 4DL3A 4M6WA 3QZ7A 3HL8A 2RKIA 3AU2A 3EZ5A 2FMPA 4NLKA 1KVBA 3KK3A 3PW5A 3KHLA 4B9NA 4YXJA 4ECTA 3LDAA 5KFZA 4PH5A 4DO9A 9ICEA 4F5QA 1T3NA 1J9AA 1ZQMA 3IG1A 1QS4A 4J9QA 9ICUA 3BDPA 2PI5A 2KQ2A 1HQUA 4AHVA 5J0QA 4FJHA 4DQSA 3CQ8A 4N76A 5KFSA 3RTVA 4RU9A 4Q0BA 1I39A 5KT5A 3OGUA 3ZT2A 2DPIA 4TQRA 4KTQA 3AVKA 1S5JA 2JEIA 1CUKA 1LWCA 3HX0A 1HUOA 3M9NB 4DF8A 3N4MB 2PFQA 4O5EA 3VQ8A 1MU2A 4DQIA 2IA6A 4PGYA 1JLFA 2XC9A 3M8PA 2DPJA 1S1TA 5J0WA 5CB1A 1GOCA 4C8MA 5IIIA 3ZD9A 2XY6A 3C94A 8ICHA 7ICVA 1KLNA 4I28A 5CR0A 1JXEA 1TV9A 4Z4CA 2DFHA 3O4QA 3VQBA 3RRGA 9ICOA 4UAWA 2DFFA 4Z4FA 3DRPA 2W9BB 4GW6A 3GIIA 4ZHRA 1BIZA 2O4IA 4F91B 3PO4A 3ASMA 3UXPA 3SUQA 3KTQA 4CGGA 3PV8A 1XHXA 3VA3A 4DSJA 4O0IA 2FMSA 4NYNA 2XO7A 1NJYA 2W8LA 4J2EA 2G8HA 4M47A 1S77D 5FRNA 1EX4A 3PW4A 5J0TA 5J2GA 4QWCA 4KHWA 4DG1A 4DU1A 4KHSA 3AA3A 4M3RA 1ZQWA 4GVMA 1Z25A 3KIOA 1ZQDA 2F1IA 2IMWP 1RDDA 4KLDA 1WAFA 3ZSXA 1BCOA 2E6LA 3VQ5A 4CEOA 1BCMA 4JWNA 1ZBLA 1Q9YA 1RBVA 4AILC 3NGDA 3KLGA 5KG7A 3Q8SB 8ICIA 4ECXA 4KITB 1IKWA 5DGBA 4DS5A 4OGEA 3ISNC 4B9LA 1VRUA 5J2AA 3NAEA 3NBPA 9ICCA 1D8YA 4IRDA 4CEAA 2B5JA 2Z1JA 3SUNA 1MC8A 2RDJA 1IKXA 5SWMA 3LP2A 4KTWA 2Q0ZX 4I9LA 4ED7A 5KFBA 4Z4IA 3JPPA 2HHVA 2AQ4A 1YTAA 3LANA 4DTXA 4CEZA 4CJPA 4FS2A 3F9KA 3V7LA 7ICHA 4Y1CA 2ZJAA 2ZTEA 5J2CA 1CZ9A 2HHQA 3CYMA 2PFOA 3NE6A 3ZDBA 1RT2A 3NF9A 2P6RA 1RTIA 4LY7A 4M9JA 3GIMA 4DL2A 8ICAA 5L1LA 4DLEA 5HHIA 9ICRA 5D4BA 2XGPA 1XSPA 1L3SA 3OYEA 3VQ9A 4M45A 4ICLA 3ZT3A 4YN4A 2FLNA 1X9SA 3V9UA 4EBDA 3ZD8A 1ZQNA 2XRIA 3L2WA 4YR3A 3KLIA 4CK3A 4FJLA 1XSLA 4GXJA 4F2SA 3IRXA 4RQ0A 3V6JA 1NOZA 2HNDA 1VSJA 1NKCA 7ICGA 4DSEA 4KLHA 4RNMA 2XY7A 2Z1GA 1Z3EB 1MQ2A 5J2NA 2VA8A 8ICKA 5CZ1A 2G8KA 2FBYA 2VA3A 1TGOA 4RNNA 1NK5A 2MAXA 4F4XA 4BE1A 3AU6A 1W9HA 7ICIA 4B9UA 3Q8KA 1RTDA 4H4MA 2BCVA 4R66A 5KFDA 3VQPA 3MDCA 2VG6A 3F73A 5HRNA 4CEEA 1C0TA 1GOBA 4KI4A 5DG7A 4J9RA 3AO4A 5C5JA 5CA7A 5DBCA 1DOQA 2PFPA 4RT2A 2Y1IA 3JPTA 3MXIA 4FCYA 1SKRA 3ZSVA 3NF7A 3PX0A 4YFUA 3C95A 9ICXA 5KFRA 4BGDA 3QZ8A 1ZQXA 2WOMA 2VWJA 1WN7A 4R8UA 5T7BA 8ICBA 1B92A 4HCBA 5KT2A 3AA2A 1NK8A 3AVFA 1JLBA 3GIJA 1ZETA 7ICPA 2G8UA 5KT4A 1RT5A 1S1VA 4MFBA 4CHYA 4CJEA 4OKEA 2QKBA 1KCFA 2LSNA 4Z6CA 1RNHA 4NCBA 3TAPA 4KHQA 4AHTA 3DLKA 1JLEA 1JLCA 1JX4A 1HYSA 1NK0A 1WSHA 1RYRA 3UXOA 1KLMA 2BCUA 3BGRA 3RJEA 2Y1JA 2IDOA 9ICGA 2HHSA 3AA5X 2B21A 3T19A 4M3YA 3V7JA 5HRSA 4KLEA 4M42A 4M3TA 3C6TA 1RDAA 5BOLA 2FBXA 4P2HA 3V1QA 9ICKA 3MGIA 1RBUA 2PFNA 2NRXA 3ORYA 7ICNA 3PW0A 4Z4GA 3DRSA 3H8WA 2V4QA 3SPYA 4M41A 3H8SA 4YD1A 3H4BA 4ECZA 4X5VA 5DQHA 3V4IA 3VQCA 1N56A 3D0PA 3TQ1A 1VSDA 3FFIA 5I3UA 4CJTA 3C2MA 5KG3A 4LD0A 1CXUA 4Q43A 2ZD1A 4LZGA 3M8QA 4KRFA 4CJLA 2EHGA 3NH0A 2A1JB 5IIOA 4DWIA 3JPNA 1XI1A 1BI4A 4RW4A 1N6QA 2V4RA 5F9LA 1LAWA 3OYFA 4B8AB 2I1QA 4QCLA 1ZJNA 3Q8QB 4KHYA 2R7YA 1RZTA 4F2RA 2HHWA 8ICQA 3U3YA 2X6SA 2YNHA 4W5TA 4ZTJA 3NGIA 5EWFA 1ZQZA 1LV5A 2E4LA 3NF8A 1WCLA 4CECA 1C0UA 4RQ4A 1SKWA 2YNFA 4CGJA 2JEFA 4DL7A 4C8NA 2VG7A 3HWTA 5CZ2A 4O3NA 3PVXA 3OY9A 9ICHA 5J1EA 3SQ4A 3MBYA 1TK8A 1D9FA 1EXNA 3PW2A 4M9NA 3AO3A 4FM0A 1J54A 1NK6A 5HROA 4ECWA 5J2BA 2A1RA 3AVNA 4KHUA 1U04A 3O3FA 3LALA 3NFAA 4ED1A 1C7YA 1FK9A 3K5NA 4E7HA 1B22A 1BIUA 4RW8A 4J9SA 3TR8A 5J2JA 3SCXA 2RPIA 2BCQA 5TZVA 4JLHA 4BACA 3GV5B 3C2KA 3V1OA 4Q5VA 4UB2A 2OA8A 7ICTA 4CFBA 4KPYA 2IHNA 1TK0A 4N47A 5C24A 1I3AA 2R8IA 3PMLA 3LWLA 1H38A 4DEZA 4PHAA 3SUOA 2IAJA 2KZMA 4O3QA 1QLNA 2XY5A 3TAQA 4IBNA 2KN7A 4AHRA 4RPXA 4I2CA 3RH6A 4MFCA 2X6NA 3EPIA 1BQNA 3ULDA 3ZDEA 1LW2A 1U45A 5KFGA 5DKWA 2BQ3A 1N5YA 4DFPA 2ATLA 4PQUA 5HMLA 3MR5A 4FS1A 4TURA 4QOZB 1WSIA 1REVA 4KB0A 2BCRA 9ICBA 2JZBB 4IR9A 3RJKA 4BDYA 5KT3A 1SL2A 3FYHA 7ICKA 1A5WA 3OHBA 4O0JA 1JLQA 3HPOA 4OJRA 1X1PA 3HP9A 4QZDA 4TUQA 4ED0A 5J0YA 4J2BA 4OPKA 8ICSA 4J2AA 5J2IA 5C25A 1RXWA 1IG9A 4R5PA 4IG0A 4BE2A 1ASUA 5KFOA 2A1SA 3WNFA 4DOCA 2XY8A 1A5XA 2HVIA 3ETLA 3RB3A 4O44A 4DSLA 2VWKA 3U6FA 1KRPA 7ICJA 3MEEA 4DQRA 2RDIA 1QQCA 1S0MA 2PYJA 3DI6A 4CJ3A 3A2FA 2BPCA 3EPGA 8ICWA 3BQ0A 4BDPA 4PGQA 3IM1A 4KKOA 3GQCA 7ICLA 2G8WA 3C21A 3OYHA 3AO2A 5IINA 3ZT1A 4CF8A 4BWJA 4YMNA 3OYMA 3V9XA 5CHGA 1B9DA 4NYFA 3B6OA 4QZBA 5DK5A 3UXNA 2P66A 5DB7A 4Z6EA 4CGFA 2C22A 1SL0A 1JLGA 1WSEA 5HMMA 4XIUA 2HB5A 2AU0A 2FMQA 4YFKA 4QZ9A 3KHRA 2R8KA 4KLGA 1HUZA 3JSMA 1ZQLA 5E41A 1Z00B 2YKNA 3MAQA 3I0SA 1S1UA 5KI6A 5DG8A 3ZDAA 1C6VA 