1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
3OGUA 8ICGA 4JV1A 5DB7A 1MC8A 3DLGA 4DSIA 4CJ3A 2JZBA 3QEBZ 2ZJ8A 1GOAA 1T4GA 5J2BA 1LW2A 4B8CA 3ISBA 1ZQVA 4FO6A 3VQ5A 3PW5A 1JLFA 2P5OA 1CLQA 3LP0A 3ORYA 2PXIA 5KFRA 4ID1A 3M9OB 4KLHA 3L3VA 2KTQA 4RQ2A 1KVAA 1HUZA 1HRHA 3C5FA 2JEIA 1C0UA 4F4XA 1S0NA 4KPYA 4CFCA 3SZ2A 2BPCA 1KCFA 1LW0A 5J0WA 4LSNA 4DSEA 3V6HA 5J2HA 2FLLA 4YMNA 4OJRA 1JIHA 1RT4A 1RYRA 1QSYA 4RQ0A 3D0PA 5D49A 2DPIA 9ICIA 5KT2A 4Q45A 2GBZA 5JS1A 3JSMA 1VSDA 1HNVA 3DLBA 1BVSA 3C21A 4TUSA 4DTSA 1JXLA 4M3XA 4LZDA 4KHWA 3DLEA 4CJVA 8ICRA 1N5YA 2VG5A 4KB1A 4AILC 1HPZA 2OZMA 3RH4A 5FRMA 3KLGA 1F21A 1G15A 4KMUA 3OYCA 3AO4A 4CJQA 1WCLA 5J2KA 3SQ2A 3VQAA 4O5KA 3QEVA 1GOBA 1UOCA 1T8EA 1J53A 5HRNA 1S9FA 4B08A 3TI0A 4RZRA 3JPTA 2BANA 4KV8A 2BHNA 4I9QA 5IILA 1ZQPA 8ICPA 3SUQA 3MGIA 4FK4A 3V9XA 4RPZA 1ZQUA 4DSJA 3NBPA 4C8MA 5CP2A 3L2UA 1S9EA 1ZJMA 4QCLA 3AVGA 4NLZA 4XA5A 3MBYA 2W9BA 5DB6A 3DM2A 4HUGA 2R7YA 3AVHA 7ICEA 8ICWA 2Y1JA 3QESA 4DO9A 4CF0A 4YMMA 3N4MB 1VRTA 4KLDA 3MEEA 2MUTA 4IQUA 3AO5A 1ZQRA 3KK3A 2PI5A 1XI1A 4W5TA 1T05A 4O3RA 3AO2A 3QIPA 1DGSA 3QNOA 5DKWA 2A1JB 1U4BA 1S1VA 3NE6A 5HHIA 4AHRA 2HHWA 3LANA 2Q0ZX 1EXNA 5KG3A 5KGWA 1TKDA 2BCQA 5HP1A 4NCAA 1W0HA 4CK2A 1L5UA 3BQ2A 4IR9A 3JPOA 3JPPA 3GIIA 2FMSA 3PUFA 3HO1A 4M3UA 5HRPA 1RBVA 1A76A 2DFFA 4DU1A 4B9LA 3KKRA 3LWMA 3VQ6A 4K4IA 4O3NA 2RN2A 3T5HA 2W9CB 2ZJAA 4Q43A 3NF8A 4YR3A 1VRUA 4O3OA 4O5CA 1UA1A 3UIQA 4F91B 1NK4A 4KLOA 2WOMA 4C8KA 5J2DA 1S0VA 4E7KA 2VG6A 3GV5B 1IKWA 4P4OA 3MXJA 1HYSA 2IOCA 3LPUA 4O4GA 4KHYA 4Z4GA 1U49A 5C42A 7ICSA 3KLHA 4F5NA 3V4IA 1RDBA 3TAFA 3MFIA 4ECXA 2RKIA 1NK0A 4NYFA 4CJLA 1K6YA 4QZ9A 2YHBA 2UVVA 3VQ8A 1BCOA 4KLJA 1NOZA 3RB6A 7ICNA 4CGGA 1VSIA 2YKNA 4I2IA 1SV5A 3HPOA 1YTUA 1BCMA 1ZQBA 1B22A 3B0XA 2HHUA 1EXQA 4CF8A 4M9GA 4ECSA 3VQ4A 3NGYA 4PWDA 3EYZA 1IKVA 2G8UA 4QZIA 1RTIA 3OYDA 3EY1A 4M2YA 1N56A 4CEEA 4FK2A 4X5VA 3Q8RB 1IKXA 5DK5A 3HPHA 1NKEA 3RJJA 3RR8A 1TAQA 4QWDA 1VSEA 4QZAA 3OSNA 3LDSA 2FPKA 4HYKA 1HJRA 1MQ2A 1C1AA 2ITGA 3ISNC 3RAXA 2HNZA 4BWJA 2JEJA 4M3RA 2OA8A 4FYDA 3OJUA 2YNIA 4Q5VA 2PYLA 3TAQA 3U3GA 2Z1HA 3V6DA 3Q8MA 5IINA 4M6WA 5KFZA 2BQRA 1K1QA 3VN5A 4UB2A 3ZDAA 1U04A 5CJ7A 1ZQWA 4TURA 4DTUA 4CEZA 3C1ZA 8ICFA 5EWEA 3G6VA 4I2CA 7ICVA 4Q44A 1WNSA 3SPYA 1WN7A 4JUZA 3WNGA 4RQ3A 3ZSYA 2B6AA 3RMBA 4FLUA 4QW8A 1X9SA 1XHZA 4JRPA 2VA3A 4KHNA 4J9QA 1W9HA 4M45A 4UB1A 2C2EA 3OS0A 1UA0A 4B9TA 1BPYA 3NAEA 1S97A 4RW4A 4YD2A 4KITB 3AVIA 5KT3A 4CECA 9ICRA 2VG7A 4H4OA 1JL1A 4RW7A 3LDAA 3F9KA 1QQCA 3HSTB 3VQ9A 3V1QA 4IQVA 1BL3A 4YD1A 2YKMA 4KKOA 1ZQLA 4KLUA 2KQ2A 3RBEA 5BOMA 5J0QA 2HW3A 1TVRA 3UXPA 2LYHA 2W8KA 3MABA 3QERA 5KFVA 1RDAA 4EZ6A 1B92A 4FJHA 4CJSA 3RWUA 2ZD1A 4ED8A 3DRPA 3ZT4A 1JMSA 1KFTA 3P5JA 7ICFA 5KFNA 1JXEA 3LWLA 4N56A 8ICIA 2ZE2A 2J6TA 3SQ0A 3V9UA 9ICNA 3VQ7A 4BE0A 2R8HA 1SKRA 4FJKA 5KFBA 3K5OA 8ICCA 4DFJA 3K5LA 1VSFA 3HVTA 1ASUA 4M47A 2Q3SA 5L1JA 2Z1JA 3MR2A 5D46A 2C2DA 2BGGA 1EKEA 2ZUBA 1TKTA 1NK9A 2IAJA 1J9AA 1ZQMA 4P4MA 4B9VA 1T3NA 2ALZA 2OPPA 2F1HA 2DFLA 4DLEA 2EHGA 3LP1A 4I9LA 3M8PA 3RBDA 3RH5A 2J6UA 3L2QA 8ICLA 1Z3EB 4JWNA 4F4WA 4YR0A 4WE1A 3G6YA 7ICGA 2O4IA 3S3OA 5DG8A 3HPGA 4QWAA 4FJJA 3ULDA 4W5OA 2AQ4A 2WTFA 3NH1A 3V9SA 3L2RA 3O4QA 3VQPA 1SL2A 4HUEA 4E7IA 4JV0A 5J2GA 8ICZA 1HMVA 1D5AA 4CJWA 3QZ8A 4KTZA 3LAMA 1JX4A 2BPFA 4MFCA 4PPXA 4M3YA 3RB4A 2BQ3A 3QLHA 4I2QA 1ZQNA 3QEIA 4F2RA 3ZSRA 3F73A 5KG0A 4CFAA 3RJGA 3KHLA 3NHGA 4DQPA 2FLNA 1S0MA 5KFOA 4EZ9A 9ICOA 3ZSQA 1TV9A 5HMLA 1BPDA 4M9HA 3QEAZ 1LV5A 4CJ5A 4EP4A 2Y1IA 5DG9A 1JLCA 2HVHA 5J0PA 3FDSA 4DLGA 4YNQA 4FLVA 3AA5X 5DGBA 3TFRA 2AGPA 1C7YA 4DL2A 4KI4A 2IDOA 4UB5A 2BCSA 4RQ4A 1FXXA 3S3MA 3MR3A 4FJMA 5CWRA 9ICXA 2XCPA 5CY4A 2P6UA 1J54A 1TV6A 1BPXA 3QEWA 4CESA 3KK2A 1TL3A 4I27A 1IKYA 2RPIA 3V7JA 3UQ2A 2UVWA 4FM2A 2VA2A 3K59A 1MU2A 1ZQJA 4BXOA 3AU2A 1RCHA 4I2HA 3MXIA 4IRKA 4UB4A 3PX6A 4LD0A 1WSFA 2YNGA 1UT8A 2IS3A 3IS9A 3C94A 4PGQA 3CYMA 1XSNA 2ASLA 2QXFA 2R8GA 9ICEA 5J2NA 2AGQA 4DFPA 1ZBLA 4ELTA 4FCYA 4I2PA 4QZBA 8ICTA 3KKSA 4HCCA 2BPGA 5J2JA 2NRTA 1TK8A 3E01A 4DU3A 4IQTA 4F5QA 2G8FA 4Z6DA 1BGXT 5J0UA 4K4HA 3LP3A 2FBYA 4RUCA 3M8QA 4IFYA 4FM1A 4PHPA 2AU0A 1L3SA 4MF8A 8ICXA 3SUOA 2ISPA 1ZQGA 1WSIA 4O3SA 1BISA 4YG2A 4EP5A 3TFSA 5I42A 3DI6A 4M04A 3V7KA 2FMQA 4KREA 1X1PA 4HUFA 3G6XA 4GC7A 4KLIA 1TFRA 4ECQA 4B9SA 3AVAA 3DMJA 3GDXA 4I7FA 4YR2A 3C95A 2PYJA 3GFKB 4ED6A 3ZD8A 3UPQA 4I2JA 4H4MA 7ICLA 3M9MB 4CF9A 4FXDA 2FBVA 3TAPA 1S5JA 4CFDA 5C24A 4ZHRA 4FS1A 3HWTA 1LWCA 4ICLA 3G0ZA 3QZ7A 5CYMA 1QTMA 4FZYA 4YFUA 4F4YA 3OY9A 4DFMA 1T7PA 1TK0A 4CEQA 3VA3A 1U9LA 3U6FA 3SI8A 4XRHA 1WCNA 2DFHA 2EX3A 2A1RA 1NJYA 1JLGA 1B9FA 3MR5A 3TAEA 4Z4IA 5KG6A 4FJ7A 4QW9A 5KFCA 4J9NA 1HNIA 3B6PA 1WSEA 1RPLA 3T5LA 4XIUA 3OYNA 5J2QA 5DMRA 1A5XA 3QE9Y 4DSFA 9ICSA 5DDMA 4QZFA 4K8ZA 1VK0A 4O3PA 3H8WA 5KTQA 4HHTA 4ECTA 1NKCA 4ELUA 2HMIA 4ED2A 3SQ1A 5J0YA 4DL6A 3MEGA 4ECVA 5CZ1A 1LWFA 1ZBHA 4CEOA 1AROP 1HJPA 4O5EA 3LP2A 3PR4A 4CK1A 8ICQA 