1NK7A

Guanine-adenine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk7A01
3P1GA 3H4DA 3HVTA 4J9LA 3IRXA 4CIFA 1XO1A 2ZJAA 5HRRA 4OLBA 4FLYA 1BI4A 4TUQA 4BXOB 2D5RA 1KFTA 3MBYA 1L3UA 3EW9A 3PNCA 7ICRA 5SZTA 3BQ2A 1TGOA 4JWMA 1TAQA 4M41A 4M9LA 4ECRA 3VQ7A 4G1QA 4ECXA 3NF7A 3VQ6A 9ICKA 4E3SA 1VRTA 1RBTA 5KT4A 2BGGA 2A1SA 2BQUA 3QEXA 3QEWA 1RDBA 4DLGA 1JL1A 2ATLA 1ZQRA 4K8XA 7ICGA 3AA5X 3RMAA 3IM1A 4EP5A 4O5KA 4DOBA 3L8BA 1SUQA 3KKSA 2FBXA 4BDZA 4E7HA 2OZMA 2E4LA 3IAYA 4UB3A 4KLFA 4I2PA 4I2IA 5HRNA 4CGHA 3K5LA 1J54A 3G6YA 2BPCA 1U4BA 3SPZA 3MEDA 3A2FA 4NM2A 5CR0A 1UA1A 4IQUA 1HYSA 3VA3A 3H8WA 1IO2A 3FYHA 2MAXA 1LWEA 4QWCA 4KI6A 3F9KA 1NOZA 2FPKA 3H7IA 2XY8A 4FYDA 5C24A 1DTQA 4FJHA 4QZCA 2ZUDA 3G0ZA 4RW8A 4Z0UA 4DL5A 5KFXA 4G3IA 8ICGA 3GV8B 1LW2A 4FBTA 4I2EA 1S1XA 3QEAZ 4F5RA 5FROA 3PW7A 1CZBA 4CEFA 4RQ1A 5KT3A 1RPLA 4B9NA 4CK1A 5D49A 3V1QA 4YMMA 4RQ2A 2FC0A 3CM5A 2PFOA 3TARA 5K14A 3T5KA 4B9SA 4RW6A 1LAVA 5KFRA 4QZDA 4UAYA 4CJTA 3NHGA 3C2MA 3VQ8A 3V9XA 3KLFA 4KHUA 2HB5A 4KB1A 5KG7A 4F5QA 5DDYA 2RF2A 5DGAA 3VQCA 2NRVA 5KFMA 3KK3A 2LSNA 3MR3A 4W5TA 1ZQBA 2PYJA 1KFDA 4HYKA 2ZE2A 3QO9A 2BDPA 5J0WA 8ICPA 9ICNA 3M8SA 4CJKA 1HMVA 4FLXA 1TK0A 2QK9A 2FBVA 1T4GA 4W5RA 3T5JA 4KHQA 7ICIA 5HRPA 3TAPA 1EXNA 4P4MA 3V72A 3M8RA 5F9NA 1FKPA 4YD2A 2DTUA 5HBMA 4FJ9A 1ZQLA 3EZ5A 3G6VA 2O4IA 4NLNA 1S6QA 4FK2A 4RNOA 4E7JA 4M0AA 3ALYA 5KFGA 5HHIA 4FJIA 4GVMA 2ZJ8A 3E2EA 1S1VA 5E41A 3PY8A 3L3UA 2GBZA 4J2AA 4FVMA 1RXWA 1CXUA 2ISPA 4M3XA 5J0UA 4CESA 4BE1A 3VQ9A 3HWTA 4DSJA 4GXJA 2RPIA 4FW2A 4DL6A 3SQ1A 4BE2A 3LPUA 1FXXA 5KT7A 2YKNA 4N41A 3THVA 1GOBA 3SUOA 5KG0A 3V9UA 1XSNA 4OKEA 3GFKB 1U9LA 3CFPA 1JLEA 1RT2A 4R65A 1VSHA 2IS3A 5KFJA 1A5XA 4JRPA 4F92B 3AA3A 2XCAA 3HVRA 1RBUA 5CY4A 3KLHA 1L3VA 3MFIA 4I2JA 1ZJNA 3RMBA 1JLBA 3DLHA 4PWDA 4MFBA 2C2EA 3K57A 4JV0A 3OYFA 4NCBA 1NK9A 1TKTA 4K4HA 3QERA 4JUZA 1S1UA 4CFBA 4B9LA 3LWMA 2WONA 4RPYA 2PZSA 4JS4A 1BISA 3SV3A 3KHLA 4O5CA 4NLGA 5KG2A 1D8LA 3OYMA 2YNHA 3LK9A 1JLCA 2DFEA 2IBKA 4CJPA 3KHHA 4TUSA 3MECA 4JV2A 2KFZA 4MEXA 3UIQA 4ZTFA 3RR7A 3OS1A 2ATQA 1EETA 4UAZA 3NAEA 5D46A 4YMOA 4XRHA 4DU1A 5J2CA 1JXLA 2YNIA 5J0SA 5KFIA 3RRGA 3ZSVA 5DG8A 2ZTEA 3VQ5A 2BCVA 1U48A 4EZ6A 4CJFA 1ZQWA 1ZQCA 2F1IA 4KLOA 1IH7A 4I9QA 3LPTA 3ZSWA 1WAJA 4DQSA 2X6SA 3NH2A 3MXJA 4BACA 4XA5A 1HYVA 2BANA 4HCBA 1TAUA 3O4NA 7ICKA 4FM1A 5DGBA 4FLVA 4ID1A 3JPQA 4QW9A 4FJJA 4RQ5A 2XRIA 1JX4A 4RW9A 1UT5A 1ZBFA 2P5OA 3RAQA 3NBPA 1RCHA 4QZ8A 2B6AA 1FKOA 2FPMA 1ZQDA 4FLTA 4O3PA 4J9KA 3RH5A 4R64A 4QZGA 4ECZA 4DFJA 3RRHA 2KZZA 2HHVA 1DOQA 5KFBA 3OYDA 1RT7A 2ETJA 4F2SA 4OPKA 4YFUA 1C0UA 1SKSA 3MR6A 3SUNA 2KZMA 3OYEA 4FLZA 4N47A 1TV6A 5FRMA 1VSMA 1S1WA 2JEIA 2Q3SA 3PMLA 5EWFA 4DG1A 3RB3A 4CJSA 4KTZA 4DL7A 4M6WB 5C42A 4QAGA 3T5HA 4FJKA 1QSLA 4KLIA 5KRTA 3M9NB 5KFFA 1WSHA 4KLUA 3V7LA 5CWRA 2DPIA 4CHOA 2BCSA 3KHGA 4M04A 3I0RA 5KFHA 4MFCA 2P51A 5KT2A 4CF1A 1KVBA 1J9AA 4I2CA 4DF8A 3KJVA 3KLIA 1IXRA 3Q8QB 3DLBA 1KSPA 1TVAA 1O1WA 4PY5A 5HP4A 3H8SA 1KRPA 3CYMA 4KHWA 3UXOA 1C1CA 5CZ2A 1ZQAA 1DLOA 1IKVA 4OGEA 2C28A 3MGIA 3ZSZA 2W9AA 2XY5A 4NYFA 3K2PA 3PW5A 5DMRA 1LAWA 2W9CA 4BWJA 3JSMA 3QETA 1JN3A 3NGIA 4ZTJA 5DG7A 4Z4CA 4E0DA 4O3OA 1Q9XA 4DTRA 2EX3A 3C2LA 4RZRA 4YG2A 3QNNA 2VANA 3SUQA 1K6YA 1VSJA 4CJVA 4JV1A 5KG6A 1Z26A 2Z1IA 4I2HA 1UWBA 3RR8A 2Z1JA 3RMCA 5IIIA 1KCFA 1MQ3A 2XC9A 4KKOA 3CFOA 5C25A 2C22A 3AVBA 3NF9A 3VA0A 2PFNA 3V1OA 1QSYA 4OLAA 3P5JA 1LWCA 3SQ4A 4GW6A 5J2JA 3LAKA 3DRRA 1QTMA 4KLGA 4CJ5A 3QZ7A 5KRSA 4KB0A 1U45A 4RW7A 4YR2A 4OVLA 4KLSA 5JUMA 4FK4A 4YXMA 4O3RA 3HM9A 3RMDA 4F2RA 4AILC 3T3FA 3N97B 4QOZB 2C2DA 3SQ2A 4JS5A 2H5XA 1TFRA 3WNFA 4ECQA 5J2NA 3S3MA 4OKKA 1RYSA 3RAXA 4O5BA 3ULDA 5BOLA 2QXFA 1ZQVA 2YNGA 3AVKA 2RDIA 4Z6CA 3K75D 4KTQA 3DI6A 2PXIA 3ZSOA 3OYHA 4M3ZA 7ICPA 4HVJA 1N6QA 3B0YA 3H8JA 4KHNA 1BIUA 4TSXA 4IKFA 3QZ8A 3BJYA 5BPCA 4PGXA 1MSWD 5IIKA 3GIIA 4KAZA 1ZQGA 4DL4A 4CHNA 1LW0A 3H4BA 1U04A 5KFQA 4M3WA 1UT8A 4YXJA 1ZBUA 4DOAA 1S97A 4O5EA 5KFZA 1ZQZA 3I8DA 2W9BB 5HP1A 4HHTA 5J2MA 3GILA 3QIOA 4CEBA 3QEPA 4HTUA 3RB6A 3PVXA 2D0CA 4FK0A 1Z00A 1SL0A 3QE9Y 1TKXA 4Z6FA 4J9NA 5J2DA 3AO1A 5KI6A 1ZETA 1CLQA 2QKBA 3ISCA 4NYNA 2ZUCA 3OHBA 4C8LA 2RKIA 1YTUA 3UPQA 1KDHA 3V4IA 5KFYA 1UOCA 2W8KA 3LP2A 1CEZA 4NLKA 3JPTA 4B8AB 3HPHA 5DBCA 1BPZA 1HNVA 4CK3A 1SL1A 1ZBHA 4DFKA 3U6FA 2ZD1A 3PV8A 1YVUA 4ED8A 3MGHA 5KG3A 2J6TA 2BPGA 3PO5A 3SUPA 1IKYA 1N5YA 3RH4A 5KFOA 2ITGA 4C8NA 2D0BA 4I2QA 1X9MA 1VSKA 4KO0A 4F91B 5EWGA 1TL1A 1K1SA 1VSLA 2YNFA 1FK9A 4O3SA 8ICAA 1WSJA 3SZ2A 5D4BA 4TUPA 4M9NA 4KHYA 1ZQHA 3ZSRA 4CF0A 2E6MA 2HHSA 2DFFA 4K8ZA 4UB5A 4J9OA 3JPSA 3AUOA 4CEDA 1JLQA 3ZT1A 4H4OA 1DGSA 4YP3A 4TURA 4LH5A 4BXOA 1Z25A 3JPOA 1N48A 4CIGA 4R8UA 4W5NA 4I2BA 2R8HA 4I27A 4KLLA 5J2QA 3MEGA 7ICVA 4GC6A 3OJSA 4J9SA 5HLFA 3KK2A 4DQPA 3V7KA 2J6SA 3B0XA 4BDYA 2HHXA 3BGRA 4UBCA 3QEBZ 1Z00B 4CCHA 4EP4A 4DSLA 3NGZA 3HXMA 4XIUA 1WLJA 2IC3A 4Q45A 3DYAA 4IQTA 3OYAA 3CFRA 4CJQA 4EZ9A 4UB1A 1IKXA 4CHZA 3ASMA 3EPIA 3BQ0A 