1NK7A

Guanine-adenine mismatch at the polymerase active site
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk7A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk7A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk7A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk7A01
2AU0A 1EKEA 5KFIA 4CIFA 1T7PA 1BHLA 4OPJA 3D45A 5KT3A 4J9QA 1RT3A 2BCUA 1QTMA 2YHBA 4B8AB 1JXLA 1FKOA 1HUOA 4FLYA 3KLEA 3M8SA 1TAQA 1XSPA 9ICUA 4NY8A 4FLXA 3AO5A 4RW4A 3K57A 2VG5A 1HQEA 3LP1A 5J2AA 2BKEA 1Z3EB 1RTHA 4CJUA 4KHWA 4KLIA 2KZMA 1S97A 4GXIA 4B08A 3AVAA 4P2HA 4J9OA 7ICNA 4N76A 2OZMA 2HHTA 3DRPA 7ICLA 4QZFA 4CHPA 1BIZA 3CFPA 3C21A 5CHGA 2FMSA 5DDYA 5J29A 3RAXA 3T3FA 4LH4A 2V4QA 2FMQA 5SWMA 2O4IA 4DOAA 4RUAA 9ICWA 3C23A 1RDCA 2FBXA 4ECRA 5J2JA 4EBEA 5HP4A 3DOLA 1NJWA 3SCXA 5KFGA 1HNVA 4LVSA 3DM2A 5KFHA 5KI6A 4W5RA 8ICNA 4IBNA 3G10A 3ALYA 4FVMA 1RCHA 2BHNA 5J0TA 3LPTA 2F1JA 3ITHA 4CJRA 1TK0A 4C8MA 1BL3A 2XC9A 5KFLA 2D0CA 3OYMA 3JPNA 3WNEA 4CJSA 3O3FA 3UXNA 1RXWA 3MDCA 1C1BA 2RDIA 1HMVA 5BOLA 2ISOA 4J2BA 2W8LA 4MQ3A 5HRRA 4TQSA 3QNNA 3NBPA 4M3ZA 3LWMA 3V81A 4FJ7A 4CK1A 3TAGA 4IFYA 3CYMA 1RDDA 3GILA 2MUTA 3NH2A 2P6UA 3HM9A 5KFMA 2JEFA 4KLMA 4ECTA 2NRWA 5L1KA 1B9DA 1SKWA 4FW2A 4R5PA 4BWJA 5KT2A 4Z0UA 1HPZA 3VQCA 1S6PA 4FM0A 4FXDA 3H4BA 3SNNA 1ZQVA 2IOCA 4H4OA 2BCVA 5JS2A 4QZEA 1ZQTA 7ICHA 1MU2A 2R8KA 8ICEA 4L8RB 5HBMA 4NLNA 2W9AA 1KFDA 3MBYA 1ZQFA 1JN3A 4BXOA 4FJJA 4CECA 4DO9A 2KZZA 5L1JA 3VQAA 2HMIA 5J2IA 4CEOA 4DU1A 4M45A 1ZQJA 1ZQZA 1TGOA 4I9LA 3MR6A 5HRSA 3CQ8A 1UA1A 8ICMA 4QZDA 4RQ6A 2R8GA 3TFRA 2PY5A 1WSEA 4FW1A 5CYMA 3PUFA 5C24A 4BXOB 4CJKA 1Z00A 2W9BB 3VA3A 1XI1A 3V6DA 4CEDA 1TL1A 3HW8A 1BIUA 1W9HA 3L2VA 1C0UA 1WAJA 2HNYA 2HNDA 4B9UA 3NF8A 4CHQA 1BGXT 1U48A 4Y1DA 4I28A 1KSPA 4J9MA 4F8RA 8ICOA 1CXUA 2IDOA 3KD1E 8ICBA 1T03A 2JZBA 1JLEA 1ZQEA 1JLBA 3KK1A 5KFNA 1WCNA 3OYJA 3MR3A 9ICHA 4Y1CA 2PYJA 3NGDA 4DSKA 3KLHA 4R63A 2AQ4A 1S5JA 2G8IA 8ICRA 3C6TA 4KN4A 5KFPA 2B5JA 4E7KA 4F2SA 1RILA 3OYEA 1N5YA 1GOCA 1KLNA 1NK0A 3C5GA 2BQUA 2HHWA 1S0MA 3SJJA 3V9UA 2XY6A 1ZYQA 3BDPA 3OYFA 4FJLA 2W9CB 3FFIA 4W5TA 1ZQGA 5DG8A 1NK7A 3PV8A 1GOBA 1B22A 4M9GA 4P4OA 3H8JA 4CJLA 5DQGA 3VQPA 3RMCA 1XHXA 1VSJA 1JKHA 1ZQYA 9ICQA 1DTTA 1TKDA 4F3OA 3M9NB 3L3UA 2FPKA 1ZJNA 5C5JA 3BJYA 2EX3A 2IGIA 2VANA 3OYGA 2Z1GA 5JUMA 2BE2A 4MFAA 3PX4A 4FJXA 5KFRA 3T19A 1BPDA 4CJWA 4Z6CA 1LV5A 2PFOA 4NM2A 4DSJA 1HRHA 1QQCA 4E1MA 2G8VA 5DBBA 1S0NA 3VQDA 4KPYA 3ZSYA 4ID5A 1D8LA 5KFTA 3DLGA 3VQ8A 2MAXA 4DQRA 5J2PA 4LSNA 4YR2A 4FBUA 4JV0A 3PR4A 3GV8B 4AHCA 4JRPA 1VK0A 1BPBA 5CY4A 2NRXA 4CF8A 1KVAA 4KI6A 2YKNA 4OKKA 5KG2A 4ECSA 3GIKA 2KN7A 1D9FA 4W5QA 4F92B 1YT3A 4GC7A 2B6AA 3AO2A 4QAGA 3FDSA 4RQ0A 8ICFA 3HPGA 1C6VA 4QZGA 4B9LA 4IRCA 4BGDA 4GMJB 4MFCA 3V4IA 9ICXA 3I8DA 3SUNA 3RH4A 3O3GA 3H8WA 2ASJA 1KFTA 1XWLA 4ECUA 3QEPA 4KLQA 3PW2A 4EBDA 2HW3A 3RB3A 4M3WA 1S76D 3VQ6A 3QEWA 1Q9XA 2A1JB 4DL5A 2BR0A 3CFOA 4OKEA 2IBKA 3K5NA 3DLRA 2UVRA 5EWGA 4B8CA 2PI5A 1WSIA 5KFDA 1DTQA 5KFAA 4Q8FA 3ISDA 1TKXA 5KGWA 4CERA 4DU3A 1B9FA 5KFEA 2FBYA 4FLZA 3RWUA 1T4GA 4F4WA 4O3NA 3G0ZA 2IC3A 1ZQLA 1S0VA 4ECYA 5CA7A 4PHAA 1ZETA 3ZT2A 3ZSXA 3ZDEA 3RTVA 1SKRA 3THVA 4I2BA 3LP0A 2W42A 4BDZA 7ICSA 1LAWA 2IHNA 4Z4HA 4CJTA 1V9PA 3MR2A 2X78A 3K5LA 4RZRA 1FXXA 3D0PA 3C1ZA 5D4BA 2C22A 4B9TA 1JXBA 3KLIA 8ICGA 2Z1HA 3AO1A 3V9XA 4JUZA 1N48A 5IILA 4DWIA 5KTQA 3HP9A 2FMPA 4WE1A 3AVMA 3Q8PB 4HTUA 3IG1A 3ZT0A 4XRHA 3QINA 4I9QA 4Z4GA 4UB2A 3C2LA 4IRDA 3RR8A 4IQUA 3AA3A 3NF7A 4FLWA 4TUPA 3HL8A 8ICQA 1NK9A 4E89A 4ECVA 4KLEA 4OVLA 8ICAA 2G8UA 4CHNA 3HWTA 3U3YA 4I2QA 4QWEA 3L3VA 3BQTA 4DG1A 4M42A 9ICSA 4E7JA 3CFRA 3SQ4A 5DG9A 1XS9D 2XY7A 1VRUA 3AVJA 4CF9A 3K58A 3AV9A 1EX4A 4XA5A 4I2DA 4M3XA 2ASLA 2NUBA 3RB6A 1KLMA 4CHYA 3S3OA 4N5SA 4TSXA 1A5VA 5KFUA 1S1XA 1JLFA 4RPXA 1VSLA 4NLZA 3TAMA 1RT7A 2V4RA 1ASVA 1UOCA 2VA8A 4K4HA 2VA3A 4Q43A 2R8JA 3L2RA 4M41A 8ICHA 4PWDA 1TL3A 5KFWA 4MEXA 3JPRA 3VQQA 4M6WB 3ETLA 4O3PA 3RJJA 1WNSA 2BQ3A 2XRIA 4XQ8A 3HXMA 1LW2A 9ICCA 1RDAA 4BDYA 1VSDA 3GDXA 1D5AA 1O1WA 3V6JA 4YMMA 5J0RA 9ICOA 4ECZA 3AVLA 5IIMA 5BOMA 3G6VA 4GVMA 4LH5A 1I3AA 3MEEA 4DS5A 1ZQPA 3NAEA 4DOBA 4IDKA 3VQ7A 3Q8RB 3OSPA 2JEJA 1C0MA 1EXQA 1BPZA 4LY7A 3QEIA 5KG7A 3T5LA 1IO2A 4FJ9A 4NM1A 4LZGA 1MQ2A 4CK3A 1S6QA 1SL1A 3VQ4A 3B6OA 4OJRA 4FK0A 4DTXA 2KFNA 2G8WA 1PZNA 4R66A 3MXMA 7ICJA 4Z6EA 5IIJA 2BPGA 3TAQA 1QSYA 3B6PA 1IG9A 1S77D 1JLCA 1QSLA 4HYKA 2P51A 3GIMA 1RT6A 3DRSA 3MR5A 4QZ9A 3PW7A 1TK8A 8ICLA 1DLOA 5C42A 3UXPA 5CZ2A 2V9WA 3RB0A 1A5XA 2YNIA 4Q5VA 1U45A 2P6RA 4FLUA 2D5RA 5CWRA 3NHGA 4DEZA 7ICTA 3JYTA 2IA6A 1DGSA 2J6TA 4ED1A 4DSLA 1HYSA 3HX0A 2BCSA 1WSFA 1Z25A 5J0OA 4W5NA 3OS2A 2KW4A 3Q8MA 4CFCA 1X9WA 3TARA 1ZBUA 4AHVA 2PZSA 3KLGA 4NCBA 1TFRA 3PMNA 4F5NA 1QHTA 5HMLA 1HJPA 1WAFA 4ZHRA 3U6FA 4KV8A 4RUCA 8ICVA 2W8KA 1ZQXA 4UAWA 1XSNA 3JPTA 1IM4A 2W9CA 4M9JA 4BWMA 4YP3A 4K8ZA 5DKWA 4KLTA 3KLFA 1XU4A 3V72A 4FO6A 4ID1A 5EOZA 2KFZA 4I2JA 3DYAA 3RJGA 4GW6A 1YVUA 2W9MA 4FJIA 3KIOA 2ZTDA 3QZ8A 4F3TA 4ED0A 