4FLUA 3RMCA 3MXMA 4ID1A 5DB6A 4FJ7A 4B9VA 1XU4A 5L9XA 4J9MA 2ASLA 2B4JA 4JV0A 5KFYA 2F96A 4Y1DA 2BDPA 1A76A 4QW9A 3C23A 1EETA 2FLPA 5HRRA 4M6WB 4DL4A 4ED2A 4R63A 4J2DA 4IRKA 1FKOA 4RW7A 7ICUA 4CIGA 4KLSA 3T5HA 4DTRA 4OGCA 5DGAA 3H8JA 2Z1IA 1QSYA 3TAGA 5KFXA 4HCCA 4EBEA 8ICMA 1UOCA 4QWBA 8ICVA 3ISDA 4FK0A 3KLHA 1JL1A 5J0UA 3HPGA 3H4DA 3LAKA 3RMDA 1BPBA 3G10A 5KRSA 3V1RA 1QE1A 4FJIA 2ISOA 1K6YA 2W42A 2ZUBA 2W9BA 1TKDA 1ZQSA 3LPTA 2J6SA 3AVGA 4DSIA 9ICLA 1SL1A 5KFIA 5KGWA 1WSJA 1N48A 3QO9A 1MQ3A 1T03A 5CYQA 2IS3A 3IHQB 2XHBA 4CIFA 3NCIA 3V9WA 3RB4A 2PYLA 3ZDDA 4W5NA 1HYVA 3RB6A 3B0XA 1VSLA 4RNOA 2HNYA 5KTQA 1RDCA 3KKSA 5HP4A 2YNIA 2QXFA 1BQMA 3JPRA 4O55A 4DOBA 1WSFA 4CE9A 1TVAA 4F5NA 2HW3A 1VK0A 1BPDA 4YXMA 3OYNA 8ICFA 1EP4A 4LH5A 4IG3A 4HUGA 4DFKA 4HYKA 4IQWA 1VSHA 3ITHA 3RJFA 3AVAA 4RQ5A 3UQ2A 4DSFA 2YHAA 4W5OA 3BJYA 5KG6A 1KSPA 3WNGA 1NOYA 4DU3A 2OPRA 3VQ6A 3FDSA 1Y97A 4F4YA 4IKFA 3WNEA 4CGDA 2R8JA 3JPQA 4OLBA 3KD1E 3NF6A 2FC0A 2FPLA 4G1QA 1ZQQA 5KG1A 2B6AA 4ELVA 1ZQEA 1ZQFA 5KG2A 3U3GA 3SYZA 3HP6A 3M9MB 1VSFA 4O5CA 1C1CA 2EX3A 4ECSA 4QZFA 1NJWA 1KFSA 4C8LA 3AVIA 4JS5A 3QEXA 3OS0A 3VQAA 4M3ZA 2QK9A 3IAYA 2YHBA 3RH4A 3V6KA 4CHQA 5CJ7A 4UAZA 4YCXA 2VANA 1RCHA 2FPKA 5KFWA 5KFFA 3K59A 4GXIA 4L8RB 2HMIA 1XS9D 4UB5A 2BPFA 4KLJA 2P51A 2ZTDA 4LVSA 2E6MA 1PZNA 4PPXA 4IQVA 1L5UA 4CJKA 4UQGA 4CJWA 1R0AA 3H7IA 5DQIA 9ICPA 5J2QA 4E7LA 4KLTA 1BVSA 3MEGA 5KG4A 4RPZA 2UVUA 8ICYA 1TFRA 5CYMA 3LP0A 2FBVA 2ETJA 3QESA 3AUOA 3QLHA 5DG9A 4PWDA 4I2BA 1TV6A 3LWMA 2OPSA 5J2KA 4EZ6A 2ITGA 4JUZA 1ZJMA 1F21A 2ALZA 4B9TA 2GV9A 4LSLA 9ICWA 5J0OA 3QIOA 1NK9A 4KN4A 4CFAA 2AGQA 3NTUA 3KK1A 1NJXA 1ZQTA 4O3SA 2QKKA 4HUEA 1RYSA 4RW9A 4RQ6A 2HHTA 3UIQA 4KLOA 1ITGA 3RJIA 3C5GA 2I5JA 8ICUA 3MR3A 2JEGA 3EY1A 3P1GA 1JMSA 4DOAA 3S3MA 5KFHA 3RJGA 3H40A 2V9WA 2HNZA 3KHGA 1TKXA 1ZQYA 2Z1HA 1W0HA 3RJJA 9ICJA 5D3GA 8ICPA 4KV8A 4QWDA 4DF4A 4I9QA 3QEWA 4FJXA 1S1XA 4JV1A 3H08A 4B9MA 5CWRA 5KG5A 2OZMA 4I2PA 4B8CA 3KD5E 4J9KA 4O5KA 2HHUA 3CFPA 2ATQA 4IQUA 3QEPA 3OJSA 4YMMA 8ICZA 3NGYA 3LP3A 2PZSA 3M9OB 3T5LA 4G3IA 3K5OA 5DBBA 2ZUCA 5J0XA 3JPSA 3GV8B 4KREA 3RAQA 1SKSA 3KJVA 2C2RA 2JGUA 5HNKA 4ELTA 1ZBUA 4F93B 2Q3SA 1U9LA 4UAYA 2PI4A 4PY5A 2OPPA 7ICSA 1B43A 1ASWA 1UT5A 4RT3A 3E01A 4W5RA 4FLTA 3N97B 3D45A 3SQ2A 1QSSA 2NRVA 4DSKA 4Z4EA 1ZQHA 5SZTA 5KG0A 5F9NA 2GBZA 3TWHA 5IIMA 5BOMA 3HVTA 4F4ZA 2ASJA 1UA0A 3RBDA 2BGGA 1NKEA 5KFKA 3MEDA 4FZXC 4I2DA 4ZTFA 3HSTB 4Q45A 4DTNA 3K5LA 1S10A 4DL6A 4IDKA 5FROA 4DTUA 4CGIA 1S0VA 5IILA 4E7IA 4TUSA 4FW1A 4FVMA 8ICGA 4FZYA 4Z6DA 4FJNA 4I2HA 3DLEA 4HHTA 1RBRA 1T7PA 2BQRA 1JL2A 4OPJA 4K4IA 3V6DA 1ZQCA 3DRRA 3KLEA 3V9ZA 1ZYQA 4BXOB 4Q44A 3SV3A 5EWGA 2XGQA 3OYDA 4F4WA 1ZBIA 9ICSA 2AJQA 4UB4A 5DB9A 3Q8MA 1HJPA 4FJKA 3V72A 2IGIA 1TAQA 3OYLA 1BHLA 3AVMA 1UAXA 4ECVA 4RQ7A 3G0ZA 2ZUDA 4GC7A 1KTQA 3RRHA 1RPLA 3ZSWA 1SZPA 3LAMA 4GMJB 8ICCA 5KFLA 2WONA 1NK4A 5JS2A 3EYZA 4CEQA 7ICQA 1JXBA 4HUFA 4F5RA 4CHPA 4EYHB 4N5SA 3TAEA 3QEVA 1COOA 4CIEA 4F3OA 4DQQA 3LK9A 2ZJ8A 4MQ3A 2W8KA 4FLZA 4EBCA 1ZQAA 2KFZA 1HMVA 3C1ZA 3DLRA 2JZBA 3HW8A 4CJ4A 1LWFA 3SQ0A
chains in the Genus database with same CATH superfamily
4E7KA 4K8XA 4CI0B 1S0NA 2GMHA 3R5GA 1BNPA 4ITSA 5DRKA 2BKNA 1MWKA 1WLJA 4ECRA 1HNIB 3QJPA 3UD3P 3CD5A 3K89A 5I42A 4FBTA 4DS4A 3VAHA 2Z57B 1XR5A 5AT1B 1NU0A 1Z1ZA 1V38A 1WG1A 1TK5A 2KRBA 2F65A 1HNZJ 4O5FA 4BR0A 4DV5K 4ZIVA 1HNXJ 1F9EB 1LW2B 4Y6IA 1A5VA 4IWVA 3DLGB 4MN4C 4HTJA 3EWAA 4LSNA 4ZPBA 4GNIA 4CJQA 1YI2N 1CC8A 1RTHA 2OZSA 1S1WA 2DGVA 1PVQA 3THTA 1RT7B 2GQCA 4TQSA 1GMWD 1ZS6A 4QIFA 4YUDA 3NH1A 1MN7A 4DLGA 3KK2A 2JH1A 2OWOA 3DU6A 1B70B 1RTJA 3HJFA 1L3TA 4FBUA 1Y7PA 1A6LA 1VRTA 5ETLA 4ECYA 1Z26A 5KFQA 3BQTA 1UEKA 3P83D 2MUTB 1HA1A 3OYJA 1NNEA 1GLCG 1ZD2P 2UXDJ 4ID5B 4QYZK 2GJFA 2GV1A 5GMDA 3H3NO 3CDEA 1CULA 3MFHA 4CEDA 2OYQA 1WD6A 3K75D 1P6TA 4ETZA 3S8SA 2KVIA 4JYAK 1Q79A 3DI6B 2X1BA 1BOTO 3H98A 4OQJA 5LJVA 4CEBA 5J29A 2IVNA 1Z2ZA 2R2TA 1MWQA 5D4NA 2XMUA 1I94J 4G1IA 5DZ7A 4NRTA 2BJ9A 3IBFB 1S48A 4AF1A 5D4OA 3W9HA 2CGKA 4FOEA 2GAGC 1OY8A 1NO8A 2IHR1 4H4OA 4YG2A 4U6PA 3CC4N 2HFZA 3SI6A 3THVA 4LFAK 5IWAJ 4A8XA 3TARA 3K2PA 2QFJA 1UPMB 4NI2B 3TJAA 3EGZA 5AK4A 2MQOA 4K4ZA 3JSMB 4HDGA 4CO0A 4DMNA 2YKNB 1T6DA 3KK3B 1FNOA 2KV2A 3O1WA 1VQLN 1X0FA 3CRXA 3VQEA 1RXOB 2K4HA 3IG1B 2PFDA 1URJA 2H5XA 4CLWA 3O0FA 1EHWA 3T1AA 