2X74A 2P66A 3CQ8A 3ISNC 2HMIA 4ED6A 4J2DA 3RJHA 4ICLA 4KMUA 4IFVA 4PA1A 2GWSA 3PUFA 4M42A 4RG8A 4MF8A 3HP9A 5HMMA 9ICJA 8ICBA 8ICQA 5CA7A 3UXNA 3SPYA 5DQHA 1BQMA 4LZGA 8ICRA 4KI4A 1YT3A 5CB1A 1BI4B 1WSEA 4DF4A 3PX4A 4UB4A 2XY6A 3C1YA 1NK6A 4JWNA 4PQUA 3ORYA 4CHYA 2OPRA 3TANA 3RJKA 1J5OA 1GOAA 3TR8A 3C1ZA 5HHHA 2G8UA 4DTJA 4J2BA 3LZJA 2KQ2A 1H38A 1JXBA 4FJLA 1RT4A 1T03A 4YD1A 4H8KA 2HNDA 2OA8A 1KFSA 3RTVA 4QWBA 4M9JA 2XHBA 1ASWA 5HMLA 3AVLA 4CEEA 1BHLA 4CK2A 7ICHA 5KG4A 3UQ0A 5KFEA 4KLQA 3Q8RB 4ECWA 2FLLA 3OHAA 4F50A 4YR3A 1TK8A 3NH1A 2WOMA 4PPXA 1QLNA 3S3OA 4DSIA 1ZQNA 3V9ZA 2W42A 2DFLA 4CGFA 3TWHA 1RDCA 2C2RA 2ASJA 1NOYA 2DPJA 4O4GA 2NRTA 1QQCA 3K4GA 3T5LA 4E89A 2W9BA 5J0XA 3ZT2A 1C6VA 3ISBA 3RJIA 4EBDA 4GMJB 4CGJA 4YN4A 1B43A 1RTHA 3O3GA 3BDPA 3QEVA 5CP2A 2LYHA 2NRXA 5DDMA 5L1JA 8ICWA 5I42A 4J2EA 2VA3A 1BCMA 4Z6DA 2AGPA 8ICJA 4ZH4A 4QZBA 4F4YA 1Q8IA 1TKZA 3G10A 4RT3A 2PFQA 4XUSA 1CUKA 5KFSA 4CGDA 4Y1DA 1D5AA 5J0OA 4ECVA 1RXVA 1VSIA 4GXKA 3V9WA 4OGCA 1Z3EB 3IS9A 4PUOA 4MFAA 1NKEA 4F4ZA 8ICLA 3AA2A 3B6OA 8ICIA 2MUTA 3SNNA 9ICEA 3RBDA 4LSLA 1RBVA 4DTPA 2GUIA 4B3OA 3MABA 1C7YA 3ZD8A 4EYIB 4DO9A 1XC9A 3HW8A 5F9LA 4FLWA 2X78A 4Z4HA 2ZJ5A 3AVMA 4M9HA 1BPBA 3GIKA 1GOCA 2JGUA 3SI6A 3TAMA 3ZDCA 1UAXA 3DM2A 2KFNA 2F96A 2HW3A 3KD1E 3ZSQA 1T3NA 1I3AA 5FRNA 3CM6A 5KFTA 2JEJA 1NJXA 4MF2A 1TKDA 8ICNA 4XQ8A 4ED1A 3C23A 2VG7A 3KD5E 5CHGA 1DTTA 3DLRA 4J9MA 4UB2A 2JEGA 3U3YA 1XI1A 1S0OA 3UXPA 2NUBA 2Y1JA 3WNHA 1T05A 4YMNA 8ICVA 4YVZA 1XS9D 4M3UA 4MQ3A 4CERA 1ZBLA 4RQ3A 1TV9A 1CXQA 3ZD9A 2HHWA 2YHAA 3SV4A 4DQRA 1JXEA 5DB9A 3HP6A 1SZPA 1HUZA 2XY7A 4JLHA 2AU0A 2FBTA 3DRPA 2G8VA 8ICUA 1XHZA 2W9CB 4JK1A 3V9SA 2G8FA 4Z4EA 1SV5A 5KFWA 4Q43A 2XGPA 5KFVA 2ASLA 1RBRA 3RH6A 3AO5A 1S1TA 4AHRA 4C8OA 3H40A 5DBAA 2W8LA 4IRDA 4I29A 4QW8A 4M3RA 2BCUA 1ASVA 1RDAA 1Y97A 4M47A 3MR5A 4CIEA 1WSFA 3ISDA 2B21A 5FDLA 2HVHA 1WAFA 4FZYA 3QINA 3KHRA 1S9GA 3AVGA 4FS2A 3OYNA 2IOCA 3ZT0A 2ISOA 3MDCA 9ICWA 3RB0A 2R8GA 3GIMA 4BE0A 4I28A 3NF8A 2R8JA 1RYRA 4FJGA 2BPFA 2PYLA 2JZBA 4YQWA 4CJRA 4I2AA 4UAWA 1JLAA 3NDKA 3HYFA 1JL2A 3C6UA 3QIPA 2FMSA 1S0NA 4IG3A 3TABA 3D0PA 3VQEA 2BR0A 2V4RA 3KLEA 1ZQXA 2BQ3A 3ZDAA 4EEYA 3L2WA 2WTFA 4ELUA 8ICKA 1RTJA 3BQ1A 1BPDA 4RQ6A 4M6WA 1RBSA 3M9MB 4M3YA 5SWMA 2F8TA 4DU3A 5C5JA 2UVWA 3OYGA 2I5JA 5DLGA 4FO6A 4KHSA 4I2FA 4R63A 1HYZA 2A1JA 3WNGA 4RNMA 4ID5A 1HQEA 2I9GA 1XHXA 1C1BA 3B6PA 2PI5A 1KVAA 4MEYA 3RJJA 4RPXA 4L8RB 3AO2A 4DTSA 1L3SA 3U3GA 4HUEA 1WSGA 4CF9A 3PW2A 4DLEA 4IBNA 2Y1IA 9ICMA 3TAFA 4FCYA 3L2RA 1HJPA 4E1NA 3K59A 4FJ5A 5CJ7A 2W9MA 2IMWP 3OYIA 3L2QA 9ICXA 4IG0A 4DEZA 2Q0ZX 3RWUA 4EBEA 2BHNA 3QESA 4IFYA 2AQ0A 3EYZA 9ICVA 4KLJA 8ICEA 3MEEA 4WE1A 3PX0A 4RQ0A 4PHDA 4ECTA 3TI0A 4PHEA 5DLFA 3NGYA 1RILA 3S3NA 9ICIA 3EY1A 3OYJA 1YTAA 5KFKA 2UVRA 1C1AA 3WNEA 1JLFA 4ELVA 3LWLA 4AHUA 4RUCA 3KIOA 4DQQA 4K4GA 3T1AA 4B9TA 2JZBB 4Q8FA 1RT3A 1TVRA 3EPGA 3VN5A 2OYQA 1B22A 3EWAA 3PR4A 3OYKA 4DFMA 9ICCA 4R66A 3Q8MA 9ICPA 3IHQB 8ICZA 1ZQQA 4B08A 4CJEA 4DSKA 3DOLA 2HNYA 1N56A 2G8WA 4DS5A 4DTNA 2OZSA 2DY4A 2D0AA 2IGIA 4O55A 5J0TA 5J0QA 1AROP 1BPXA 4ECSA 4DS4A 4DOCA 1ZQOA 3KTQA 2OPPA 3GV7B 4K4IA 3ZDDA 3JPNA 4DU4A 3AVNA 1COOA 1HPZA 1KTQA 1JLGA 8ICXA 4IR9A 8ICSA 4KLMA 2ZUBA 1HNIA 3PX6A 3MFHA 4I2GA 3HSTB 2A1JB 2YV0X 4NCAA 2FMPA 1UA0A 2ZTCA 2G8HA 1KLNA 4BGDA 4IR1A 4E7LA 4E7IA 1W0HA 3L2VA 1KVCA 1NJYA 4CHQA 3DMJA 1J53A 4E19A 1ZQKA 7ICJA 1SL2A 4M9GA 4ED0A 1A76A 1D9DA 4RQ7A 1EP4A 2FPLA 2AGQA 8ICHA 4YNQA 1RTDA 4R5PA 3ZT4A 3Q8KA 4CJUA 1NKCA 1T7PA 5DG9A 4JRQA 4FM2A 1R0AA 2PY5A 5DQIA 1ZJMA 3M8PA 3QLHA 1VK0A 3DLKA 3HJFA 2B4JA 2EHGA 4CECA 4P4PA 2HHQA 5L1KA 3M9OB 2OPSA 5JS1A 2HHUA 2FLPA 3AU2A 4CFCA 9ICRA 5J2FA 7ICNA 3TFSA 3K58A 4RT2A 1B9DA 3N4MB 4MFFA 4N76A 4OPJA 3SI8A 4ED3A 1D9FA 4I9LA 5L9XA 5KGXA 2KW4A 1X9SA 5I3UA 4FJ7A 4PH5A 4I7FA 1NOMA 9ICGA 4KTWA 2AJQA 3ZDBA 4C8KA 4AHCA 4NY8A 2OWOA 4B8CA 2X6NA 2Z1GA 5J2AA 3VQ4A 4TQSA 1I39A 2ALZA 1ZBIA 4CJ4A 4NXZA 1S9EA 3OS0A 1TK5A 1X1PA 3AVAA 2G8KA 3HT3A 2VG5A 5IIOA 3SQ0A 4FS1A 4QZAA 4F8RA 1TL3A 4UQGA 4FBUA 3LP1A 5HROA 1RDDA 3HL8A 3Q8LA 3VQBA 2XO7A 4M45A 3G6XA 7ICMA 5J2BA 3V6DA 1IG9A 5KFAA 2IDOA 3LP0A 1BVSA 1KLMA 4QWEA 2VWKA 4DTUA 2P5GA 3LDSA 4ELTA 3AO4A 3E01A 4F93B 1RTIA 3HK2A 4O0IA 3M8QA 3Q8PB 3GV5B 5L1LA 4CEAA 4DQIA 5KT5A 4FJNA 4ECYA 1Y88A 4HUFA 9ICSA 4LH4A 1ZQEA 3MDAA 4KREA 3ZCMA 3UQ2A 9ICBA 1NK7A 1RZTA 1XSPA 4O3QA 4CF2A 2PI4A 3JPRA 5IILA 1ZYQA 4F3TA 1ZQPA 4W5OA 3CG7A 3FDSA 3L2UA 1ZQIA 3JYTA 1ASUA 4DTOA 4J9RA 2VWJA 3S9HA 1U49A 1REVA 3NE6A 1MQ2A 3DLGA 9ICQA 3FFIA 2FMQA 1HUOA 3VQDA 2O4GA 2F1HA 3P83D 1SKWA 4OJRA 4B9MA 5JS2A 1S77D 1EXQA 3C5FA 3KK1A 3MR2A 1S10A 2UVUA 4NLZA 2ZQBA 3O3FA 3RJEA 3AVJA 3NF6A 1L5UA 1HJRA 5BOMA 4KFBA 4E7KA 3AVFA 3F73A 2YHBA 1W9HA 3DRSA 5KGWA 4KLHA 4Z4GA 4EYHB 3HPGA 4DL3A 3V6JA 2MUTB 5T7BA 4PHAA 2R8IA 3K5MA 4KN7A 7ICSA 3VQPA 8ICCA 4KPYA 1NKBA 3TAEA 1XU4A 4LY7A 4PGYA 4RNNA 2HHTA 3K5NA 4TQRA 3SJJA 2A1RA 1JIHA 1RT5A 4CEZA 3TFRA 1NK0A 4Q44A 2ASDA 3ZSXA 