3NF6A 2R8JA 3FYHA 4DTOA 1I39A 3K2PA 4I2BA 1TL1A 4KHUA 4CJEA 4ZTJA 1NKBA 8ICYA 1A5WA 1JLEA 3QNNA 4CF2A 2X6SA 1C1CA 1KVBA 1TKXA 2R8KA 3OYBA 4FJ5A 3HX0A 3CQ8A 1RBUA 3CFRA 4CHQA 4O55A 2ETJA 5L1KA 3NF9A 5KFDA 4BDYA 2UVRA 1NOMA 4FBUA 2V9WA 4QOZB 3H08A 4B8AB 4CGIA 4FJNA 5KG5A 3E2EA 1DTQA 3T5JA 2I9GA 4JK1A 1ZETA 3PMLA 3PO5A 1NJWA 4E19A 1BQMA 4NLGA 2UVUA 1ZQAA 4CHOA 4E89A 1JKHA 4KLQA 4UAWA 3GIJA 4ECZA 2E4LA 5KFIA 2D0CA 4HVJA 3AVCA 4GW6A 4NM2A 4F3OA 4O0JA 3JPQA 4QAGA 5HRSA 4E3SA 4GVMA 2ATQA 3MFHA 4I28A 3HJFA 4Q8FA 1ZJNA 4CCHA 3VQEA 3M8SA 1DLOA 1NJZA 2BR0A 4Z4HA 3NGIA 1ZQSA 4EYHB 1X2IA 1Z00B 5HMMA 2P6RA 4BDPA 3ZT0A 1BI4B 4N47A 5D3GA 2YHAA 2I1QA 1S9GA 4Q8EA 4N5SA 4HTUA 4K8XA 3SNNA 1NK5A 2BQUA 3V9WA 1V9PA 2NRZA 5J2AA 4AHUA 1D9DA 4FVMA 4E0DA 4N76A 2KFNA 5FROA 1HYZA 4M3TA 3THVA 5FRNA 1Q9YA 5DLGA 4RT3A 3EWAA 5L1IA 1ZQDA 3SYZA 1PZNA 4CIEA 3D45A 1Z00A 4BDZA 1Q9XA 1ZQXA 1S77D 1IG9A 3ISCA 4DQIA 2P5GA 1QHTA 3V72A 3WNEA 4CGDA 4J9OA 1COOA 4LH4A 3UXOA 4CJUA 1C0TA 4CEDA 2PFQA 5DGAA 4NLKA 8ICMA 9ICUA 4DL3A 5FDLA 1HQUA 4CERA 3B0YA 3NTUA 3C1YA 4J2DA 1VSMA 4J9RA 3ZD9A 3GV7B 1TVAA 4MEYA 3WNHA 4OLAA 3PW0A 3IAYA 1TGOA 1NK8A 3RMDA 5DDYA 1KFDA 3IRXA 1ZQTA 9ICFA 4EBEA 7ICMA 4NCGA 3DLKA 3G10A 2IHMA 3MDAA 2AQ0A 4RW9A 1YVUA 3C6TA 3OYLA 1SKSA 3DRSA 3GIKA 4R5PA 3U3YA 3TQ1A 2HHSA 4BGDA 1RT3A 4GMJB 5EU7A 5KG2A 9ICKA 3TANA 5J2EA 1D9FA 3IM1A 2W42A 1ZBIA 1ZQEA 3K75D 4FLWA 5J0SA 3SV3A 3H8SA 4KLSA 4I29A 1KFSA 3AO3A 3TAMA 3ZDEA 2JGUA 1J5OA 2FC0A 2BCRA 4KFBA 4CFBA 3V1RA 4OKKA 5DB8A 4GC6A 5C25A 1LWEA 3EZ5A 4J9MA 3TR8A 4F8RA 3AV9A 4FJLA 4Y1DA 4NXZA 4DOCA 3DYAA 5E41A 1RT6A 2PFOA 1NOYA 5DBAA 2B21A 4GXIA 2D5RA 4YFKA 7ICUA 4JRQA 1YT3A 2KZ3A 5T7BA 1JLAA 3L2WA 1FKOA 1VSHA 2A1SA 4CHPA 3GV8B 5DG7A 5EWFA 3NGDA 1BIUA 2XCAA 4QZHA 4JS5A 5J2MA 4QWCA 9ICBA 1JXBA 3S3NA 2ZQBA 2ZTEA 2FPMA 2F8TA 4CIFA 4Z6EA 3K5MA 2PZSA 3JPSA 3V81A 1ZQZA 3Q8LA 3EPGA 4ED1A 4QZCA 3ZDCA 4J9KA 4G3IA 5EWGA 1RT7A 4XUSA 2YNFA 5KFXA 5KFMA 1BPBA 2ZTCA 3RJKA 4ID5A 8ICHA 4C8OA 4B9MA 3MDCA 2AGOA 5KFAA 3OYAA 4RPXA 3QINA 4LSLA 3QEXA 5KT4A 3K58A 2OPSA 2F96A 3S9HA 4J2BA 1XC9A 2R8IA 3Q8SB 3TABA 2BKEA 4NCBA 2XHBA 4YMOA 5J1EA 2HHXA 2ASJA 3HXMA 4BACA 2YNHA 3DOLA 1SZPA 4IG0A 2XGPA 1CZBA 1ASWA 1KEJA 4R8UA 2Z1IA 4M3WA 5CA7A 5J0TA 4DF8A 4PHEA 5KI6A 7ICIA 3KK1A 3H8JA 3H4DA 4PUOA 4RUAA 2OZSA 4LH5A 4RNMA 4R65A 1HUOA 1S76D 2C2RA 4G1QA 4E7HA 2DPJA 4F92B 4EEYA 5HP4A 3ZDBA 4OVLA 2O4GA 3TARA 5KRTA 2RF2A 5DLFA 3RJIA 1QS4A 4M3ZA 4KHSA 1BPZA 1XSLA 3ZT3A 1ZBFA 3ZT2A 9ICQA 3KTQA 3PX4A 3L3UA 1S1WA 4RNNA 4CIGA 5IIKA 3LPTA 8ICOA 5F9LA 1NJXA 8ICAA 1SL0A 1ZQOA 1D8YA 1QSLA 3H7IA 4B9UA 4RPYA 2W9MA 5KFEA 5J2FA 2KZMA 5KFTA 1TK5A 1ASVA 7ICJA 2C22A 4F93B 1IM4A 4DTMA 3BGRA 3JPRA 1RDCA 3PX0A 3OJSA 2XY6A 4RG8A 2VANA 4UQGA 3PNCA 3OS1A 4C8NA 4CJTA 5CYQA 3MGHA 4CEAA 4TSXA 5L9XA 3PW2A 3DOKA 3ISDA 2A1JA 4DU4A 9ICMA 1A77A 3MAQA 5I3UA 4PA1A 2I5JA 3SV4A 8ICNA 3NGZA 4IR1A 4LY7A 3H4BA 3OVNA 1S6PA 4F5PA 2IHNA 4FW1A 2BGWA 4XQ8A 3T1AA 4BE2A 4RQ6A 1WSGA 3M8RA 4PHDA 2BCVA 3P83D 4DQRA 1EETA 4FLYA 2NRXA 3QETA 3LZJA 1S0OA 4FJXA 3ZT1A 4DEZA 4ZH4A 2QK9A 4H8KA 3IG1A 3CFPA 3KLFA 3AVFA 4GXKA 3SPZA 3ITHA 3MXMA 1RILA 3LAKA 4TUQA 1ZQCA 2D0AA 1D8LA 4F5RA 4W5NA 2F8SA 5K14A 2DTUA 4M9LA 4F5OA 3NCIA 1WAFA 3A2FA 4J9SA 3NH0A 2J6SA 1RT1A 2QKKA 1B9DA 4FLTA 4DL7A 2PFPA 1JN3A 4OPJA 3BJYA 3RJEA 4TQSA 3VQCA 4KO0A 1RTDA 4AHSA 5HHHA 4DL4A 4EBCA 4KLTA 4M9NA 3I8DA 4R64A 4B9NA 3Q8PB 8ICUA 3AVNA 3MEDA 1ZQQA 5HROA 5KFUA 1NK7A 5J0RA 1KRPA 1UAXA 1EP4A 3CG7A 4KRFA 8ICBA 1TAUA 3VQQA 1WSJA 4ED3A 4M41A 1LAVA 4FS2A 2ZTDA 4YXMA 2RDIA 4DOBA 1FK9A 1WLJA 5CZ2A 1GOCA 5TZVA 4FJ9A 1N6QA 5KT5A 7ICPA 3PY8A 4R8UB 4W5RA 4KAZA 1RTHA 2B4JA 1Y88A 4Q0BA 4AH9A 2BDPA 5IIMA 1O1WA 7ICRA 2XGQA 4E1NA 2E6MA 4MEXA 3V6JA 1KVCA 4NY8A 4MFFA 3NDKA 1R0AA 1KTQA 3HK2A 4KLEA 2ASDA 2FLPA 5DB9A 2M9NA 3RRHA 4I2EA 3HL8A 4M6WB 1RZTA 4FM0A 4YN4A 4Z4EA 3M9NB 3O3FA 3AVKA 4LVSA 3RTVA 2FPLA 4DSLA 3K57A 8ICSA 1VSLA 4EYIB 4CGFA 2OYQA 1Y97A 4RQ8A 2FMPA 2G8WA 4F2SA 1XHXA 3QEPA 4YXJA 4FK0A 5J2PA 5F9NA 3ASMA 4F50A 1A5VA 3JPNA 3BQ0A 4CJKA 1SL1A 5IIOA 2IMWP 1S1XA 4RT2A 2XY7A 4DSKA 2X6NA 3KIOA 3RMCA 5KG4A 4DTXA 1IH7A 4ECYA 5KGXA 4IFVA 3O3GA 5HBMA 3OYEA 1BHLA 5KRSA 4ELVA 4KLLA 3AU6A 2XC9A 5DQHA 2ISOA 3RJHA 2KN7A 3RJFA 1ZQFA 3OS2A 4PQUA 2OPQA 3EW9A 4M42A 4DF4A 3Q8QB 4DWIA 3SI6A 5SZTA 4CJPA 4FJIA 1B43A 5JUMA 5BPCA 4CJFA 4I2FA 3I0SA 2MAXA 1T03A 3NF7A 4CGJA 1S1TA 9ICWA 1QSSA 1I3AA 3JYTA 2H5XA 1QE1A 3C2LA 4FBTA 4KTWA 1N48A 5CB1A 4CEFA 3O4NA 9ICTA 4OGCA 3PO4A 4CJ4A 4YP3A 2X78A 4IQWA 4NM1A 4O44A 2KFZA 4Z4CA 3HP6A 4MFBA 1SUQA 4FJ8A 2F1JA 2LSNA 1CZ9A 5KFWA 9ICVA 4DOAA 3SQ4A 1H38A 5DQIA 1C0MA 4JWMA 4ECWA 1CXQA 4QWBA 4KTQA 4UAYA 3Q8KA 4R66A 4J9LA 1ZBUA 5HNKA 1S6QA 2HVIA 4JV2A 1LAWA 4GXJA 5CHGA 2YV0X 3KD1E 4AHCA 4O9MA 4ED7A 2HNDA 4Z6CA 3C5GA 4CJRA 3RRGA 4OLBA 3C2MA 4IRDA 2D0BA 3DLHA 4FW2A 2ZJ5A 4DQQA 2E6LA 4PGYA 3HYFA 2G8KA 1L3VA 2FBXA 2JEFA 1CUKA 3K4GA 4IG3A 4K4GA 2FBTA 2BE2A 4OGEA 4DS5A 4RW8A 1CXUA 5KFQA 3OYKA 