4DL2A 3QIPA 1Q8IA 4DTPA 5J2HA 7ICKA 5D46A 4QWCA 3H08A 4KHQA 5CR0A 4HCCA 4UAYA 1CZ9A 1BPEA 5KFKA 1WSGA 2BQRA 4KLOA 2OZSA 2A1SA 1RBSA 5HMMA 4CF1A 4Q44A 4QZHA 5DB6A 2OWOA 4YFUA 2Q0ZX 4ED8A 1S10A 2ALZA 1RT1A 2F96A 2ZE2A 3T1AA 3OYKA 5I42A 1NK6A 3KHHA 3O4NA 1MC8A 3KHRA 1HJRA 4YMOA 1WLJA 8ICXA 1DOQA 1T3NA 4DTJA 2OPPA 1IKVA 5CB1A 1BCMA 2H5XA 3PR5B 4W5OA 3KK3A 2RPIA 1SL2A 3LZJA 1XO1A 3V9SA 4E19A 5J0YA 5CZ1A 4C8KA 5KG1A 1ZQQA 4I2PA 5F9LA 4YFKA 9ICNA 1QE1A 4F91B 4KITB 5HNKA 1S1UA 3MABA 4KREA 4YQWA 4KI4A 4IQVA 3TAFA 2Q3SA 2YV0X 3NCIA 1CZBA 4I27A 5KFXA 4RU9A 2FPLA 4E1NA 1S0OA 3ZT1A 3MFIA 3QEAZ 9ICBA 3C95A 2A1RA 3OS1A 2XGQA 3L8BA 3RBDA 5J0UA 2C2RA 3UQ0A 4M3YA 2ATQA 4O5CA 2KQ2A 1X9SA 5DLFA 4AHUA 2VWKA 2FBTA 3GIJA 3HVRA 4PGQA 2C28A 4KLLA 3A2FA 1JIHA 4TQRA 5DB7A 4YR0A 4Q45A 3AO4A 3HYFA 3OY9A 4KLJA 1F21A 3ASMA 3T5JA 5J0PA 3SYZA 2IMWP 1ZBLA 3K4GA 3VN5A 3ZT4A 2R8IA 5HRPA 4MFFA 1KVBA 2IS3A 1U9LA 1SKSA 8ICJA 3LWLA 3AO3A 3V9ZA 1ZQBA 3UQ2A 9ICIA 3S9HA 2P5OA 4BACA 2E6MA 4ELTA 1H38A 4H8KA 2X74A 2XHBA 4ED2A 4IQTA 4DFPA 3P1GA 4RQ7A 1JLAA 2ZUDA 1S1WA 4IKFA 1I39A 1QSSA 4KTZA 4MFBA 4CGIA 4TURA 2XCPA 3EPIA 5TZVA 1LWFA 5J2FA 1AROP 4B9SA 4K4GA 4DSEA 2HNZA 4Z4FA 5KFCA 4B9MA 4O3SA 2Y1IA 1NKCA 4ZTJA 4EP4A 4MF8A 2QKBA 1JL2A 1ZQAA 4CJVA 1L3VA 5FRNA 4DS4A 4FBTA 1ZQHA 1L3TA 4CF2A 3DLEA 4O3QA 3M8PA 3ZSVA 3JPSA 1EP4A 4KMUA 1GOAA 4RQ5A 1VSEA 4FCYA 4DU4A 8ICSA 4EZ6A 4E0DA 5T7BA 4QZIA 4UB5A 2E4LA 4CEZA 5KG6A 5I3UA 3RMBA 4EYIB 4Z4CA 4CHOA 5CJ7A 3QIOA 1KEJA 4YVZA 4AILC 5DQHA 4HVJA 8ICIA 3QE9Y 3ZDCA 3ZSQA 5E41A 3ZSWA 3E2EA 4PHPA 7ICEA 4UB3A 5J2NA 1CEZA 3BQ2A 3Q8SB 3HJFA 1UA0A 1ZQCA 2MUTB 3SI6A 3MECA 7ICIA 4JLHA 4NLGA 2VG7A 2A1JA 3EY1A 3IRXA 3OS0A 4CGHA 2JLEA 4KB1A 1KRPA 4P4PA 1IKYA 1FK9A 1ZQRA 4CEFA 3PW5A 1J53A 4JV2A 4CEEA 4YNQA 4DTMA 4OKJA 3JPPA 3MGIA 1CXQA 2AQ0A 4M47A 1IKWA 2BANA 1TKZA 8ICKA 4JS5A 4DTNA 5HRNA 3SQ0A 4QW9A 1TAUA 4ZH4A 3QZ7A 4F5QA 1RBRA 3P83D 4FM1A 3HK2A 4DFMA 4IR9A 3HPHA 3N4MB 1RXVA 4HCBA 4R64A 4JK1A 1NOZA 3ZDBA 3NGYA 2G8KA 1YTAA 4KKOA 4DL6A 4F5PA 1KCFA 1KDHA 4CCHA 4O5BA 2ZUCA 4J9NA 1ZBIA 5J2MA 1IH7A 4JWMA 3VQ5A 3Q8KA 7ICPA 4I29A 4J9LA 2JEIA 3DLBA 3UPQA 3H40A 4FLVA 3JSMA 3AVCA 4N56A 4M9LA 4DTRA 5KFSA 4I2AA 2X6SA 5J0SA 4CGJA 2OPQA 1KTQA 3LALA 2Z1IA 2VA2A 1C1CA 3ZDDA 3QESA 4YD2A 4OGCA 2NRVA 3PW0A 5KFVA 1UT5A 1VSIA 7ICGA 3UXOA 3ORYA 4CIEA 4EP5A 4I2EA 2GUIA 4HHTA 9ICGA 9ICTA 2RN2A 4RQ3A 5DDMA 4NYFA 3IS9A 2XCAA 1COOA 4J2EA 4F93B 2ASDA 3OYBA 2DFFA 4RPZA 3HT3A 3SV3A 4DQIA 3F9KA 3PMLA 1NK4A 1U47A 3KTQA 4QZBA 4J9PA 4ED6A 4CK2A 5KRSA 3SV4A 5IIKA 4GLXA 1CUKA 5KFJA 2ITGA 4CFBA 4E7LA 4FM2A 4DMNA 3LDAA 4QZ8A 4BE0A 2VG6A 8ICCA 3TQ1A 1BQMA 4O5KA 3I0SA 5DGAA 1S9FA 4NCGA 3O3HA 1TV9A 5J1EA 2R8HA 1XSLA 5DB9A 4M3RA 5D3GA 5KT7A 4K4IA 1ASWA 4R65A 1UWBA 3TWHA 1RBUA 1BVSA 4ED3A 4O3RA 3OYLA 3OHAA 3L2UA 3AU2A 1S9EA 5J2GA 2G8HA 3EPGA 3V6HA 4AH9A 2WONA 2HHVA 2FLLA 3CM6A 7ICUA 2FC0A 3PNCA 4M9HA 3U3GA 3ZT3A 4I7FA 4ZTFA 1A5WA 2F8SA 3K75D 3G6XA 4DLGA 4C8OA 1IKXA 4O0IA 2C2DA 3FYHA 5DMRA 1YTUA 3TAEA 4E3SA 1RBTA 4O0JA 2ZTCA 4RT3A 7ICOA 3AVIA 1JX4A 2O4GA 1RDBA 3C94A 3ISCA 2X6NA 4DFKA 4MEYA 4QWBA 5EU7A 5HP1A 5DBCA 5HHHA 2ZUBA 4RW7A 3ULDA 5KFOA 4RPYA 2LYHA 1WCLA 3H4DA 4QW8A 4ECQA 1HYZA 5J0QA 4IG3A 4QWDA 1NJZA 4JWNA 1ASUA 5DK5A 2ISPA 1Z26A 1ZBFA 4DLEA 3C2KA 4F50A 4QWAA 3N97B 2AJQA 4JV1A 2F8TA 3KK2A 4E7HA 1VRTA 1LB2B 3NF6A 3MFHA 4AHTA 5JS1A 4FJNA 3LK9A 4IQWA 1QLNA 3VQEA 9ICRA 1VSHA 3C5FA 4ELVA 1BPXA 1BISA 3F73A 8ICZA 3Q8LA 3OYNA 3TAPA 4I2GA 5FROA 2OYQA 4YR3A 4J9RA 2VWJA 4PUOA 3QERA 3RJHA 1B92A 7ICVA 4FZZA 4RW9A 2I5JA 2FLNA 2ZTEA 1RT2A 3ZCMA 4N47A 1RTIA 2JZBB 2WOMA 3KHLA 3QETA 3EW9A 3OYHA 2M9NA 3HO1A 3MDAA 4KHYA 3M8QA 1RT5A 1U4BA 5K14A 3OVNA 5SZTA 9ICLA 2XY5A 2F1IA 4DOCA 3TI0A 2YKMA 3RJIA 4ELUA 1J54A 5KG3A 3V1RA 3LAKA 1HYVA 5CYQA 1Q9YA 1N56A 3BQ0A 3ISBA 3OYAA 3GIIA 3C6UA 4NXZA 3E01A 4RNMA 5HROA 4TUSA 2OA8A 1HNIA 5FRMA 3T5HA 3AVKA 2I1QA 5KFFA 2BGGA 3EWAA 4C8NA 3QEXA 3SUOA 4YXMA 5EWEA 4CJFA 5KFYA 4HUEA 2C2EA 1UAXA 4LD0A 5HHIA 1NJYA 5EWFA 2ZD1A 1C0TA 3RAQA 3CM5A 1RT4A 4M04A 3WNFA 4KN7A 2OPRA 2BPCA 1S9GA 4CF0A 3AVBA 3AU6A 3DRRA 1VSKA 1JLGA 3RJKA 3EZ5A 4J2DA 4O4GA 5IIIA 9ICMA 2J6SA 4P4MA 4M3TA 2PI4A 3SQ2A 5DLGA 4EYHB 4AHSA 2KZ3A 4IRKA 3KKSA 5CP2A 3MXJA 3GV5B 4B9NA 3HP6A 5KT4A 5DBAA 4I2IA 5D49A 3PX0A 3RB4A 3L2QA 4KO0A 3RMDA 4J2AA 3AVNA 1NK5A 1XHZA 2LSNA 4CGDA 3M8RA 4RT2A 5KT5A 4PHDA 4FJHA 2AGQA 3OSNA 3DI6A 8ICPA 2P5GA 4GC6A 4CJPA 3S3NA 1W0HA 3V6KA 4O55A 1JL1A 2OPSA 2GBZA 2YNHA 4Z4EA 4DL4A 4Z6DA 3LAMA 3SPYA 5KG5A 4G1QA 3V7KA 4KLHA 2DFLA 4MF2A 1S1VA 4DSFA 4F4KA 9ICVA 3V7JA 4CEQA 1RBVA 3BGRA 1LAVA 4RQ1A 3RBEA 4F5OA 1D8YA 3KKRA 1T8EA 4FLTA 2PFPA 2D0AA 4OLAA 1S1TA 1U04A 4R8UA 1RZTA 3TABA 4N41A 1EXNA 2B4JA 4FJ8A 2YNGA 4H4MA 4FJGA 1ZJMA 5J2CA 1TV6A 2HB5A 1ZQDA 4RQ8A 3V7LA 1SL0A 4F2RA 2DTUA 3BQ1A 1X9MA 5DGBA 1BI4A 2Z1JA 1RPLA 4DFJA 1A77A 3K2PA 4YMNA 1K1SA 2YNFA 1LWEA 4I2CA 4Z4IA 4FS1A 3LZIA 3H7IA 4CE9A 4JRQA 1CLQA 4PH5A 4RNOA 2FLPA 3NGZA 4O9MA 2HVIA 1ZQUA 5L9XA 3OJUA 3HVTA 1VSFA 