3OY9A 2KZ3A 1A5VA 4GXIA 4DMNA 2I1QA 9ICHA 4IQWA 3ETLA 4YFKA 5L1IA 4YCXA 4FJXA 4QZ9A 5KFUA 2NRZA 1K1QA 9ICAA 1X9WA 4DWIA 4LZDA 2E6LA 1NK5A 3OSNA 3NTUA 1HRHA 4KV8A 4CEOA 4F5NA 1U47A 4ECUA 1IKWA 2IA6A 3AO3A 1A5WA 1VSEA 1ZQSA 3C2KA 9ICUA 1IM4A 3QNOA 1LV5A 5HNKA 1ZQUA 4LVSA 3C95A 3O4QA 2IHNA 4O0JA 5CYQA 2RN2A 1S0MA 1QE1A 4F4XA 5KFCA 3AVCA 4R8UB 4CFDA 5D3GA 1NJZA 4Y1CA 5IINA 5J29A 2UVVA 1EX4A 4HUGA 4ED7A 1ZQFA 4IRCA 4O3NA 4W5QA 2G8IA 5J0PA 4F3OA 4P4OA 2P1JA 2BCRA 3LANA 1KEJA 8ICOA 4M3TA 3K5OA 3RB4A 4AHSA 5IIMA 4QZEA 9ICOA 4PGQA 3V1RA 4J9QA 2J6UA 5J1EA 3RBEA 4H4MA 4F4KA 4FZZA 2FLNA 5CZ1A 5KFPA 3NH0A 1Q9YA 1NK8A 3MXIA 4N5SA 1F21A 1ITGA 4CE9A 4YR0A 2IHMA 3H08A 1BL3A 4M2YA 2RDJA 3IG1A 1MC8A 3V6HA 9ICLA 1S6PA 3NGDA 3TQ1A 4F4WA 3Q8SB 3D45A 4FJ8A 4FM0A 5KT6A 2V4QA 2JEFA 3AVIA 3PW0A 2KN7A 1VSFA 1T8EA 3JPPA 1B92A 9ICFA 3SCXA 2VA2A 3OSPA 7ICEA 5J2PA 4OKJA 5J2KA 4O9MA 5DQGA 2GV9A 5HRSA 1ZQMA 3OGUA 3LAMA 7ICQA 4PHPA 3AA4A 7ICOA 4AHTA 2BGWA 3DOKA 5J2EA 2NRWA 4QCLA 4RUAA 3RJGA 4B9UA 1C0MA 5J0YA 5EOZA 3PO4A 3HO1A 8ICMA 1BPEA 1BPYA 3ZSYA 4AH9A 5J2GA 2YKMA 3QEIA 4GC7A 3SYZA 1G15A 4RW4A 1BQNA 3DLEA 4Q8EA 3L3VA 4HCCA 4RQ4A 3C5GA 2ZTDA 4KLDA 5CYMA 4ZHRA 2QKKA 3LP3A 4FJMA 3GQCA 8ICYA 1S0VA 4N56A 3LALA 9ICTA 3AVHA 3MAQA 2FBYA 4CJ3A 4KN4A 1BIZA 4F5PA 4QWDA 3AU6A 2PFPA 4QZIA 4CF8A 1WCNA 7ICFA 3OJUA 4ED2A 4DFPA 4AHVA 2R8KA 4LSNA 3OYLA 5DBBA 3OVNA 5KG5A 3TAQA 5DKWA 3OYCA 3PR5B 2IAJA 3MXMA 1LWFA 5IIJA 4DSFA 1S76D 3V81A 1MU2A 4E1MA 2F8SA 2AQ4A 4BWMA 5KFNA 4Z4IA 3OYBA 4CJLA 1WN7A 2HNZA 2BKEA 5KTQA 4DTMA 5DB8A 4KLEA 3KLGA 8ICFA 4P2HA 5DB6A 2BCQA 2V9WA 1CZ9A 3V7JA 4KLTA 1C0TA 2OPQA 2VA8A 1BCOA 4Z6EA 2XCPA 4C8MA 3TAGA 1RT6A 3ZT3A 3ZDEA 1WNSA 2F1JA 1JKHA 5DK5A 3T19A 1RT1A 4CJWA 3GIJA 2P6RA 2KTQA 4KRFA 4X5VA 3HX0A 2XGQA 4DSEA 2BQRA 4J9PA 4FW1A 4FLUA 4NM1A 1BGXT 1NJWA 4B9VA 2M9NA 5J0RA 1VSDA 1LB2B 1ZQTA 3AV9A 3GDXA 3C6TA 2BE2A 2AGOA 1RNHA 1A77A 1D8YA 5EWEA 1WCLA 4CGGA 4KITB 4RPZA 1QS4A 3ITHA 4Q0BA 4RQ8A 8ICTA 3NCIA 4O44A 4CGIA 4CHPA 7ICUA 3VQAA 3C21A 5KFDA 2Z1HA 4LD0A 4CEQA 1B9FA 4GLXA 1ZQJA 1QHTA 3V6KA 7ICTA 4NCGA 4F5OA 4IDKA 1XSLA 5J2IA 4IRKA 4QWAA 1EKEA 4FZXC 3I0SA 2R7YA 5DB7A 5KG1A 1JMSA 3PMNA 1VRUA 5EU7A 4EBCA 3VQQA 2B5JA 4BDPA 5TZVA 4UBBA 4DL2A 4I2DA 2HVIA 1S9FA 4CFAA 1PZNA 3PW4A 1WSIA 2DFHA 3O3HA 3NFAA 4FXDA 7ICLA 3OS2A 2JLEA 4QZFA 3BQTA 1ZQYA 4QZHA 3LZIA 1HQUA 5J2HA 4Z4FA 3KKRA 2P6UA 4RU9A 4Q5VA 1XWLA 1V9PA 4DTXA 3HPOA 2VG6A 1L3TA 3RJFA 1SKRA 3C94A 1X2IA 4IQVA 1QSSA 3LDAA 1NK4A 1S5JA 5KFLA
chains in the Genus database with same CATH superfamily
4Z2XA 4YMEA 3NVVA 3HVTA 4JV5K 2KG5A 3SENA 3HVAA 4X4QA 3MUMP 1HNXF 4TUQA 1S99A 2XNQA 3MBYA 4CIOA 7ICRA 3H5YA 3BQ2A 2FD2A 4CM0A 3CCUS 2GIRA 4DV0J 4JK9A 3VGTA 1TAQA 4O44B 5TKYA 4PG6A 2JDJA 3VQ7A 1IWAA 4ECXA 4E3SA 1VRTA 1CZAN 3TVYA 3CCJN 5GAEU 2BGGA 1P9QC 2ZWHA 2VJ4A 2V9KA 1NO8A 5CZXA 1VQKN 2Y9HA 4V19J 4PG8A 7ICGA 3DHXA 2HIQA 1J5EJ 1QAXA 3SBGA 1ED1A 3KKSA 3SDEA 3NVYA 2E4LA 4UB3A 4I2PA 2JZ5A 4NA3A 5GAGP 4Y2JA 1MROB 3GFZA 1U4BA 2EZZA 1M1KT 4LF4J 3RSEB 4NM2A 1M5HA 3Q86A 4NEYA 1UA1A 2EFQA 3H5SA 2ZH2A 2LHTA 1ELOA 3C46A 3FYHA 3P96A 1BWFO 3EE3A 4QWCA 2AD9A 2DGTA 2FPKA 5LMNF 2DNMA 1DTQA 1CC8A 3CI5A 3CC2S 4MHVA 3GONA 3MEEB 4G3IA 1BMQB 8ICGA 3O44A 4ZOHC 1S1XA 5E33A 1ZBTA 4PYDA 1FXDA 3PW7A 4YDUA 3IXQA 2P9NA 4RQ1A 5KT3A 4GO5X 1IBLJ 4YMMA 3GG0A 2FC0A 2PFOA 3T5KA 4B9SA 4XAKA 3P45B 4O8KA 4RCHA 3IRUA 3SCLE 3TEHB 3UDLA 5G5GA 5FJ4A 1JWWA 4UAYA 2GAGC 3UVJB 3NHGA 3C2MA 2UXDF 2DYAA 2EEYA 2N82B 4LF5F 3LP1B 2FUG9 5G0RA 4WKYA 2HB5A 4KB1A 3G6ES 2FF3B 4RX6A 1FTRA 4F5QA 4Y2YA 5DDYA 3N6NA 2LYVA 1QVFR 1LK5A 2RRNA 4NLBA 3WIUA 5DGAA 3LP0B 2NRVA 4A46A 1FD8A 1PBAA 3WKCA 3MR3A 4W5TA 2MLXA 3NS7B 4HYKA 2ZE2A 4B3MJ 2JOQA 1LOTB 3M8SA 1NDKA 2C1EB 4JI0F 1CJTB 1TK0A 1SQEA 2QK9A 3AAPA 2FBVA 3DLEB 1HBUB 3AN1A 4B3TJ 4LFAF 4NX9A 4KHQA 2AYEA 2YWWA 2WMMA 3TVZA 4JMUA 2W55A 3V72A 3M8RA 3BS5A 5LSLA 4V19X 1NHKL 3J7ZT 2IM3A 2DTUA 5HBMA 4UARA 1Z05A 2RT3A 2YNIB 4TY8A 2HBZB 5BYRA 4NLNA 2W41A 4K4YA 4FK2A 3OXLA 4M0AA 3ALYA 5AQTA 3VEXA 2I1RA 4NXNF 3TJ8A 4NJ8A 2DHXA 3E2EA 4O23A 3LDOA 2VIXA 2FC8A 2GBZA 2GIFA 5AKZA 1RXWA 2ADBA 4M3XA 1YIJN 3BSOA 3RFAA 3HWTA 3HZ6A 2N3OA 3OVSA 4H4KA 2MJNA 3CUNA 5KT7A 2YKNA 5MAOA 3SUOA 5KG0A 4DX5A 5IT0A 4OKEA 1F3FA 4IFEA 2IJFA 1RT2A 4HAIA 4M95A 1CRXA 2V63A 3L4IA 5KFJA 4MDBA 4H0VB 2R7OA 1VBYA 1A5XA 1YLXA 4A8YA 3AA3A 2YKPA 3RMBA 3WIVA 4DV6F 4QPTA 2IOFK 3R7NB 4JNEA 2AT1B 4DV0F 4WTOB 2YWGA 1U09A 2RD5C 4ZJOA 4PZNA 4DV3J 3CETA 3IP4B 3BO2A 4IOAL 3SAFA 2KDOA 3LH2S 3LWMA 3MMCB 3H45C 1Q95G 2F4FA 1NGFA 2ZE2B 4BROA 1RAAB 4JS4A 3DDIA 4NXMJ 4Y0WA 1FJEB 1YITS 4O5CA 3TZYA 2ZH9A 2XMUA 2WK4A 2DFEA 3NNHA 2IBKA 4PR6A 1J5EF 2E8AA 3LDPA 4XH1A 1AZSA 1FRLA 1R8PA 4I6MB 4ZTFA 3RR7A 2K3KA 4DPTA 2FVPA 5KL8B 2IRYA 1RISA 3B4DA 2E1EA 2DR5A 1Q82O 4XRHA 1SUQB 3MDFA 1XJWB 1JXLA 2ZH1A 4LRBA 4P75A 3W9JA 4DR2K 4A47A 5ALGA 1HUXA 2JL9A 2ZTEA 3H2LA 2VFUA 2EZYA 2XEXA 3DRSB 3OR1A 4JKAA 1ZQWA 3MGJA 1P9YA 1ZQCA 2H65B 4LF8K 2E5GA 