2BUNA 3KBBA 1NH7A 1FKOB 5AM1A 4RW7B 4KX5A 3KDNA 1BU6O 5E26A 3U8XA 4LF5J 4XUSA 5AI0A 2E8NA 2AH5A 1YJVA 4Q0BB 4QZIA 2O3DA 4NXMF 1TL4A 3N6NA 1IM4A 1N52B 1FX2A 3AJ1A 2HBZB 2W9AA 4DFJA 1JCFA 3J80U 2YHXA 2XYGB 3EE3A 3ETOA 3W2VA 2ZQBA 2O8BA 3QPIA 3VGSA 4DV4J 2A19A 3KKRA 2VHGA 2JJ4D 3S9HA 3KUGA 3AO1A 3L2RA 3AQEA 2IHMA 2YMMA 5IIKA 2J7UA 4IOBA 5IV4A 5E84A 1XO1A 1IBMJ 5AKYA 4QQBA 4RKUC 2ZE2A 2IVFB 1S72N 3OYAA 4ZHRB 3SXLA 9ICQA 1RWNB 4DV6J 4CHOA 3THXB 3C19A 4P2SA 3OSPA 4RJVA 1U4BA 5LMUF 3MMVA 2OJ3A 2C1EB 3QBWA 4JRQA 2YVSA 2QO3A 4FWPA 5AZJB 1CS4A 2X1FA 2L9WA 3RR8A 2PY5A 1Y11A 3D2FA 1S9GA 3DEEA 4LRFA 2YNIB 1K8KA 4JD2A 1OY6A 2L48A 2VH7A 1QY7A 2H65B 2NLWA 2F44A 3I55N 1ZQ1C 2D4WA 4CJ5A 3VQ4A 1CJTB 5JXSA 1C1AA 4NLNA 4A5BA 3BB5A 5JLFA 2CPDA 2RAQA 3I5AA 2BM0A 2HHHF 4LFBK 2AJ1A 2HFUA 2P8IA 1LB2B 4G9ZA 2LEBA 1OVYA 2BTFA 4CJUA 2YKMA 3H20A 4F3QA 1RQLA 4M04A 1HHQA 3NBPB 2VUGA 4V1Ak 3WQPA 1KQGB 1VQ9N 3JS9A 4G1QB 3GIKA 3T5KA 3W62A 1T05A 3OA9A 1VBYA 1CJKA 3OR1A 4M63C 4DI6A 3W7BA 4IKAA 2F4VJ 1JIHA 5L38A 5GAEP 2DD8S 3CM6A 5C0YA 3NH2A 3ZNJ1 3AT1B 2DXEA 3IMQJ 1LFPA 1HBOA 1WDDA 4P71A 2G09A 4P7TA 3UFCX 2OO4A 5H9EK 4FXDA 2HGLA 2MLXA 3MR2A 4ICLB 1WKJA 2NRZA 4IO1A 1U49A 4YB5A 1ZQKA 4CHNA 3NRBA 1NJZA 2GUPA 5KFEA 1S6UA 3C2LA 5CD4A 1COKA 1UWBA 1KDHA 2IDEA 2C2EA 5C15A 4DV3F 3DAWA 3QDKA 5IT4A 3KHHA 4JHDA 2WB1C 3AAWB 3A13A 4B3TJ 4ZLJA 4OX9F 2KZ3A 1ZC6A 3BSCA 3MN9A 3O5BA 2KE7A 5J2QB 3ISZA 5AK6A 1K9MO 4RQ2A 2CPFA 4MFAA 4RQNA 4P4MA 2AKWB 2RF2A 3ULEA 4P4OA 2F3JA 4KTZA 4M1KA 5CYMB 1FRMA 2KG5A 2VASA 4BRNA 2R4FA 2VA2A 1QAXA 3QLHB 1KW4A 1YUWA 4NL9A 3D2EA 4JI6K 4K25A 1SC1B 2DO4A 3O4NA 4O4GA 2DGWA 2FJAB 4WXOA 2K4EA 1C0TB 2YKAA 2AZ1A 4BRGA 1K1SA 3DOLA 1R7IA 3MI7X 4MIWA 1ZBHA 2WVCA 4LF6J 3J7AP 4ELUA 4MF2A 1B7YB 1NHVA 1X8DA 2XZTB 1HNXK 1ZQRA 2B4OA 1HBUB 4FF2A 2DY1A 3JS6A 4PA1A 4M8LA 4LVNP 2LBOA 2BGWA 2WOMB 3HFZB 4JI3K 1K8AT 2MZJA 1KQSR 4LF9F 4TU9A 2WC9A 3RUBL 5ALLA 4F4AA 5F8HA 3H5YA 2O8CA 2Z7JA 4CHZA 1PK3A 2BJ8A 3E58A 2NSBA 4FJ5A 3RR7A 2AX1A 5CR4A 1L7PA 3SI8A 4DV2F 1JLEB 4FJ8A 2AGPA 3G2XA 4P9SA 5A2QO 3QUBA 2UUWA 3B6PA 2KSOB 4P2FA 5AM4A 2LXFA 4PKIA 2P9SB 2R8GA 2OTJN 1V3SA 4CJVA 1G7CB 1E3MA 1V3RA 3QUQA 1IJFB 9ICIA 2WCXA 3SAFA 3RH5A 2F1FA 3KJVB 3ZSQA 3OTDA 1NDCA 2J76E 5G5GA 1WG5A 5K8MA 2E1ZA 1PUZA 2BJ1A 1GMWA 3LH2S 3CI5A 3CG7A 4OJOA 3M8QB 3CGIA 1HI8A 2M8HA 4IOAL 2MZ1A 1VQ4S 4UB3A 5AHXA 1NGFA 1KAXA 4FK2A 3HKZD 3OYCA 4KN7A 1ZZNA 1QVFR 4OI1A 1BI4B 1Q3UA 3R2DJ 3F9MA 1T9YA 4BRAA 4O4RA 1B9FA 5JUMA 2NZ4A 5H2FU 5IWAK 1YZ7A 4KAZA 2QEXN 2QSFA 1W7WA 4XTTA 4MLHA 5M1PA 4MTPA 2IC3A 3ZSRA 1HNVA 4B9SA 2YNFB 1YJ9S 4XO0A 1RA7A 4KI6A 5DM7L 1RU1A 2HBQB 3QQCD 1HWIA 2GFFA 2NUUG 2WTFA 4K43A 4NMXA 1RDBA 2ZZTA 4JI1K 2BKOA 4HEA9 4DB3A 3FZMA 2XMKA 5ALXA 1J5EF 4B1ZA 3NGZA 2Q43A 4IQTA 3N4PA 2BABA 2YPYA 2KNJA 1T9UA 2G2YA 3G8SA 4C9DA 4QOTA 4M7XA 4I6MA 5L39A 2W6KA 5DB8A 3O08A 3H0RB 3G71N 4BQZA 2KJ9A 4LF5K 4K4XA 3E1YA 3TSQA 3T3FA 4QZAA 3CQXA 3GCWP 2OGUA 3UVJA 4KLFA 1WSGA 3C5FA 2O4GA 1JROA 2NXUA 4KC5A 4NXNF 4DV4K 4DR2F 4FZZA 1HPZA 2KT2A 4MO5A 5HI7A 3PJ9A 1ZXOA 3OJUA 1OO0B 2FHOB 4EZ9A 2MXYA 1IBMK 1T9TA 3L3UA 5IM0A 2CGJA 3JQKA 4OFZA 4RBVA 4OJLA 5KFCA 2BACA 2EFNA 1URNA 3CP8A 1SV0C 2Z0GA 4CFDA 1REVB 3CVKA 1XMQJ 4DV6K 4WZQA 5HP1B 2YV0X 2QX0A 3BGFA 3TZWA 1S9EB 2AYEA 3DDKA 5B0FA 3JYTB 2X7IA 3BS7A 3W5XA 1DQ8A 3CWJA 4ZDNA 2YTCA 4GKKK 1Z2LA 4DTOA 4WFAQ 1G3OA 4F25A 5C25B 1VS3A 1RBSA 2HOIA 4OKKA 4IG0B 4ED3A 3HKWA 4GY2B 2EZZA 2G13A 1JQGA 3AEVA 3J80Y 2OUGA 2D7SA 2LA6A 3QRQA 3J81j 1OY9A 1SC4B 2N7YA 1O03A 4A8OA 4HVJA 4BDZA 2ZWOA 4E98A 1KQSM 2W24A 4CEFA 1BUXA 3G6YA 2C2NA 1ZM3A 2EPIA 2J7WA 3U9DA 1IBLJ 4NM1A 4ZLNA 4M9HA 1WOSA 3R3TA 3OBYA 2RRDA 5AKKA 4DR3J 2G8IA 2F4VK 1U47A 2RMLA 4JK8A 1GAOA 4O3PA 2W9CB 1KHVA 4P74A 4Y2CA 2ZZNA 1N34K 4LF2A 1XMOK 3MECA 2LYHA 3L8BA 3AMZA 2YH0A 4I27A 5F3XB 3DLHA 1YVUA 4CJRA 1XC3A 4DL3A 4M6WA 2D1CA 2O1PA 2YKOA 3GJSB 1WC6A 4B3RF 1WEXA 1RACB 3EZ5A 4NLKA 2CGLA 2MY8A 2VPXB 1TELA 2W7OA 3J7YI 3D2QA 4PG4A 4YXJA 3KDOA 4LMZA 1NU4A 3EMTA 5BN9A 4E2FB 1T3NA 2KD1A 4FN5A 4YOYA 1FJGJ 3EM1A 4B3TK 4J9QA 3BDPA 3LM2A 4FWMA 2XMTA 4AHVA 5K14B 4ERDA 5J0QA 4FJHA 2MDAA 2VQEF 3CQ8A 5KFSA 1KVKA 2E1AA 5AKZA 2UUBK 4UAUA 3WQUA 3CCUN 3SMVA 3SCIE 1CUKA 1LVHA 4O8UA 2XC9A 2QSWA 3M8PA 1NZBA 3TPQA 1QUPA 1X4FA 3CMES 5AKGA 2HQFA 2RS8A 1QE1B 2I5HA 4OJGA 4Z4FA 4UAWA 4KHPK 1CQMA 4GW6A 4ZJOA 2A41A 