4CJ3A 3EYZA 5L1LA 4QOZB 4IR1A 5FDLA 1NK8A 3DLKA 2DFHA 3QLHA 4IG0A 5DG7A 1L3SA 1BI4B 4O3OA 4BE1A 3OYIA 1TKTA 3LP2A 4RQ2A 2HHSA 8ICYA 2ZJ5A 1IXRA 2DPIA 2ZJ8A 3NGIA 5J2EA 3SPZA 2F1HA 2BCRA 7ICMA 1KVCA 3SQ1A 4NLKA 3OJSA 4M3UA 4XIUA 1RTJA 3JPOA 3ISNC 9ICFA 3O4QA 4FS2A 4RG8A 4CFDA 2UVUA 4QZAA 5IINA 4ED7A 5C25A 4KTQA 4I2HA 4KLDA 2KTQA 2HHXA 1ZQSA 9ICPA 3ZD8A 1Z00B 2W9BA 3PVXA 3GV7B 4BDPA 2IAJA 4IFVA 3VA0A 2DFEA 3GFKB 2QXFA 2G8FA 1D9DA 1TVAA 1WSHA 3OHBA 2BDPA 5KFBA 3RJEA 3V1OA 3NF9A 2AGOA 3NH0A 4XUSA 1ZQOA 2IHMA 3C2MA 4YD1A 2GV9A 4DTSA 4DTOA 1U49A 4ICLA 4M2YA 4Q0BA 3HPOA 1RTDA 4UBCA 4GXKA 3NTUA 2GWSA 4CJEA 5J2DA 1X1PA 1Y97A 4CESA 2I9GA 1MQ3A 5J2BA 1HUZA 4DL7A 3ZSOA 5KGXA 1NKBA 1WN7A 3B0XA 5IIOA 3MGHA 2BCQA 3MEDA 8ICWA 3PO5A 4KAZA 3ZSRA 4KLUA 3UIQA 2JEGA 2PFQA 2Y1JA 3M9MB 1TVRA 4K8XA 2BPFA 4DQPA 2XGPA 1KFSA 1SZPA 4HUGA 2PFNA 4Q8EA 8ICUA 4PPXA 3T5KA 4B9VA 4EEYA 5KFQA 3IAYA 4Z6FA 4FYDA 3PO4A 4KFBA 1C7YA 3PY8A 4KHSA 4J9SA 2R7YA 4CJQA 3OYCA 4M9NA 9ICAA 4NYNA 3H8SA 3IHQB 2DPJA 3NH1A 2B21A 3AA4A 4KLGA 1ZQNA 3TR8A 4KHNA 1XC9A 3DOKA 3MXIA 5KFZA 1ITGA 1Y88A 3L2WA 4RW6A 2AGPA 4OPKA 3SUQA 4FJ5A 9ICKA 5BPCA 3LANA 1UT8A 3AVGA 4OGEA 4FK4A 3ZDAA 4RW8A 1JLQA 2YHAA 1NOMA 4ECXA 4NCAA 1J5OA 2QK9A 4G3IA 4PQUA 4YG2A 4F4YA 4GXJA 3P5JA 4DSIA 1ZQMA 1FKPA 3C1YA 4CIGA 3KD5E 3GQCA 2UVWA 4CEBA 3WNGA 4QZCA 2NRZA 1RYSA 1NJXA 2XO7A 4DQQA 3JPQA 2NRTA 4EZ9A 1K1QA 2BGWA 3QEVA 3RMAA 7ICRA 1NOYA 3B0YA 5KG4A 3OGUA 3OYDA 4UB4A 3AVHA 1WSJA 3DMJA 3V1QA 2PYLA 2J6UA 1SV5A 4KB0A 5DB8A 3RRHA 4AHRA 1QS4A 1X2IA 2ZJAA 2E6LA 1JMSA 3QNOA 3NFAA 3I0RA 1TK5A 4PY5A 3SI8A 7ICQA 9ICEA 5KG0A 5DQIA 4B3OA 3RH6A 5J0WA 1J9AA 4J9KA 3WNHA 2XY8A 1ZBHA 3IM1A 2P1JA 3S3MA 1BPYA 2ETJA 4ECWA 3KJVA 3PX6A 1LWCA 4E7IA 4O5EA 3SUPA 2QKKA 4O44A 2WTFA 3TFSA 4YXJA 4KRFA 3K59A 3PW4A 2DY4A 4CGFA 8ICTA 2D0BA 5F9NA 4M0AA 4PA1A 3AVFA 9ICJA 4RQ4A 4I2FA 2FBVA 3VQBA 4C8LA 1C1AA 1B43A 1JXEA 4RNNA 3MEGA 4FZYA 4OLBA 4UQGA 3RH5A 4DF8A 4TUQA 4DQSA 1N6QA 5J2KA 3RJFA 1G15A 4YCXA 1LW0A 4KLSA 2FPMA 3AA5X 1A76A 4X5VA 3TANA 1L3UA 2ZQBA 5KRTA 4HUFA 1SUQA 2RF2A 1REVA 4DTUA 4BE2A 4FZXC 4CGGA 2P66A 3QEBZ 2EHGA 1EETA 3SZ2A 3AA2A 5J0XA 4EBCA 3ZSZA 5HLFA 4LSLA 3MAQA 4CEAA 4R8UB 1RYRA 2HVHA 2RDJA 4CFAA 3ZD9A 2JGUA 1ZQKA 3RRGA 4FJKA 3LDSA 4KHUA 4PHEA 1K6YA 4UBBA 1BQNA 4CJ5A 4FK2A 3G6YA 4CHZA 2ATLA 1VSMA 2UVVA 1HQUA 3NDKA 1ZQIA 4CJ4A 4FJMA 4F4ZA 4UB1A 1RNHA 5J2QA 3LP3A 2PXIA 4F5RA 4JS4A 3CG7A 7ICFA 3KHGA 5L1IA 3RR7A 3K5MA 2HHUA 4PGXA 3LPUA 3VQ9A 1ZQWA 4DL3A 2RKIA 3M9OB 4DF4A 3V9WA 1NKEA 1T05A 4F4XA 3NE6A 4M6WA 4UAZA 5KT6A 3QO9A 4KLFA 3DLHA 3Q8QB 1MSWD 4LZDA 4PGYA 1R0AA 1BCOA 1L5UA 4KTWA 3HSTB 4QCLA 4YN4A 3K5OA 2HHQA 3AUOA
chains in the Genus database with same CATH superfamily
2K3IA 2PA3A 3TA1A 4EI2A 5BPMA 5AXMA 2O8EB 5KFIA 1BHLA 3I31A 2BMBA 1TMMA 1PVRA 2DEIA 3MD1A 4ZCKA 2AH5A 3AOBA 1RT3A 2QZ8A 1HI0P 3QBWA 1QTMA 2IM1A 2RDDA 3OR1B 4MTPA 4FLYA 1N8RO 4IOCQ 5GAGP 4BR4A 5D15A 5ALQA 4K4ZA 4FLXA 1PJ7A 2RRBA 4RW4A 3TSPA 4Y2XA 1UEUA 3HZEA 1HW8A 4CJUA 4QIWF 2CQ4A 5B0GA 5C0YA 2HRUA 2KZMA 2PD1A 3S01A 1SH0A 3GOIA 4P6QA 2OZMA 3DRPA 5JJBA 3BZQA 4AYBD 1Q5VA 4CHPA 2A1BA 3A3OB 3FRZA 5CHGA 2FMSA 3RAXA 3T3FA 2MTLA 1SJFA 4M94A 2FMQA 2GW8A 4CO5A 4RUAA 1RDCA 4NYZA 1ZM9A 5G0RB 1NJWA 2QIFA 1NBEB 5IC4B 1CJKA 4EELA 1HNVA 5AIAA 2NYIA 2XZDB 3DM2A 4B3RF 8ICNA 4W5RA 2RSQA 3DOMA 4IBNA 3GLJA 3VTHA 4FF2A 2P9GA 1R31A 2A3ZA 4CJRA 3IR5B 5KFLA 3L9ZA 2D0CA 3OYMA 4CJSA 1ZM4A 4OX9K 3MDCA 2BA9A 1EQ0A 3SBTA 2RUGA 1ECWA 3Q2SC 2G13A 1TU0B 3DU6A 3TJAA 3QNNA 5ALZA 3HKZD 2FZGB 5JVHL 2Y9TA 2CG8A 4CK1A 1K9MT 1R8HA 1SVDA 4LF5J 4AF1A 1DGJA 2MUTA 2CJ9A 3NH2A 4C7ZA 4HT5A 1H2VZ 2JEFA 4KLMA 1FKOB 2CZ9A 1B9DA 2WAQD 1SKWA 4PL1A 4BWJA 3NXZA 3UKUA 2Y3YA 2FB0A 4LF9F 1HPZA 4JI2J 3MCPA 2WMMA 3U4LA 3H4BA 1LWXA 3SNNA 5ALGA 2DGZA 2BCVA 4A4JA 4QZEA 1KC8T 2PKEA 1HI8A 4L8RB 4NLNA 2W9AA 2Z30B 2UP1A 2F77X 4CECA 3OBWA 5L1JA 3RRKA 1HNXK 4DUYK 3VQAA 3NCPA 1HNZK 2DGWA 2ZOFA 5LMNK 2EK6A 5J2IA 3UN2A 4DU1A 1C1CB 1YHQN 2BJEA 2DR7A 4A47A 4OFZA 2MMYA 3JXOA 3WXJA 5ETOA 4I67A 3MR6A 3CQ8A 4F0KA 2BRLA 4FWMA 5EOYA 1AA1B 4RQ6A 2MSNA 4DR2K 3D67A 4H03B 3AB4B 4WFYA 4BXOB 3QJPA 4CJKA 3VA3A 1XI1A 3KLIB 4MKBA 1TL1A 1BIUA 1W9HA 3VC8A 4K2JA 1IQTA 4B9UA 3SMSA 3M2VB 1WDTA 4I28A 1JNRB 4J9MA 1N32K 1VQKS 3MEKA 8ICOA 3K5OA 4QR1A 2UXDJ 2JZBA 1S79A 2LKYA 1PC4A 1G1XA 1JLBA 3CGIA 1IR1A 3FZFA 5B66U 1RBAA 5AK4A 1RP5A 1F44A 3B9JA 2HFZA 2AQ4A 2G8IA 1SXLA 3M32A 3RUBL 5KFPA 3NAHA 2UXCJ 4B1XB 1VJQA 2BOPA 3QWUA 1T9YA 3QSYB 4CYUA 1NK0A 1VYAA 4JI4K 2BQUA 2HHWA 1S0MA 3V9UA 1HWUA 1B64A 5ALJA 3OYFA 4NLOA 1CJVA 2YTUA 3FFIA 4PABA 5L38A 3VPZA 3H0LB 3MECB 1M5HA 4P4OA 3H8JA 3UMCA 3THXB 5DQGA 2RP5A 4EUVA 4JNEA 3GL1A 1DTTA 1GLFO 1T9UA 4NI2A 1WUDA 1TKDA 3J7AP 2ZBCA 3W64A 4X4NA 2UXBJ 1ZJNA 3QFUA 1RCXB 3WK4A 1KAXA 2EX3A 4A5AA 3ZETA 4WFAL 1N34F 2Z1GA 5JUMA 2BE2A 4RBUA 2HS0A 5KFRA 1VQ7S 3T19A 5E3AA 1HRHA 1QQCA 1IBCB 3LDNA 4E1MA 3W5YA 5AM4A 2H48B 1N36J 2IBOA 2G8VA 3H5UA 1IVZA 4DU7A 4ID5A 4DV7J 1X5OA 4IOXA 4JV0A 3DI6B 4CO1A 3M30A 