2F1IA 1UQVA 3TJAA 4IQMA 4NE9C 3FRZA 2X6SA 2PFDA 2ZZTA 3CTRA 4JYAK 4BACA 3VEVA 1DLOB 2LA6A 3TTFA 1IVZA 5GVQA 2HFSA 4HCBA 2CQ2A 4FM1A 5DGBA 4EU0A 4ID1A 3SJHA 2QMXA 4RQ5A 1JX4A 4NI2A 4YOYA 1ZBFA 4FN5A 2P5OA 1WEZA 2P9NB 2J8AA 1GQEA 2G2YA 1B4FA 1ZQDA 1HARA 1M90O 3LW5C 1K8KA 5CXTA 4R64A 3H8YA 3ONNA 2DGSA 2OSQA 5JICA 4KHPK 1R8BA 2IVNA 1N61A 3OYDA 2ETJA 2PE8A 3M30B 4FNHA 1C0UA 1FRKA 1SKSA 3T1YK 1NLKL 2UV8A 5HMYA 3QATA 2OD4A 2F1FA 3MOJB 5FRMA 5AKKA 3PMLA 4DG1A 4B3MF 4YHHJ 4P0PB 3WK9A 3R5AA 4TKTA 2A6AA 5AM1A 1Z2LA 1WWVA 4ES3A 1HR0K 2EQYA 5KRTA 1WSHA 1WUUA 1BO5O 5CWRA 3AOCA 1WTFA 2BCSA 3H2UB 4MFCA 5AE2A 1B99A 2XQCA 1KVBA 1H7XA 5HVFA 2V5HG 4DF8A 2GQQA 1C4AA 3ZZZA 2M5YA 3KLIA 4P10A 3NOGA 3Q8QB 4DHYA 1W25A 2E5LF 1TVAA 5HP4A 1KRPA 3CYMA 3CIPA 4LF5J 2DUYA 4NXNJ 1DHMA 4C4RA 1ZQAA 2B4OA 4PKIA 4LFBF 3GU0A 2HS3A 2M9KA 1VFJA 1IKVA 3J81Y 3M2RA 2ZEJA 2LBOA 2W9AA 3DDNA 3K2PA 1LAWA 1HBNA 2RILA 1OKJA 1JN3A 1EARA 2H4WB 5DG7A 4E0DA 3CCMN 1ZD5A 4YEAA 5DDPC 2QB1A 2O8DA 3VENA 4ZVRB 4KR0B 1TUGB 1T9UA 3IKMA 3C2LA 2K7JA 4YOTA 4YG2A 5M2RA 3V2UC 3BKFA 4Z7CA 5AQRA 3A8IA 3IGNA 2OTJS 2YX7A 3MUVP 1Y5NB 4GKKK 3QBCA 1MW7A 1GO3F 2LDYA 3RMCA 2FJWA 4LR9A 4P6QA 4KKOA 1HNZJ 1C2PA 5C25A 2C22A 4W98A 4DI6A 3NF9A 3M6KA 1QSYA 2FIUA 3EGVA 3SQ4A 4WXOA 3IC1A 4GNIA 4CJ5A 1VIOA 2KT5A 4YR2A 3MM8A 3IM8A 3TAMB 4OJ6A 5ALNA 2D9OA 2RH3A 2VQFK 2G2ZA 3KLEB 4IEIA 4JS5A 3KK7A 2Y0SF 3L7UA 4P71A 3MMBA 4DV7F 3G87A 1JMTA 4OKKA 4Z94A 3ULDA 5BOLA 4DV6J 2QXFA 4HI1A 1AW0A 1R3NA 1YJNN 3C19A 1HQ2A 1U26A 4YB1P 4C7ZA 4C80A 3A4TA 2XZDB 1H72C 4DV3F 4DCJB 4RBVA 4HVJA 2B43A 3B0YA 1W7AA 2RP5A 3CMEN 2NLXA 1BIUA 4IKFA 1HBUA 2CN1A 2QLWA 4NLWA 4PGXA 4NXMF 5ELZA 3UDCA 1H2UX 2RUGA 1LW0A 4A62A 2QGFB 1ATSA 1HLWA 3CJ8A 3MAAA 4M3WA 4X65K 3WQPA 1S97A 5B0CA 2DNHA 4TY8B 3I8DA 2W9BB 2L5YA 3KK1B 4I2PB 3QNMA 5BN8A 1VDVA 2P9KA 3M8QB 3IWNC 4JI0K 4OYWA 4QYRA 3WKEA 3NMRA 5J2DA 3AO1A 5KI6A 1TFYA 5EDWA 4ZLNA 4OZ0A 4HTJA 4MK7A 5KOXA 4USUA 5CE3A 3L3FX 1FFUA 3UPQA 3V4IA 2OKQA 2P9LA 3NMUA 5KAIU 4Y2XA 1UOCA 1IBKK 4YHHF 4NLKA 1KQSM 3JPTA 2GVDB 3JTOA 1F2GA 3ZNUA 4JI7J 3ZNJ1 3QFWA 3U6FA 2ZD1A 3PV8A 2CG8A 1F0MA 3KLHB 5KG3A 3FBBA 1R6YA 5ITHA 5AXLA 5ALXA 3SUPA 1IKYA 4OZ5A 1X4AA 2E5HA 2KOBA 5KFOA 4I56A 2HVDA 1ROFA 5F8MA 4AQYJ 1BE4A 3R9LA 1U8SA 4KO0A 4F91B 1K1SA 1VSLA 3TADC 3SZ2A 4TU9A 5D4BA 4JI6J 4DV5F 4KHYA 4F36A 4NL9C 1ZQHA 1XERA 4CF0A 2HHSA 3VAMA 4K8ZA 2CWXA 4I6MA 2W6LA 1SBRA 2KLAA 4QR1A 5A0LA 3JPOA 4X66F 4BQLA 2KG0A 4W5NA 1UW9A 4OI2A 2R8HA 4I27A 5J2QA 1IJJA 7ICVA 3V4MA 4WF9Q 1TUWA 3ULHA 5DZ7A 1AXQA 4OHWA 6FD1A 2BUPA 3V7KA 2J6SA 4CNYA 3B0XA 5D0RA 4BDYA 4K8RA 5CQGA 3MPVA 5BRFA 3QEBZ 3VAIA 1N33J 4MO5A 1Z00B 1CI4A 2ZF5O 3T9ZA 3RVCA 4EP4A 3NGZA 1KXPA 3S8SA 3UWTA 3KLVA 2QYCA 4HR2A 3D6TB 4IQTA 3OYAA 4WK3A 4CJQA 1MNEA 4DDFA 3CDEA 3ASMA 3H1VX 5D77A 3BQ0A 2X74A 1OH6A 5AIBA 3ISNC 2H3FA 4ED6A 3CD5A 1WOOA 1S5LU 2WTUA 5D8HB 1I3OB 1E6YA 3HM8A 3SPYA 5DQHA 1TKZB 3MXHP 4KI4A 1WSEA 3I96A 1OUQA 3FBCA 5HMXA 2XY6A 4KX5A 4Q7AA 3S01A 1I94J 1EX8A 2B4UA 3RJKA 2WVBA 2V6AA 4LF9F 5F8HA 4AM7A 1SWVA 4PYAA 2J76E 4G1QB 1T03A 2GHPA 1YJWS 1KFSA 1N32F 2Q97A 4QWBA 3MCSA 4M9JA 2XHBA 2RJZA 2LEBA 2J5AA 1E4FT 5LJWA 4CK2A 5MLCQ 4OYBA 3UQ0A 1MWZA 2GLEA 5KFEA 3PNIA 2RRBA 3W60A 2A3ZA 1GTEA 2FLLA 4CNQA 4ZLJA 4OFZA 1F5AA 4JI3F 3NH1A 3G4SN 2WOMA 4PPXA 3S3OA 2CJXB 5C2GA 2ZG6A 1ZQNA 4ZHRB 4H0OA 3QYPA 2HZCA 2VJ5A 2HAIA 3IBCB 1DRZA 2JH7A 5IOLA 1ZOTA 3TWHA 2ASJA 1NGBA 1S7IA 4CNZA 4B1VA 4O4GA 4GVBB 1WBDA 5F8IA 4AXIA 2W4CA 3GWCA 2W9BA 5J0XA 4B1WB 1VQ8N 2O66A 3THYB 4CGJA 1HNXJ 1RTHA 4UTGA 9ATCB 4OZJA 3GL1A 5I42A 3CW2C 2V7YA 8AT1B 2XI9A 2VWBA 1VC5A 1BCMA 1IJFB 5J8YC 4QS9A 2APOA 4F4YA 1TKZA 1Q8IA 1VHIA 4BRLA 3L4BC 4JI7F 4RT3A 4J7CA 4XUSA 1CUKA 4J91A 2KI2A 3I56S 2RQMA 2AZ3A 4X84A 3SQIA 2AP6A 5IV4A 3OLBA 2BMBA 8ICLA 1ZA2B 2WVCA 3C14A 2KYXA 4K5RA 3SNNA 3HI9A 1A9NB 1Y00A 9ICEA 3UFCX 4LSLA 1RBVA 5B0FA 3J7YU 4P52A 3I9V9 1C0FA 3HW8A 3OFHA 4LF4F 2AW0A 2IVPA 1Q7LB 2IM1A 4Z4HA 1TYQA 5JXSA 2UXCJ 4I67A 3MN5A 1NGCA 3SI6A 2WHEA 3TAMA 4JB3A 3DM2A 2F96A 3A0HU 1SJ4P 3ZSQA 1NDLA 1RFQA 1I3AA 3K5PA 3EGZA 3CM6A 5KFTA 4GKKJ 5AKJA 2BJDA 5C42B 4MF2A 5BN9A 1PC4A 3W62A 1NHVA 1TKTB 1NAQA 3CCVS 1TUUA 5C15A 5CHGA 1H98A 3U3YA 1S0OA 2W24A 4USKA 1GLJO 3AA9A 5ETLA 2D0PA 1YBUA 2IIHA 3WNHA 3PLAA 1FO1A 1HNIB 2IPOB 2G5HB 4P0QB 3CJKB 2YNHB 4MQ3A 2UUBJ 3GJSB 3GSIA 4ES2A 2V4JB 4TNOA 2FF6A 2P9GA 3EDQB 5F8LA 1SZPA 1HUZA 4Q2MA 4JI6F 4C98A 2YX1A 5ETTA 1WHYA 4JD2A 2FBTA 4OI6A 1ECWA 4F72A 5C0YA 8ICUA 2W9CB 4Y2VA 3U02A 4KY3A 2WC9A 1Q81O 1R0AB 4Q43A 2DGUA 2XGPA 5KFVA 2ASLA 2CXEA 3AO5A 1S1TA 1HHTP 4AHRA 3ED5A 4C8OA 3ZZOA 3KKFA 5DBAA 1I94F 3KXDA 4KRWA 1URJA 2D4WA 4LF9J 4IRDA 3W65A 1LNQA 3GSDA 4AT1B 2VONA 4JKHA 4M3RA 2BCUA 2YTUA 4M47A 3MR5A 4TYBA 3ISDA 1Q16B 1TELA 3UKRB 4FZYA 1S9GA 8RUCA 1KKHA 2AYBA 3A8EA 1S4FA 4OYPA 2R8GA 4JI3J 1Q18A 2DNZA 2JZBA 4YQWA 4K43A 4CJRA 5BPNA 4CF5A 4WJ3B 1JLAA 1JL2A 1CULA 3FLCO 4P9SA 1Q8KA 1HWJA 2FMSA 1OQ3A 1FK9B 2JMGA 1LVHA 3T9NA 4JI1F 3LUYA 1NNLA 3ENAA 