3VA0A 3ZCMA 4E1MA 4PH5A 2GV9A 2HHQA 1BQNA 2QKBA 3B6OA 3FFIA 1JLQA 5KG7A 2P66A 5EOZA 4DMNA 2VA8A 3SUNA 1BIZA 2G8VA 4MFAA 2DFEA 1RT5A 4DG1A 4B3OA 3OYMA 2JLEA 4J9PA 3PV8A 5KG1A 1XU4A 2VWJA 3C2KA 3H40A 1C1BA 4RU9A 4UB3A 4Z6FA 3RMAA 4OPKA 4RQ1A 1MQ3A 9ICAA 3LZIA 4KLMA 3OHAA 9ICGA 4PHAA 5KT6A 3VQBA 4GLXA 1JLBA 4KN4A 4DTJA 4Z4FA 3TAGA 9ICPA 4CGHA 3ZSXA 4KB0A 1HYVA 3NFAA 3RB0A 3HM9A 4FJGA 4CHZA 3GILA 9ICJA 4F3TA 3ZSOA 1XS9D 3SCXA 4FLXA 1S10A 4DFKA 3PR5B 1KSPA 3AA2A 3PMNA 4DTRA 2NRVA 3UQ0A 4PGXA 2DY4A 1L3UA 2X74A 4J2AA 4IKFA 1SKWA 4AHVA 3I0RA 4R63A 4I2AA 3KHHA 1YTAA 3WNFA 2KW4A 1XWLA 5KFLA 1RNHA 5SWMA 3IHQB 5J2CA 2W9CA 5J29A 4TUPA 4IRCA 3AVMA 3OYIA 5KFHA 4C8LA 1IXRA 3VQDA 3LK9A 2V4RA 4KN7A 4I2DA 2OWOA 3OYFA 5IIIA 1EX4A 1RXVA 3GIMA 3KD5E 4DTNA 4QWEA 4FLZA 5DBCA 3ZSVA 5KFJA 4E7LA 2XY5A 4M9JA 3AVBA 4RQ5A 8ICVA 8ICJA 1XO1A 2W9AA 4M0AA 5BOLA 7ICKA 4O3QA 5C5JA 2HHVA 5HLFA 1Z25A 1ZQIA 1U47A 4F4KA 3ZDDA 4N41A 3MECA 5KFYA 4TQRA 1WSHA 3AVLA 3BQTA 1ZQHA 5DBBA 1U48A 2PFNA 3L2VA 4CHYA 4ED0A 4CHNA 3RB3A 2GWSA 3AA4A 3V9ZA 4ZTFA 2NRWA 1WAJA 2JZBB 4YQWA 4F4ZA 3T19A 4HCBA 3T5KA 1K1SA 2P1JA 3DRRA 3ZSZA 1CEZA 1VSKA 4CE9A 5J2IA 2HB5A 3OYGA 4KI6A 1RBSA 3AVJA 3V6KA 3QIOA 4CEBA 3RAQA 1MSWD 9ICCA 5L1LA 1ITGA 1RT2A 1RBTA 9ICHA 4Y1CA 4L8RB 5HRRA 2G8IA 3KLEA 5KFSA 3AUOA 3T3FA 2AJQA 2IC3A 4QZDA 1S1UA 4AHTA 4QZGA 4O0IA 4ECRA 3NH2A 3MR6A 3SJJA 3V1OA 3AO1A 3O3HA 3QO9A 1IO2A 3BDPA 3OHBA 4QZEA 3V7LA 3PW7A 4FZZA 4Z0UA 4I2GA 4MQ3A 4DQSA 1REVA 4DS4A 4BXOB 1ZQKA 2BCUA 3KJVA 5J0OA 1Z26A 3ETLA 2XY8A 1DOQA 1L3TA 3AA3A 1RYSA 2ZUDA 3UXNA 4RQ7A 4LZGA 3CFOA 4W5QA 4UBCA 4UAZA 3ZSWA 2P51A 4MF2A 4FZXC 3PVXA 4RW6A 4UBBA 4OKJA 3OYHA 2VWKA 5JS2A 2V4QA 5KT7A 1UWBA 5D4BA 1ZYQA 1RXWA 4KLGA 4CF1A 5KFKA 2NUBA 4P4PA 3CM5A 5J0XA 3GQCA 4EBDA 2C28A 3HP9A 4KHQA 5KFGA 5DQGA 4NYNA 3P1GA 3TWHA 4OKEA 7ICOA 4BE1A 4ECUA 1BI4A 2OPRA 2XO7A 5CR0A 4YCXA 1X9WA 2GUIA 3RR7A 1FKPA 4IDKA 4E7JA 2W9BB 1JL2A 2ZUCA 4DTPA 3HT3A 3KHRA 1X9MA 2PY5A 1LB2B 1U45A 2KZZA 1Q8IA 4RNOA 1XSPA 4JS4A 4BWMA 4QZ8A 3HW8A 3LALA 4PY5A 2HHTA 3L8BA 2IGIA 1RTJA 3PW4A 1RBRA 2MUTB 1UT5A 2PI4A 2B5JA 2IBKA 8ICKA 2ATLA 1DTTA 5KFPA 3K5NA 3SUPA 4IBNA 3RH6A 7ICTA 1NK6A 2HNYA 3OSPA 2F1IA 1TKZA 4J2EA 4YVZA 1C6VA 3N97B 3BQ1A 7ICHA 1BPEA 1KLMA 3DLRA 3KLIA 2WONA 5KFFA 4JLHA 1QLNA 4CK3A 3ALYA 3CM6A 1KDHA 3OYJA 3HVRA 4KLFA 1ZQYA 2W8LA 2G8HA 5IIJA 4DL5A 4O5BA 2JEGA 2IA6A 2RDJA 7ICQA 8ICEA 2XRIA 2Z1GA 3C6UA 1KLNA 3EPIA 1HQEA 3KHGA 9ICLA 1RDDA 3C23A 4P2HA 4NLNA 1VSJA
chains in the Genus database with same CATH superfamily
3MGJA 4C0HA 4C1NK 4DPOA 1MC8A 3DLGA 3DDKA 2JZBA 3CCMN 4DV7K 1LW2A 1VLYA 3H8MA 1U6ZA 2R7WA 3WIUA 3HF5A 3VVUA 3PW5A 2RIJA 2WAQC 1XIQA 1CLQA 4ICAA 3ORYA 1SUQB 4IH5A 2LCWA 2PXIA 1NBEB 4KH1B 1QAYA 1MLAA 2BANB 1D1UA 4KLHA 2QWNA 1HUZA 2QLFB 1RDRA 4NLTA 1HRHA 2VDIA 4IDKB 4V1Ak 1C0UA 4KPYA 3ZX0A 1DBDA 1LW0A 3N9UC 5J0WA 4ZIWA 1I94K 3GONA 2GC8A 3DI6B 4DUZJ 2KB2A 2ZXIA 2RS2A 1RYRA 1QSYA 4RQ0A 1TL5A 5D49A 2QFJA 4NLUA 2CQ4A 5KT2A 4BS2A 4WFNQ 4XH4A 3JSMA 1VSDA 1HNVA 4NMLA 5BR8J 2BKOA 4DTSA 1NNLA 4KHWA 1TP7A 3DLEA 4KGXB 4G1IA 1HPZA 2MZ1A 5FRMA 3GJRB 3I55N 3AO4A 4CJQA 1IBCB 5J2KA 3SQ2A 2UV8G 3O1WA 5GAGP 4JI8K 3QEVA 4BQLA 1SXEA 1VQMN 4I6AA 5LJ3Y 1T8EA 1J53A 4UASA 2HHHF 2EZXA 2XG8A 3P96A 4ZVUB 4I9QA 2KG0A 2RQ4A 1ATSA 1WF1A 3SUQA 5E7OB 1V85A 4JNEA 5F8MA 4OI3A 4LVOP 2BJEA 3SBMA 8ATCB 4JI3K 5CP2A 2VGNA 1S9EA 4QCLA 4KSEB 4PL1A 3MBYA 3C16A 3DEEA 2W9BA 1QE1B 1LXNA 3DM2A 4WE1B 2R7YA 4HUGA 3H20A 1B99A 2GGPB 3T1YJ 1RB0A 2PMHA 3G9CA 4A47A 2DBYA 1R43A 4CF0A 3I32A 5AI0A 4YMMA 3N4MB 2KHVA 4ILRA 4PEOA 5L1MA 2VQFK 1YBAA 1DXSA 1RGVA 3MEEA 2HQIA 3AB2B 1QDUB 2GAGC 4O5FA 2W41A 4IQUA 3AO5A 2ROEA 3MXHP 3MEKA 2HQFA 3IRXB 5AKYA 4CO0A 2B8QA 4O3RA 3T9NA 3AO2A 1HKCA 2VZ9A 3Q2SC 1DGSA 2CQ1A 4X65J 5DKWA 1S1VA 3O9TA 5HHIA 3H3OB 3ZXWA 1TYQB 1FXDA 4FPBA 3C29A 3FSIA 2GO7A 5HP1A 4A8XA 3OA9A 2HNZB 3HO1A 5AQJA 4XEIA 5HRPA 4KY3A 2O8EB 4EENA 2EKYA 2DFFA 2CPRA 3LWMA 1X7VA 4O3NA 2RN2A 4F67A 4K25A 4WP3A 3US5A 2QWPA 3NF8A 2G06A 1VRUA 3N7SC 5LSRA 3UIQA 3GR0A 3CD5A 4KLOA 4JI5K 4DV2F 5J2DA 4IQXA 1YJNN 3CCTA 2E1ZA 1S0VA 3MK6A 2QLWA 2VG6A 2EFVA 1IKWA 4P73A 3MUTP 2IOCA 3AOAA 3A5NC 2XEXA 2DXFA 4WIQA 6FD1A 4KHYA 3QWUA 4Z37A 3OTDA 5LXYA 3KLHA 4L74A 3QAUA 4OYIA 2YPZA 4QZ9A 3T6JA 1FJGJ 2UVVA 1BCOA 3NASA 1NOZA 2QE5A 3SMPA 2XICA 3B54A 2Q6BA 3MEDB 3OTQA 3B0XA 1CJUB 2HBKA 3VQ4A 3NGYA 4PWDA 1HNXJ 3EYZA 1IKVA 4P0PB 4BR2A 2Y9TA 1IKWB 4WBFA 3OYDA 3IBWA 1WYGA 3D5MA 1N56A 1X31C 2P9NB 4CEEA 4MK9A 3KYLA 2EK1A 2XI9A 2BRKA 3A3OB 3GSDA 1ECWA 2A6OA 2JZ5A 5G0RB 1IKXA 2EI5A 1PYOB 2E5LF 3B8HA 3RR8A 4QWDA 4TYBA 2VQFJ 1HUXA 1D8ZA 3HRGA 1EQ0A 2HNZA 4CH0S 2HQCA 4M3RA 4FYDA 3UO0A 3OJUA 3TZWA 2YNIA 3NXZA 4XO0A 4GV3A 2PYLA 1D0EA 2V94A 1HHSA 3SQOP 4CRJA 3MM7A 4M6WA 2BQRA 4I6MA 3ZDAA 5CJ7A 4TURA 2ZOGA 5B8HA 1VRUB 4YY3K 4H0XB 4CEZA 4J9VA 2C1EB 3R5GA 3TSQA 4BRKA 5DDQC 2HBRB 2FGOA 3DRPB 4Q44A 1WNSA 2KHQA 4JUZA 3D2SA 3WNGA 4RQ3A 3SSRA 3MDFA 4C2MA 4QS7A 3TW0A 1XHZA 4JRPA 