1TL7B 1BIZA 2O4IA 1M5PC 3OFGA 3J7AN 1VGYA 4DSJA 4O0IA 2CQHA 4NYNA 4LIRA 2XO7A 3QO9B 4C6AA 2W8LA 4EI2A 4J2EA 1KKXA 3QB0A 3I56S 1FX4A 1U1RA 2QRRA 1N63A 1OSCA 1H0HB 4KHWA 4DG1A 4DU1A 2K8GA 4KHSA 4M3RA 1ZQWA 5A0YA 1B0TA 5HMYA 1X4DA 3CCLS 4PG6A 5JVHQ 3T6JA 1BCOA 1KWMA 1BCMA 5C2CA 3I9V9 3NVVA 5EY4A 4JWNA 2F77X 1JNRB 4PYDA 4WPAA 4B02A 3NMUA 3NGDA 3NASA 3KLGA 4DS5A 3FJ2A 1X9JA 2ZXHA 4DR5J 3QAUA 2A3ZA 4WCEQ 4CEAA 5K8NA 2V7ZA 2OPRB 2Z1JA 4CH0S 3SUNA 3CC7N 1QCKA 4BY9C 1UVNA 5ADXH 3K17A 4DN9A 3QMLA 4ISGA 2AQ4A 4TLQA 3LANA 1TU0B 4CEZA 1RT1B 1RLDA 5FDLB 4YOEA 1YJNS 7ICHA 4Y1CA 2EG1A 2HGMA 2DNYA 3NE6A 2UUCJ 4DR7F 5BREA 3NF9A 3G87A 4LY7A 4M9JA 2ACYA 2R2RA 4DLEA 2HI0A 3N7RC 1XSPA 1JLAB 4F0KA 2R7TA 3VGTA 3HRGA 1WSVA 3D6TB 2Q1NA 3V9UA 5ALWA 2DO0A 1RT6B 3M30A 2RH3A 3KLIA 1YJ7A 4CK3A 4FJLA 2QLJB 1RBAA 1GXTA 1T02A 2HOFA 1A0OB 5ALDA 1UAWA 4XPEA 4Y2JA 2KU7A 3KG1A 2ZIXB 4KLHA 4JI4K 3KWGA 3SMPA 4Y2QA 4FZLA 4RNMA 2Z1GA 3K1RB 5HSPA 5CZ1A 2YX4A 2G8KA 2FBYA 2VA3A 4BUGA 3K7RA 1JMTA 3D5MA 1DARA 4ILMA 1R0AB 2BRLA 1U24A 2XI9A 5C2FA 7ICIA 4IH5A 1NDKA 3Q8KA 2P9PA 3IA0A 3IFEA 4R66A 2CWXA 4WK3A 2GVDB 3KG0A 4AYBF 3MDCA 3SQGB 3BZQA 2DGUA 2VG6A 4KJIA 5GAHU 3MEKA 4CEEA 1CVJA 1KVJA 2OPSB 3Q8UA 5CA7A 2ROGA 1V4SA 3ATVA 1M1GA 1KBRA 3CCEN 1LOTB 4RT2A 4C8YA 3O6QA 4Z7CA 2ZH5A 3MXIA 1SKRA 1ZM9A 3I96A 3KK1B 2DGZA 1X4EA 4MK9A 4YMEA 1QQ6A 4C4TA 4DR4F 4USJC 3IP0A 5KFRA 3QZ8A 2VWJA 3KZIU 8ICBA 2I5JB 1B92A 2BZFA 3Q22A 2LKYA 3O9TA 4L6V3 1SJFA 2C3YA 2AYGA 3AVFA 1RUSA 3C65A 2KKHA 5KT4A 3G6EN 3GJTB 4CJEA 5B09A 3HX9A 1KCFA 3MM5B 2LSNA 1XMQK 3PYGA 2EWSA 4Z6CA 2HNZB 3TP2A 3TAPA 2QLTA 1RT4B 1SAZA 4QIGA 2JH7A 1JLCA 1HYSA 3JTPA 1HFEL 4LBHA 3MPVA 5D3GB 4CYUA 3A4TA 1VCTA 1HNZF 9ICGA 2HHSA 4RWXA 4UY85 5E3PA 2RUGA 4S0MA 4M3YA 1Q8LA 2PA3A 5HN0A 4C80A 2HFNA 1UVKA 1O6XA 2GZOA 4A2AA 2GW8A 2NRXA 3ORYA 4WF9L 4B1YB 2FVQA 3H8WA 2LFVA 4PZOA 2V4QA 4JEPA 5IS2A 4FDFA 2AHOB 3DDIA 3TTDA 2KVCA 4ECZA 5DQHA 3BBCA 3H2LA 3KKAA 4JKGA 3CF5Q 3TQ1A 3FFIA 1VSDA 4CJTA 5AI8A 5B08A 3VETA 4DR6F 3BGUA 3FFKB 4X65J 3C6AA 2YH1A 1AFJA 2FSNA 5GMEA 2QB1A 5F8IA 3C15A 2P35A 1NRKA 4DR3K 4C0HA 2N7CA 2VL1A 4QCLA 1ZJNA 3DXMA 3AD9C 4KHYA 1RWMB 4ZMMA 4DV7J 4CM0A 4DUYF 1T44A 3HVTB 4F2RA 5AI4A 1J5OB 2YNHA 2P9NB 1WUUA 3C16B 3N4QA 3NGIA 1AQ6A 3FQKA 1WCLA 2HS3A 1C0UA 2Q79A 4CGJA 2DWQA 1NGHA 4ER8A 4IDKB 5CZ2A 5IC4B 3SQIA 2DRDA 2D3OR 3SQ4A 2ZIWA 1A7GE 1EXNA 3BSAA 2CPHA 4JOUA 1FDNA 2RQMA 5J2BA 1I94F 3GE9A 2JXJA 5TKYA 3CJQA 2J0QD 3CJRA 2EC0A 4DBQA 2YWGA 2VONA 4X4TA 3MUTP 3T9NA 1C7YA 4UOGA 1EQYA 2I7PA 4AXJA 3DRRB 5ALVA 1VQMN 1IM6A 2XB2D 2RPIA 2BCQA 3FZBA 5TZVA 4LC9B 4BACA 3GV5B 3OUYA 3C2KA 3V1OA 3EZUA 7ICTA 3VAMA 5ETMA 1T11A 1PVRA 5C24A 1I3AA 3PMLA 4TU7A 4R0EA 1R8HA 1H7XA 2F9TA 2XY5A 2WUSA 3TAQA 4IBNA 2K1RB 4AHRA 3H2VE 1V9OA 4KMOB 2WONB 4MFCA 4HWIA 3FCHA 4WQ5A 4L74A 2C2ZB 1BQNA 4NO7A 4X4NA 3ULDA 3GSDA 4GVBB 4KH6A 2EANA 1X4BA 4MK8A 2QA2A 1Y10A 2E8MA 1N5YA 2ATLA 1JJ4A 5HMLA 4K2JA 4TURA 4TLRA 3VOVA 3D1OA 4KB0A 3AQFA 9ICBA 4NEYA 3DXSX 3B54A 2OTLS 5ALZA 3DLJA 3FYHA 4Y2TA 1DQAA 1A5WA 4O0JA 3OTQA 2RJZA 4QZDA 1G99A 3SLCA 3EZOA 2HLTA 2MKJA 1YHQS 4R5PA 1O5JA 5C42B 1YK9A 1U6ZA 4JI2J 5KFOA 3PJXA 2RD5C 3H45C 3WNFA 5ALPA 2EBEA 4PRFA 4LSNB 1KC8O 2DKZA 1NXIA 2BBEA 2E5LF 2EDUA 1RTHB 1CZAN 2V2QA 4CLKA 2ZHAA 1HQEB 3MEEA 4UF4A 2R7WA 1QQCA 1MMDA 4L3KA 4U7UK 1YRUA 4UTGA 2ZXIA 3KK2B 5EVZA 5HMXA 3I4HX 4CO5A 4PGQA 4KKOA 2E1MC 3VVUA 3SMSA 1ELOA 3MMCB 1VRTB 2ZOFA 3T1YF 2VC1A 3ELHA 1XNQJ 4NASA 2GQQA 5BXIA 2DR7A 2YWWA 4WYWA 4GKJJ 4BWJA 3N28A 2DGOA 3OYMA 2LYBA 1CULB 1WI6A 3B6OA 4BREA 4QZBA 3UXNA 2P66A 4L73A 5KAIU 3CIPA 4CGFA 1SL0A 5ALFA 1MWZA 4JI5F 4PL1A 5HMMA 2ZBCA 5B0AA 5FLXU 2O8EB 2AU0A 5LT5A 1AW0A 3P38A 5GTIU 2CXEA 2DNKA 1YJRA 2YWHA 1YDLA 3A8JA 3WIUA 3WUHA 1YJWN 1SWWA 4NE9C 5KI6A 3MXMA 3H8MA 4Y2YA 1XU4A 3MWPA 2ASLA 3GWCA 2B4JA 4H4OB 2LDYA 2RVJA 5F1XA 5AICA 1A76A 3T41A 3IRUA 3NVYA 3PHTA 2HEKA 2WVBA 3OTOK 4C8ZA 1VQ7N 2N1RA 1M1HA 4RR5A 4OV6A 5KFXA 2VFUA 3PACA 4HACB 3TA0A 4EBEA 5LXRA 8ICMA 4FK0A 2PE8A 3RMDA 1ZXIA 1RAJA 3SK3A 2ISOA 3MM8A 3VEWA 2HF4A 1OQ6A 2BM1A 2GMLA 2IOHA 2GQ2A 2QWQA 1E6YA 4JKBA 3I28A 5AI9A 3G4SS 2CIMA 4UQTA 1SL1A 3GR1A 1FWKA 3CD6S 2DGTA 3QT6A 5BYRA 4A8QA 5CYQA 2IS3A 2DT9A 3IHQB 2XHBA 3E9OA 3C0BA 3OBWA 1MU2B 1RFQA 2E1PA 3GYGA 3KMSA 3QATA 3ZDDA 4W5NA 1HYVA 1S1TB 4ID8A 2YB4A 3A8YA 1GXLA 5ETPA 4RNOA 2Y0BB 2KYZA 2HNYA 