2RQCA 4ELUA 3DOKB 4JI8F 2N4CA 2KVSA 5ALZA 4RQ6A 4M6WA 2NRHA 3IO1A 4HT7A 2OPPB 4IO9Q 2BM1A 2DNQA 4JI7K 3PHTA 1R43A 4ZVGA 5ETSA 1F6TA 3OYGA 4EHTA 4C3MA 2FVCA 5JMVA 1HYZA 2KN4A 1XQIA 2HVEA 3U3GA 3QICA 4B1YB 4HUEA 1FNOA 2OM6A 2D74B 1CS4B 4NOHA 1FJCA 3CCZA 4IZ9A 4X66K 1C1CB 1ZM3A 2HBLA 2W9MA 2JJ4D 3QUCA 2BV3A 2CPDA 1S72N 2P9KB 1F0XA 2WSEC 2Q0ZX 2YCHA 3QLHB 4EBEA 3BSCA 1TL3B 4IFYA 3BBCA 3NLCA 3OL6A 1KVJA 4ECTA 3TI0A 2KM8C 3DXMB 5B0EA 5EX3A 3AY0A 4FVUA 4BRFA 2ZM6F 3EY1A 3T7ZA 2HBYB 3CDAA 3OV7A 2P9LB 4FWOA 5KFKA 1JLFA 3K9KA 1VQNS 3LWLA 4AHUA 2Q3PA 3AGKA 4MJKA 2JZBB 2GVDA 3PJ9A 1TVRA 3W3SA 1YIJS 3I6PA 3DHWC 4C6AA 1VQKS 9ICCA 1FRJA 3FAHA 4NWBA 1M0SA 2LKYA 2H3EB 3B54A 1TP7A 4AL5A 3VAGA 1SCJB 2GJFA 5BXIA 1BPXA 1DY3A 4FPAA 4DZ6A 4DQ8A 3ZDDA 1RWMB 1Q1KA 3AVNA 1HPZA 3N5FA 8ICXA 4IR9A 4LF6F 2KYZA 2JSXA 4XPEA 1B70B 4WCEQ 1HNIA 3PX6A 2AJ2A 3VR1A 1X7VA 3X3UA 1WG5A 2FMPA 3AOAA 3IGVA 4O0NA 5DDOC 3U1NA 5AI8A 2DO0A 4PXBA 2ZGYA 3D6MB 4E19A 3TRGA 2YH1A 1A76A 1D9DA 2JV3A 1EP4A 1AUDA 3JQMA 4YNQA 2WB4A 2Z57B 3Q8KA 2E5JA 5L39A 3U9DA 2YNGB 4WYLA 4BY9C 3A3NB 3QMQA 4NRUA 5DQIA 3CMQA 1ZJMA 1RAEB 1UCNA 4IKAA 2NREA 4FO0A 2CNLB 1KAZA 4WE1B 5L1KA 3M9OB 2BJ8A 2FLPA 2ZM6K 3R2DJ 3MWPA 5F3XB 2E2QA 4UZCA 1B9DA 3CJQA 3AY9A 2K8BB 5ALVA 4YS2A 2IJNA 4RW8B 3ZETB 3O5BA 1NOMA 2VOOA 4CLKA 3SQOP 4UOGA 1PILA 4JI1K 4LF8F 2OEJA 2OWOA 5DS7A 2FQQB 1TL7B 1EKRA 1PJ5A 3I32A 2ALZA 2YWEA 4DR4F 4TVAB 4DXLA 2KJ8A 4PG4A 3AVAA 2VG5A 5EVZA 2LKZA 2KG1A 1X3NA 4FS1A 5ALYA 3IV6A 1S79A 2EPIA 1NH7A 1UVIA 1HHSA 5M2UA 3HL8A 3Q8LA 4UAVA 1NWKA 3VQBA 1SVDA 2QZ8A 1U1QA 5F8NA 5I3QA 1ZAXA 3HHLC 4PL1A 4EWTA 2IDOA 3O1WA 4EUVA 2G0IA 4RNHA 3GZFA 4QWEA 2W2MP 4DTUA 2X51A 2P5GA 4BR2A 3LDSA 1F9FA 2DEJA 1X40A 3HK2A 5HANA 2ZJQQ 2YNFB 5BPMA 1S4EA 3GV5B 5L1LA 5AQXA 1B0PA 5KT5A 3CD0A 4KT0C 1X5OA 3U1LA 5IQQA 3WZ0A 3UQ2A 3HHLD 9ICBA 3OLAA 1WKKA 3THYA 1V5VA 3AEVA 3FFKB 3ULEB 3JPRA 5AQUA 1ZQPA 2DVIA 4NXNK 3CG7A 4TXSA 2EFNA 1W2BM 2XSJA 3BKTA 3H59A 4JOUA 3JYTA 2A6OA 4DTOA 1U49A 2HSZA 2XYGB 4K42A 5AXKA 1SKWA 4PG5A 4HL9A 3OR2A 3WK4A 4US8A 3MR2A 4NLZA 3F56A 3O3FA 1KS2A 2E1MC 3NF6A 4WBFA 1BWEA 1IKXB 2ZKUA 3AVFA 2V67A 2Z4PA 3KZBA 2IJRA 1SIJA 1TZ0A 1VBKA 4DPOA 4ENOA 1SXEA 1PIEA 2CJYB 5T7BA 3BH6B 2A10A 2Q4TA 1NKBA 3ADAC 2HWIA 5GAGU 4CYUB 4DU8A 2H51B 4WU2A 1T0TV 1H2TZ 4RNNA 2ACMA 5B8HA 2G0JA 3MN9A 2A1RA 3D2QA 3ZZUA 2ZM6J 3CIZA 4Q44A 2Q6CA 4L3NA 2KZ3A 3C6UB 1A5VA 4DMNA 4GV9A 3CCLN 3NBPB 9ICHA 3N01A 2YWKA 2XS7A 4OI4A 4F0MA 5A2QY 1KQQA 2GELA 3CCQS 3CJAA 3D3CJ 2NZCA 2PFUA 4OX9K 5L1IA 3ZZPA 1B3TA 3N4QA 4YCXA 4BRKA 1K1QA 1V6HA 2FHJD 2E6LA 1NK5A 2ROPA 2KVCA 1APSA 4CEOA 4ECUA 1IKWA 1KD1T 1TUVA 3IR6B 2YQ1A 9ICUA 3ILLA 4Z7YA 1NI3A 1H3DA 2FJVA 3F2CA 5CYQA 4IWVA 4F4XA 3CIMA 2FZGB 1GAOA 2NSBA 5D3GA 5IINA 4Y2KA 5ADXA 1CSJA 1MDUB 5M1QA 2DHGA 4BC4A 2IM0A 3J7YP 3HHNB 4HTLA 4GO7X 3CJ4A 1N36K 4I0WA 1DRGA 1D1UA 2BCRA 2AF6A 3OQ2A 3K5OA 4AHSA 4J9QA 2DNYA 4J9UE 4JI0J 2M7SA 5CAAA 1YQHA 1BQXA 3VEOA 4QS8A 3MPWA 2A40A 1N33F 2J0XA 1IM6A 4FZZA 2YI1A 1JLFB 4YN3B 3CCRS 2G0CA 3D1HA 4EEKA 4FF1A 4IFVB 2ZIWA 1S59A 3TQEA 4CI6A 3H08A 4RU2A 3FQLA 2HRUA 5DO2A 3IG1A 3FC9A 9ICLA 2E8MA 3TQ1A 4CO4A 3CXCM 4FJ8A 2V4QA 3PW0A 2KN7A 3W5ZA 3M8ZA 1VSFA 3R9PA 3JPPA 1NHUA 3QT5A 1TL4A 4O4RA 3SCXA 3KKAA 3FZFA 1JB0C 1BY9A 3L7OA 4MK9A 4O9MA 5GTIU 4DR4J 5DQGA 4ZP8A 2GV9A 3IWXA 1ZQMA 5B08A 2BE7D 2UXBK 2ZC3A 3H6EA 2NRWA 4HT5A 4RUAA 5D0EA 4B9UA 1C0MA 3NVZA 3K8WA 1QE1B 2ZH6A 2DIVA 2ZUAA 3QO9B 3ZSYA 4CZEA 1YVFA 2VCPA 4H5RA 3QEIA 1N32J 5AKYA 3O1BA 3L3VA 4Q8EA 4JI5K 4H0TB 2Y0BB 4PQAA 3FSYA 5AR0A 4KLDA 2GO9A 2XBPA 3DLJA 3GQCA 4Y2UA 1S0VA 3LALA 9ICTA 4AYBD 2GW8A 1NPKA 3AU6A 3E58A 4CF8A 4ED2A 2G07A 5M1FA 3EDRB 3MGVA 3OYCA 3PR5B 4U7CA 4PL8A 2FLOA 3AHPA 3C65A 1IQZA 4J8FA 1MU2A 5GINA 2FJXA 3OYBA 4CJLA 5D78A 1G4CA 3MHYA 2RQ4A 4PWUA 2UV8G 5DB8A 3E3XA 5F1XA 5DB6A 2DCLA 4CZKA 4JN4A 1A6SA 3SMVA 1RT3B 4IH6A 5B0DA 4XO0A 1X60A 2KXFA 1DTQB 2IBOA 1ZA1B 4KLTA 4OYZA 1JLBB 1BCOA 2EW9A 3C28A 2D3ZA 3QGPA 2PKEA 1RT6A 2VBWA 3ZT3A 4JI8K 1PJ6A 2ESEA 3ZDEA 3CGIA 1YBAA 3OHRA 5AK6A 2A1AA 2C2KB 1N5TA 2P6RA 1RU2A 2P9CA 4QR0A 2RRDA 4FWQA 2DXFA 4J9PA 3MD3A 1FRXA 3VF0B 2M9NA 1GMWD 1EQMA 1VSDA 1ZQTA 2VASA 4FWNA 2BE2A 1GLBG 4EX7A 1RNHA 1W2BR 2Y8YA 4H0XB 3E8OA 4UW2A 1E4GT 3NAIA 5BPLA 3MF5A 4LF4K 4K0KK 3DN9A 3NCIA 4O44A 4HHUA 4GKKF 1R8HA 1NMNA 1OS5A 2ASPA 4K4VA 4NLRA 4OYOA 5AFUA 2VC1A 3US5A 1FFGB 3U27A 4IL6U 1U0HA 2I2YA 1S22A 1V3RA 5L46A 1VR6A 1XC3A 4LF7F 1YG0A 1QHTA 1C0GA 3W2WB 1XSLA 2KT3A 2HPUA 1SPBP 4XTTA 3PMNA 1VRUA 1U0SA 3MEGB 5EU7A 3BPDA 3R1LA 2AXTU 2UUBF 2YTCA 4P73A 4CJ7A 5TZVA 1P8ZA 2P2CB 4H5TA 5K14B 4A4JA 2XLIA 2IVYA 1S9FA 2FJ6A 4CFAA 4ZJLA 4LFBJ 1RHMB 2DFHA 4DR7J 3NFAA 5C2FA 1FDAA 5DDQC 2MKCA 4QZFA 1NZAA 2VPZB 4QZHA 1HQUA 1RT6B 1X4CA 2HGNA 3L09A 4DR5F 5J2HA 2CZVC 2LXFA 4Z4FA 4C1NK 4C4WA 4CYUA 4NV0A 1XWLA 2A2DA 2VFSA 2HWHA 4C9DA 3J7Z5 2VG6A 1UCVA 4A2AA 2ZNYA 1U2FA 1TL1B 3PRVA 4IQVA 1QSSA 3DFEA 3V81B 2WBMA 4CO0A 1JJ4A 3P1GA 3H4DA 3NGUA 1FXLA 3L5KA 4FZLA 4CWBA 1XO1A 