2VA3A 4AQYJ 2LLZA 3CNHA 5J2PB 1HL6A 2AYGA 3M8ZA 4UB1A 3OS0A 4B9QA 1HQ2A 4B9TA 2QL5B 2FDNA 2OD4A 3ZTSA 1GAOA 1WC0A 4A8YA 1Q81T 4CP5A 9ICRA 3I4PA 4H4OA 4RW7A 3F9KA 4PL7A 4IJNA 4KH6A 2O66A 4DR1J 4ZK7M 2M88A 4LF5F 4KGZB 1YIJN 4IQVA 4MKYA 2QC3A 4P0PA 2UXDJ 2K7KA 3FQLA 2E9RX 4FYWB 4LRDA 3UXPA 2LYHA 2DO4A 4DV4J 2JHEA 1X60A 5KFVA 1RCOB 2H4YB 5CCMA 1RDAA 4FJHA 4CJSA 2CWKA 3ZX2A 4ZIVA 5BYSA 3CCRN 4ES3A 7FD1A 4PPZA 4CI0B 3G8TA 1UZHA 2EWHA 2I6XA 3VOVA 1BDGA 1JXEA 1KWMA 4FWSA 3LWLA 8ICIA 2ZE2A 2LYBA 4JYAK 5K20B 4ZLPA 3PJWA 2R8HA 3CMES 3K5OA 4DFJA 1O51A 3K5LA 5L1JA 2Z1JA 2LQBA 4OHWA 3G71S 2ZUBA 1RADB 1TKTA 1NK9A 1RAHB 1ZQMA 4P4MA 4OI1A 2OANA 4QS8A 1FD2A 1RG6A 3B4DA 5D4LA 1WUUA 2OPPA 2YKNB 2UUBF 2JJ4D 5LXRA 3LP1A 4NV0A 2GX9A 4NLRA 3CCMS 3G6YA 3VAHA 2O4IA 4Z94A 3OW2M 5KNIA 2H3GX 1M5KC 3HPGA 4F36A 3D68A 4FZMA 3MM5A 4WP9A 1W97L 3NH1A 3MD1A 4KRWA 3O4QA 4N8OA 1SL2A 4HUEA 1ZD3A 4JV0A 1Z2LA 5C2DA 5AI5A 5J2GA 1FD8A 4DR1F 1KC8O 2DHAA 2YPYA 1HNVB 1RYUA 2KJVA 2UXDF 4PPXA 4CD1A 5AM5A 2O5DA 3QEIA 2EZYA 3WKEA 3NHGA 4DQPA 5A76A 2ZITA 4XTTA 5KFOA 4IXCA 1UEUA 5HMLA 4OCZA 4M9HA 1FX2A 4ZP7A 2YKQA 5LMUJ 2F4VK 3F9MA 3P45B 5ALTA 5BRFA 3D2EA 3E8OA 3D54A 5SUHA 4X4QA 1M5HA 2HVHA 4OI6A 2HZCA 5J0PA 3T1HF 3AA5X 3MR3A 2R2TA 3DWLA 1GNKA 3KLIB 3C16B 3HHLD 1TV6A 3QEWA 1ZA2B 1WACA 4DV2K 2X3DA 1TL3A 2QO3A 1QQ7A 3R6MA 4FM2A 3AJ2A 1FNXH 1RA6A 3W3SA 1ZQJA 4BXOA 1N5SA 5DRKA 1BXNA 3MXIA 3C6UB 4UB4A 1SV0C 1Y7PA 3DN9A 1OS5A 1VQLS 3CJAA 2FHJD 3KDOA 1UCNA 1W7AA 2LEAA 1R0AB 1FDNA 3J7ZO 1R59O 2HNDB 1UKUA 5HROB 4C3KA 4RR5A 2NXJA 3UNGC 3X3UA 3POTB 1ELOA 4AL7A 2OGUA 5JVGL 2MEWA 3KKSA 4B3RF 4LF4J 2NRTA 2KVCA 2LA4A 2G8FA 2KOBA 1RCXB 2HMXA 4RUCA 3QB0A 4PHPA 2AU0A 5A0LA 4MF8A 1F3FA 2ISPA 1ZQGA 1WSIA 4O3SA 1WKJA 4GKJF 4YG2A 4EP5A 3TFSA 1WOOA 2ZC3A 4LJXA 4FPRA 1RBOB 4C0ZA 3DI6A 1S8OA 4WU3A 3TVKA 1FF2A 1MW7A 1F44A 1UVJA 4U96A 1X1PA 5GMKa 4J03A 3HHLA 2DUYA 4YR2A 3S41A 3NGSA 3GFKB 3SQGA 3UPQA 2CNNB 1BU6O 4H4MA 3M9MB 3CPWM 4CF9A 4FXDA 2FBVA 4ZHRA 1S5JA 5C24A 1TUGB 4DN0A 1LWCA 2VPYB 2ZH5A 4JI1K 4H5RA 1GTEA 2E5IA 3WC0A 4FZYA 4YFUA 1LKYA 4PABA 1X4EA 2ZM6J 4ZPVR 2B51A 5A2QU 1GLBG 1HR0K 4JV5F 3VA3A 3WK7A 1U9LA 2G13A 3H1QA 2EX3A 2D4WA 2A1RA 3MR5A 3TAEA 3VF6A 3AODA 2N3OA 4FJ7A 2E8OA 3CVKA 3GFHA 5AI6A 1WSEA 2RU3A 1RPLA 3UD3P 2DGTA 2IYIA 1U1OA 3QE9Y 2FYXA 2DHHA 4DSFA 4K8ZA 1WDTA 5KTQA 4IL6U 2LXFA 2AWZA 2AJFE 4DL6A 3MEGA 1FHTA 4NLSA 2GO9A 4ZVPB 5CZ1A 1AROP 1WEZA 2NSCA 3LP2A 3ENHA 3MPWA 3H5XA 2E5HA 8ICQA 2DITA 3FYHA 3NS6A 2HS3A 1I39A 3CJKB 3IDWA 1TL1A 3ZNJ1 3A13A 8ICYA 4ILGB 1JLEA 2RH3A 1EX8A 1S48A 4RCHA 2HRUA 4CF2A 2X6SA 1C1CA 2R8KA 1IJFB 3OYBA 3D9BA 4EO6A 3TTCA 4CHQA 2ETJA 5L1KA 5KFDA 4BDYA 2UVRA 4U67L 2AD9A 2HQGA 3C19A 4FJNA 5HN0A 3HSCA 4JK1A 3PO5A 2QL7B 1NJWA 4E19A 1MG7A 1BQXA 1ZA1B 2QMWA 1ZQAA 1Y00A 4E89A 2CQ3A 2OEKA 1FO4A 3EVMA 3IP0A 3AVCA 2K4EA 3DC2A 3MMCA 4GW6A 4ZVQB 4RW7B 4URQU 2B7CB 2HHPA 5HRSA 3DOKB 1DY3A 3BGLA 2EFQA 2DNQA 2H65B 2JNJA 3MFHA 3KLVA 1PBUA 2FJAB 3IM9A 1GX6A 3PM9A 2IOFK 4CCHA 1V5IB 5J2NB 2BR0A 3FR0A 4P9SA 3QXGA 3GCWP 3IDHA 5HMMA 4DCPB 4DG1B 3ZT0A 4N47A 1S9GA 3IG8A 4K8XA 3SNNA 4DR7F 3U9DA 2PSZA 4LBIA 3GU3A 2NO4A 1EQMA 1LOUA 3OHRA 2AEJA 3QSIA 4OYMA 2B7BB 2COLA 5M1OA 1SZHA 5FJ4A 4KX3A 1FJ7A 4M3TA 1QVGM 5FRNA 3H5SA 1Q8BA 3KG0A 4NASA 4BQZA 4RT3A 3IR6B 4JI7K 1OW5A 5L1IA 1ZQDA 1PZNA 4NZ0A 2W04A 1NPPA 3L95X 4TY8B 4Y2KA 4DQIA 1QHTA 4CGDA 3HSDA 3QLHB 1URNA 2P9LA 2CZ9A 4A8SA 4OZ5A 5T41A 2OPPB 5L46A 1COOA 2XSFA 2ASPA 3UXOA 2W7OA 3O5TB 2PFQA 5DGAA 8ICMA 9ICUA 1N52B 3Q83A 4UB8U 2IHR1 1HQUA 1RI7A 3OXFA 2WHOA 1NGAA 1TVAA 5IFMA 4MEYA 2UU9J 2GIQA 1TGOA 2K8AA 2NXCA 4I6MB 3W0LA 3TSPA 2HPUA 9ICFA 4I4BA 5C2CA 4NCGA 1U0HB 2HZVA 3HD2A 2YCHA 4Y2QA 5ALIA 2GLEA 2AKWB 3MDAA 2AQ0A 4RLEA 1XR6A 1J97A 2DEJA 3FUYA 1KTVA 2FVRA 4R5PA 1R6YA 2JLFA 1RT3A 1YF5L 4GMJB 3RFAA 5KG2A 4GKJJ 3R8YA 4PG7A 4WWSA 1D9FA 2O67A 3EUNA 2W42A 1J27A 4I29A 1KFSA 4QIWD 2KH9A 2FC0A 4DV6J 3K89A 1KD1O 2AP6A 1FFWB 4OKKA 3EVOA 1LWEA 3D67A 3BUZB 4J9MA 4F25A 3TR8A 3THWB 2V8PA 3AV9A 2GOLA 4FJLA 5ADXA 2PC6A 1NGBA 4NXZA 3HZEA 2P9KA 4R5PB 5ADXH 4DOCA 1NOYA 4AXJA 1NGIA 2HIYA 5DBAA 4GXIA 4IH6A 1RTIB 4JKCA 2P9IB 4YFKA 1YBTA 4I69A 3T1YF 4U7UK 4JRQA 3CRXA 3P31A 1QJHA 1NGFA 4DV1K 1JLAA 3L2WA 3ID8A 1FKOA 2ZBCA 3IWNC 4CHPA 3JYTB 5DG7A 3GWCA 3ENVA 1O03A 5K8MA 1MWQA 3U4LA 1HQUB 2NZTA 4NLWA 3THWA 4X4SA 3EGVA 3C7NA 1ZQZA 1APSA 1F2GA 2NYHA 4CZIA 2QWQA 2YXLA 2ZOFA 4J9KA 3CETA 1RT7A 1ZXIA 1BPBA 3FBFA 4C3LA 1UEKA 4WZMA 4OZ0A 2DH9A 4JV5K 2BVZA 3AD7C 3K58A 2F96A 4FE3A 4ISEA 4M5GA 4I1TA 3LUYA 2K8GA 1NSKL 2PMZD 1XC9A 8RUCA 3Q8SB 1T44A 1EP4B 4V19X 4P52A 2XHBA 3EM1A 3A3PB 3HXMA 4QQBA 3FJ2A 3IR7B 2A18A 1SZPA 2RU9A 3I0SB 2ZFHA 1VQMS 2FJXA 4IG0A 5AQYA 3TPQA 4FKYA 1KEJA 4R8UA 2B5JB 3NRZA 5BXIA 1RWPB 3IGVA 3BKFA 3L6QA 5J0TA 2AH5A 3KK1A 2AA4A 2E1FA 2Z2MA 4RUAA 3AD8C 1GK8A 2OZSA 3E1YA 2GQ2A 3QO9B 2R9LA 4MIWA 5LSOA 3CNQP 2DPJA 4JI8J 4OVLA 4LVNP 2O4GA 3TARA 3H3NO 5C10A 1IVZA 1WUDA 1WC6A 3D1OA 1N33J 1BPZA 3H2LA 1S3XA 