2HBMA 3GV8B 4X84A 1DK2A 1OY8A 4ECSA 2JH3A 4ZDNA 1IG6A 3GIKA 2J0SD 3FGUA 4A62A 1SS6A 5C2GA 3VZHA 4YHHF 3K7RA 3ZEUB 3R7SB 3I4HX 3AO2A 4KGVB 4RQ0A 1YJVA 1I51B 1LK5A 3CJKA 3HPGA 2CQ0A 4B9LA 4IRCA 2UU9K 4QS8A 3CJRA 3EKUA 3MEDB 2HK2A 2UV8G 2FJEB 3NAIA 3UM9A 1G3OA 2YI1A 2B56A 3GCXP 2FVPA 3BGUA 5CEHA 2OYYA 4DB3A 2K4PA 2E7WA 3CFOA 1CJTB 4OKEA 4NI2B 2FJBB 4ZPDA 5KFDA 1DLOB 4XH1A 3MMVA 1P8GA 1DTQA 4Y0WA 5KFAA 5HL7L 2R7UA 3CD5A 5TKWA 2EG1A 2AJFE 4CERA 1B9FA 2E1RA 3QT8A 1KLMB 4BRPA 4EMDA 4C48A 3D2WA 1S22A 2J0QD 3UDVA 4OYZA 2P9PA 3IDWA 2H5EA 2NRRA 4YY3J 5CA7A 1WSRA 4JI0J 4PHAA 5FD1A 4DV6J 2WB1D 3RTVA 3MAAA 1M5OC 2W42A 4OD0A 4BDZA 4WYWA 3W2VB 2MHNA 4Z4HA 2P9NA 1RXOB 1W97L 4P2SA 1D0EA 4KH0B 2X78A 4RZRA 1FXXA 3C1ZA 3M2RA 3NP5A 3JSMB 3KLIA 4RWWA 2RHKA 3NCRA 3AO1A 1UVNA 3HFVA 4JUZA 2CADA 2D41A 3M2UA 2FGOA 4BRQA 1N48A 5IILA 3BGFA 4DWIA 1RAHB 1D9AA 5E3PA 2VYPA 5K8OA 3HP9A 4CO2A 4D3HA 2IMOA 4WE1A 4HH0A 5CQGA 1BQXA 4CIOA 3TUPA 3VCBA 2YTCA 4DUYF 4Z4GA 4UB2A 1PIEA 4C80A 4IQUA 4FLWA 5JVHQ 1T3OA 5H9EK 4AM6A 3G6ES 2FJXA 1NK9A 4E89A 2DR9A 3OVSA 2Z8QA 4KLEA 3J81j 5D0EA 3V2UC 2CJQA 3HWTA 4HACB 1VQMN 4I2QA 3NS5A 3R1LA 4M42A 4E7JA 1FE4A 3AGRA 2I9SA 4GO5X 1XS9D 3OTDA 1VRUA 5E0OA 4CF9A 1H7XA 2ZH7A 3K58A 4KHPF 1EX4A 3WKDA 3NLCA 1CQMA 3IC1A 2IRYA 4BGAA 2V7ZA 2ZIVA 5E79U 5J1EB 1UCVA 2A6MA 2HGNA 1ATRA 2J9DA 3D66A 5M1FA 1JLFA 2A2DA 3JQKA 4RPXA 5ETKA 2V4RA 4IXCA 2B9WA 3L3FX 1UOCA 4LF6K 2VA8A 4JI5F 4ZVUB 4Q43A 2DKOB 3H25A 1KBUA 1OVYA 5HK4A 1F9FA 1OIAA 3PZPA 1SC4B 4CZKA 2VDHA 2WVDA 1NDCA 1KNZA 1B99A 3RJJA 2XMJA 2QV6A 3ONNA 2YHYA 1RDAA 4UTGA 3GDXA 2XMWA 3ENHA 4A8FA 4MK8A 3OBYA 3R5GA 4ECZA 3AVLA 3O9UA 3A8JA 3CCVS 1I3AA 3KOOA 2Q0RA 2RAQA 4IDKA 3VQ7A 3OSPA 3SSQA 1EXQA 3D2EB 2O8BB 4CZEA 1BPZA 1UPPA 5KG7A 4CF3A 3D0IE 2HF3A 2DH8A 1S6QA 4Y2JA 3VQ4A 5LJ3Y 4LFAK 2Q43A 1PZNA 4R66A 4KGZB 1LXJA 3L4IA 3MXMA 3O8WA 2FSKA 4KIAA 2CQIA 1NH7A 2BPGA 3H2LA 1JLCA 1RBLA 1PK1A 4PZOA 1EB0A 3AJ2A 4URGA 4BR5A 5LMUK 4WYLA 2FY1A 2QXLA 4K8RA 3GIMA 3DRSA 1TYQA 8ICLA 3GYXB 1DLOA 3P38A 2ACMA 3QJJA 5FPEA 3IV6A 2XBPA 3C66A 3IXQA 2PEBA 4Q5VA 3NHGA 4F4AA 3JYTA 1DGSA 5D78A 2PDAA 3HX0A 1UWAA 1WSFA 1VK3A 3HSCA 4W5NA 3U27A 1X9WA 4PUOB 3Q22A 2KP7A 2E5JA 4WYBA 2RQKA 1HJPA 4IFVB 3KK3B 4XEIA 1OWXA 1E3MA 5B09A 1ZQXA 4K4XA 2PIIA 4O3MA 2DXDA 3LYSA 2ZWPA 4JMUA 2Y8YA 3CCLN 1UJ6A 3JPTA 5AI5A 4M9JA 2Q6CA 2HYIB 3QO9B 1O8BA 4MLHA 3LPEA 2VICA 2HWHA 4U8YA 4HI1A 2KRRA 4KLTA 3KLFA 3VAIA 3MTKA 4PRFA 6FDRA 2YMQA 4AQYJ 3NRZA 3CNHA 4WXWA 2IDLA 1Y5NB 5CYQB 4P7TA 3QIPA 2NXCA 3K8WA 2QLFB 2ZGZA 2GNKA 2F9JA 4WZMA 3E51A 1I94K 2B9EA 5J2HA 2W6LA 4E1JA 3I8BA 1WBBA 3UO0A 1NSAA 4C0OC 1HR0J 2IM0A 4DV3F 1WSGA 2O8FB 5AKHA 4JI1J 1X8DA 4PR6A 1RBSA 4JKDA 4Q44A 4QZHA 3RU0A 3R1XA 1M1GA 2FGCA 2XIDA 4XO0A 4YFUA 1VRUB 2H3QA 4HI2A 4C98A 2QWMA 5IV4A 2F96A 2ZE2A 3T1AA 6AT1B 3OYKA 5GAEP 1Y9OA 2WFAA 4X64J 4PKDB 3MMBB 2QE5A 2ZIXA 3A12A 4WZQA 1DOQA 3WIUA 1IKVA 1BE4A 2RLTA 2Z2LA 2YBVA 4LF9J 3A5OC 3OUYB 3K1RB 2E2QA 5M1NA 2GH1A 3FM9A 1U1RA 4OI4A 1P6TA 2VKQA 1QE1A 5HNKA 4KITB 2G2OA 3MABA 5DDPC 2YNHB 1FNMA 2YV0X 4H5TA 1HBUA 4CH0S 5AR0A 1U1MA 4DR5J 2GUPA 4B1UB 2W6KA 2VL1A 2A1RA 4JOUA 4C0BA 4EIAA 1ZPWX 3WEEB 3L8BA 1HNXF 5J0UA 2NLXA 2O8BA 3UQ0A 2V69A 2MHEA 1NUEA 3D9BA 2VPWB 4X4TA 3ZZUA 4AHUA 3TR5A 2VWKA 2NCKL 5F3ZA 3M1VB 1YX2A 4PGQA 2CRLA 1TFWA 3M5RA 3A2FA 4TQRA 4B3SK 3IAM9 2DF4B 4RUHA 3DN9A 2MLYA 2R8IA 1HD1A 1KVBA 4DZ6A 2MQOA 1SKSA 1ZD3A 4PG7A 4BS2A 5EE1A 2KHQA 4ID5B 2KSOA 4PXBA 3A8IA 1U8WA 1ZQBA 2P5OA 1U6FA 3T79A 1NMEB 3EGNA 4QR0A 4TLRA 4P71A 3SBMA 2LP4A 4DFPA 4NZ6A 1XERA 3CC4S 5B0EA 2ZNYA 4DXLA 3TZZA 1W7AA 2WB1F 3M8PB 1H72C 4P2FA 1PO6A 4MFBA 2PFUA 3DLKB 5H9FK 4LF1A 5J2FA 1AROP 3DXSX 4YS2A 4L72B 4DSEA 2HNZA 2ZIWB 4Z4FA 4B9MA 4O3SA 1HNIB 1H0HB 3HTVA 2V8PA 1WEYA 4ZTJA 4MF8A 2QKBA 2R2RA 3HHLD 1VBYA 2FSNA 5FRNA 4DR1K 4CBXA 2WHOA 1L3TA 2LA4A 4CF2A 2IOFK 5TKYA 4O3QA 4LFAF 4I69A 3JPSA 2BJ3A 2HHPA 2RHFA 1IJJA 3IKMA 4B1YB 4RQ5A 2NXEA 3MD3A 5G5GA 1AXQA 4JI4F 1F2GA 2AEJA 3E3XA 2E5LJ 4MAKA 2ZH3A 2E4LA 2MJUA 3C65A 5I3UA 4Z4CA 3BBFA 1SV5B 3MN5A 4CHOA 3QIOA 1KEJA 4Y2UA 1VCTA 3QE9Y 2PN6A 2L48A 3ZSWA 3W2VA 3MN9A 4YB5A 3JSYA 2F63A 3DCAA 2XI3A 4PQUB 1RT1B 1N32F 3BQ2A 2CNNB 4WIQA 2W11A 2D0PA 2MUTB 4U7BA 4I4BA 1UFKA 2GS8A 1XEZA 3BS9A 3QMLA 3IRXA 5K8PA 2JLEA 1KRPA 4P4PA 2X1BA 3MUVP 1IKYA 1NGAA 2OEMA 1S1VB 3VTIA 1YHQS 4CEEA 3NGUA 4YNQA 4OKJA 2JV3A 3JPPA 3MGIA 2JH7A 2AQ0A 4KBOA 4LF4F 1B0PA 3NVYA 1MN8A 1SWVA 1WG5A 4L74A 3NRBA 2QMUB 3HK2A 4DFMA 4UAUA 1HNWF 3PSFA 2H1YA 4R64A 5L8RC 1OQ6A 3C8YA 1VAZA 1ZAXA 1QDUB 1LFPA 4CP5A 1W26A 2F76X 3D28A 5C2CA 1KCFA 1MA9B 2FJ6A 2LM4A 2V52B 4AP9A 4JWMA 3F0NA 2K8CB 3VQ5A 3DLBA 3UPQA 2GGPA 3DAWA 5KFSA 2QC3A 2GVDA 1HWIA 2OPQA 4C7QA 2P9UB 1KTQA 3LALA 2Z1IA 3CMES 2W2MP 3ZNUA 3U1LA 1VSIA 4JI6J 3G82B 3MMCA 1RWXB 3U02A 4CIEA 2KFYA 3SCJE 3CCUS 4B3TK 9ICGA 3Q8YA 2B8PA 2W4PA 2KSOB 2XCAA 5M2UA 1T6CA 4WCEL 2MQLA 5H1SV 2DFFA 4RPZA 2KEYA 1R89A 4DQIA 4NA2A 3PMLA 4CK2A 4EEKA 5IIKA 4GLXA 4JD2A 4AYBC 4C23A 4CQ1A 1LQ9A 3C15B 4QIGA 4RTFD 