2ZJAA 1F5CA 2HSTA 3CEDA 2KHVA 5C2DA 2MKSA 2QLTA 4WQ4A 4BXOB 2D5RA 1ZPVA 1KFTA 2NZTA 1L3UA 3EW9A 3PNCA 1RAHB 5SZTA 1PYSB 4Q0BB 4JWMA 4FYYB 3UVJA 3MMCA 2BJ1A 4CTAA 3LDNA 3H42A 4BRAA 3O1LA 3J8AA 3H0PA 4I6YA 3I55S 2CDQA 2GX8A 4DLGA 1IBCB 2UUWA 5AZJB 2QWMA 3D0GE 5JTIA 4K8XA 4MKVA 4O5KA 3DJCA 3JTPA 3L8BA 1SUQA 1ZM4A 3SSQA 1K0TA 2FBXA 4JI8J 4KLFA 1NB7A 4M5JA 4DV7J 3G6YA 2BPCA 2D3OR 2EAOA 3M6WA 3ONQA 3CCEN 5CR0A 2F9TA 1UEKA 3A8KA 3VA3A 4KYZA 3EN9A 2RUSA 2KK0A 3SSRA 2MAXA 4USIA 4KI6A 2KL8A 1M5PC 1NOZA 4FYDA 2XY8A 1HA1A 3ZTQA 1EWQA 2R4FA 4HVZA 4DPYA 4NA2A 3G0ZA 4NZ6A 4DL5A 3NP5A 5KFXA 4FBTA 1VQON 4F5RA 1IXKA 1HR0J 4DR6F 3BY5A 5ADXH 4ZCIA 2D0OA 1I94K 4BLGA 3MDQA 4B9NA 3UPFA 2K60A 2ZOGA 3TUJC 4RW6A 1SZHA 4ZIVA 1PAUB 2Z30B 3UNYA 1NEEA 4QZDA 4YOEA 2F77X 1JQGA 3V9XA 4YOXA 5HROB 2XG8A 4LF5K 1BU6O 3KLFA 4KHUA 1VDHA 1NGGA 1XNRF 3EKSA 4DV5K 1EO1A 3IA0A 3CJ3A 4CBUA 4Y2RA 2AP1A 4USTA 1KVKA 3H98A 2RF2A 4WFYA 4DR3J 1RA6A 2ILZA 3EJMA 2BZFA 3KOOA 4LJXA 2EC2A 2PYJA 3UR3C 4ZN1A 4MIAA 3KG1A 3IN5A 4KSEB 4W5RA 3T5JA 1JNRB 1NGJA 1SKUB 4NCGB 3LPYA 2HMXA 3RU0A 3SXLA 1TE2A 3ICLA 2R9LA 1XMQF 4CBXA 1DZ5A 3G6VA 4DR7F 4H4KC 1WI8A 2HQDA 1FX2A 3GYGA 5HHIA 4GVMA 5LM7E 1LKYB 4X66J 2VFRA 1IBLK 2NSCA 2VU5A 1P7DA 3BS7A 2GHWA 4CESA 1IR1A 2W3RA 4DSJA 5DJBA 3R5GA 4A5BA 3LPUA 2XYPB 4LF7J 1GOBA 4GKJK 1Z6RA 4ZMMA 5LSRA 3VGUA 2VBYA 3GFKB 1JCGA 3CFPA 5HQLA 2C3OA 1VSHA 2IS3A 5CCLA 1IN0A 2ERRA 4CO3A 3ZZ0A 4N77A 1NGEA 1XO0A 1L3VA 3MFIA 2O3DA 1U2CA 4IG3B 3QJLA 2DNRA 4PWDA 4MFBA 4JV0A 4NCBA 5HI7A 4EGLA 1FI4A 1ZXOA 2HS0A 1HNWK 4JUZA 3Q23A 4OX6A 1EAYC 3I9ZA 4AYBC 1GLEG 4B3TK 4CFBA 4CT8A 5B66U 4RPYA 5HJYA 2PZSA 3E51A 4EFHA 3QDKA 2CA9A 4NLGA 4IC9A 3LK9A 1CBKA 1Q8BA 4ERDA 3RAMA 2X1GA 3UIQA 2QJ3A 1IUJA 5A8WA 2GV1A 4CDGA 2M8HA 2ATQA 5DM7Q 3AAQA 1XBWA 1B0XA 4YMOA 2CJQA 2OELA 3CMAN 2VYPA 5J2CA 5AKEA 5J0SA 4KQZA 2FVSA 3M5RA 3RRGA 1JXVA 4LF6K 5DG8A 3UW1A 2BCVA 1WSRA 1VQ5N 4V1Ak 3DLLL 3OT9A 3QIDA 4RO0A 4EZ6A 3VF4A 2A6MA 2VGMA 4CLYA 1KN6A 1N32K 3W2WA 1IH7A 3ZSWA 3M2UA 5AQIA 2PGCA 3NH2A 1T9VA 3MXJA 4XA5A 3HX9A 4NLPA 3W1YC 2LPEA 1IR2A 1Z4UA 3CJ2A 4WTYA 4MO4A 1HYVA 5KQDA 2BANA 3MM6A 1K0VA 2GWJA 5J2MB 5D4LA 1U1PA 1FDBA 3JPQA 2XRIA 1N4LA 3HHLB 2DNGA 1UT5A 3WEEB 2XULA 3RAQA 2YKAA 1IBKJ 3FFIB 1RCHA 3SMSA 3CMAS 1FKOA 2FPMA 4LR8A 5EXWA 3MCPA 4K7QA 4CBWA 3JS6A 1RK8A 3I5CA 3ATVA 2VICA 1XR7A 3Q7BA 1DOQA 4OO1J 5KFBA 4H4MB 2Z2ZA 5AQQA 2GCFA 4F2SA 4OPKA 2V50A 2R2TA 2DRDA 3POTB 1RWNB 1RM6C 3MR6A 4UOFA 2YMMA 2EAPA 4A59A 5AK4A 2JEIA 2Q3SA 3VERA 5EWFA 3RB3A 3CCMS 4CJSA 1D8BA 2D41A 4KTZA 1GLDG 2KIWA 1S12A 2OGUA 1VQPN 1MWQA 2E7WA 2CKWA 2NUHA 1QCKA 4OZNA 2ZJQL 1HR0F 4FJKA 1QSLA 4KLIA 2MEWA 5KFFA 4J03A 2D9PA 4KLUA 3D2FB 4P2SA 1R7IA 4FWLA 5KT2A 4CF1A 2VPYB 3CCTA 1FKAF 4I2CA 4O3MA 3KJVA 5GMDA 2V34A 1IXRA 3KMSA 4QIGA 3O9RA 3UD3P 2LLZA 1O1WA 4PY5A 4KHWA 3UXOA 2ASOA 4F02A 5AM2A 4P74A 2SXLA 1XNRJ 4ED5A 1Q79A 4GKJF 4XPCA 5J2QB 2O1PA 3ZSZA 1SJFA 3I82A 1WELA 4FWPA 1N54B 3PW5A 5DMRA 1QQ7A 2BVZA 3LP2B 4DR3F 1NLVA 3JSMA 2OSRA 1BA0A 4DZDA 3T41A 4ZTJA 4K25A 1ZOLA 2Q66A 3F5TA 2DNKA 4X4VA 4EX6A 2WF8A 2HZVA 2EX3A 3W5XA 4C48A 1DEJA 4QIVA 2VANA 3SUQA 1K6YA 5KG6A 3F41A 2W54A 3JSBA 2KRBA 2ZIXA 3O6WA 3TSPA 1UWBA 2XI2A 2CAJA 2CPYA 2GO7A 3NS6A 1IV0A 2I38A 5H9EK 1B7YB 2F7VA 3KOAA 1WJ9A 3OR1B 3FCHA 3VA0A 2MSSA 5AQNA 1GXLA 2PMWA 5AHXA 1SJRA 4P72A 1ACMB 2L9DA 3TZWA 3NNAA 3B82A 3LAKA 1SGGA 2ZHOA 3DRRA 1QTMA 3DGPA 5F41A 2NXCA 4QYZK 1J2VA 1ZAWA 5KRSA 2ZJRL 1QQMA 5JUMA 2KNJA 2IOFA 3HM9A 2X3GA 5SUHA 3RMDA 5ALRA 3I0RB 2A42A 2M0GB 3JAMU 4U8VA 4TLRA 1PC5A 2W40A 5CA5A 1T03B 3N97B 1A0OB 3N9UC 3C0BA 2J9EA 2C2DA 3SQ2A 1YK9A 3AAWB 2H5XA 2DHAA 2E2NA 4KIAA 5ALOA 1PJ7A 4JKCA 2B9EA 2EWHA 1RYSA 5ALFA 3RAXA 3HHDA 2VQEF 4O5BA 3D54A 3TUZC 2MHNA 3OTOJ 3AVKA 1KN5A 2RDIA 3PFOA 4KTQA 2Z56B 3ZSOA 1RDRA 4C23A 7ICPA 4CW7B 4RQMA 1OWXA 2K1RB 3WQUA 1I51B 2NCKL 3S7RA 4TSXA 3S6EA 1HKBA 3BJYA 1WG4A 3CHWA 4AD6A 3M4XA 1TUYA 1MSWD 2PEHA 3GLJA 2XMWA 1ZQGA 4PZVA 3M6UA 4M63A 1U04A 2HOIA 4GVBA 1HNWF 2V0NA 2G9OA 4EO6A 3PRBA 1UT8A 4OI1A 1ZBUA 4L73A 1IBKF 4HHTA 5J2MA 2CGKA 3GILA 2B9YA 4MTPA 5AT1B 2CPXA 4PQUB 4HTUA 2OTJN 1Z00A 2QWOA 2ZXHA 1TKXA 2P5VA 2AKWB 2NO4A 3VQTA 1CLQA 3BR9A 3VAHA 4JI4K 3KJQB 4H54A 2O8CB 2WBRA 3U4LA 4CO5A 3T6JA 5L8RC 5IT9U 5KFYA 2W8KA 4LRFA 4X62J 4ZCKA 1FE4A 2YQ0A 4PWWA 1CEZA 4RW7B 2PC6A 3ZX2A 1R0BG 3HSDA 1BPZA 1HNVA 1RLCL 3M1VB 4LF2A 1REVB 1R89A 1YVUA 4ED8A 4EENA 2V2ZA 5I3PA 3MGHA 3HBTA 2J6TA 3MN7A 2BPGA 1M5VC 2BE2B 1VI7A 1YDLA 3N4PA 1SWWA 1U1KA 4I2QA 1X9MA 1VSKA 2JWNA 5EWGA 5C25B 2LYAA 2WCXA 1N5VA 2P8IA 1BWVA 4GKJJ 2DFFA 2O6KA 4UB5A 4CEDA 2R2RA 5H9EJ 1WF1A 2RHKA 1FDDA 1DGSA 5E0OA 3CD6N 2CRLA 1N48A 1Z25A 5CH7B 5AK3A 4R8UA 4WFBQ 3ENHA 3NG8A 4PPZA 3CCWA 3MEGA 3WXIA 3OJSA 1R27B 5HLFA 3KK2A 3CF5L 5D0HA 1Y9OA 2IDLA 1T05B 3GIRA 2XHCA 4CCHA 1IR0A 1DAXA 3MCOA 1L7NA 3VZIA 2A3VA 2C2MB 5JVGQ 4XIUA 3BQ7A 2K4IA 3C7NA 2EBEA 2YX6A 4WFAQ 3DYAA 4WFNQ 5TKWA 3CFRA 2ZUGA 4NMLA 3MM7A 3MWBA 2B8PA 1YRXA 3O0FA 1COKA 4LF9K 2I8EA 