1B4FA 1XSLA 1YRTA 2FVQA 2V8VA 4GVBA 1YGYA 4JI6F 1N5QA 5AQNA 3R6GB 3PX4A 4KO0B 2YWWA 1UVNA 2BMBA 2K7JA 4FF1A 3C7NB 1SH2A 2W01A 5F9LA 1NJXA 8ICAA 3M6XA 2KE7A 1QSLA 3OBWA 4R0JA 1FRXA 5CYJA 1FJGF 4B9UA 2BUNA 4BC7A 3LDNA 5J2FA 4IH7A 1TK5A 2I2YA 3A8EA 4X64F 1YITN 1UMJA 3PX0A 4UOGA 2XY6A 5D0HA 2B3TB 2DNZA 4UQGA 4GRSA 4DR4J 3ONQA 3D6TB 3CCLS 2HWIA 1J5OB 2YB4A 4C8NA 4HR2A 3BEGB 1WEYA 2J7WA 4CEAA 2FC9A 4TSXA 2ZNYA 3VQTA 3QIPB 4Y00A 2KDOA 4DU4A 1GMWD 3MAQA 2Y0SC 4PA1A 3SV4A 3M8PB 3O44A 1UETA 3H4BA 3OVNA 1YJWN 3BQ7A 2R2SA 3TTFA 4RWTA 1NU4A 5ALXA 4XQ8A 4USWA 3T79A 2NUUG 1CRXA 4A2AA 3AXMA 3O0FA 1T11A 3H0RB 1MU2B 3THYB 1R8PA 3K5PA 1S0OA 1NJIO 2OPRB 3VWSA 4FNHA 3HHEA 2QK9A 4ZKAA 3B4MA 5F8NA 4A8OA 3H5YA 3CMQA 3SPZA 4BR0A 3R27A 4EX7A 2G09A 4TUQA 1ZQCA 2D0AA 3W5ZA 3SQIA 3ET6B 4BRFA 2DR9A 1X5PA 4K59A 2PMZF 2YKAA 1QUPA 2OEMA 2DTUA 4FWLA 4F5OA 3H6EA 4Y3CA 3NNAA 1IKVB 2R18A 4J9SA 1FE4A 1RT1A 1B64A 3L3CA 3KG1A 4BRNA 3Q0AA 2B8PA 4KO0A 3I96A 2H3ZA 4C80A 2VJVA 1R8AA 3ZZUA 3Q8PB 2KKZA 4ETZA 5HROA 3BS5B 2V2KA 3CG7A 2EBGA 2LYAA 8ICBA 1SJ3P 2HLUA 4HHUA 5AM0A 1TAUA 1JCEA 1WSJA 2PBDA 2QM1A 2M70A 3CMAS 4NLVA 3BZQA 5C7PA 3RGIA 3TP2A 5TZVA 1N6QA 3C2PA 2YJFA 4JI3J 1RTHA 4F4AA 5MLCQ 4AH9A 1FE0A 3BDEA 5IIMA 1CVJA 3G2XA 7ICRA 1BNPA 3V6JA 1VHXA 4LF8K 2W24A 1KVCA 2IA0A 3IO1A 1VQNN 4NY8A 4MFFA 5F3XB 3NDKA 4HLBA 3J7YU 4KLEA 2ZVSA 3UE5A 2FLPA 3R3LA 4I0WA 3HL8A 1IKYB 3GZFA 3M9NB 3CCVN 4UW2A 3AVKA 3EMTA 2FPLA 2OUGA 1ZOTA 4CGFA 2LU2A 2OYQA 1GH8A 4WIIA 4OZNA 3IA0A 4X4TA 3BN4A 3QEPA 1EWRA 2HSTA 3KLEB 1Y64A 5F9NA 3D2QA 1X4CA 2J9EA 3PCOB 2XSJB 1WC3A 5IIOA 2CGJA 2IMWP 2WHEA 2GWJA 4RT2A 2NO5A 4DSKA 4O0NA 2X6NA 3KIOA 2E8MA 2ZIXA 3RMCA 3D2NA 2YY6A 4DTXA 2CNLB 1HIWA 3D0GE 4TXSA 3TYTA 3QMLA 4B3MF 5B0AA 4KE5A 5L38A 1GLDG 3WXMB 3RW6A 2XC9A 1QH9A 2N3LA 5FLXU 4A59A 5AK3A 3RJFA 3ZZTA 5AJ3F 4BRCA 2P5VA 1REGX 3OS2A 4DKWA 4PQUA 2JOQA 4A8EA 1V5VA 4H0YB 4M42A 2ZDPA 5C15A 2QB1A 4CJPA 3CJKA 4ETXA 2CQDA 4YOTA 2R4FA 5F1XA 1KKXA 4I2FA 1VQ5N 4KFBB 4C4WA 3I28A 3ISZA 3EKSA 2MAXA 1D8BA 1T03A 3BV8A 5ADZA 3NF7A 9ICWA 3IAM9 3JYTA 1N5VA 3QT7A 3C2LA 4KTWA 5CB1A 1MA7A 4UW9A 2Y3YA 2B6GA 1AB8A 5CXTA 4DR3J 2F4FA 4OGCA 1UJ5A 3JQJA 3DDIA 2FZCB 4MYTA 1SIJA 3HP6A 1FRIA 1X5SA 1B0VA 1Q78A 4NL9A 2FLOA 3S7RA 3OQ2A 4DV0J 2LSNA 4K4VA 9ICVA 1C0MA 2ZG6A 1FEEA 4QWBA 3IBPA 1RT7B 2RUSA 2E66A 3Q8KA 4CWBA 1ULRA 2YX8A 1V6HA 5HNKA 2VPXB 4NRTA 4P7TA 1HPMA 3LM2A 1JMTA 4U67Q 5CHGA 4CTAB 4JI0K 2ZHAA 3H2VE 2VPWB 3DHXA 3CDUA 3C5GA 4OLBA 3C2MA 3A8IA 2CQCA 3LTOA 4ZP6A 4KGKA 5K4LA 2OSRA 5GVQA 2JEFA 2PGCA 4AD6A 1P9QC 1X4HA 3AMZA 1WI6A 1X9XA 2FBTA 3JTOA 1KDNA 4OGEA 4CBUA 5AXLA 2QIFA 2JVOA 1CXUA 3VA0A 3UR0A 3AFGA 3QGHA 5I42B 2CA9A 1BQNA 3HSZA 2PIIA 2XHCA 4F0HA 3R9LA 4FYYB 1NG9A 4UT4A 4TU7A 3DXKB 4RBUA 5EOZA 2P9PA 3SFUA 1WWVA 2ILYA 5A8KA 4I64A 2OHDA 1XTZA 2DHXA 2G0IA 3TADC 2J0SD 2DGXA 4MT1A 1RT5A 4B3OA 3OYMA 3IR5B 2PD1A 2V8GA 1L8OA 2UUAJ 1F0XA 2QTDA 2KT5A 4M63A 4CI6A 3LGNA 1BE4A 1DFDA 4UB3A 3CMAN 2CZ4A 3RMAA 1JWWA 5IT9U 2NLWA 2Q3PA 4E8UA 2NRHA 3LZIA 3OHAA 5CAAA 2YTUA 1WHYA 4PHAA 4UATA 4GLXA 1JLBA 3CC2N 4Z4FA 3TAGA 3K1RB 3ZSXA 2GJIA 5AZJA 4Y2XA 2GA7A 1ZD4A 2FJBB 4F3TA 2K4IA 1WKLA 3SCXA 4FLXA 2GMJA 4HACB 2DNYA 5HQLA 4NZ7A 3UQ0A 2OTJS 3CF5Q 4PGXA 1L3UA 1SC4B 3OFHA 5ETLA 3EN9A 5AFUH 1X4BA 1HWKA 3OV7A 1SC3B 2XM3A 4AHVA 4WZQA 1A0OB 4I2AA 3KHHA 1YTAA 4A8KA 3WKCA 2IAJB 1CULA 1NSAA 3EGNA 1KNZA 4ZVHA 2FJWA 5EE3A 5J2CA 3AB4B 2G2YA 1BOTO 5AQQA 5AQSA 5AK4A 3ETOA 4S0MA 3HHLB 4FSVA 5KFHA 4FWNA 5AKIA 1YSJA 2QA2A 1F0MA 1S72N 1EX4A 4HACA 4EFHA 1RXVA 3GIMA 2KG5A 2N1RA 4QR0A 3KD5E 2P9IA 2H5JB 4IC9A 2D9PA 4FLZA 5KFJA 3AQEA 3AVBA 1YIJS 3FZFA 8ICVA 4N8NA 8ICJA 1NGCA 4B3SJ 4M0AA 3QU9A 1E6VB 4PJ0U 2CH5A 4NXMK 2XO6A 4F4KA 2M7SA 4N41A 4TQRA 2BZFA 2E1RA 2PFNA 3QU5A 4URGA 3GLJA 2BTFA 2YHXA 4CHNA 1TVRB 1ICEB 3VAIA 2JZBB 3MMJA 4HCBA 5ALJA 1K1SA 2NYVA 2MQOA 4CE9A 1P1LA 5J2IA 3OR1A 3V6KA 1RE1B 3I5CA 3RAQA 4CEBA 1MSWD 5L1LA 2F77X 1RBTA 4Y1CA 4L8RB 3OVSA 2E2QA 1KC8T 4C0OC 2IC3A 1S1UA 4QZGA 3SDEA 3QJJA 2IJFA 3E9LA 4IO9L 2XNQA 1AFIA 2MZTA 4NLOA 4K7QA 2HNYB 1ZTWA 3BDPA 2FF3B 4QZEA 2W2PP 1JJHA 1V3RA 2VFUA 4OPAA 2K60A 4Z0UA 2FIUA 4DCOB 2B4UA 4MQ3A 2E2OA 1REVA 4DS4A 3D7SB 1A9NB 3J80Y 2BCUA 3TR5A 4OX9J 3AQOA 3OL8A 3KJVA 3ETLA 2YVSA 1L3TA 1S79A 4PQAA 3AA3A 2HEKA 3UVJA 1RYSA 3UXNA 3FZKA 2P51A 4MF2A 3GE1A 4UBBA 5AKHA 5JS2A 5KT7A 4H5TA 3I56S 4MJKA 1NZBA 1RXWA 1AT1B 3S1TA 4CF1A 3QFPA 4FNIA 2D41A 2NUBA 1Z19A 3KD3A 5J0XA 4EBDA 3GMGA 2IRXA 3I5BA 5DQGA 2HGMA 3P1GA 3TWHA 2IFXA 4BE1A 2OKQA 2OPRA 3CJ4A 4UF4A 2YTCA 4M5DA 4YCXA 2QKQA 5MAOA 1ESVA 2XS2A 5B0FA 4Y2UA 2DD8S 2W9BB 4NXMJ 2AX1A 3VR1A 4RWWA 3HJEA 3J81j 1KVKA 3TEHB 5M1PA 2ACMA 1X9MA 4DR6K 4C3MA 4DFDA 2G07A 1X4GA 1B3TA 1Q8IA 1PUZA 4FWKA 3KFWX 1W7WA 3N79A 4QZ8A 1FRMA 1NM2A 2NXNA 3TVYA 2FGCA 3L8BA 2WUSA 1UT5A 3OVBA 3VGTA 2WBNA 2IBKA 8ICKA 5EN1A 4LFAF 4TY8A 3ITHB 4IBNA 4LF7K 5A2QO 3RH6A 1XNSA 4RBTA 2IM3A 4WF9L 1VQ6N 2B43A 3BP8A 1MN8A 2HNYA 3OSPA 2F1IA 2OYYA 1YJUA 2A1BA 5A6PA 4UZCA 