4BE0A 2YY3A 3TQ1A 3I0SA 2IPOB 2HSZA 4NCGA 4CWBA 1TV9A 5JLFA 4ED5A 5CD4H 1XSLA 1FFWB 3ENBA 5CABA 3CULA 2UUCJ 1AW0A 4PG4A 1O5JA 1KVIA 3AD9C 3IRWP 1ZH5A 1S9EA 1OSCA 5J2GA 2G8HA 3D54A 4Y00A 3M1FA 1NZAA 2D3O1 3R8EA 2KOBA 2WONA 2FLLA 1ILYA 1QZ6A 3GR1A 4I7FA 4NLDA 3LDPA 4NOHA 1A5WA 1WC1A 3HHNB 2F8SA 3OA9A 1KW4A 3QGGA 2XLJA 4O0IA 3CDAA 2C2DA 3FYHA 1RTDB 1HKCA 3TW0A 2XNRA 1X6IA 4J9VA 1YTUA 3TAEA 2FE9A 4USTA 1NZPA 4KHPK 3AVIA 2P6SA 1J2NA 1JX4A 1U6ZA 3ENVA 1J27A 2X6NA 4DFKA 5EU7A 3AAWB 3B4DA 2KYXA 4RW7A 5DBCA 2ZUBA 5HHHA 4L3QA 4Y2SA 1T94A 1VQ8S 4ANDA 4BVPA 2HS3A 4YY3F 4JWNA 2YHXA 1N5SA 1ASUA 3F56A 2ISPA 2XULA 3C2KA 3M8WA 4CBWA 3N97B 2ZUAA 4CT8A 1NMDA 4JV1A 3WKBA 2MZTA 1VRTA 4OJ1A 4ZVTB 4L6V3 3AQFA 3CHWA 4FJNA 4IQWA 4O4RA 9ICRA 1LFWA 2KK0A 3A1YG 4ELVA 1U6BA 2CA9A 1FA0A 3F73A 2CNOB 4YN3B 1YJUA 3Q8LA 1B70B 3PYGA 3FEZA 4CH1A 3QJLA 3RJHA 3OTCA 5HSPA 1WI6A 2I7NA 4WKRA 3CE8A 3TADC 1B92A 3TO8A 3D2NA 2ZTEA 4N47A 1TQLA 5AXKA 1ZA2B 3MURP 2WOMA 3SFUA 2Q2RA 1Q86T 1GMUA 2OHFA 4YDXA 2M9NA 3QRRA 4DPUA 1BC6A 2MQQA 3R7NB 4KHYA 2YH1A 5BPLA 5K14A 3OVNA 2ZH2A 4ENOA 4IWVA 4ILMA 2VGNA 4QIFA 1HL6A 4B3RK 4DOCA 5ETRA 1F60B 2YKMA 4ELUA 1O6XA 2QARB 1J54A 5KG3A 5H2FU 4PYDA 5C7PA 2V0NA 3UN3A 2YX4A 3BQ0A 3UNGC 3ISBA 1DAXA 1QAYA 3W2WB 4J8FA 4JK8A 5E3QA 1VQ7N 4QU7A 4BC3A 2HSEB 5FRMA 3R6GB 4ZLLA 1S1TB 1ZQ1C 5KFFA 1WUUA 4C8NA 3SUOA 5EWEA 4DR6F 1YJWS 3VGMA 3HSZA 4BG8A 1TL7A 1KVKA 3GDQA 3VESA 1NJYA 4DPXA 1C0TA 4RUBA 4DR1F 3CM5A 1VQPN 4YDUA 1HNWJ 1FRLA 4M04A 2E88A 3WNFA 3ZZPA 2FVCA 2I6XA 1JLGA 2E5IA 1C4CA 3L4QA 1QTNB 2X3GA 5IIIA 3D6HB 2DHGA 2PI4A 5IT9U 4BRNA 1R59O 1XK8A 3O6QA 3THYA 1XIQA 2FJAB 3MXJA 2ILZA 4CTAA 3HP6A 3RB4A 2PFFB 3QFWA 1UEKA 3RMDA 1X9XA 2XZWA 3PRDA 5EUHA 4LF8J 4UOHA 3QU5A 3JAMU 1MWZA 2Q0UA 1HHSA 4FJHA 4CD3A 1TAMA 8ICPA 3SCKE 2P5GA 4E98A 2LEAA 1KS2A 1NNDA 1UKUA 2QG9B 3EGWB 4OHVA 3FRYA 2IM3A 2GBZA 2AXTU 1MN9A 3WEEA 3SPYA 3DXKB 4RQMA 1IBMJ 1IUJA 1IKYB 3IBCB 3C29A 9ICVA 3R9PA 1FDDA 1HA1A 1CRXA 2CZ4A 3SIPB 1RBVA 2H5JB 1OYDA 1LAVA 2ROGA 2L9DA 3IWLA 3RBEA 3PIPQ 4NO7A 4FLTA 3CDUA 5HMYA 2KKHA 1S1TA 2A6AA 2EBGA 3RBXA 2YMLA 4R8UA 1RZTA 1F2HA 1ZS6A 5M1QA 3BBCA 4DR7K 4FJGA 2RS2A 1ZBTA 4ZVRB 3AN1A 2B3TB 1ZQDA 4RQ8A 3V7LA 2JVOA 4HHJA 2DTUA 3VGLA 3M7VA 5HATA 5DGBA 2QX0A 2OD4A 1ZD4A 3CDEA 5HMWA 2ES6A 2C1EB 2C3MA 4ICAA 2V68A 1GTHA 3V81B 4YMNA 1K1SA 5HANA 1HBNA 1JJHA 2DR8A 2YNFA 4GKKK 4I2CA 4OHXA 4FS1A 3LZIA 2E8NA 3FZHA 3WDOA 2QTDA 1CLQA 3NGZA 1D09B 2VC0A 1SC1B 1VSFA 3EYZA 4FL9A 5C15A 2K3KA 1BY9A 4H4OB 3N28A 1U26A 1YJRA 1DQ9A 5DM6L 2DFHA 4IG0A 5DG7A 5LJVA 1BI4B 4BE1A 4EWTA 2W54A 3PJXA 3PG9A 2WVEA 5RUBA 4RQ2A 5B5EU 5LOQA 3HRDD 3GFXA 2ZJ5A 1RG6A 2M52A 1IXRA 3P8BB 4IO1A 1RDFA 2F1HA 1TELA 2GX8A 4CLZA 5LXRA 3IGVA 7ICMA 2W7AA 5FP0A 3H98A 3VEVA 3MGJA 5BJRA 2J0WA 2AYGA 1RWWB 4DV3K 1SCJB 4FS2A 4CNQA 3WIVA 4WFNL 1HKAA 4XPEA 1VQNS 1KQFB 2CGLA 4KTQA 3DOKB 5ETLA 3FGVA 3IBWA 3ZD8A 1Z00B 2W9BA 1E4FT 3GV7B 2XS5A 1NJIO 3ZX3A 4KBIA 4IFVA 1QY7A 5J1NA 2YX6A 2DFEA 4I6WA 1L7MA 4LT6A 1NMNA 1VBZA 3SAGA 2W2QP 4XUSA 2IHMA 4CZLA 2R7VA 4YD1A 2HFOA 4P74A 3MM5A 1U49A 1CI4A 3QYPA 4CE6A 4Y28C 4M2YA 4ICLA 5F8LA 3IRXB 2VQFK 1X5SA 3KLFB 1RTDA 1XNQJ 2ZBPA 4BX9C 2AJ4A 2DGVA 4Y2CA 4ZCMA 1XNRJ 5KGXA 3GE1A 3B0XA 3MGHA 1RM6C 3O3LA 3TTDA 3H8MA 4CW7B 4YMEA 2HQCA 1FVQA 5T14A 2E20A 1RSCA 4DV1F 2B8QA 4EO6A 3KVGA 9RUBA 2ZM6F 1HBMA 4K8XA 2ZVSA 2XGPA 2HCFA 4HUGA 5HAOA 1HEKA 5AQUA 2W24A 3Q7CA 1RT4B 2G0CA 3PLAA 2QB0B 3OLAA 3IAYA 3PO4A 1NAQA 1L3KA 1C7YA 3PY8A 4KHSA 4CJQA 5LXYA 2ZITA 2ADCA 4GV9A 5AM5A 3BO3A 4USKA 4JI3F 3TR8A 3DOKA 1CULA 3PEHA 1PYSB 2YPYA 1Y88A 2AGPA 1LWCB 1E4GT 4ZJQA 1P7DA 5DDOC 9ATCB 2KH9A 3ENQA 2NZ4A 2NUHA 2UUBJ 4OGEA 2EFGA 2HBQB 2P9NB 2VBWA 3ZDAA 2G0IA 1QJHA 3BB5A 1DQAA 4NCAA 5F8NA 1YIJN 3MEGB 2WF7A 4GXJA 4DQ8A 3MCSA 4IH5A 1RT5B 1ZQMA 1WACA 1RQ0A 4ZA1A 4AD6A 2IVPA 2B6AB 1QVFR 3SAFA 2OP5A 3ILOA 2BRKA 5ELZA 2AEFA 5E26A 2NRZA 4KFBB 4WFZA 3SDEB 4DQQA 2NRTA 4LMZA 2BGWA 3RMAA 3DHXA 1NOYA 4OYIA 5KG4A 2CPDA 4EK2A 1WSJA 3V1QA 5CZVA 2B4OA 2VDIA 4PZNA 2ASPA 4AHRA 2F3NA 3D6JA 3DLGB 1L7PA 1SJ1A 4DUTA 5ALPA 3WKCA 3I0RA 2P9KB 3A3NB 5AQWA 3CERA 5A8WA 1KOOA 4DV6F 1TKXB 4WXOA 2FTRA 1VQ9S 2JGAA 5DQIA 1N5VA 4RWTA 4K50A 3RH6A 2K7KA 2G08A 2QEXS 2XY8A 3O80A 3KLHB 2AZ3A 2DPNA 2EDUA 2ZIUA 3EL2A 2ETJA 4FPAA 2FY8A 3KJVA 3PX6A 1VQKN 2AJ2A 3MZIA 2QKKA 4KRFA 3VQSA 8ICTA 4PKIA 1GLDG 5F9NA 4ILJA 4KO0B 4ZPWR 1T3QA 5EX0A 1VLYA 1RZMA 4DCHA 4DR4J 3VQBA 3LL3A 4C8LA 1FI4A 4MYUA 1IBLJ 1C1AA 4QIEA 1XUPO 3MEGA 5F0WA 4ISFA 1HIWA 1Y5IB 3TYTA 1GMVA 4DF8A 5IQQA 4CNYA 2XSJB 4DQSA 2E9RX 1G15A 2IJRA 3G25A 1LW0A 4KLSA 3VF2A 3AA5X 1A76A 1PVPA 3KK2B 2VPZB 5AQSA 1MG7A 4O44B 3L95X 2XMAA 2DBBA 1Q8LA 4HUFA 1SUQA 1SIJA 4BE2A 2XMUA 2F8KA 4G1PA 4FZXC 1S48A 4CGGA 4DX5A 4NRUA 5KAKA 1EETA 1KQQA 5J0XA 4CEAA 1RYRA 2HVHA 1NZBA 4C7YA 2RDJA 4LQ9A 3ZD9A 3GE9A 4BC2A 1PK1B 1QH9A 2F1FA 4BLGA 4CJ5A 4PYAA 1RCOB 4ZPAA 3IFRA 4CHZA 4JKEA 1HWLA 5I4MA 4RNFA 1HQUA 4GVLA 4OYAA 3HD2A 4CJ4A 5IFMA 1JRPA 4RJVA 4OQJA 2W3SA 3NWGA 2H3IA 4AT1B 4US9A 4LF7K 3KJVB 