5KTQA 3PEJA 3IXQA 2HLUA 4DCCA 2RE2A 4ZP7A 2QXFA 4DOBA 1FFSB 4MIAA 1WSFA 2QMXA 1TVAA 1VQPS 1RHRB 5AR0A 4LF6F 1IG6A 8ICFA 1T9VA 4P0PB 3UWTA 1EP4A 1GLFO 4LH5A 2L3MA 4HUGA 2KJ8A 4MYTA 2ZE2B 2XM3A 4DFKA 3QFWA 1UFLA 3ZTRA 3A5OC 3ITHA 3UDLA 3RJFA 3UQ2A 3UKRA 3CMQA 1K9MT 2QM1A 3BJYA 1NOYA 4BS2A 1RQ0A 1Y97A 3SEOA 4H0PA 2R8JA 3JPQA 3QGGA 1UZHA 3VF2A 3D2FB 2FC0A 3SCJE 4KY3A 2OFHX 4JD2B 3TYTA 5THWA 1NGJA 1ZQEA 3U3GA 1WYGA 5LL6d 5KQDA 2AYMA 4CT8A 2EX3A 2Y8WA 1VK3A 1BDGA 1IKWB 2V8DA 2HVDA 1WSRA 3MDQA 4M3ZA 2V5HG 3IRWP 2QK9A 2FQQB 3D6FB 4CHQA 3BKFA 1IKXB 3LP2B 2DGSA 2WB4A 4LBPA 5A8KA 4XH5A 3LOUA 3ZC4A 1FNXH 4EX7A 4L8RB 4AQYK 5BYSA 5FPNA 3OL9A 5ALEA 4UB5A 1MNEA 3C14B 2O8FB 3C66A 1U1MA 1UVJA 4KLJA 5BRHA 3W0LA 4X62J 3IKMA 4H03B 5L1MA 1L5UA 4UQGA 2VPWB 3F41A 3Q8VA 5DQIA 1E4FT 3EXYA 5ADXA 3KOAA 4RPZA 4BR7A 5ALGA 8ICYA 2DH8A 3MCMA 3QBCA 3QESA 3QT5A 1XNRK 3ILOA 4L72B 2F8EX 2NLXA 4B3SJ 2O8DA 5B0GA 3O1LA 4LF8K 1NK9A 3UMBA 4KN4A 4CFAA 3NTUA 2IIHA 3ZETA 2FSKA 3A0IX 2QKKA 3W61A 4HUEA 4FYVB 2OXOA 2HHTA 3UIQA 4KLOA 1VMBA 1DEJA 2LI6A 3MR3A 2JEGA 3P1GA 3ETRA 3ULEB 3MC1A 2POKA 4DOAA 5AM5A 5KFHA 3QU4A 1WKKA 2H5IB 4ENOA 3HHLA 4MHVA 1TKXA 1D8BA 2Y0SD 4LF7F 4H5NA 2L41A 2KB2A 1IJJA 1FRXA 1MW7A 3DOLB 4FWRA 4BVOA 4YOXA 3KK7A 2V63A 1S1XA 3D3BJ 2VC0A 3UW1A 2YMLA 4C97A 4B8CA 2HS4A 3DGPA 4JI0J 4CJ7A 3QEPA 3OJSA 4YMMA 3NGYA 2J0SD 3M9OB 2WBRA 3LDQA 1HLUA 4B1UB 3U7JA 4G3IA 3CCWA 1QQ5A 4PXEA 3GV8B 3TR5A 2FGCA 4IL6U 1KBUA 3LW5C 3HVAA 2VKZG 2JGUA 4NMLA 3NS7B 1BLUA 4USTA 2PI4A 2V9KA 5KL1B 2A1BA 5HK4A 3FVYA 1B43A 5CHIA 3E01A 3FMWA 1OYDA 4CBUA 4AT1B 1M5VC 4E19A 5HOOA 3DDNA 4Z4EA 4OZ0A 1XNQK 3WK7A 2DRAA 1FJEB 4CZJA 3TWHA 2FDNA 2CXYA 5BOMA 2M70A 4ACOA 4F4ZA 5H1SV 2O01C 3D9BA 1NKEA 3CD0A 5KFKA 1WC1A 2W4CA 4DTNA 3PYEA 4CDGA 3O9RA 4DTUA 2E29A 4CGIA 2G9OA 3NVZA 2GVZA 1M90O 4FW1A 3EX7B 2VPZB 3NOCA 4Z6DA 3FK4A 2UUAJ 3DLEA 3KHYA 3ENQA 2FZKB 4CH1A 4MAKA 3OQ2A 3M6GA 1N6QB 4JI7J 1JL2A 5CZXA 4K4IA 4M5GA 2VYPA 3M1YA 2KKPA 3LPEA 1RADB 3IDHA 1JALA 1OIAA 5E0OA 2RHSB 3MF5A 2VG7B 3JXOA 3GDQA 4RQ7A 1R89A 5A0LA 3TQEA 8ATCB 4GC7A 3RRHA 1Y5LB 4NV0A 5HROB 4ILJA 5K20B 1R6YA 2C42A 4N77A 4A8KA 3VTIA 4GMJB 4DV0F 4ZK7M 4OD0A 2FD2A 2RU9A 2HF3A 4CHPA 4EYHB 4N5SA 4BROA 2OANA 3SFGA 2JFKA 1COOA 1FK9B 4CIEA 1FJGF 4FYXB 5KAKA 5FLXY 4MQ3A 1WEYA 3M8WA 1KXPA 4I6MB 3DLRA 2JZBA 1U6BA 4MIBA 4PABA 4Y3CA 1APSA 3MD3A 3CFRA 5G0RB 2G1DA 1ZQBA 2IRUA 1NMNA 9ICNA 2XHCA 1RAHB 1FJCA 1VSKA 2XYHB 2ZHOA 3OL6A 4EHTA 5J2HA 2CJYB 4X4SA 1CXQA 4FJMA 1HBNA 2N3LA 1JUDA 2BX6A 2AJ4A 1HPZB 4FM1A 3S41A 3HM8A 2VKRA 5ALOA 3OHAA 2F1JA 4ZKAA 3UR0A 5DDYA 2FY1A 3WIVA 5FD1A 1VLYA 5HHHA 3VN5A 2HIQA 4DV5F 2E1RA 4DOZA 2C2DA 9ICFA 3UQ0A 1X4AA 2K2PA 1BA1A 4UY8T 1N33K 1VQ8S 2OD6A 4OHWA 3WC0A 3TI0A 2H4YB 3JAMU 3Q2TC 3I9ZA 4K5SA 4JWMA 3O1BA 4IZ9A 4O9MA 4F92B 1PC4A 1VC0A 4KO0A 2UXCK 2A3VA 1EX8A 3RBEA 4JP8A 5GAHP 3NAHA 2ES6A 4PCQA 3EVMA 3UI3A 4O44B 3AXKA 3V6HA 3WX8A 1WTBA 4Y2PA 5BR8F 4K8ZA 4QZHA 4BRMA 5BRFA 2VBYA 1HHSA 3QNNA 1C20A 3OYBA 4QWEA 1NPPA 2AYBA 2HPUA 2HVHA 2IM0A 1RKJA 4IFYA 2PMZF 2LYVA 2KRRA 3CERA 4JV5J 5EOZA 1ZTWA 3IDWA 2J0XA 3QT7A 1BQXA 2CJ9A 2RS2A 4X62K 4Z0UA 4OJ1A 4GV9A 5DLFA 2UUCF 4NLDA 4WYLA 3BM7A 3MECB 3CJ2A 4CF2A 3GFZA 3A3OB 2CH6A 2IJFA 1G6BA 2ESEA 5EX0A 5F0XA 4F3TA 2KFNA 1P1LA 5JLHA 2ZUGA 4RQ1A 3D2SA 5HR7A 2DHGA 1VQ5N 2WBNA 1LK7A 2D9PA 3CCMN 1NM1A 1JXLA 4FM2A 1BL3A 3O3GA 4BJQA 1YVNA 1XHZA 5KOWA 1PK1A 2J5AA 5B0CA 3T7ZA 1BPYA 2YHYA 1BISA 2F8TA 3NKYA 4ANEA 2OHFA 3H42A 3ZYYX 4DX7A 3AQOA 4E1NA 1JN3A 3VA0A 5LM7E 3THYB 3HKZC 2KTQA 3O9QA 4QZ8A 3UCZP 3WNHA 3BEXA 2PXIA 4HTIA 2NRHA 2FJEB 6FD1A 3FBCA 2JH3A 3CCLN 2W4DA 1W25A 1DLOA 4RQ3A 1S6QA 3ZSOA 3GL1A 1UT8A 1Y4ZB 3MN6A 4E8UA 3RG6A 5IT9U 1GX6A 3BBFA 3LTOA 5JVGQ 2NRTA 1JWWA 3PIPQ 2BANA 4Z4HA 5AQGA 3TUIC 3RBXA 3GFHA 4BRDA 1DT9A 1FFUA 3CB4A 8ICTA 3MAAA 4JI0K 6FDRA 1T03B 2B8QA 3SDEA 1MG7A 2KXNB 3TFRA 4FKYA 2F1HA 2K8AA 1WG8A 1VBXA 3AO5A 3VALA 1NSPA 4CF0A 3CCJN 5IQ6A 1Q82O 3F2KA 1VJQA 3MOZA 4GRSA 3AVBA 4K4UA 1UA1A 3HPHA 4E7JA 2F7TA 3NS1A 1RWPB 2HG4A 3C6HA 3FBBA 4YR2A 5A0YB 2G1HA 2M9NA 3WK6A 2R7SA 1B4FA 3V81A 5L1KA 1IVZA 1VBKA 1VC5A 4GVEA 1QDUB 4WE1A 1ZRMA 5KT7A 4IG3B 3BQ1A 1N61A 1NMEB 2QMUB 2IBKA 5C7PA 3KLGB 3CJTA 5M1QA 1UCNA 2P5GA 4UW9A 3BF1A 4XQ8A 4ZVGA 1DURA 4NLVA 2HSEB 5J2FA 9ATCB 5JJBA 1UVMA 2QV6A 3KNGA 3WEEA 3NWRA 2OEHA 1RHMB 4Y2KA 4CZGA 1OYEA 1SIWB 