5BPNA 5HANA 1BPEA 2FY8A 5KFFA 4JLHA 4NL9C 1QLNA 2HSEB 3CM6A 2ZJQQ 2CPJA 1B7YB 5KPTA 3FRYA 1H2UX 2OELA 3O80A 3NY0A 1SWWA 4DV3K 3T6BA 2QYCA 2BJDA 2IA6A 2VV5A 2G1HA 4X64J 2XRIA 3D7EO 5IC4B 1YRUA 1HNIB 4LFBF 1K44A 4BLGA 1RDDA 5IQ6A 1VRQC 2FVCA 1NCLA 4WF9Q 2Q31A 1U0HA 5CR4A 1ZAVA 1XBWA 4DSIA 5G5GA 4CJ3A 2ZIWA 2CUYA 1T4GA 3MWBA 4B8CA 4LF6K 3OL9A 4FO6A 4WFAL 1PC5A 4AUKA 3VQ5A 4CBWA 2DXDA 2Q2RA 4DL0C 3NS1A 1S72S 3OBYA 2FHJA 3SLCA 5I9EB 3M9OB 1VOMA 3L3VA 1RWUA 1KVAA 1PJ5A 3C5FA 5ETTA 2JEIA 1Z2ZA 2DBBA 5HL7Q 2ZM6K 1U26A 1HR0J 3IUCA 2VDHA 3KDNA 2VFTA 4IWVA 4CFCA 3SZ2A 2BYCA 4NXMF 2FSJA 1XMQF 4LSNA 1HBMB 3G6ES 2LM1A 5D4NA 4EX6A 2EVZA 4OJ5A 4YMNA 1JIHA 4ZVEA 1RT4A 4DV5J 2P9KB 3D0PA 4YOUA 5J1EB 2DPIA 2QFIA 2ZIXB 2GBZA 5JS1A 3C21A 3HI9A 1Q86O 3M6KA 1FKOB 4M3XA 4LZDA 8ICRA 4LF5J 2RDDA 4DR2F 2OZMA 3KLGA 1ZM9A 4DX8H 1G15A 1UWBB 2WF7A 4KMUA 3OYCA 4M5JA 2DGVA 4W4MA 2HGLA 2E1AA 1WCLA 4F7VA 1RKJA 3GJSB 5LMUF 3DXMA 3LM9A 1Q5VA 1JJ2R 2BM1A 3T1HK 1H72C 3F2DA 4OHXA 4XPCA 1GOBA 1UOCA 2H5IB 1X6IA 3PRVA 4B08A 3JPTA 4BGAA 2G1DA 2SXLA 1JALA 4QU7A 2ZH3A 1ZQPA 8ICPA 4YB6A 3V9XA 4YOWA 1G4CA 4RPZA 2YHYA 4PZOA 3KNGA 1ZQUA 4DSJA 2YWFA 5B09A 4C8MA 1ZM4A 1YJ7A 3AVGA 4XA5A 4KBIA 3IBFB 3CC7S 3AVHA 2DKXA 1U24A 4X66F 3VAGA 7ICEA 3I8BA 4PXEA 2Y1JA 1C0GA 4DO9A 2IVYA 3O6QA 4JI5J 1K8AT 4PKDB 1VRTA 1Y3KA 4KLDA 1S12A 3H0MB 3KK3A 2PI5A 4LFBJ 4GIBA 4UQTA 3D2EB 3Q8UA 4RL1A 2GHWA 2MA1A 3H5UA 4AHRA 4K43A 4V19J 2V8HA 3LANA 1EXNA 1SVDA 2F4VF 5KGWA 1TKDA 4YHHJ 2BCQA 2F65A 3MMBB 2WW4A 3DLGB 4C4TA 1L5UA 3BQ2A 4IR9A 1HW8A 1YWXA 3CCWA 3JXOA 3TUJC 4UUWA 4M3UA 1D09B 1RBVA 1A76A 4AYBF 3MZIA 4B9LA 2FF6A 3OL7A 3SIPB 3KKRA 1WG8A 4C1NI 3P4IA 3T5HA 4PG5A 4ZP8A 2ZJAA 4YN3B 5FPEA 4PCQA 2VB6A 2KXFA 2UYTA 3OUYA 2UXBF 4O3OA 3VALA 4F91B 1UWAA 5F3ZA 1NK4A 3P5BP 4DZDA 2VIXA 1VMBA 2GEMA 4E7KA 3GV5B 1QQOA 2LBOA 1EAYC 1FA0A 2VPZB 4P4OA 2RRNA 1WTFA 1TL7A 3CHWA 4DUZF 1Q3UA 2CGKA 2HGNA 4RQMA 1U49A 2YWGA 4V19S 4QIFA 7ICSA 2NPFA 1JI7A 2H5EA 3V4IA 2Z8QA 1RDBA 1IBLK 2RKIA 2XMUA 5HR7A 4OYZA 2DYAA 2VC1A 3VQ8A 3CSKA 1SWVA 1FIQA 7ICNA 4DV3F 2YKNA 1FI4A 4P10A 4I2IA 4HH1A 1JRPA 4X66J 1B70B 1FKPB 4LFCF 5AE1A 4R25A 2HHUA 2E3TA 4M9GA 3T9ZA 1S1UB 2YKMB 2HMIB 1NGJA 4QZIA 3QNWB 1RAAB 2KRBA 1ZOLA 2DHGA 2N7YA 1L3KA 1IR2A 3MUMP 4FK2A 4DV7F 2VICA 4JI6J 1TMJA 4H0TB 3L4PA 3Q8RB 2HFVA 2OJ3A 4PKIA 2XLIA 4GKJK 5F0XA 1TL4A 1NKEA 3RJJA 4QZAA 1RM6C 4HYKA 2VFSA 3ZTOA 1MQ2A 3C6HA 1C1AA 2ITGA 3I9V9 3ISNC 4P74A 3RAXA 5AFUA 1VFJA 2GFFA 2ZBRA 4NA3A 2HOIA 4Q5VA 1GXTA 4O4GB 2DXEA 1XERA 2P9UB 2FD2A 1K1QA 3M5RA 4EMDA 1ZQWA 1QTNB 4TKTA 3DYAB 1KN6A 1F5SA 1T6CA 5EE1A 1RWKB 1AA1B 4F0MA 3ZSYA 3AH6A 2B6AA 2JC1A 2CJYB 4FLUA 4Y2VA 1MWKA 3AT1B 2KKHA 2QA4G 1TUYA 4M45A 2C2EA 3C14B 3R7BB 3FCHA 1ZBSA 2W4PA 3IP4B 3NAEA 4RW4A 1XMOF 3AVIA 1NMEB 5KT3A 4CECA 2YN4A 1SI9A 1A6SA 4FDFA 3AOCA 2EAOA 3H0PA 4CF4A 4L3QA 1QQCA 3CCEN 2UXBJ 3VQ9A 4DR5K 1YJWS 4OPHA 2YKMA 2ZEJA 4UAVA 1ZPWX 4KKOA 3M2RB 5J0QA 2WBRA 4B02A 1TVRA 1RLDA 1P7DA 1N5TA 3F0NA 4NA1A 3KKAA 2MZQA 2QWRA 3QERA 4NEZA 1B92A 4WYBA 5HBMB 1OJ4A 1SJ4P 3RWUA 4N77A 2ZD1A 2F76X 4OD0A 2FHOB 2ZJRL 4ED8A 4WJ3B 2EQYA 2V8DA 2HS4A 3MN7A 5M1QA 4N56A 1H3DA 5ALVA 5AQTA 3MMAB 9ICNA 4USTA 4BE0A 3TX0A 8ICCA 1H98A 4U7BA 4XH1A 4M47A 2C2DA 2V69A 3M4XA 2BGGA 5LMNK 2C2KB 5EOYA 1C2PA 3R1HA 7AT1B 3UNYA 3FM9A 3THYA 4B9VA 2KHOA 4HHHA 5DM7Q 1C20A 1VISA 5IQQA 1FRKA 1BWVA 4DR5J 5G0RA 1T3NA 2F1HA 2GIFA 2B56A 2DFLA 4PG4A 3N4PA 4I9LA 1GLJO 3L2QA 3RU0A 3DM2B 4WE1A 4B17A 4QOTA 3CF5L 2ZWHA 7ICGA 3OFGA 3O08A 5IT9O 4GV9A 2GGPA 2F63A 1NLVA 5DG8A 1N34K 4K4SA 5AIAA 4FJJA 3UR3C 3L2RA 4CH1A 3UCUP 3CJ3A 4E7IA 2GHPA 4DV5F 4QZVB 2Q43A 4CJWA 1LCUA 1SQEA 2CJBA 2NCKL 4KTZA 3LAMA 2WAQD 1JX4A 2BPFA 5IT0A 3CIMA 3DRXA 4EEKA 3RB4A 2BQ3A 3QLHA 3THTA 1ZQNA 3CCSS 1KHVA 4RW8B 3F73A 2ERRA 3BS5A 3W5YA 2H54B 2VODA 3N4WA 2FLNA 1S0MA 1MN7A 3FBBA 3WEEA 2MQPA 3M8WA 3DXMB 4B6JA 4U9RA 2DRBA 1BPDA 2HBLA 4PWWA 4A8FA 2CJQA 3SAGA 1S99A 2YBVA 5DG9A 1N33K 3VZIA 1Q0NA 4H4OB 1FFSB 1ZTTA 2AXTU 1KR4A 3HT0A 4DLGA 3D3CJ 4FLVA 5DGBA 2AGPA 1C7YA 4IOCQ 4XDDA 4KI4A 2IDOA 2BCSA 4RQ4A 1FXXA 4QYZK 5HMXA 2DGOA 5CWRA 3ZTPA 4D3HA 2E5LK 5AHXA 4P0QA 2P6UA 1VHFA 5K8PA 2ZH7A 1S5ZA 1MDUB 2W7AA 1IKYA 2RPIA 3UQ2A 3GPAA 5JMNA 4M5DB 4LF1A 1NB7A 2PA3A 4DV1F 1UJ6A 4IRKA 3O5BA 4YB7A 4IO8A 3ID6A 3PX6A 1R0CB 4IOXA 2IS3A 2GX8A 1ZPVA 3UD4P 2P9SA 3C94A 1VQ5S 1MWYA 3HVAA 4DR4F 2YMMA 1H74A 5DM6L 4DV0F 4C4RA 2BJ9A 3MMBA 9ICEA 5J2NA 4DFPA 3MAHA 5AQHA 1FJGK 2EG2A 4FCYA 4I2PA 4QZBA 4E2FB 4HCCA 2BPGA 4LF2A 1IKXB 1TK8A 4DU3A 2C42A 3D6JA 3FC4A 4RPFA 4F5QA 1XMOK 4RBVA 2QB0A 3TWZA 1BGXT 2RQ5A 2QLJB 2R7OA 1JK9B 1L3SA 1IQTA 1RWMB 3CCQS 3SUOA 3VHQA 3MWPA 3MCSA 1A7GE 5B7WA 2D8CA 1K73O 2JX2A 1JB0C 5D78A 2XMTA 2BKPA 4P72A 2UUAF 4M04A 2MQNA 4WKYA 5BR8K 5EX3A 2GO8A 3N28A 2A3JA 4HUFA 3G6XA 3M3ZA 4KLIA 1TFRA 3ZZOA 1PVQA 4TU9A 3ONNA 2KI2A 3C95A 3L5KA 2KIVA 3B6BA 1FNOA 4X2BA 1YHQN 4HDHA 2PFDA 2ZHBA 2YNGB 1OKJA 3UDLA 4Y2IA 2JWLA 3W2VB 2D74B 2AJ4A 5LL6Z 3BF3A 3HKZF 3V6DB 