4F5RA 2MQPA 4NPOA 2FC9A 1VQ5S 3O2IA 3GG1A 4LFBK 4QS9A 3AXMA 2V7YA 2EK1A 2JMGA 3SXLA 3VCDA 1RQNA 3JTNA 4DF4A 1WTFA 5CYMB 1H74A 2V6AA 1I5OB 5KT6A 3Q8QB 2J5AA 1JI7A 2YWHA 2V4JA 4QCLA 2DITA 3AUOA 1R6VA 4MYTA 1BQNB 3BQ7A 4OJGA 4XDCA 3O9QA 2IVFB 1EKEA 3G82A 3MMCB 4QR2A 4CIFA 3BSCA 4WJ3B 4BJQA 1KEKA 1EZZB 2KJWA 2V67A 3HBTA 3BF3A 3CJAA 2YHBA 1T0TV 3F5EA 4B8AB 4DV2K 4LBHA 5AK3A 1UTAA 3KLEA 1TAQA 1YIJS 4Z2XA 2JC0A 3KJQB 4FSVA 3GG4A 3K57A 5K4LA 4A8WA 2Y8WA 3DGVA 2VG5A 1EKRA 3VVUA 1HQEA 2BKEA 1RT6B 3MMJA 4I6YA 1Q1KA 2DNNA 4KHWA 4L73A 3VAFA 1IV0A 2CJXB 4BRFA 4P2HA 1YZ7A 3FBBA 2MKKA 4N76A 5AJ3J 1MMLA 1UW4A 3HFKA 4YDDB 2VQEK 4QZFA 1T11A 3MM5B 2ZIXB 5J29A 2V34A 3O08A 4B3MF 4FWLA 2DHHA 4X66J 2ZKUA 3QUBA 9ICWA 1OQ3A 1RUSA 2V8VA 3OPKA 4DR6J 2FDRA 2RUSA 2P9KA 3DEEA 2FBXA 4ECRA 2LQ9A 3D0HE 3DOLA 3OPXA 4P73A 1WHVA 2H65B 4M8LA 5KFGA 4LVSA 2WF8A 5GADP 5F8MA 2KE7A 5M2PA 2A42A 3ALYA 1QAJA 1NGBA 3AQEA 1RCHA 2BHNA 4Q2MA 1FW6A 4GFJA 4DN9A 3ITHA 4IS7A 1HFEL 2XC9A 2KI2A 2MB0B 2CPYA 4TY8B 3JPNA 2Q1NA 1U02A 1ACMB 1CC8A 1RHUB 1KQKA 2HNDB 2WW8A 5AQNA 5CE3A 5HRRA 1VHXA 3DLLL 3Q23A 3V81A 3IUCA 1S57A 4I64A 3CYMA 2R2TA 3Q8VA 2G09A 4PCQA 2KG0A 4ZN1A 2P6UA 3KWIA 5KFMA 2X1FA 2NRWA 2F9TA 5FPNA 4FW2A 5KT2A 2K8BB 3G2XA 4AQYF 4Z0UA 3I5CA 1FJGK 1NZ8A 1S6PA 3W8GA 5LY3A 4QYRA 4FM0A 4WFBQ 4NLVA 1ZQVA 2IOCA 2RF2B 5M1PA 1X7VA 2AYMA 2F4VJ 4Y65A 5EE0A 4K5RA 5JS2A 7ICHA 4FZMA 3WK9A 2R8KA 8ICEA 1MU2A 4Y2KA 1P1TA 5HBMA 1LOTB 1KFDA 3VV2B 4G6VB 3CC2N 1JN3A 4BXOA 4USVA 4FJJA 3BKUA 2KZZA 2EI5A 3GFZA 1UJ4A 3MDQA 3PFEA 2MKCA 2VF3A 3CJ1A 5GIOA 2O5DA 1ZQJA 1ZQZA 1TGOA 1R43A 4QS7A 3BN7A 2JOQA 5HRSA 3QT7A 8ICMA 4M5NA 4JV5J 3L7OA 2GO8A 2DO0A 3K2YA 4FP9A 3P45B 2UUWA 5D4NA 4CD1A 1WSEA 5CYMA 1FEEA 3R97A 3W65A 1Z00A 2W9BB 2WOMB 1FEZA 1ZXIA 1F3FA 3L2VA 4LFCJ 4DKWA 4GNIA 2HNYA 4CYUB 3L6QA 2YNGB 4DR7F 3LP0B 3QGPA 3F2BA 5AQJA 1KSPA 4JYAJ 3GU0A 4TYAA 2BZFA 4F8RA 4Y34A 3CO0P 5BR8K 1IWGA 4B1VA 4FF1A 3OTBA 1IBKJ 1ZQEA 3KK1A 5KFNA 5DZ7A 2RJZA 1UAWA 3W3SA 4Y1CA 3NGDA 4DSKA 3KLHA 4R63A 2HPUA 1K8KB 2AA4A 4M7XA 3QXGA 5AZJA 3ATUA 3MHYA 4FKYA 8ICRA 4I6AA 2B5JA 4QIWC 1RILA 2QYCA 1N5YA 5THWA 3C7NA 1KLNA 3SJJA 3B4MA 3HRGA 1JQGA 5DG8A 1GOBA 4M9GA 1JLBB 1JLGB 1V5VA 3BS7A 3F53A 2RD5C 1VSJA 1A7GE 1DHMA 2FJWA 1ZQYA 2MQNA 4NLTA 1SWWA 4F3OA 2BM0A 2A40A 3M9NB 3L3UA 4A8EA 3VGUA 3W0LA 3ZO7A 2GV1A 3M30B 5C5JA 2DR5A 2V8GA 1F0XA 4M5IA 2VPYB 1SAZA 3OYGA 2BJ7A 3T1HF 4ZP7A 1S1XB 2E1PA 3PX4A 1ZM2A 4CJWA 2DVIA 2D3ZA 2PFOA 4NM2A 1C0UB 2APOA 4J9UE 2G2YA 4XH5A 4JI8J 4IH7A 1CJTA 2KRBA 2HMPA 4DR4F 2NSBA 3WHIA 1X66A 4F0HA 4NXNJ 5KFTA 3DLGA 4C3MA 4UOGA 3C14B 3N6LA 1M1KO 2ZE2B 1DBDA 2QMWA 4JRPA 1KVAA 4KI6A 2BOAA 3F2DA 3SQGA 4LSZB 5AI4A 2BE9B 4IOBA 3M6UA 1D9FA 4W5QA 4F92B 1YT3A 5AZJB 2XQCA 3A8KA 2DGOA 4QAGA 5EDWA 1TUGB 3OXGA 1R0CB 1NI3A 2I6WA 4QZGA 1GLLO 1U2FA 1P9YA 4MFCA 3SSRA 4C2MA 2VBXA 3U1MA 4X65J 3SUNA 1UHUA 5AICA 4ERDA 4KR0B 4ECUA 4KLQA 2BW7A 3PW2A 4EBDA 2HW3A 2E1FA 3RB3A 2V2ZA 1S76D 3QEWA 5ETPA 2BR0A 2IBKA 3K5NA 1AYEA 3IR6B 5EWGA 3NKYA 2HHHK 1WSIA 2M0GB 1JCGA 3NNCA 2BX6A 4AXJA 1QM9A 4Q8FA 3NGKA 1N32J 3GSIA 2PMWA 1M6YA 1U09A 3C6UB 2FBYA 4QBUA 5CH7B 3A0HU 3NRWA 2FHJA 2LCWA 3CWJA 4ID8A 1S0VA 2CPHA 3VGTA 4JB8B 2D9OA 4ECYA 4FXWA 4CLUA 4CLTA 1ZETA 2LKZA 2XYPB 3ZSXA 3ZT2A 4CDIA 2YJEA 5C12A 4J90A 1V3SA 2IIHA 2R7OA 1U2RA 4JI7J 2CNKB 4CJTA 4JI4J 5BYRA 3IP4B 4BR0A 2MA1A 2JRSA 2ZNZA 3CD0A 3KJFB 3K5LA 2G5IB 4FZNA 3D0PA 3JTOA 4EGLA 4B9TA 1JXBA 1G6BA 2Z1HA 2DD8S 3V9XA 2BJ8A 2CPXA 1Z4NA 1UVIA 3BY5A 2FMPA 3AVMA 3Q8PB 1VFJA 3I32A 1J5EJ 3QU7A 4FKXA 3DM2B 4RR5A 1U1NA 4QPTA 3AA3A 4TUPA 2X1AA 3FAHA 5ETSA 2R7TA 2GQCA 3T69A 4ECVA 8ICAA 1PG5B 3CTRA 2PFDA 2G8UA 1HLWA 4QWEA 3L3VA 3M2UB 3BQTA 2LQJA 4ER8A 4FWKA 5BYSA 3HZ6A 3CFRA 5KL1B 2UU9F 4K4TA 5DG9A 2XY7A 3NS1A 3K89A 2OEHA 5AQZA 4CRXA 2FPHX 3CDBA 4CDGA 4NX9A 1GFWB 3FE1A 1Q0NA 3H8YA 3EZUA 4QPXA 3NCQA 3N4WA 1WEXA 3IWNC 3W7BA 4NLZA 3FZ2A 2DNHA 4TU8A 4FOIA 2LXFA 2VA3A 3DLLQ 3L2RA 2A1AA 1WDDA 4OYXA 3VEZA 3H2VE 2E1MC 1GMWA 5C10A 2M9KA 3JPRA 4KHRA 2UU9J 3QATA 2UV8A 3UWTA 5DETA 2EFNA 1S6OA 4WU2A 4XQ8A 4LR9A 3ZTPA 3BO2A 3QDKA 1Q7YO 2IHR1 1JKHB 3SBGA 1DARA 3D68A 3QMQA 1EIYB 3TP2A 2KD1A 1KDNA 2QTWA 5AQPA 3W5ZA 3GZ7A 4GVMA 4LH5A 4J5OA 5E33A 2LMIA 1ZQPA 4DOBA 3J8AA 1S1WB 1AFIA 2MPUA 1C0MA 5AE1A 3SSSA 1FD2A 4LY7A 3QEIA 4JI5J 1VQNN 1IO2A 3IMXA 4NM1A 3HZGA 4TLQA 2MLXA 1SJ3P 1N5QA 4Z37A 3WKAA 1VI7A 4C11A 3B6OA 4OJRA 4DTXA 1AFJA 5HJYA 2F5GA 4ITSA 4B17A 1T9XA 1JALA 1X5PA 7ICJA 4TKTA 5AKZA 4MN4C 3QIDA 2CQDA 2CPZA 5IIJA 5G5HA 4YY3K 1FKPB 1QSLA 2I7PA 4JI0K 2QLBB 3CCRN 1FTCA 4ZVFA 3MR5A 3HSDA 4DV6K 4NZ0A 4H5NA 1E6VA 2V9WA 4YORA 4JI3J 1A5XA 1QUVA 1SXEA 4XTTA 4DEZA 4ACOA 2ATCB 2WB1C 3WK5A 4ED1A 1HYSA 2BCSA 3D5MA 1Z25A 4YOYA 3MM6B 4BRLA 4AHVA 4NCBA 1RAOA 3SCIE 1QHTA 1QQOA 4N8OA 1WAFA 3WZ0A 2B43A 5F0UA 3N6MA 3M6GA 1X31C 2HS4A 3EWGA 4UAWA 1XSNA 2H3GX 4OLOA 4NLSA 5H9EJ 1EKSA 3BYRA 1IXKA 4YP3A 2VFSA 5DKWA 2D9PA 3V72A 5GTIU 1XNQF 2MGZB 3UDLA 1QAIA 3DLEB 3IAS9 3R27A 4USHA 1Q4RA 4J7CA 4GW6A 1WBDA 5GMEA 