3VC8A 5AQWA 3KKAC 1PYSB 2WVFA 1SZ2A 5ALIA 9ICAA 2XMWA 2NRWA 3HJEA 1WHVA 2EQYA 2DXFA 3LP1A 2COLA 1YX2A 2DR9A 1DAXA 4X65F 2F8LA 3J80O 1S5ZA 8ICRA 1T6CA 3C7NB 4KGMA 2RNEA 4NXZA 5FP0A 4V19X 4C0BA 3VEOA 1ED1A 1YT3A 3P4UB 5J1PA 1KD1T 4X64K 4M9GA 1TUVA 2VBZA 1FKPA 2ZC4A 5IZHA 3ZSZA 2MU2A 2D5RA 2VV5A 2KO1A 5ITHA 4MMOA 2VFTA 2FYXA 3K5PA 2HMIB 2LM1A 1SIZA 3VQDA 1Z19A 1SC3B 3R1LA 3EDQB 3TVKA 3IBCB 4WWSA 2DY4A 8ICJA 3DRYA 3AVCA 3E2EA 3UB5A 2D0AA 4BC7A 4ISFA 1UP1A 2HHXA 2Z2ZA 3MEGB 2OEMA 1Z1BA 3R27A 1SXLA 1WJ9A 2VKQA 1DTQA 5KFUA 4UB8U 1KAYA 5BPMA 1U8SA 1HI0P 3U26A 4KLMA 2OH2A 2VDIA 3S1TA 1DHMA 4HT7A 4MT1A 2P9PB 3OSNA 4AE5A 2DNZA 3A1YG 2VG6B 2CPEA 3VGKA 3MR7A 7ICOA 2Q6CA 3WZ0A 3D4JA 2CVIA 5DLGA 4F4KA 1ZQVA 1YBUA 2DFLA 1UMJA 3EL2A 3K8VA 5J2MA 5AKEA 2VF3A 3B6BA 3TABA 2LLZA 3RB0A 1UJ6A 4O3RA 5DS7A 3L7PA 4E89A 2KK0A 2UVVA 3PIOQ 2YY6A 1TYQA 3BSOA 4WFAL 3QNOA 5DMRA 3VESA 2KM8B 3FZKA 5A8RA 3MM7A 5LMUJ 1JI7A 1YITN 2R7XA 2CNKB 3W5ZA 3W5YA 2F9DA 3B82A 1M5OC 4XA5A 4FF1A 1ZQUA 2MHEA 1SH2A 4QS8A 5E3QA 1HR0F 2RQ4A 1GOAA 3D28A 1NGAA 3AHPA 1BPXA 3M32A 3KZBA 2B9YA 1JLCB 2P6UA 3M4XA 5BJRA 5KFNA 2HHHJ 5J2PA 1S79A 3LUYA 1FTRA 4Z2XA 4BRIA 2P9KA 1ZQOA 4IEEA 3S3OA 2VQFJ 2OPQA 2FSJA 4FOIA 3H59A 4K4GA 1HKBA 1SWVA 1JJHA 4KLQA 4FK4A 3KLFA 3H5SA 4J7CA 4QR2A 3VQTA 4M63A 5HBMA 2F63A 3L2UA 2Z2YB 2P9LB 4OJPA 2W7AA 4JKGB 1S22A 3CCVN 1VQ6N 4E3SA 1LWEA 4MDBA 1H7WA 2JNJA 1Q16B 4J9LA 1BWEA 3HO1A 5F8JA 4JV5K 3N0VA 1BPEA 2WAQF 5DDOC 1S6PA 4BE0A 3T5JA 4F9OA 2HRUA 4OX8A 3QETA 2KEYA 1DTTA 4K0KK 4NZ7A 3JAMY 3R5AA 2XLJA 3DXMB 4GKJF 1B99A 2RRBA 5I3QA 1K0VA 1RLCL 2EAPA 1DFDA 2HIYA 4DCHA 4DPYA 2MA1A 8ICLA 1C0UB 4LVOP 5L1IA 4I2EA 4DV3J 1YIJS 4I67A 1RP5A 1KC8T 1GH8A 5KGXA 2MKYA 2IOFK 1IKVA 2ZC3A 1HBMA 1A77A 2ZIWB 3ISBA 1NK7A 4CF9A 1Q9XA 4FLYA 1O1WA 5F8NA 4H5VA 1F9FA 3MMBA 4RW6A 5B5EU 2MZTA 1Z4OA 3LYSA 2K3IA 3ZZZA 3HSZA 3VQ7A 2VOPA 2BE2A 2DTUA 3K8WA 3SQ1A 3HM9A 2BOAA 1QHTA 3AM9A 3KVGA 2E44A 2DEIA 1YTUA 5EHHA 3A8KA 4OYIA 4B3OA 1FXXA 1QZ5A 2E9RX 4HTLA 3ALYA 4C0ZA 3ZSYA 4EU0A 1ZQIA 2KJ5A 1SUQA 2ATCB 3TX0A 1WACA 5CP2A 3CNQP 4Y0WA 5HL7Q 1X2IA 1L8LA 1LKZA 2HQ3A 3NMAA 4CJSA 2Q6BA 3L4BC 3D3CJ 4PG5A 1UVIA 5FJ4A 2CQ2A 1U1QA 2FTRA 1HARA 3ZTSA 1ZM4A 2KH9A 2GO9A 4DTMA 3CSKA 3QYYA 4AHUA 1U2FA 3DM2A 3CM5A 3F2CA 1PAUB 1PBUA 3AXMA 3ZTQA 5JVHL 4WIIA 3CIMA 3ID6A 1VHFA 5AQKA 1VSIA 1YGYA 5J0SA 3BN4A 4AHSA 5IT0A 4CZEA 1N5YB 3ZCMA 2ZBPA 9ICMA 1VQSA 2J6UA 4A5AA 2W03A 3SBMA 3TKAA 3GLJA 2K7JA 4DV2J 3CJAA 2EKYA 5DDPC 1Z4UA 3KJFB 1TKZB 3MPWA 8ICOA 3NS6A 1WAJA 4BRHA 4WCEL 2HMPA 9ICTA 4LJMA 3OXFA 3TVZA 4KH0B 2HQDA 3FBEA 4DU7A 2ZBQA 2HBMA 1KL9A 4R5PB 3EUB2 4OZ3A 1IV0A 1QTMA 3RJHA 3R5BA 4KFBA 2IM2A 2CZ4A 3A0HU 1SXDA 4KT0C 4JI8F 2B43A 5AXLA 5EX5A 2BQUA 1KOOA 2DY9A 4I68A 8AT1B 3TACB 5IT9Y 2ZIVA 4CZHA 4L76A 3C29A 4HDHA 2YWFA 2EAMA 1HX1A 3RBZA 1P8ZA 2H48B 1Z4NA 4YNQA 4M0AA 4KBIA 3W8GA 4CESA 3L2VA 2KT3A 2AEJA 5C10A 1PCAA 2DIVA 4J9PA 4RUCA 4CLZA 2RP5A 4QIWD 4I2AA 4ISEA 4PAAA 3M2VA 1VLBA 4OHYA 2RRNA 3R6GB 4J9OA 5J0RA 4RUHA 4JKEA 3C6UA 1S9FA 3RMBA 1JRPA 3N9UC 1TKTA 1M6YA 1MA7A 1VQYA 3AVHA 2OFGX 3KZXA 4BC9A 1J6ZA 4OYXA 2F40A 3J7Z5 5AQOA 3K1ZA 2RKIA 2Z30B 3I5CA 3ONQA 1WEZA 1XMOF 2FMPA 2IVMA 3KFUF 1GT8A 5HATA 1J5EJ 5HVFA 2HFSA 4FZMA 2J8AA 4F5QA 3WXLA 4CZFA 1RAAB 2QTDA 4G9BA 1X3NA 1ZQMA 3QWUA 2VPYB 4PEOA 1OJ4A 2CDQA 1HQUA 1O13A 2ZIUB 2XNRA 1N36J 2MTLA 3CNHA 4NXMK 2QGFB 3PG9A 4OX6A 2IA0A 5BRDA 3BGLA 3ZT2A 3AFGA 1LWXA 4OYZA 4ED5A 4NWBA 2GHWA 4NXNJ 4DF8A 4DR2J 4YDUA 3HMJG 2BE7D 4DQIA 4YHHK 3PJWA 1JLFA 4DR1K 3PRDA 4TVAB 1VQPN 4B3SF 3HILA 5AQYA 2CJBA 2ZZMA 4I28A 1TV9A 2JWNA 4P6QA 3IG8A 1RHJB 3RRGA 9ICOA 4MDAA 4PXCA 3DRPA 3GIIA 1O8BA 2P9UB 3TZYA 1WHYA 5CZVA 3M2UA 3ASMA 5LMUK 3SUQA 3POTA 4QJVA 4UOCA 1U1NA 4WFXA 1X42A 5LSLA 3A0BU 4M5LA 5ALMA 1NJYA 3L9ZA 2IRYA 5CYQB 4ZJLA 1H74A 7AT1B 3TU5A 2J9EA 1EX4A 4HT5A 5ALSA 3CF5L 5J0TA 2MQNA 4QWCA 1BG3A 2HNYB 4DUZJ 1F2HA 3U4LA 3KIOA 2KP7A 1SXEA 1ZQDA 5A76A 1U1LA 2IMWP 1RDDA 3UE5A 1WAFA 2ALYB 2ASPA 2E6LA 3VQ5A 4CEOA 3QWPA 3IAM9 4IC9A 2QKQA 4CNYA 1RBVA 4AILC 1HQ2A 5KG7A 3FC4A 2HRYA 4B9LA 4FP9A 3D67A 3WXKA 3TO8A 3NAEA 2K06A 4IO9Q 3CPWR 1KTVA 3IFRA 4IRDA 1X5TA 1U1OA 3EWGA 2B5JA 3Q0AA 1MC8A 1QTNB 5SWMA 2QZ8A 4WU2A 4U96A 1YQHA 3JPPA 4ZP6A 4M5MA 2RHKA 2YWKA 5ETQA 5AZIB 4DTXA 2EW9A 1GFWB 1LNQA 4FS2A 1HWJA 3D1QA 3VAKA 2ZJAA 1OPZA 3T9ZA 2FVPA 4LFCJ 2F7VA 3AN1A 