1FDDA 4CEQA 2OO4A 2RNEA 3KOAA 4XRHA 2DFHA 3OTOK 2I7NA 3CC7N 1JLGA 1NRKA 4Z4IA 5AM2A 5KG6A 3N5FA 5EX5A 3ATUA 1RT2B 5DDOC 4OO1J 5KFCA 4J9NA 1XNQF 2HWTA 1V97A 3U02A 3T5LA 4XIUA 1GT8A 3OYNA 4TLQA 4NRUA 5J2QA 4EI2A 5JRTA 1IV8A 3NP5A 4DPWA 2QARB 1EWQA 2UUBK 4O3PA 4NLCA 4ECTA 1T3VA 2NSBA 5CHCB 2DNRA 5H9FJ 1LWFA 1ZBHA 1SJRA 1K0VA 5LL6d 1HJPA 2POKA 4ZPWR 5BYRA 3U7JA 2F40A 4OYAA 1JLCB 2FJDB 2DJWA 4F26A 4B3RJ 1NKBA 4CIOA 4ZJOA 2HVEA 3DRSB 2XVTA 1IUJA 3GZ7A 4IFEA 3NVKA 4B3SF 4FJ5A 3FE1A 3CQ8A 1N54B 1VR6A 4QIEA 3VGMA 1UVMA 2GELA 3VF0B 4CT8A 4A4JA 1WORA 2KKPA 2JRSA 3H08A 2VKQA 2BKNA 4CGIA 3I33A 3E2EA 3T5JA 2I9GA 1ZETA 5ALLA 1WWUA 4IEIA 5AI9A 3NEKA 1BQMA 3G6EN 3O3LA 1ZC6A 1U25A 3D2FB 1RWVB 1JKHA 3NGKA 3SCIE 1KEKA 3GIJA 3MECB 5KFIA 2G5IB 1S6OA 3LP1B 4Q2MA 2DKOB 2I0XA 3EEQA 1NB2A 4GVMA 2ATQA 1R3NA 4K5RA 2NS1B 1IM6A 3F5TA 4MDBA 1VRTB 2HS0A 1DLOA 1TL7B 2JLGA 3NGIA 1ZQSA 4EYHB 5G5HA 4CRXA 1O6XA 3VEVA 1Z00B 4RNFA 3EZWA 4BDPA 5F0UA 2JVRA 2PMZC 1O08A 3PYEA 2YWEA 3ZEUB 2I1QA 4X4VA 1K73T 4RNHA 1WC4A 3UDVA 2Q6CA 1SH0A 1NJIT 3V9WA 1V38A 3B9JA 4AHUA 3EICA 2F7TA 3C6TB 4FVMA 4E0DA 3LOUA 5GMEA 5ALNA 4N76A 1DQAA 4B3MK 4HTLA 2DWQA 3IWXA 4DUYF 3ADAC 1IBMK 4JD2B 4F3MA 3THVA 3TKAA 3PRBA 1Q9YA 5AJ3K 1L6NA 5AKZA 4OLPA 3SYZA 1T3OA 1Z00A 4FYVB 4PR6A 5I4MA 5ALQA 3AHPA 1S77D 4UOFA 2P5GA 3WNEA 1PYTA 5H9FK 4BRDA 2DIVA 3UKRA 3L7PA 4ZDNA 4CJUA 1FT8A 4CEDA 1OY9A 1U1LA 2GW8A 4NLKA 1VS3A 3OVAA 2D0PA 3WK9A 5F2RA 1VSMA 4CE6A 3BZCA 3GV7B 2HVDA 4OLAA 3IAYA 1R8CA 1NK8A 3A1YG 2Z7JA 3RMDA 1T05B 5F41A 2KJWA 3NGUA 3G10A 2IHMA 4F72A 3ENWA 3F41A 4RW9A 5KOWA 1JLEB 4PZVA 5GAGU 3WQTA 3QUBA 3NVYA 1C1CB 1S49A 5EU7A 2O3DA 3W9JA 4CLFA 5IV3A 4ZLJA 2FJVA 2R2RA 2DRDA 1X0FA 3F56A 3POTA 1ZBIA 3WEEB 2A5XA 1KW4A 2Y0SD 2FVPA 1J5OA 2JGUA 3ZZZA 2BCRA 5D6GA 1NZPA 1N60A 3V1RA 4CFBA 2B4PA 2HFOA 2Y0BB 2Y9HA 4GC6A 1VHIA 3IS9B 5C25A 2J0WA 5BPMA 2WVDA 5GAHP 2HAFA 1MNEA 2IRUA 4F8RA 4C9DA 4E98A 4IO9Q 1YTYA 4RW9B 1NH8A 2RRAA 2IYGA 4MIAA 3CJ5A 3DYAA 1IV0A 1RT6A 1HHQA 1UJ4A 1IN0A 2HI0A 5KPZA 4FZNA 3BKTA 2A0FB 4ZPDA 1YT3A 2UUCK 1X3NA 2KZ3A 3CDBA 4YY3F 1VQPS 5EXWA 2NLXA 2GQCA 5EWFA 1GEHA 4LQ9A 3ZZYA 1KL9A 3UDCA 4DR7J 2PA8D 9ICBA 2IY5B 1JXBA 3G82A 3S3NA 5K8NA 2ZQBA 4ZHRB 5FLXY 2FPMA 4CIFA 2PZSA 3H7HB 5JICA 1H73A 2DNOA 2KXHA 6AT1B 3KZIU 4QZCA 3KK2B 5I3PA 1CJVA 3FCVA 2YNFA 3AY0A 1VJQA 5KFXA 5KFMA 2ZTCA 8ICHA 4MMOA 4OJGA 1IJEB 4DN9A 4B9MA 2AGOA 3OYAA 3NLCA 3QINA 4LSLA 2KO1A 3R8EA 4KHPF 4JN4A 1JQGA 3MCOA 4USAA 3SMSA 4Y2PA 2R8IA 2WRMA 4L3KA 3UM9A 2BKEA 2QLXA 3S8SA 4A8MP 4YMOA 3QGGA 2RMLA 3I76A 1QUVA 4YHHF 4XPEA 4HT5A 5HJYA 3W1YC 1N6QB 2PMWA 1CZBA 3CDWA 4URSA 5CD4A 2V7ZA 3NVWA 2Z1IA 4BRLA 3EE8A 2DPNA 4UY8O 3EZOA 3M05A 1YZ6A 4DF8A 4PHEA 2ZBIA 2V2QA 3PYGA 2BW2A 4LR9A 1Z1VA 2VIHA 2J7UA 4MDAA 3CPEA 4LH5A 4RNMA 4LF9F 4R65A 2XWXA 3HOSA 2QTWA 4EEYA 3JS9A 2NYIA 5BJRA 4M3ZA 1DTTB 3WK5A 4MKBA 1ZBFA 3D66A 4PWUA 2ZBPA 4CZKA 5ETSA 5ETMA 9ICQA 1TKXB 3IV6A 2HFNA 1FX4A 1SL0A 1XNQJ 4JB8B 4RPYA 3BY5A 5KFEA 3NL0A 1GLAG 7ICJA 1BG3A 3W66A 5ALWA 3BO3A 1RU2A 2EH9A 2KYXA 2AW0A 2RJZA 3TAMB 1TKTB 4ZLLA 5CYQA 3OTCA 3BR8A 5A0YB 2DY9A 2DHSA 2KKVA 3PW2A 4CNQA 2D9OA 2A1JA 1M5SA 3F53A 9ICMA 3OW2R 1HIYA 2I5JA 4AT1B 3FEZA 4IR1A 3ZYYX 1QAXA 5AQLA 1FWLA 1S6PA 4LBHA 2ZZNA 3O8MA 4F0KA 4F5PA 2IHNA 4BE2A 1N36K 4RQ6A 1RT4B 2EFPA 3M8RA 4PHDA 3M7VA 3P83D 1WSVA 2R7VA 4X62J 5D3GB 4Y6IA 5AI4A 3QETA 2RVJA 3ZT1A 4I2PB 1EB0A 5AK5A 4DEZA 2KG1A 2Z2ZA 2NUHA 4H8KA 3ZTRA 3IG1A 3KLFA 5GTIU 3ENAA 1M1KT 4C23A 3TUZC 2ITMA 4J7CA 2KNJA 5AT1B 3JQKA 4B1UB 4NWIA 3M1VA 2BH1A 3KG4A 3H2UB 3FK4A 3G86A 3TQEA 3NCIA 3NH0A 2J6SA 2QKKA 1B9DA 3I1YA 3WKAA 4DL7A 1FEHA 4UOHA 3LPEA 1LEOA 4TQSA 3K17A 1DAXA 2XLJA 2ZGZA 1RTDA 1OO0B 2VU5A 5HHHA 1N5YB 1X4FA 3I8DA 4M9NA 4IFVB 4R64A 4KC5A 2HLTA 3DU6A 2MQ8A 1SKUB 3D28A 1ZQQA 5KFUA 2BJ7A 1FKAF 2UV8A 1XQSC 1CC7A 1UAXA 1VDHA 4I68A 4O23A 1VQOS 4KAIA 4M41A 4U7CA 2HCFA 4FS2A 2ZTDA 1U8WA 2Y0SF 1Q7YT 4DOBA 1C0FA 2W6KA 3RG6A 2P9UA 1D3WA 4DR6F 4FJ9A 2BUPA 3QGPA 2KSOB 4B3TJ 5KT5A 1F5BA 5D15A 4BX9C 4K42A 4W5RA 4KAZA 2YH1A 4NX9A 4IOAQ 1N88A 4Q0BA 2CPXA 4IYQA 1O1WA 5DM6Q 2E1MC 5IOLA 5CHIA 4E1NA 1M90O 3DXBA 2ZVIA 2MLZA 1R0AA 4LR7A 2D7SA 3OLAA 2K89A 3AEVA 2QI2A 3EVWA 4WQ5A 4OIXA 2HHHK 5CZVA 3NNHA 4LF6J 1BQNB 2Y9UA 3U27A 1T6DA 5AKXA 1U1PA 2LECA 4FM0A 3HKZD 2I9SA 4Z4EA 3CJBA 1LWFB 3HULA 2E7XA 2ILZA 4JK7A 3RTVA 1NZAA 1VSLA 4KT0C 2XMJA 1HNWJ 1IG8A 3QJPA 5T14A 1WELA 5K9FA 3R7NB 1XHXA 1FRJA 4IUFA 2KFYA 2E8PA 1N4LA 4KHPJ 4G6VB 3BS7A 1X4DA 2RAQA 4BRPA 3LQVA 3ASMA 1O13A 1O8BA 3BQ0A 3MN9A 4N7TA 1SL1A 1JLBB 1UVKA 2XY7A 1HKAA 2GJ2A 5AKGA 2A19A 3BO4A 3D0HE 1IH7A 5KGXA 4IFVA 1CJTB 5JVGQ 2CIMA 1NU0A 5HBMA 2WFAA 3JAMO 3Q86A 3HKZC 4OI4A 4ELVA 4FKXA 5KRSA 4ZJLA 4BRQA 5KAFU 4HI2A 2WF8A 1GXLA 2F8EX 3UVJB 1UW9A 5D0EA 1NUEA 3PEJA 5DQHA 2VYPA 4AL5A 3RJHA 5E2QA 3PSFA 2KN7A 3NCPA 1YI2N 3ET6A 2WCXA 2F8LA 2W43A 4X4PA 1T9UA 2OAUA 4DF4A 3Q8QB 4DWIA 4KV8B 3B82A 3W65A 2ODGA 4Q2LA 4MIBA 5BPCA 3H90A 4ANEA 3I0SA 5LJ5Y 1PBAA 1S6QB 4HVZA 