4FJIA 4C4WA 4F3TA 5ALWA 4ED0A 3OBIA 2W2OP 4F3QA 1FX4A 3PJ9A 2KXFA 4PXEA 2P9SA 4JN4A 3LPYA 3SMPA 5CR0A 4HCCA 3CCQN 3WT0A 1BPEA 3SK3A 1HBUB 1KQGB 5DB6A 4LF6J 2OWOA 3SJHA 2Q0ZX 3KG0A 4HHUA 2ALZA 1RT1A 4A8MP 2E1AA 4I7FB 4BROA 4DPTA 2X1GA 1N5WA 1NK6A 3M8QB 4ILLA 3KHHA 5LSRA 2UYTA 3O4NA 3KHRA 3B54A 4JHDA 1V3ZA 1HJRA 1RGVA 4YMOA 3D3BJ 1KD1T 3MN7A 1RDRA 3T1HJ 2ZM6K 2DRAA 2OPPA 1VJ5A 4IOAL 1M1HA 3WQTA 2RPIA 4HKQA 4FYVB 1YG0A 3LVVA 2HF4A 3O5BA 5J0YA 3HSGA 4KH6A 4C8KA 2ZC3A 5KG1A 4OZ1A 2D69A 4U96A 5F9LA 9ICNA 3TNVA 4F91B 1NRKA 4YQWA 4QQBA 2OI2A 2YKAA 3TAFA 1EHWA 1RADB 2Q3SA 4I27A 2VOOA 4E1NA 3PACA 1S0OA 3QEAZ 9ICBA 1NHKL 2XGQA 4B3SF 1N62A 1H2TZ 2P8IA 2ZIVB 2NO4A 2FSJA 3FBCA 2MZRA 4KH5A 4MO4A 1Q3VA 2AYBA 2P35A 4X4PA 1BXNA 1F9EB 2B4PA 3HVRA 3KUHA 2P9EA 4DPOA 2WVBA 4K0KJ 1WC6A 3EXYA 5DB7A 4YR0A 4Q45A 1Q95G 2FHJD 1P9QC 3ZYYX 1J97A 1ZBLA 4H4MB 3K4GA 3B8HA 1XR6A 2WBRA 4US8A 1OY6A 2IS3A 4MDAA 8ICJA 1FRMA 1H7WA 3LWLA 2HOIA 3VEOA 3JS9A 4IO9Q 4K7QA 3AO3A 4H0XB 4NWIA 2ZG6A 3PKMA 3DDHA 1BWFO 2QLJB 4NLWA 1A6SA 3MMAA 1PBAA 1H1VA 1KTVA 4IQTA 1FO4A 4U7UD 4CI6A 1JLAA 4OJLA 4OLPA 3ED5A 3QRPA 1LEOA 4WIIA 3D7EO 2VODA 1I39A 2YX7A 3I0SB 2C2NA 4ETXA 2VPXB 1REGX 5AQFA 2IVMA 3D1QA 4CGIA 4TURA 4M5KA 5EX5A 1LNQA 4RO0A 4B9SA 4K4GA 3OL7A 3O5TB 3ZZYA 4C4RA 4DBQA 1BU6O 4KJIA 3WUHA 5CXTA 4QJVA 3RYLA 3WC0A 1C0FA 2QWQA 4LR8A 1L3VA 3VGSA 5J2PB 1TL7B 4JI1K 2ZH9A 3DLEA 1SIZA 2BJ1A 4RWXA 3BEXA 1J6ZA 3M8PA 3ZSVA 1EP4A 4PG6A 3GYNA 1JJ2R 1DRGA 3X1LB 4KGKA 8ICSA 2A19A 4DR3K 4E0DA 5T7BA 3KLGB 2X7IA 4CEZA 3KG4A 2IA0A 1UPMB 2ZOMA 1GEHA 3SLCA 2WAQC 2IOHA 4GVBB 4HVJA 5IWAK 4LF9K 5E41A 3RG6A 3US5A 7ICEA 4UB3A 2AKWB 4UW9A 4KX5A 3MMAB 3HJFA 1CJUA 1UA0A 1ZQCA 3MECA 2K1RA 1K73T 1YRUA 5J2QB 2A1JA 2HQIA 3CCEN 3EY1A 1HX1A 4CGHA 3AH6A 3P4IA 4C0ZA 1IV8A 1ZQRA 1FK9A 4A8XA 3QB0A 4CEFA 3UPFA 4DR5K 3NS6A 3GZFA 3FQLA 1EWRA 3J7ZT 2GMHA 8ICKA 3QT5A 2YQEA 2W1BA 4DTNA 1WOQA 4BRAA 5HRNA 1IM6A 4FM1A 1TAUA 4ZH4A 4F5QA 4UARA 1VS3A 4IR9A 4HCBA 1D8ZA 1KBRA 4O8UA 2KKVA 1KONA 3NGYA 5D0GA 2IIRA 4ED4A 3EKSA 2L5YA 4F5PA 1KDHA 4U67Q 4O5BA 4PQAA 4J9NA 2NLWA 2XMTA 2DNLA 1T9VA 2HAFA 2ERRA 4I29A 2GO7A 2JEIA 2FQQB 2OGUA 2VG6B 3AGKA 1RLDA 4DCJB 3H40A 4C97A 3AVCA 4N56A 4M9LA 1U1PA 4I2AA 1FIQA 2K4HA 4CGJA 3DRRB 2ILYA 3I6PA 2YKOA 3W60A 3P31A 4A8SA 3GIRA 3QESA 5D0RA 2KG1A 4G65A 7ICGA 3UXOA 4JKCA 3OTOK 3M6VA 3G8TA 2BUNA 4ZP6A 4NCGB 1IJEB 4FYWB 1TUVA 2QWPA 2OUGA 1WC0A 1COOA 1TUYA 2WUSA 5CHIA 2ASDA 4MO5A 3OYBA 1K47A 2BM1A 1NK4A 3KTQA 2K2PA 4ED6A 3KWGA 4CFBA 2ITGA 2JZ5A 4FM2A 3C14A 5FLXY 3LDAA 3T7ZA 1BQMA 4MFBB 5DGAA 3AJ1A 3QU2A 3CI5A 4X62F 2N4DA 5J1EA 4OJ6A 2O3DA 2FIUA 3KK7A 4X4RA 2W55A 2OPQB 5DB9A 2P9UA 4FDFA 1NGDA 4X4QA 1UWBA 1BVSA 4NJ8A 2E5LK 2HEKA 2QA1A 2MY8A 4DV5K 1WTBA 4QU6A 1KL9A 7ICUA 2FC0A 3MUMP 4IJNA 3U3GA 1RT2B 3KNAA 4C8ZA 3G6XA 4DLGA 3VAKA 3ZTOA 1BDGA 1IKXA 3RAMA 3GB0A 2A5XA 1V38A 5E5NA 3PDNA 4E3SA 3CJ2A 1QZ5A 3AY9A 1RBTA 4O0JA 4V19X 7ICOA 5IM0B 3MWPA 3C94A 4ANCA 3ISCA 3BSNA 1Q81O 3HF5A 5HP1A 5F2RA 1N63A 1KWMA 2W2NP 4RPYA 1WCLA 2VHGA 3H4DA 2QL7B 4QW8A 4ECQA 2YMPA 4IG3A 2DNQA 3THPA 5GAEU 2CQ2A 4QWDA 3M1YA 3D4JA 5DK5A 3MWTA 1Z26A 1ZBFA 5KAFU 4QWAA 3CJQA 4QZVB 3NGRA 5C42B 4WBFA 1E6VB 3IM9A 2IOFA 5LM7E 3NF6A 3LK9A 5HJXA 3SEIA 2GO9A 3ZX0A 3W62A 1BPXA 4LR7A 1VQ4S 2D8CA 2XSFA 2OD6A 5D4OA 3M1VA 3TAPA 2K1RB 5FROA 4HAIA 4YR3A 1N5XA 2POKA 3VGVA 2VFUA 5BRFA 5FPDA 1PKUA 2ZBIA 4PUOA 3QERA 2VOPA 3CD6S 3MC1A 4JI6K 4OI0A 4FYYB 4BC5A 2FLNA 1Q86O 1RT2A 3ILIA 4JKAA 3N79A 4DCPB 8AT1B 3QETA 3OYHA 3VWSA 1L7NA 1T9TA 2E5GA 3UKRA 1XMOF 4X62J 4M5DB 4CLPA 2VJUA 1U2VA 2F1IA 2YY6A 5EN1A 2DYAA 2G4BA 3TUJC 3MUTP 3MOZA 1YLXA 3LAKA 4GV6A 1HYVA 4H54A 1PK3A 3W61A 2DNZA 1Q9YA 2HIQA 1OXJA 1N56A 1KKXA 3OYAA 3E01A 1BUXA 5HROA 2DH9A 3FCWA 1NG9A 4IG3B 4FVUA 1WKJA 1ZBSA 4TY8A 4RBTA 2ZH6A 2CPRA 2OSRA 1WNEA 2GFFA 5AKXA 2BGGA 5L9NA 2UUCK 3EWAA 4YXMA 4CJFA 4WWSA 2C2EA 5L46A 2HZVA 2E8AA 5AZIB 2G0JA 4DUZK 2EKNA 5EWFA 3RAQA 4A8OA 5BR8F 1HD0A 2KV2A 4FOEA 2VU5A 2BUPA 4KN7A 2BPCA 1S9GA 4PEOA 3AVBA 3AU6A 2VUGA 4ZP9A 3CC7S 3TSUA 4O4GA 4OL8A 1NGIA 4EYHB 2RH3A 4X64F 4AHSA 2KZ3A 3WK7A 1J2MA 3KKSA 5KT4A 5DBAA 3HVTB 1DRZA 1SC6A 2XB2D 4NEZA 2VBYA 1FRJA 4CLFA 2LSNA 3M8RA 4I1TA 1RTHB 4GRSA 3OSNA 3DI6A 3SAHA 4GC6A 1HR0F 4CJPA 3S3NA 4O55A 2FZKB 2GEMA 4NZ7A 3SR6A 2YNHA 4K59A 3Q83A 4DL4A 3LAMA 3Q7BA 4OX9J 3E9LA 1N0UA 3H5XA 2EW9A 4MF2A 5B08A 2IM2A 5A6PA 4AXIA 2YKQA 4WF9Q 1HI1A 2C3OA 4RQ1A 1AZSB 3MWBA 4F5OA 1D8YA 3KKRA 3G4SN 2RRDA 2U1AA 4WQ5C 2NYVA 2HBJA 4OCZA 4OLAA 2LVWA 2HRTA 4DL0C 2ZUGA 3N5BA 4MJKA 4Z7CA 3RW6A 1TV6A 2HB5A 1IR0A 2DNKA 1S6UA 1YK9A 1UEVA 1SL0A 1EJ7L 3BQ1A 5F8JA 3W9HA 2RRNA 4USAA 2Z1JA 5AQTA 2EAPA 3TKAA 2OEKA 3GJRB 3KK1B 3GJQB 1LWEA 2A10A 1HNXJ 4DR2F 1LCUA 3H7IA 2EZXA 4JRQA 1NHUA 3I1YA 4RNOA 2P9PB 1RK8A 4O9MA 2ZBQA 2HVIA 4NLYA 1CBKA 3OJUA 1Q16B 3VAHA 3SQOP 1ZZNA 1FFUA 5L1LA 4B3RJ 1ATSA 4IR1A 3MCMA 3LW5C 2KNJA 3I28A 5FDLA 4NXMK 2JJ4D 2J9EA 3DLKA 2F4VF 3EZOA 2KMDA 3QLHA 1N33F 3OYIA 4DMZA 1TKTA 1TUWA 3LO3A 4ZPCA 3P4UB 3NVWA 5ETTA 