2ZTEA 2WMMA 1CZ9A 4NA2A 2HHQA 3ZDBA 1FRHA 5DZ6A 4B3RJ 8ICAA 3HD2A 4OYPA 1ZPVA 2ZGZA 4Q2MA 4O8KA 4QU6A 4M45A 4YN4A 2FLNA 1T9WA 2J9DA 4ZOSA 1OH7A 1ZQNA 3L2WA 1JCGA 5B0BA 1KDNA 2WB1F 1F0MA 3IRXA 5A8KB 4ZPAA 2BJ3A 2CRLA 4OX9K 4ZVRB 4ILHA 4FXVA 1VSJA 4DSEA 4WFBQ 2XY7A 2D69A 2AT1B 5J2NA 2VA8A 1Q0NA 2NNWA 2EZYA 1NK5A 4OI4A 3BS5B 3ONNA 1CJUA 1W9HA 1RISA 4B9UA 2DNHA 2CPXA 2DNQA 4F36A 1RTDA 4H4MA 1V5VA 2BCVA 3RAMA 4ZP8A 2J0WA 4AFFA 4YDDB 3H5XA 2OSRA 3ENAA 3F73A 5HRNA 2MZSA 4JKAA 2CPJA 4KI4A 1S7IA 5DG7A 2GCFA 2W2NP 3RGIA 5C5JA 2RU3A 4XDDA 4FWNA 2PFPA 4W90B 2XYPB 3TZXA 2O8DB 3R7SB 3DLLQ 2Y1IA 3VMFB 3JPTA 1FVSA 2ZH7A 3NF7A 3ZETB 3OPKA 2IM1A 1UL3A 2X1GA 2B0GA 1N5VA 3MD1A 2CQ3A 1ZBTA 1HI1A 3PFOA 4QU7A 4BG9A 4LF9K 4R8UA 5AQIA 4HCBA 2RDDA 5EE0A 3QU2A 1NK8A 1JLBA 2ZHBA 4AP9A 3GIJA 4Z94A 7ICPA 1HNWF 3QJLA 1X6IA 4CHYA 4OKEA 2QKBA 2WW4A 2O67A 2XICA 3UE2A 3HHLB 4DV2K 4ZVEA 1ILYA 1JX4A 2UXBK 2C3MA 1NK0A 2QA4G 4EWTA 1WSHA 1RGVA 1KLMA 3MX2A 2RB7A 4M5KA 1NLVA 2IDOA 2M8DB 2ZNZA 2AD9A 5FPMA 1S1XB 3UMCA 4L75A 3T19A 4KLEA 3AB4B 4AL7A 3C6TA 4BX9C 4C23A 1IKYB 2PFNA 3PW0A 2W01A 4C7QA 3DRSA 3SPYA 3ICLA 1IUJA 2QWRA 2DQNB 4M41A 3H8SA 2KHDA 3H4BA 1VQON 3V4IA 1EWQA 5T41A 5I3UA 3EEQA 4U7BA 3C2MA 2E1EA 1CXUA 4UATA 2Y8YA 4FZNA 4BC3A 2ZD1A 2QIFA 1SV4A 4BRCA 4KRFA 2B4VA 3FEZA 1SJRA 3NH0A 2A1JB 4BQLA 4DR7J 4JB3A 2NXCA 1VHIA 3MUMP 4WKRA 4BG8A 1TVRB 2V4RA 4KYZA 4FPAA 3HF5A 3BQ7A 3Q8QB 3IC1A 1P1TA 2R7YA 1FXDA 1J97A 3R7NB 4ZTJA 2E4LA 3NF8A 4LRBA 2RIJA 4CECA 1RABB 4RQ4A 1SKWA 3BZKA 4I2QB 1N8RO 4ZJQA 5E2QA 3H90A 4O3NA 3PVXA 3JTOA 5J1EA 1FE4A 3CPWM 1D9FA 3I33A 2GVZB 2V52B 3AO3A 3CETA 2CQIA 4FM0A 1N0UA 1J5EK 3A12A 1NK6A 2FJ6A 2VOOA 3MK6A 1Y9OA 4PG8A 3CQYA 2QWPA 2A1RA 3AVNA 1N32F 4KHUA 1E6VA 2ZH9A 3O3FA 1FF2A 5KQ8A 4F0MA 4ED1A 4OYMA 2RQCA 5J2JA 1LQ9A 4A2BA 3GG4A 1JKHB 3BR9A 3MPYA 1UTAA 1ZD4A 4Q5VA 4U7CA 3S6EA 3RSEA 2IHNA 3IS9B 1TK0A 1S5LU 4N47A 3H1VX 1WC3A 4OZLA 4DEZA 1OSDA 1SQKA 1KR4A 4W98A 4NXNK 4DR2K 1J27A 3BH7B 3L4IA 4RUBA 4I6AA 4Q7AA 3GONA 2KN7A 4Z37A 3JQJA 3ISND 4I2CA 5GADU 2C2OB 2JL9A 2N3OA 2LEPA 1NNDA 1LW2A 2UU9F 3CJ0A 4H0YB 2FUG9 5ETOA 2XWXA 1GTEA 5F0UA 4DFPA 1VQ8N 1RYUA 3IWLA 3NGKA 4W92B 1WSIA 4H5WA 2BCRA 2JZBB 1LW0B 3IBWA 2JWKA 5F0WA 1SL2A 5F8MA 7ICKA 3AOBA 3ZZUA 2ZITA 1JLQA 2GELA 2EFPA 2YQEA 2V4JA 4C11A 1C1BB 2QL5B 3OVBA 5M2PA 1S6OA 1GX5A 5J2IA 1EARA 1KEKA 1OH5A 2QLBB 5KPRA 4B3MK 1RXWA 2B9XA 2KHQA 2QN6B 1D3WA 1PKUA 2H3FA 4BE2A 2V68A 1ASUA 2V8VA 4X66K 2W2OP 2R7OA 3BN7A 1A5XA 1NB2A 5EOYA 3WK4A 2FHJA 5HQMA 3RB3A 3QJJA 2VWKA 2MQQA 4DR6J 4DQRA 4CZMA 3I0RB 2RDIA 1YI2S 3L5KA 1S0MA 2PYJA 3DI6A 2XMMA 4L3NA 5DETA 5GAGU 2JOQA 3BQ0A 1N5WA 3IM1A 2EAOA 7ICLA 2FVRA 2W2MP 2NV3A 3NAIA 3R5DA 1T3QA 4DUYJ 3OYHA 3DHWC 3R1XA 3THWB 3VAIA 3DMJB 5IINA 3ZT1A 4CF8A 2Y0SC 3CPEA 5GAEI 1ULRA 5CHGA 4NYFA 3GYNA 4B3RK 3PSFA 4G6VB 3TTFA 3I1YA 1JLGA 4ICAA 4NI2A 1WSEA 1C4AA 4ZVTB 3BYRA 3HTVA 3VCDA 3P5BP 4KLGA 1HUZA 3JSMA 1TL5A 1AT1B 2CJKA 2IPOB 2IMOA 1IBKF 2FPHX 2Q1LA 2MJUA 3GE1A 1N5XA 2YKNA 4IFYB 4K4VA 3EE8A 3Q24A 2NPIA 3ZDAA 4DX8H 5ALUA 1X9XA 1Q82T 3RMCA 4ID1A 3LPYA 3BPSP 1FEZA 5DB6A 4FJ7A 4B9VA 4X84A 2VQEK 1TUGB 4OPAA 2PSZA 2OAUA 3PRBA 5A8WB 1V3ZA 1Q8BA 4AXIA 3C23A 5A6PA 5AQHA 4X4PA 3MCAB 5LJWA 3CC4S 3M7VA 4IRKA 4CW7B 1FKOA 4RW7A 1D1UA 5KNIA 4CIGA 2QC3A 3H8JA 4KRWA 4B9QA 4UOFA 1L7MA 3TAGA 5G4DA 4M5DB 1FNMA 3HZEA 3ZTOA 4USMA 3AAPA 2U1AA 3RVCA 5J0UA 2ERRA 5E5NA 5KRSA 4NLWA 2QA1A 4EENA 4FJIA 1WG4A 2W42A 2W9BA 1TKDA 3LF0A 1YAGA 3AVGA 1VQLS 2NREA 2R7VA 2EWHA 1HWKA 4PPDA 1PK1B 9ICLA 3IGNA 2APOA 2XS2A 2Y9TA 3IWXA 1N48A 2HK3A 2LYAA 3THXA 2A10A 3ILIA 3PNIA 3CJ3A 2PYLA 4AD6A 2YJEA 4LR9A 4KGZB 2YB1A 2CPZA 3AA8A 1XK8A 1S6QB 5J8YA 5FLXO 3KKSA 5HP4A 4HAIA 2YNIA 4C4RA 2DGXA 2GJIA 4O55A 1IWAA 2E5LJ 4CE9A 4F5NA 1WHXA 3IAS9 1RAOA 1CJTA 4ZA1A 3WKDA 3O9UA 3U1NA 1WDTA 4C48A 1F6TA 4HYKA 4IQWA 3AVAA 4RQ5A 3SDEB 4DSFA 2LQ5A 1JCEA 4OIXA 3WNGA 2DVIA 1RG6A 4IOCQ 2ZDPA 3X3UA 1P7DA 3T1YJ 1S72S 2V67A 2IIRA 4F4YA 4IKFA 2P5VA 2RT3A 4CGDA 1WORA 2AXTU 3NLCA 3I5BA 2DCUB 2W25A 2VU5A 3NNHA 3KD1E 3NF6A 2FPLA 4J5OA 4G1QA 3EVWA 3VERA 2M0GB 1PIEA 3DXKA 5KG2A 4DR7K 3FE1A 3V81B 2GAHC 1C1CA 1S57A 1MDUB 4ECSA 4WE1B 4JI5J 4QS7A 1NJWA 3I55S 4C8LA 1B64A 1RWUA 2VQFF 3VQAA 3OS0A 1Y3JA 3ET6B 3MWTA 4LBIA 5CJ7A 4UAZA 5AIAA 4YCXA 3SBGA 3Q86A 2FPKA 4ED4A 5KFFA 2KFYA 4GXIA 5E33A 2PC6A 1XS9D 4A8EA 2VODA 3J7ZT 