5GADI 1QSSA 1I3AA 2GHVC 1CS4B 2WB1C 1S4EA 3I87A 2D3ZA 4FXVA 4CEFA 4FPAA 3O4NA 4A46A 1P1TA 3PO4A 3I0RB 4CJ4A 3R1XA 4P2FA 4DR2K 3E0FA 1Y5LB 4TNOA 3WBZA 4Z4CA 3R5CA 1JKHB 3SBTA 4MFBA 1SUQA 3NOCA 1DRZA 2M0NA 2EFGA 5KFWA 4DOAA 1H38A 1T9TA 2AEMA 1T02A 2XTJP 4ECWA 1KOHA 1CXQA 4KTQA 2YNFB 3PDNA 4R66A 2JH1A 4WFZA 5HQ8A 2MKSA 1S6QA 1RTHB 3QU7A 2E29A 2HVIA 2WFBA 3VEXA 4CNYA 3EKUA 3R5BA 1FEZA 3I55S 4CM0A 4C6AA 2YV0X 3KD1E 2GQQA 4O9MA 1WWHA 2HNDA 5JTIA 3ILLA 4Z6CA 2QYGA 3PIOL 4CJRA 1SC1B 3IRWP 4ED5A 5IWAF 3EDRB 2VD3A 3P8BB 3HOTA 3Q23A 2ZJ5A 3HYFA 2G8KA 4M5MA 2OFHX 3W9IA 1CUKA 4ZJQA 3N5BA 2MZJA 3C3LA 2BJ3A 4RO0A 4KIAA 3O4WA 3KJQB 1DZ5A 4Y34A 2V2VA 5KFQA 2QMUB 4KKOB 1KQFB 3JS6A 3OYKA 2GNKA 3NAIA 4GFJA 3WK4A 1B7FA 4PH5A 2WVFA 2HHQA 4QIVA 1NPRA 2JH7A 5EUHA 2P6SA 3FSYA 1BHNA 2QKBA 3FFIA 3B6OA 5KG7A 1CJKA 2HK2A 2P66A 1N0UA 2VA8A 1UPMB 3DLJA 4ZCIA 3E01B 4RQNA 2VFRA 4L6V3 2DFEA 5DZ7A 2DNKA 4DG1A 3P6YC 3PV8A 4WTOB 3AY9A 4OMFG 4FF3A 1XJWB 2VWJA 1WUAA 1IXKA 3H40A 4JV5J 4Z6FA 4I6YA 2PT0A 4LREA 4OPKA 5AQOA 3ZETB 3EWGA 1YZ7A 1RT6B 3THXA 3Q8VA 3J7AP 4K4XA 2E2PA 4KN4A 2HBYB 3HMJG 2GJFA 1EO1A 3NFAA 1P8GA 3V4MA 1HBOA 5DM7L 3HM9A 3A8YA 1T9YA 1SC6A 4OI2A 1XS9D 5CZXA 4IZ9A 4GKKK 2CXEA 5CYQB 5L9NA 3PR5B 4JI5F 4RTFD 2NRVA 1M1HA 3TA0A 4J2AA 1RHMB 3OLBA 4IKFA 3ULEA 3M32A 3SCLE 3FEXB 4BCAA 1DK2A 1QAIA 1G99A 3WNFA 2KW4A 1PK3A 5KFLA 3VGKA 1RNHA 4K4UA 1HKGA 1RFQA 3IHQB 5JLHA 4TUPA 3BN7A 2NNWA 4KR0B 5C25B 3W8GA 5JLFA 2XI3A 3AVMA 2VQFF 3OYIA 1NMNA 1VIOA 1IXRA 2JRZA 1CPZA 3OYFA 4EAHD 2OWOA 1XMOJ 5BREA 2DR8A 3J7Z5 3M6ZA 3IG1B 2VG6B 4YB1P 3CC2S 3LL3A 5ALEA 4DTNA 4QWEA 5DBCA 4E7LA 1KHWA 3M32B 2Z58B 3CTRA 1XO1A 2YB1A 2VG7B 4C0BA 4ISGA 1FWPA 4O3QA 2E7WA 2HHVA 5HLFA 1Z25A 2A40A 1ZQIA 1U47A 4NEYA 1AUDA 4Y2JA 3ZDDA 3KWIA 5KFYA 2NZCA 2N7CA 4QR1A 3AVLA 3BQTA 3L2VA 1U48A 4K4YA 4IQMA 4OZLA 3AL0B 2GVDB 4ED0A 2FVSA 2GWSA 1W2IA 3S01A 3V9ZA 4ZTFA 4DB3A 2B9WA 4FFDA 3VEYA 1XN9A 4A8WA 3T5KA 3WK8A 3ZSZA 1X42A 3OYGA 3AVJA 3K9KA 1SJQA 2P9EA 2DGSA 4RX6A 3QIOA 1JNZB 2L9DA 2XIDA 1JLAB 2XZWA 1ITGA 1BLUA 4RJVA 9ICHA 2KJ5A 4RW6B 1DT9A 2KSOA 4QYZJ 5KFSA 3L9ZA 2CQBA 4QZDA 2HFZA 4AHTA 4ECRA 3NH2A 3V1OA 1OQ3A 4DR5F 2B9EA 2JWKA 3AO1A 2O8DA 3V7LA 1X4AA 3BREA 2UUBJ 4FZZA 2ZUAA 4NYOA 3QBWA 4I2GA 4DQSA 4ERDA 2XYPB 5A8RB 2HF3A 2FJ6A 2MJNA 3RUBL 1Z26A 2D3OR 2QW9A 1DOQA 1BQMB 3VGVA 1B0TA 4LZGA 4RQ7A 4PRFA 5E3QA 3IM8A 4W5QA 4UBCA 2QA1A 3H0LB 4RW6A 2EG1A 4BVOA 3MCNA 1GMWA 1YKWA 1UWBA 2ASMA 1RWWB 4DMZA 2GWKA 1IBKJ 4F9OA 1T3QA 1S6PB 1KVJA 3KK7A 3B8AX 2ALYB 3CM5A 2C28A 1Q3VA 4NYNA 4OKEA 1ED1A 2OP5A 2LA6A 3LW5C 1PCAA 4ECUA 1WI8A 2U2FA 2XO7A 3LH2S 3UN3A 2XULA 3WXKA 4CDGA 2GMLA 3KHRA 3BB5A 3J7ZT 2PY5A 1LB2B 1Q18A 1U45A 3MMVA 1QM9A 4JS4A 4BWMA 3HW8A 3LALA 3UPFA 1Q16B 2HHTA 1RTJA 2IGIA 2Q36A 3IMQJ 4LQ3A 1K8AO 4OI0A 2E44A 2GIRA 1NK6A 3QT6A 5IWAK 4J2EA 1C6VA 3UQSA 3BQ1A 1LW0B 4CZFA 2AP1A 1KDHA 1OVQA 3OYJA 4KLFA 4FF4A 1IBMJ 1I51B 2WW8A 2YHWA 1NDKA 1ZQYA 2G8HA 5IIJA 2F8HA 3MDQA 4O5BA 2JEGA 5GADP 2YX4A 5MLCV 5DJBA 4MFBB 4GNIA 4OJHA 3L09A 1TZ0A 2IOHA 2KRRA 1Q81O 4BC5A 9ICLA 4IG3B 4OX9F 2OSQA 2F9JA 2HSZA 1VSJA 3AXKA 1MMDA 8ICGA 5B5EU 1RAGB 2L9WA 4Y65A 3U9ZA 1LXJA 2WMMA 2KICA 3GTYX 1GOAA 4C11A 2CJAA 2MKYA 2LDYA 2XBPA 1R8HA 1ZAWA 1FFGB 2C2MB 3V2UC 4HL9A 3GU0A 3K1ZA 2HOQA 1VQ8S 3LP0A 2DTJA 1U2FA 3I31A 4ID1A 4NXNK 4JI0J 4WFNL 1N8RO 1UPHA 1JJCB 1IQZA 4XK8C 9ATCB 3MM8A 1DARA 3ILJA 5KQ8A 1OPZA 4NLQA 2J0QD 5IWAJ 4H4MB 4F4XA 1S0NA 2UU9K 3QFUA 4RKUC 1U1NA 4KGMA 5ETRA 2FLLA 3L7UA 4OJRA 1S5LU 1HLWA 4LF4F 1DLOB 2QL9B 2RQKA 2LU1A 3MEEB 4AM7A 1BMQB 5E5NA 3FZBA 4WFBQ 1BVSA 4TUSA 3H45C 3MM6A 4K5SA 3CB4A 2E20A 2VG5A 1WDDA 2J8SA 4P2XA 5LMNF 2DKZA 2FB0A 4DV6K 2UXDK 3D6FB 3QFHA 4MO4A 5JMVA 2CPHA 3JSYA 4P6QA 1GO3F 1S1XB 1VAZA 3SSSA 1HARA 1VYAA 4JKFA 4OZ1A 3TI0A 3CXCM 4RZRA 2BANA 3W63A 4KV8A 2BHNA 2A3VA 2ZGYA 2LMRA 5IILA 2MYFA 1VBZA 1HJOA 1NH7A 1AUSL 4CZHA 4WU2A 4BR5A 5E33A 4C11B 3L2UA 1ZJMA 1KBUA 4YOVA 4NLZA 1RISA 5HVGA 5JVHQ 5AM4A 1Z4OA 3CWJA 4PYDA 2L48A 2E88A 4FWRA 8ICWA 3CJQA 3NS7B 1QD1A 3PSIA 3VGUA 1N0VC 2CWXA 4MLHA 3OR1B 4HT7A 4K2XA 4NYZA 2MUTA 1T05A 1AYEA 2LQJA 3QIPA 2IJNA 1YI2S 3QNOA 1U4BA 2QGFB 2ZXHA 1TKZB 1P6TA 2ADBA 1VGYA 5KG3A 3SDEB 4YEAA 4NCAA 4MK7A 5FIIA 1W0HA 3R6LB 3LGHA 3TO8A 3JPOA 3JPPA 3TNVA 2FDRA 2FMSA 2XS5A 2DNNA 1W2BR 4DU1A 2G2OA 2CXYA 5ITHA 4K4IA 2W9CB 4OJLA 4Q43A 4ZLNA 4CLUA 4YR3A 1F9EB 2BOAA 4DV2J 2XI2A 4IJAA 1VQPN 4C8KA 1UAWA 5ALYA 2A6MA 4JI4J 2MSTA 2GVDA 1NDCA 1BA1A 1HBMA 1H2TZ 2NR0A 3M2VA 2AYMA 1LK5A 2C2ZB 4OFZA 3ICXA 3OFEA 4DPYA 1GTHA 3J8AA 3R9KA 1EHWA 1RT1B 3R7SB 4L3NA 2UUAK 5IZHA 3TAFA 5HO4A 1NK0A 3QUCA 1WG1A 4CJLA 1K6YA 3EXCX 3AJDA 1SB3C 2GCFA 1QQ6A 4KLJA 1BUXA 3VCBA 1VSIA 3MHYA 1S1WB 3HPOA 1UVLA 1SV0A 4LF9J 1ZQBA 1BCMA 2NQPA 4JI2J 4BRHA 4ECSA 2VUGA 1XNQK 1NM1A 2G8UA 1S7IA 2ROPA 3BYRA 4J5OA 1WTBA 2ZIUB 3OTEA 4Y2RA 5JJBA 2W2NP 3CDEA 3HD1A 2MKIA 1FJEB 5DK5A 5A8RA 1TL1B 3OSNA 3TX8A 3LDSA 1YX2A 3KLFB 4X62F 2J4RA 3LDPA 4BWJA 4Y2SA 2A2DA 5FLXO 2OA8A 2ZHOA 3BSOA