4BRDA 4M5DA 3ATVA 2XHWA 2DPIA 2B4UA 2ZJ8A 5AQKA 3NGIA 2BCRA 1N8RT 4W90B 1KVCA 4S0MA 3PYEA 5IS2A 4M3UA 2Z4PA 1RTJA 1LKZA 1O03A 3ISNC 9ICFA 4R5PB 4RG8A 4AFFA 3CCSS 4CFDA 1U0HA 4ED7A 5C25A 4I2HA 2ZOGA 2XWYA 5AZIA 2IAJA 4FNIA 3CCQS 3VA0A 2BTFA 2QXFA 2YMMA 2RVJA 4HL9A 3LP1B 2G8FA 2BABA 5ALTA 4LF8K 3RJEA 2AGOA 2D3OR 1ZQOA 2F8LA 2OKQA 3KBBA 3C2MA 2PMZF 4BQLA 4CLYA 2EZYA 3FMBA 4DTSA 1HQUB 2MEWA 2HBYB 4DTOA 4FWNA 1UZDA 1IQZA 3C6HA 4Q0BA 3HPOA 2ZVIA 4GXKA 4GKJF 4CJEA 3HHLA 3P49B 5J2DA 1X1PA 3NNHA 2I9GA 3KFWX 1MQ3A 2KKPA 5J2BA 1HUZA 1P8ZA 3WBZA 2AIRB 4WF9L 3QNWB 1WN7A 5IIOA 3W2WA 2BCQA 2Q1LA 1VJWA 2ZBRA 8ICWA 1FESA 1UVJA 3PO5A 4KAZA 2QLWA 1NSPA 4KLUA 4JYAF 2JEGA 5J8YA 3P3DA 2M8HA 2PFQA 3M9MB 5EY4A 2O8DB 2HQDA 4DV0J 2HFNA 4CLSA 2Q4TA 1RU2A 3OL9A 1ICEB 2Z2ZA 1MN7A 1ZA1B 3R5DA 2EC2A 2HBZB 2RT3A 4Z6FA 3RFAA 2GZOA 2DH7A 4KFBA 4J9SA 3NBPB 3MOJB 3KHYA 4M9NA 1FFVA 4NYNA 2CRXA 1NGFA 3AA4A 1XJWB 3F2CA 4JHDB 2BKPA 4OJHA 3T1YK 2Y0SD 3M32B 4CT9A 1COKA 4RW6A 3CCVN 2VKZG 5LT5A 3SUQA 1WF2A 5BR9A 1VOMA 4P72A 4JI8F 2EPIA 4FK4A 1MMNA 1LWFB 3KUGA 3GPAA 4RW8A 3A8EA 2QI2A 1JLQA 1YGYA 1J5OA 2Y1RI 1AT1B 2D0OA 4Z7YA 4PQUA 1OYEA 5CYJA 1YDLA 2MY7A 3P6YC 1WF0A 1LXNA 1TUUA 1QQ7A 4NWBA 3UCUP 3C1YA 4CIGA 3KD5E 3GQCA 2UVWA 4CEBA 3OFGA 3CIZA 1DFDA 4EZ9A 2GA7A 4XPCA 1RT3B 4DV2F 4JAXA 7ICRA 3ZI4A 5KQ8A 2ZDOA 2UUAF 4PG5A 2O8DA 3FC9A 2J6UA 4K4VA 4KB0A 5A8RB 4OZ3A 4JKGB 2QWOA 2WSEC 1CSJA 1B4FA 1QS4A 4KV8B 2JRZA 3N7RC 4WFAQ 3IO1A 4L76A 4R0JA 1SV0C 4PY5A 3DKDA 7ICQA 9ICEA 1WI8A 2DIUA 2KJ5A 4IEIA 2DGUA 8RUCA 4EHUA 3C16A 4J9KA 4CM2A 4OI6A 1IWAA 1ZBHA 3BP8A 1IBKF 1Q79A 3FEYB 4BBYA 4E7IA 5B0AA 2WTFA 3OLBA 4YXJA 2G5HB 4CGFA 4ZS6A 4MKYA 3Q89A 1BOTO 2M88A 2GWJA 3F2KA 2FBVA 3M6ZA 1B43A 4RNNA 1XR7A 4FZYA 1EETB 3O44A 2WBNA 3RZAA 4F72A 4UQGA 4DX8H 3JYTB 3F5TA 1NPPA 4K4WA 3NG8A 4HDHA 2BEFA 3MEEB 4OJOA 3TANA 2XVTA 3DXMA 1GO3F 3KKAA 2OTLN 4GVBA 1REVA 3I56S 3L4PA 3G87A 2ROPA 1XMQK 1TL5A 3DWLA 1RAAB 1AZSA 2EHGA 3SZ2A 1LVHA 5ETNA 2EEYA 5J2NB 3ZSZA 4R8UB 2QA4G 4Q2LA 3G8SA 4UOCA 2JGUA 1Y10A 2O8CB 3RRGA 3M6XA 2MZ1A 4A8KA 2HBKA 4IC9A 4UBBA 2ADBA 5L1MA 2KVIA 4IO9L 4GKJJ 3IS9B 4YEAA 1VSMA 2UUBK 3OTEA 3Q0AA 5E3CA 2UVVA 3NDKA 5GINA 1SZHA 1R3NA 4F4ZA 2OPRB 4LUBA 3BF4A 3RGIA 1C0GA 3FKBA 4CF5A 5J2QA 2DR6A 3M8ZA 5BN9A 1FFGB 1TMJA 4NLCA 4Y2MA 1NGGA 2BH1A 4K0KF 4R0EA 1O08A 3N7SC 1TL1B 3CG7A 4L3NA 1RA7A 2HHUA 1MMDA 4UOFA 3DDKA 3LPUA 1ZQWA 5B8HA 5GVQA 1X0PA 3C7NB 3BSOA 2CPEA 3V9WA 3PJWA 1NKEA 1YBTA 1OPIA 1T05A 3NE6A 4UY85 4M95A 4KLFA 4OX7A 1S99A 2HVDA 3LM2A 1YBAA 4PGYA 1R0AA 2V63A 3HILA 4KTWA 4UQTA 3TUIC 5BPNA 2HHQA 4M7YA 2W01A 2MGZA 3RSEA 2AU0A 1X4CA 5LMUJ 3VR1A 3HJEA 2HSTA 4IO8A 4ZVOB 1Z1VA 4OPJA 2FHOB 5AM2A 5KT3A 1VR6A 4CJ7A 2BCUA 5EGYA 1JXLA 5B0CA 1FKOA 3CC4N 4USUA 1ATNA 3M8SA 9ICUA 1OS5A 1NO8A 3O9TA 4I68A 3EDRB 2J7UA 3BUZB 3NL0A 1JCEA 1C4AA 2D1KA 3QFPA 4MKVA 4U7CA 1FKAF 2DNMA 4U95A 1RTHA 2LM1A 1ZTTA 4KLIA 2E2OA 1S97A 4GXIA 5I42B 4B08A 7ICNA 2CVEA 2HHTA 5F8GA 4JKGA 3CCES 3GWCA 2HZAA 1MDUB 1BIZA 1JNZB 3C21A 1S7IA 1Q46A 5DDYA 4EX6A 4LH4A 4QJFB 2V4QA 1QQMA 3PEJA 4CNZA 5SWMA 1OH7A 2O4IA 1XMOJ 3C23A 3KZXA 3NVVA 4NV0A 5HP4A 1LKYB 2GWKA 2CKWA 5KFHA 5FDLB 3ICXA 4BRIA 3MXHP 3MX5A 3U26A 1HHQA 3UCGA 1N60A 2XO6A 5KNIA 5J0TA 2LU1A 3FR0A 1TK0A 4NA1A 2R7QA 3GONA 1BL3A 4I2QB 1RQLA 5AI8A 2BACA 5DJBA 3M8YA 3UXNA 1YVNA 3N6NA 1RXWA 5AQRA 4WFXA 2RDIA 1D8BA 3GYGA 2ISOA 4J2BA 2CQCA 3ZTRA 2PMZC 2W8LA 3BEGB 1YAGA 4MQ3A 4X4UA 5F41A 5E2QA 4M3ZA 3TVKA 4FJ7A 2CWKA 4OO1J 2LDYA 1DXSA 3TAGA 4IFYA 2V5HG 5HP1B 2HAIA 1CZAN 4ECTA 7FD1A 2ZH8A 4BG9A 5KPRA 4KT0C 4R5PA 4YDUC 3HHKA 5I3QA 1I6JA 4KGXB 2DCUB 3ITHB 4IUFA 4FZLA 3MCOA 4PWUA 4O23A 3BF1A 3QQCD 2I8EA 4H4OA 5GAGI 2OHDA 2EANA 1ZQTA 1VBXA 3P39A 2VQFF 2CDQA 1SV4A 3MBYA 3KWMA 1F5AA 1T03B 2E2PA 5U47A 1BWEA 1VRQC 2HMIA 1VQ9N 2KN4A 1IIPA 4KKOB 4RX6A 4HEA9 3FBEA 3THXA 3S1TA 1NH8A 4F04B 1K8KA 4M45A 3TEGA 4TU7A 3H46O 1UA1A 1ULRA 4PKHA 3I5AA 3OHRA 2ZH5A 1CJKB 1HNVB 2P9CA 5HVFA 5IT4A 3CIPA 2KL8A 4URSA 3J80Y 2PY5A 1XTZA 4Y2IA 2E2NA 3PUFA 2BE2B 3CMEN 5C24A 4GVEA 3AT1B 4DV2J 3K17A 1HWJA 1Y11A 3MR7A 4CEDA 3HW8A 4EFAC 2GJFA 1FF2A 2KM8B 5A76A 2XEXA 4B3SJ 1UL3A 1WAJA 3KKFA 2FVQA 1UMJA 2A3VA 4QOTA 1SQEA 1TZ0A 3HOSA 4JK7A 2GELA 1IBMF 5H1SQ 3MI7X 4DV4K 2V8DA 2GTDA 2B9YA 1HBNB 4ICLB 1DK3A 4NLBA 3OYJA 4BRKA 2E7VA 2ZIUB 3DC2A 2QYGA 2VQEJ 2KT2A 2PYJA 2F4FA 4MKAA 4JD2B 3CC7N 3HULA 5GAEI 1PC5A 4KN4A 3MAHA 4F2SA 3AB2B 3KJNB 3D1HA 3EE9A 1BHNA 1GOCA 1YJNS 2IJNA 3NASA 4UZBA 2DT9A 3FSYA 1ZYQA 3CJ7A 1MWQA 4FJLA 3MDFA 2FYXA 2XSJA 3PV8A 1NM1A 3I55N 3K9KA 3HOTA 3VQPA 3RMCA 1XHXA 4UASA 2AMCB 1JKHA 5IT0A 4FWPA 9ICQA 4OJPA 4B3MK 1R8BA 4IZ9A 1H73A 2UZAA 3A5LC 3BJYA 1U1OA 4Y2PA 3QICA 2OSQA 2IGIA 1JJ2M 4FNHA 2DNPA 3V4MA 4DI6A 1T02A 1J5EF 2B7BB 4O4GB 1RFQA 1CQNA 1HUXA 4JP8A 4MFAA 2P9SB 3TTFA 2LYBA 3TAMB 1BPDA 4Z6CA 3FSIA 2N7YA 3MF5A 1SJRA 5DBBA 4FPIA 1S0NA 2E5LF 4KPYA 3LVWA 3P96A 3WQPA 1W7WA 4UUXA 2H5IB 3VQ8A 2MAXA 4ZVGA 1P90A 2GMLA 4FBUA 2CAJA 3PR4A 2BV3A 4CVNE 4AHCA 1VK0A 1BPBA 2E1EA 1LW2B 2MYFA