1SQKA 4QBUA 2GWSA 3PZPA 4M42A 4RG8A 1WC4A 3QU9A 1S1TB 2EI5A 9ICJA 2J0QD 1NPRA 4RBUA 3UXNA 1YSJA 2QB0A 1BQMA 2QRRA 2M2BA 2WF6A 3VETA 2GMJA 4Y2SA 4UUWA 3AXMA 3H25A 2I7PA 1RQ0A 1GOAA 4JI3K 3TR8A 3C1ZA 3VCDA 4DTJA 2FZCB 2L41A 3VEYA 1KWMA 3MEKA 4FJLA 1GTHA 4FYVB 2HNDA 2OIHA 3SCJE 1VQSA 4KHRA 3FZKA 2F5GA 5ETMA 1ASWA 1V97A 3ETMA 2RNEA 3AVLA 4CEEA 1BHLA 3D0HE 5KG4A 2V8PA 4LF8J 3I28A 2POKA 4KLQA 3OHAA 4NYZA 1HJOA 3DRPB 4DR5J 2GAHC 4RQNA 3VEZA 2FYXA 1VQNN 1TK8A 2XMAA 4WU3A 3C3LA 3P31A 4NL5A 1HNWJ 4DSIA 5G0RB 3DXKB 3VTHA 1N5XA 4OYXA 1SC1B 2DFLA 1RWWB 4AXJA 3K0SA 1O5JA 3FEZA 5BR8K 2DD8S 1Q3VA 2DPJA 5LJ5Y 1N5YB 1X9XA 1QQCA 3K4GA 4E89A 2KB2A 3ISBA 4EBDA 4DHVA 1B43A 1U2VB 3BDPA 3QEVA 2IRUA 3NCQA 5K8OA 3KWGA 3QWPA 1ZBSA 2NRXA 5L1JA 4ANCA 4V19S 5BREA 4Z6DA 1VQMS 3LTOA 3W66A 3PYGA 2OMOA 2YPYA 3ALRA 2ES6A 1NBEB 3ISND 3MM9B 2NYHA 3TSUA 5AKXA 2YKQA 4RLEA 1D5AA 1RAFB 4ECVA 1UJ4A 2FJBB 4CQ1A 3D6HB 4WCEL 1D9AA 4X4OA 3J7AN 1FX4A 1UZDA 1FWPA 2OHDA 3OBWA 1Z3EB 1OQ6A 1YHQN 1NKEA 3AA2A 1ZQ1C 3B6OA 4B3MK 8ICIA 1Z1ZA 1HYSB 4IH7A 4YY3F 1FEHA 2DHSA 2ZH5A 3G71N 3QJPA 1O13A 1C7YA 3F5EA 4EYIB 5IM0B 4DO9A 5A0YA 5AKGA 2HDOA 3OFEA 3MN6A 2G09A 2ZJ5A 1GOCA 3GIKA 1UAXA 3M2VA 2KFNA 3CCSN 2HW3A 3CQXA 3KD1E 2CVIA 2YXLA 2DGXA 2H3VA 4ID5B 2HNZB 3H8MA 2ZWOA 1GXUA 4U67L 3H2VE 1HNXK 4NLYA 3J7A1 1RTZA 1KEKA 3AARA 2D3UA 3GR1A 1TKDA 3PEJA 2R18A 4ED1A 1DTTA 3DLRA 2BBEA 1H6KX 5EUHA 4U7UK 3BZQA 2LQ8A 2QE5A 2JNJA 1VQ7N 3IAS9 1T05A 3O2IA 8ICVA 1GMUA 2FTRA 1IQTA 5E3QA 4M3UA 2NYVA 4OD0A 3BH7B 1ZBLA 4RQ3A 1TV9A 1U6FA 1CXQA 3H0RB 2HHWA 4QIEA 1GMWA 2QWNA 3P5TL 2JLGA 4DQRA 5DB9A 3HP6A 1WSVA 1FFSB 5C2CA 1RTDB 4JLHA 2KHOA 2AJ1A 3S41A 1WNEA 3DWLA 3V9SA 3MMAB 4Y65A 1SV5A 3GR0A 5KFWA 3RG6A 2GWKA 4JEPA 5A2QO 3H40A 3BS5B 4M1KA 2OCEA 3N7SC 5HBMB 1RKJA 2W8LA 2UXCK 3D1OA 2W6KA 4WZQA 1UWBB 9RUBA 4QW8A 4FL9A 4A8KA 3J7YI 1FDNA 2Y0SC 2Y3YA 5A0YB 1MN9A 4KE5A 2RS8A 1XMQJ 3DC2A 1RUSA 4KH0B 2NNWA 5DETA 2XLJA 3DXMA 1EZZB 4FS2A 3OXGA 4IOCQ 4DV4J 2DY9A 1ZD4A 3ZT0A 1NH8A 2HYIB 1Q7YO 1U2RA 2GJ2A 4A61A 1QQ6A 1Z4OA 4MYUA 4QNLA 2PYLA 2OMLA 2LXIA 3KG4A 1RT5B 4UAWA 2E7XA 2Y9UA 1H7WA 2VODA 2HBMA 3THXB 3QIPA 4QR2A 3OL8A 4X65J 2PIIA 1S0NA 3GFYA 1XQSC 2V4RA 2Q6BA 3KLEA 1VISA 3O8MA 3N6MA 5EHHA 3BGOP 1N34K 8ICKA 2QTDA 1BPDA 4NB4A 3O80A 5SWMA 4DU3A 4A8FA 1WC1A 5EX0A 5FPNA 1U2VA 2ZC4A 1S3XA 3SDEB 5DLGA 1TU0B 3O9TA 4FO6A 3DLLQ 2E1FA 4LRCA 2E8PA 2A1JA 3WNGA 5I3UB 4AFFA 4RNMA 3F2BA 3R97A 1Q53A 4LUBA 3SLCA 2EXUA 3ZZTA 4MEYA 4Y6IA 4RPXA 4DTSA 1EP4B 5LXRA 1QD1A 4DLEA 2PBDA 4IBNA 4BRHA 1RWPB 4ISGA 4E1NA 2DNOA 5IS2A 2KP7A 2IMWP 3E9LA 1WDTA 1RP5A 4O5FA 4OHXA 9ICXA 4IG0A 4IDHA 3M30A 2CUYA 4BR7A 2BHNA 3K17A 5IZHA 1I5OB 9ICVA 3KD3A 2FSNA 2H3QA 4KLJA 4WE1A 5D6GA 4PHDA 2OD6A 1SC3B 2A18A 3HSGA 4PHEA 4A8XA 3S3NA 4WFXA 3OYJA 4P0PA 3UD4P 3G82B 2KHDA 1C1AA 3FZBA 4ELVA 2ZH4A 4PXDA 3TX0A 1JALA 4B9TA 1QVGR 2EVZA 4Q8FA 1P8GA 4RW9B 1YI2S 1B22A 4FDFA 3IRXB 4OV6A 4K5SA 3OXFA 1QZ6A 4ZP6A 2K4EA 2ZJRQ 4I69A 4DSKA 4C0ZA 2IVOA 3VPZA 2HNYA 1N56A 2G8WA 2DY4A 5A8KB 1FWLA 1RWXB 2D0AA 4DOCA 1ZQOA 2EFVA 4DU4A 1YGYA 5HOOA 2MQQA 2HFOA 4YY3J 3MOZA 1JLGA 8ICSA 1T9YA 3K0JA 4I2GA 2AEJA 3HSTB 4DB3A 4DUZK 2P6SA 2A1JB 2YV0X 4ZVHA 4ZVOB 2G8HA 4TN2A 4BRPA 5ETRA 3D2SA 3SCIE 4BVOA 3DMJA 1ZQKA 2QARB 7ICJA 3MX5A 1SL2A 4ED0A 4Y00A 1Z1VA 2H9ZA 8ICHA 1RTDA 4R5PA 2FJAB 2VZ9A 2CG4A 2CQIA 1U1LA 4CJUA 1NKCA 1ZS6A 4JHDA 1ZRNA 2FHJA 4DMZA 3FCVA 2LYBA 4FM2A 3D9BA 3M8PA 3MUTP 1QM9A 3HJFA 2B4JA 4CECA 1G1XA 5JS1A 1V9OA 2HHUA 1V3ZA 3D2NA 2CZ9A 9ICRA 7ICNA 3TFSA 3K58A 4RT2A 3D6FB 3DRYA 4MFFA 1ITPA 4OPJA 1D9FA 4B02A 3R5DA 2WFAA 2Y8WA 9ICGA 1N0UA 2MZQA 5AQVA 1S1XB 3ZDBA 1UL3A 4DV6K 5F8JA 2JWKA 2QA4G 4B8CA 3TYTA 4D3GA 2X6NA 2Z1GA 4K2JA 3C14B 2GQ2A 3D68A 4CJ4A 3N4WA 1KOHA 3OTEA 4WYWA 4X65F 2FY1A 1CG2A 3CJSA 2G8KA 3MMBB 5LMUK 3HVWA 3SQ0A 2Y1LB 5AQYA 1TL3A 2H48B 2PT0A 4FBUA 1O51A 3LP1A 1RDDA 4DX7A 3HD1A 5IFMA 4OZ3A 1W2IA 2X1BA 3AXKA 5LL6d 3P4IA 3G6XA 4YUDA 3CB4A 7ICMA 3VESA 2FDRA 1EJ7L 5KFAA 3LP0A 2LU1A 4BRNA 2Z2MA 1BVSA 5AM4A 2QARA 1X5TA 4ZVTB 5JLHA 4PL7A 4UAUA 1HL6A 4ELTA 4M63C 3AO4A 1QZ5A 2WOMB 1RTIA 2GMLA 3I76A 4O0IA 3M8QA 3Q8PB 4NRTA 4QIWF 1VC0A 3FBEA 2W25A 4CEAA 1UPHA 4DQIA 3FZHA 2ZBQA 4FJNA 3W0LA 4LH4A 1ZQEA 3HMJG 4GV6A 1DFDA 3A13A 4CRXA 4M94A 2W4DA 3S1TA 4RUBA 2G2OA 3PDNA 3EUNA 1RCOB 1HEKA 2PI4A 3A8YA 2MQNA 3CJ1A 1ZTTA 5DRKA 3KUEA 4DCOB 1S1VB 4E2FB 1JLCB 5AQSA 3L2UA 2O8EA 5E5NA 2ZVIA 4GY2B 2XMVA 2LDIA 1S6UA 1XMOF 1QJHA 3S9HA 3DLGA 3MEDB 5E26A 3WKBA 2GS8A 2VL1A 3VQDA 3I0SB 2O4GA 2F1HA 3P83D 1Y5LB 1AA1B 3SCKE 4B9MA 5JS2A 2CGLA 1N2XA 3KK1A 4XH4A 2UVUA 2BKNA 3RJEA 2MMYA 3L7PA 1ZRMA 4FPRA 4KFBA 2XLKA 1C0UB 1M1KO 4Z4GA 2HVZA 3WQTA 2XWXA 4DL3A 3CULA 2F2AB 2DIUA 1RDUA 1FRIA 3EUB2 2OH2A 2DO4A 4LSLB 8ICCA 2V69A 1VBZA 4KPYA 3BF4A 1T9TA 4GVLA 2DL0A 3GDQA 1WC0A 2QSWA 2K3IA 1X4EA 2QSFA 4XDDA 3PHEA 1YJ7A 2AJ0A 4KX3A 3IUCA 1RT5A 4XDCA 4M5IA 4QIWD 2ASMA 4BR4A 3OY9A 4K2XA 1CULB 1SB6A 2B0CA 3IBFB 2ZIUB 2UXBF 1XIQA 4PG7A 3ETLA 2LMIA 4ZKAA 4B1UB 