3OXLA 2WZ1A 3BO3A 4X4UA 2P51A 2DF4B 2ZTDA 4LVSA 2NZCA 1NPRA 1PZNA 2W55A 3QNMA 3QU7A 4IQVA 1VQ9S 4CJKA 4KH4A 3H7IA 4A57A 2W1BA 2C2MB 1RTIB 2QA4N 1N0VC 9ICPA 5J2QA 4YY3J 4U67Q 2UVUA 3A5MC 1R8CA 5K8OA 4F7VA 1E4GT 2ITMA 2CQGA 1TFRA 5E3CA 1XERA 1U0HB 2B7BB 5CYMA 4OL8A 1PO6A 3IUCA 1FKPB 4DHVA 2FBVA 5IQQA 3J7A1 3QLHA 3UNGC 4WP3A 2HQIA 3FSXA 3OFFA 1B7FA 1XR6A 4YOWA 3QFHA 1WKLA 4PKDB 1F5SA 4KGXB 2ITGA 4JUZA 1ZJMA 1LKYA 2HNDB 1YG0A 2ALZA 4LT6A 5J0OA 3O2IA 3I4PA 1XNRF 5AKLA 1X5SA 1NJXA 1ZQTA 2LDIA 4DR4K 1W2BR 3TSPA 3BKUA 1BMQB 1ITGA 3B8HA 2VJUA 1P8GA 1AB8A 4P2MA 4LF8F 1HBUA 4J9UE 8ICUA 2G2OA 3EY1A 2I0XA 2VCPA 2M0NA 1R59O 3KUHA 1NSAA 2V2ZA 4BVPA 4GFJA 2JLFA 2D8CA 1RDUA 5JRTA 2FZGB 5AQNA 4OMFG 2R7QA 1NSQA 1HNZK 4ZLLA 4M7YA 4AL5A 1XEZA 5J2MB 1GMUA 4FJXA 5KG5A 2AJFE 4USAA 1FRIA 2XSJA 3FSYA 4I6WA 4YS2A 2W3RA 5JMNA 3LDOA 1PG5B 1NPKA 3RFAA 1RT5B 5AJ3F 2ZUCA 4R79A 4DR6K 2V50A 2CPYA 4A59A 1SKSA 2EI5A 3KJVA 4A8MP 4ELTA 3DLKB 2B3TB 4E1JA 2CZ9A 2Q3SA 2PBDA 3H8YA 2UXDK 4CF3A 1UT5A 4FLTA 1HJOA 5AQMA 4H0TB 4OZ1A 3H0PA 4MH8A 1ZQHA 5J2PB 3UD5A 4RWWA 5KG0A 3IM8A 2GBZA 2BXJA 4C98A 3R2CJ 2ASJA 3KKFA 3RBDA 4B1XB 4Y2MA 2OPQB 3MEDA 3FR0A 3HSTB 4Q45A 4C1NI 1TAMA 3EN9A 1A0PA 5IILA 1I94K 3W9JA 3VWSA 1MWMA 3HZ6A 4I2HA 3ZZYA 4RW4B 4HHTA 1RBRA 1D0EA 2XMJA 1S6PB 3ZI4A 2NCKL 3OLBA 1HHTP 2MYFA 1DK3A 1TUUA 1DTTB 3AQPA 5B0DA 4UASA 3NOGA 4Q44A 3SV3A 1NEEA 4CTAB 2ZH3A 3OYDA 1U0SA 1XN9A 5EUHA 2QI2A 1RDWX 3SAHA 1R8BA 3FCWA 2HBRB 3N6LA 2MMYA 2AJQA 5DB9A 3Q8MA 1HJPA 4FJKA 2LMRA 2H3EB 4MO4A 2FF6A 1TAQA 5AQSA 1QQMA 4Y65A 4ECVA 1M0SA 2QEXS 3FZHA 1KTQA 1RPLA 1EB0A 1RSCA 1HBMB 3ZSWA 1Q81O 2FXUA 3MMBB 4FE3A 2GIRA 4RW6B 5JS2A 1K47A 2KXHA 4IQMA 4FWOA 1JXBA 2B6GA 3FZLA 3QEVA 2BE2B 2QYGA 3LK9A 2ZJ8A 3EGNA 4CRXA 4USWA 1U7LA 5JVGL 4WZMA 1FEEA 4IH7A 3HI9A 3PIPL 1N36F 3H46O 4BHQA 1SC6A 4CJ4A 1G1XA 4LF7J 3SQ0A 1RBOB 4CK2A 1SUQB 2PT0A 3RW6A 4F50A 4MKBA 2Y1RI 5HP1A 2NPFA 3CCRN 4CF4A 2HBKA 4NY8A 1S9EA 1Q3VA 3G71S 1XC9A 3MM9B 4QS9A 3JYTA 4NLBA 3H1QA 4YDUC 1W2IA 1AZSA 2ZH2A 2LCWA 5CA5A 2E8OA 2DHAA 2E2NA 4YQWA 1EKEA 4A8YA 3CDUA 3WKAA 1W2BM 1ICEB 3NNCA 4PQUB 1T4GA 3AVJA 3CJ8A 3Q8PB 4PPZA 3SV4A 3OVSA 3B0YA 2EG2A 1SB6A 7ICMA 4OJ3A 2NXEA 3DOKA 2H54B 4KMUA 5CAAA 2E1YA 4M3XA 3EW9A 4X2BA 2DPNA 3T1YK 2AIRB 3ED5A 5KRTA 2F9JA 4WFNQ 4GLXA 2ASOA 1ATRA 3SAGA 4DUZF 1P9QC 1F60B 1HKAA 2A40A 4FXWA 2W7PA 3CJSA 3OTCA 2ZGYA 4DFMA 2GJ2A 2D0BA 3Q7BA 1NH8A 4RWTA 4YB6A 3FKBA 3GILA 4UZCA 2W9CA 3QE9Y 4JB8B 1Q46A 3H25A 4JI5K 4KB1A 2NO4A 1EXQA 3S6JA 2P9IA 1FEHA 1HJRA 1WCNA 3GG1A 3ZDCA 2ZIVB 1F1BB 4BRFA 4ECUA 1Z00A 5EE3A 4YP3A 5I9EB 3NCQA 4H5RA 4RZRA 3I32A 1UVLA 3ADAC 2E5SA 5DJBA 4JRPA 3UD4P 3OHRA 4M3WA 3E51A 2AA4A 3SMZA 3DC2A 4CNQA 5J2EA 3OTBA 4OI3A 4LFCF 3K5MA 1WUDA 3NRWA 3L95X 3M2VB 2AP1A 2QWLA 1MROB 3FLCO 2NUBA 1ZAWA 5AQZA 5K14A 2W3SA 2ABYA 3UPFA 1NKBA 4WFYA 4JKDA 3UNYA 2DL0A 1TKTB 4F67A 1ZM2A 2FY8A 1YJTA 4DV0J 3RMAA 1BGXT 2RKIB 5CRXA 2FJWA 4BC4A 2R7UA 3OXGA 3JAMO 3HI0A 1V9PA 4UY8O 3CFOA 1SJ3P 3EKSA 4EEYA 2PMHA 3PR4A 4HHHA 1RAGB 1QVFM 3SD7A 1PJ5A 3AOAA 4PGXA 4CT9A 3QERA 2OEKA 1EETB 2HOQA 2OYYA 3PIOL 1HQUB 2GH1A 1TL7A 2JHDA 3A5NC 3ICXA 5HQLA 2PN6A 4LF4F 3LQVA 2QARA 1TZ0A 4BGBA 1CLQA 2JV3A 1HRHA 3O4WA 2GGPA 4TN2A 1RILA 4I2GA 3P5JA 5TISU 2GC8A 5TKWA 3KLHB 5AXNA 2Q4TA 2KXFA 4NLXA 3CCUS 4LF6K 2YTUA 1JJ2R 4CERA 5GIPA 2VBWA 3MPDA 3MURP 4DV5J 3BS9A 1R6VA 1WC0A 1SQEA 2FLLA 4XAKA 4FL9A 1D4XA 5ELZA 2R2SA 4FJJA 5MLCV 3PHEA 2Q0UA 1QM9A 3G82A 3POTB 2DNRA 3GFYA 1KQFB 2M7SA 3TADC 3PNCA 4YOTA 3WXMB 4EYIB 2D41A 1RXVA 4MFFA 2DNNA 3PY8A 2BJEA 4QWAA 2ZVSA 1ASVA 1NBWA 4ZCLA 2HK2A 3ATUA 4TSXA 4USVA 3RYLA 4DN0A 2FPMA 2BE9B 3SZ2A 4OYAA 3EVOA 5M1NA 2DITA 5MLCQ 5U47A 1RT1A 5FDLA 5BR8J 2P2CB 2FHMA 4QYZJ 4ES2A 4E1MA 4OYWA 4CLFA 3CCSN 4FYDA 5K5MA 3ZT0A 7ICEA 4K4HA 1ZD5A 6AT1B 3UMGA 2P9EA 5EWEA 1JLAA 1P27B 4WIQA 3ZT4A 4PHDA 5GADP 1C4CA 1I3OB 3VQQA 2AX0A 1RT6A 4H0OA 3P45B 2B5JB 3J81U 2DB1A 1PYOB 4QZVB 5ALQA 4HL9A 4AH9A 2BVZA 4I56A 1S59A 3PTWA 1Q78A 3CC7S 2ZIXA 4Q8FA 2GUIA 4C3MA 2ZTCA 4PKHA 3DOMB 3MDAA 2JX2A 1U6FA 3K58A 2FJDB 3HD1A 2PEHA 5IT9O 3DKDA 4MLEA 1Y0HA 4PHEA 4FKXA 3R7BB 2NQPA 3CJKA 2EFQA 3UPQA 2FVCA 2F8KA 1D8LA 3EZWA 3PR5B 4XK8C 4X64F 5HL7L 4NLPA 3MGVA 3MABA 4IFEA 4ECQA 1HD1A 5EXWA 4BRLA 3FM9A 1NM2A 2F4FA 2GO8A 5GAGP 1QJHA 4DX6A 8ICNA 1VI7A 2E5GA 1CJUB 3NG8A 3LP0B 1UFWA 3CEDA 1CI4A 1SQGA 4CZIA