3BN7A 1U1RA 1FESA 2RDDA 2BRLA 5H9FK 4FJXA 3KFWX 5THWA 3D28A 1Y0HA 1X9WA 4LZDA 1Q78A 3CJ5A 3VV2B 4DR6J 1PK1A 4L75A 1RCXB 4LSZB 3ILOA 4LIRA 3CPWR 3HFZB 1HRHA 2K4PA 5BRDA 5GMEA 1U47A 3AO3A 3CCES 1A5WA 5KNIA 2DBYA 1VSEA 3SFUA 1ZQSA 1VMBA 2MY8A 4F3MA 1NNDA 3FEXB 2XS5A 1LWFB 3C95A 2CQGA 2NO5A 2UUAF 4O0JA 4NXMK 3TA1A 1QE1A 3WC0A 3VQSA 4ZVSB 4K4XA 2G4BA 4LFBK 1NJZA 4Y1CA 3CJRA 2W7PA 1EX4A 4OPAA 1PVPA 4IRCA 1YJVA 4P4OA 1QVGM 2GOLA 4CZIA 3WKAA 2KKZA 2OPQB 3I5BA 4ICAA 4QZEA 3ETOA 2J6UA 1WHWA 5AQMA 1UTAA 4CM2A 3FM9A 4F4KA 5CZ1A 3TZXA 5I4MA 2MQ8A 1NK8A 3GBTA 1Q9YA 1RT1B 3ZX3A 2E1RA 2YQ3A 1ILYA 1N63A 3FCWA 2VPWB 5AIAA 3FBFA 5A6WA 1F21A 1ITGA 4BR0A 4URQU 2O8BA 4IEEA 3RJMB 1BL3A 2RDJA 3VVUA 2QEXS 3CJCA 1MC8A 3R3TA 3NGDA 2IDEA 2V52B 4FZNA 3D45A 4LFCK 2CVEA 3BS9A 3L0QA 2HNYB 2ZBCA 1S5ZA 3JSRA 2GC8A 2VDIA 5A8KA 2VJUA 2ZXIA 1VQPS 4YOVA 3TU5A 2VA2A 3VGVA 5J2KA 1C0TB 3M1FA 4WP8A 2CFXA 1B4SA 2XWYA 4AHTA 3DOKA 1R6VA 2KJVA 3M6VA 4PCQA 2FHMA 3RJGA 2XIDA 3PO4A 8ICMA 3RW6A 3IFRA 5F3ZA 4KHMA 2QN6B 2YKMA 4KC5A 2B5JB 3SYZA 1G15A 2ZH3A 4HCCA 4CTAB 2RB7A 3BREA 2EC0A 2QKKA 3DV9A 1QUPA 4I6WA 3QBXA 1XNRK 4N56A 1XMBA 3AVHA 2GFFA 2NLWA 2ZDPA 2ZOMA 4KGZB 2FBYA 4KN4A 2WSFC 2J7WA 5AQZA 4YY3K 4USVA 4QQBA 2P9UB 4QWDA 2W1BA 1KVIA 2CJKA 3OJUA 3CWJA 3O6QA 1O08A 4CF4A 3OYLA 1Z4NA 2AX1A 5DBBA 3OVNA 3V4IB 5B09A 5KG5A 3LM9A 5A6PA 4IQXA 3LYSA 4GRSA 2W2NP 5ALDA 2BM0A 2DHHA 4DSFA 3QUQA 2HGLA 4ANDA 1QY7A 4ISFA 1JUDA 4USHA 1ATRA 3TA2A 1VQYA 3AJDA 4E1MA 3MR7A 4BGBA 4CO2A 3ENOA 2Z2LA 4P7TA 4IH5A 2HNZA 1PCAA 2DGVA 2HQFA 3QWUA 4WXWA 4ZA1A 1SS6A 3CT9A 4DTMA 4OLOA 1XMOJ 2Z58B 3KKAC 1IKYB 3KLGA 8ICFA 3EEQA 2GNKA 5GAEP 2HRTA 3JB9k 4KBOA 1J2MA 2V9WA 1TVRB 3TWZA 3LA0A 2QG9B 1C0TA 4C8ZA 3HT0A 1OW5A 1VQ9N 1FJGF 2EK1A 2BH1A 1EIYB 2GO8A 1DJ0A 2LEAA 2EFGA 2QT7A 1T11A 3VAFA 1HFEL 1OYDA 4IJNA 1JKHA 4ILGB 4CJWA 3H5UA 1YITN 3GIJA 4YOWA 3N79A 2R7QA 4KRFA 4X5VA 1WOQA 5D4NA 3NUQA 2XGQA 5EGYA 1KQGB 2BQRA 4FW1A 2O67A 3VGLA 3HKZD 1NJWA 1H74A 2DGQA 3GG1A 3UMCA 5J0RA 3U7JA 4ILMA 3ZLJA 3C6TA 3ID6A 1SJ1A 2AGOA 1WCLA 1NZBA 2WRMA 2RF2B 4CGGA 2WW4A 3D1QA 1AT1B 3ITHA 4Q0BA 1FHTA 4FKYA 8ICTA 3OL7A 4B3SK 2VH7A 5KFDA 2DISA 3AH6A 3BZKA 3VEWA 3KZIU 2QMWA 2KV2A 4GLXA 2A41A 2G08A 2GJIA 4BCAA 1D3WA 4LF7K 3V6KA 3UD5A 4NCGA 3UKRA 2PSZA 4ZVEA 3I0SA 2QKQA 3QSYB 2IIRA 2KXHA 4USMA 4A48A 1HWKA 4RWXA 3HI0A 3KLGB 4BRCA 3AQOA 2HVIA 2ZHBA 4HEA9 2LA4A 4X4PA 1F9HA 3PW4A 3O3HA 4CLSA 2E1ZA 2B6AB 3OS2A 3PM9A 3NASA 1UZHA 1ZQYA 5HN0A 2YY3A 4CZLA 1P1TA 1WACA 3LZIA 1KP6A 3EMTA 2M70A 1R8CA 2JXJA 1XNQK 3RJFA 1KL9A 3NAHA 3ETRA 4W4MA 1S5JA 2RAQA 3M8WA 5EN1A 5LMUJ 4CIFA 2F9DA 3C6TB 5EOYA 3VGSA 1BI4A 4BUGA 3BV8A 1DQ9A 2JRZA 1G2EA 4F9OA 2AJFE 2P6TA 4OJ3A 4YOUA 4K59A 4JK7A 5AJ3K 4DV4F 4NWIA 5L1MA 1DQ8A 3MM5A 4KGVB 1QAJA 4M41A 2M8DB 4ECRA 1A6LA 4Y28C 2WVEA 3TPQA 2DGZA 3NF7A 3VQ6A 4N7TA 1N6QB 3QGIA 5KT4A 2ASYA 4AL6A 5I42B 1X5SA 4JK8A 2BQUA 3E9PA 3RGIA 3QEWA 3W5YA 1RDBA 3QEXA 1BC6A 2AMCB 1I1GA 1PGZA 2WHOA 2ATLA 1JL1A 5AZIB 1ZQRA 2XZWA 1VQOS 3RMAA 3IM1A 4EP5A 3HFKA 4U6PA 2MTLA 4B17A 1F2HA 1RWOB 4IOAQ 2XMMA 4BDZA 4E7HA 2OZMA 3IAYA 3FVYA 3Q7CA 1GLLO 3WX8A 4I2IA 3NWGA 2ZJPL 2UU9K 4CGHA 3K5LA 1NG9A 2VQEJ 5DM6L 5AQFA 1N5QA 3QT8A 3OTOF 2B8QA 3C6HA 4OHVA 3B78A 5KOWA 5K4LA 4IQUA 4JI4F 3H8WA 3Q83A 1VQ6N 1HWLA 2I6XA 5IXUA 1Z19A 2QYGA 5E3PA 1FJGJ 2H3ZA 5C24A 3BDEA 1SB3C 1UMJA 4UY8O 1RADB 2UP1A 4CD3A 2WONB 4LRAA 4RW8A 3ZETA 4FZVA 3HHLA 4FOEA 3GV8B 2MLZA 3DM2B 1VRQC 3BBBA 4I2EA 5EE0A 3DGVA 3QEAZ 1CZBA 4CEFA 4F67A 4EI2A 1JKHB 3QUTA 2YB4A 1ICEB 4QJVA 5D49A 3V1QA 1F9EB 5K14A 3CM5A 3TARA 1V3SA 2M88A 2F9JA 3PJXA 1Y3JA 2XI3A 4OYIA 4CJTA 1FERA 1CJKB 1JJHA 2ZIUA 5AQLA 2E29A 2E9ZA 2G5IB 5KG7A 1F60B 2ZVSA 4X62F 4X2BA 3B8HA 2MLYA 1S49A 3Q8VA 5J2NB 1Q4RA 2NPIA 3QSIA 2CPEA 2V2VA 5KFMA 3RF9A 3KK3A 1KLMB 2VQFJ 4UY8T 5LY3A 1ZQBA 1KFDA 3QO9A 3GB0A 2BDPA 2HOEA 4DFDA 9ICNA 2YKMB 4UOHA 1RTHB 1YHQS 4CJKA 1HMVA 3GU3A 1E6VB 2ZKTA 2UZAA 1SIWB 2P9EA 4R0JA 4AM6A 2OTLS 1HWUA 2CGJA 5ADZA 7ICIA 3TAPA 4EFAC 3CPWM 1EXNA 2DQNB 2V94A 4P4MA 2Z8QA 2HMPA 4DX6A 1TL7A 4FJ9A 1YKWA 1U1NA 3TNVA 2GMHA 4RUHA 2MGZA 1S6QA 4E7JA 2A19A 4BRGA 5KFGA 4IXCA 2VG5B 4ZVFA 2ZJ8A 1QDUB 1VRTB 2DKXA 3G8TA 4M5GA 3PY8A 3L3UA 3I56N 3SFGA 3MMJA 4ETXA 4FVMA 1CXUA 2ISPA 4QYZJ 5J0UA 3VQ9A 1S1WB 3OVAA 1TFWA 4DL6A 3SQ1A 2RKIB 1B0TA 1HI0P 2D6FC 2WF7A 3ENVA 5ALPA 3CO0P 4N41A 3THVA 3QU7A 3SAGA 1XSNA 1U9LA 1QUVA 5EX5A 4R65A 2JLFA 3WUHA 4PKDB 2OPRB 5AI0A 1NGIA 2QMUB 1FKOB 4NLUA 2XSFA 4I2JA 1ZJNA 3O9UA 1JLBA 1FW6A 3DLHA 2VF3A 2KO1A 4RBTA 3CCSS 4QZVB 3K57A 3OYFA 4CE6A 3KVGA 1NK9A 1RE1B 2OAUA 3QERA 3TX8A 1RT7B 5M2PA 4FOIA 3TACB 1S1UA 2QL7B 4B9LA 1T44A 1IV8A 4EO8A 2WVFA 2KVIA 4PHTX 2AEMA 2KHQA 3SV3A 2U1AA 3KHLA 1RHKB 2VGNA 3R3LA 2ALYB 5KG2A 1D8LA 3RUBL 4UASA 2YMLA 2X7IA 2O8EB 2F3JA 3KHHA 3QMLA 4HACB 3VALA 1SH3A 3MECA 4OHYA 3OS1A 2RMLA 3MCNA 4UAZA 3NAEA 4JI2F 5D46A 1D4XA 1OY9A 2CH6A 5HR7A 4DU1A 1J97A 4A8SA 2AX0A 2MPUA 3D2FA 7AT1B 2V7ZA 4P2MA 2GA7A 2YVSA 3L3CA 3NVWA 3ZSVA 3A1YG