1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
4JV0A 1RTDA 4DG1A 4GXIA 4FBUA 2E6LA 2FLLA 3V6DA 3C1YA 2XRIA 3K5MA 2DY4A 2FMQA 2BPFA 3IS9A 3DRPA 1HYZA 5J2QA 4O5BA 3RB3A 5HRRA 3LDSA 3KLEA 4P2HA 4FXDA 1HYSA 5KT2A 3NE6A 4C8KA 4CK3A 4Z0UA 4M41A 3ZSRA 4CJRA 2AGQA 2FMSA 4FJNA 3LPUA 2C2DA 3RJHA 2FPMA 1EKEA 4M45A 3TAPA 4ECTA 1ZQMA 9ICQA 5KFDA 2QK9A 3SQ0A 2ZD1A 4JS4A 4F8RA 3HSTB 5JS2A 2F1JA 8ICAA 3CFRA 1BISA 4DWIA 3OS0A 3QEAZ 4M3UA 4I2QA 4ECRA 4QAGA 2HVHA 4DSEA 4DMNA 4Q8EA 1WCLA 2BPGA 1D8YA 4FLVA 4DS4A 4M3TA 2V9WA 3RMDA 3PX4A 3SUPA 4F4ZA 4KLGA 3HWTA 2R8JA 2RPIA 4PY5A 4XUSA 1XC9A 4AHCA 3U6FA 1HQUA 4M42A 4DF8A 8ICXA 5KT6A 3AUOA 1K6YA 1L3SA 4DU3A 3S3OA 1U45A 3C95A 4ECUA 1ZQUA 3G6XA 8ICVA 1S6PA 3H7IA 4F5QA 4M47A 2F8SA 4F2SA 4EBCA 1VRTA 4QZCA 3AVIA 4DQQA 3KIOA 9ICXA 2KFNA 1GOBA 4F3OA 5CY4A 4LSNA 4R66A 1JMSA 1A77A 3NGDA 4PGYA 4MEXA 3OYNA 5KT5A 1N48A 5C24A 2A1RA 4ZTFA 4DL2A 5DLGA 2B21A 3N4MB 4KO0A 4HVJA 2X6SA 4UB1A 1RT5A 1ZQYA 5KFYA 4KN4A 4OKKA 4YMOA 8ICIA 1HUOA 2J6UA 4RUAA 3JPQA 1ZBUA 1KRPA 1CEZA 1XU4A 4QW8A 2OYQA 4NYNA 4FK4A 5SWMA 4AHTA 4GVMA 3QEVA 2BCSA 1QSYA 4F93B 4J2AA 2ASLA 1W0HA 4FM0A 1WSEA 1CZ9A 3ZCMA 4FJJA 1HYVA 4RQ0A 5KFKA 4M2YA 3KKSA 2OPPA 3UIQA 4RPYA 3PNCA 4QWAA 2PZSA 5CB1A 4RNMA 3E2EA 5J0QA 1KVCA 4NM1A 4OGEA 2G8FA 3L2WA 4JRQA 4ED6A 5DB8A 1ZQAA 3MEGA 4PPXA 3VQBA 1N5YA 2IC3A 2FBVA 7ICJA 2BCUA 3QLHA 2D0CA 2H5XA 4RQ6A 3JPRA 2W9BB 3BQ1A 4XIUA 3OYIA 3RJKA 5CP2A 3VQPA 5BOMA 4DQRA 4Y1DA 3SJJA 5F9NA 4EBDA 5J2IA 8ICHA 5CA7A 4K4HA 2MUTB 1X9SA 4I9LA 4Z6CA 3ZDEA 4ZTJA 3HO1A 4DTRA 2DFHA 3T5JA 3HPOA 1JLQA 3MGHA 3CG7A 4CIGA 4FS2A 3C2MA 4DTUA 4YXJA 3OJSA 5DB9A 4FZZA 2NUBA 4FK0A 4RW6A 2NRWA 4B8CA 4AH9A 4O4GA 3QINA 4I28A 3V1RA 5KRSA 1IKVA 4Z4CA 5KFOA 1ZQSA 2G8HA 4DLEA 4AHRA 3C21A 7ICVA 3TAGA 3MFHA 5J2NA 2FLNA 4PHAA 1G15A 1HPZA 4LVSA 3JPNA 3SZ2A 1NJWA 3OYGA 5JS1A 3VQQA 3O4NA 4E7KA 5KRTA 2IHNA 1R0AA 1ZQIA 4ECVA 3ISDA 1N6QA 5KG5A 2P5OA 1UAXA 4KKOA 3QIPA 2GWSA 2W42A 2RDJA 4KI4A 3T19A 3UPQA 2EX3A 1FK9A 7ICQA 3LZJA 4CJFA 4YXMA 4CHZA 3RRHA 3N97B 4KMUA 3L2UA 1EP4A 3HVTA 1XSPA 4FJGA 4DU1A 1JIHA 3QEPA 4M9LA 4JS5A 1VRUA 2KZZA 3AU2A 3JPOA 4DS5A 2A1JA 3NF9A 3QNNA 4NCGA 3VA0A 2YNFA 5IIOA 4OKEA 4JV2A 3O3HA 1WLJA 5KFBA 3QE9Y 4MQ3A 5KFQA 4KLDA 4N47A 4YNQA 1CXQA 4LZGA 3G6YA 2Z1GA 1IH7A 1DTQA 1MSWD 4J9LA 1HNVA 1ZQZA 1ZJMA 4Q0BA 3H40A 5IIKA 4TUPA 3AVGA 4CFCA 4ZH4A 3TFSA 1RTHA 2XY8A 1LWFA 3OYDA 3DLKA 2XCAA 3U3GA 5KG0A 1IKXA 4J2DA 1TKZA 5KFAA 9ICUA 4KHQA 3K5NA 2PI5A 3EPIA 3AA2A 4Q44A 3Q8PB 4ECQA 3HXMA 4ED2A 5DQHA 1IXRA 3WNFA 3V1OA 3TAFA 4PHDA 3PMNA 1UOCA 4XQ8A 4GW6A 2LYHA 3Q8SB 4CGDA 1ZBHA 4FLZA 2C2RA 4BDZA 3ZD8A 1I3AA 4IQUA 4NM2A 3GV8B 2ZJ5A 1U04A 7ICFA 4CEAA 1XWLA 3ITHA 4X5VA 3H4DA 2BQ3A 1LAVA 3NHGA 1ZQCA 3SNNA 3ZDCA 4K4GA 1RT6A 1BIZA 2YNIA 4UB3A 5HRSA 1X9MA 4IBNA 4F4YA 1ZBFA 4KRFA 3MBYA 4FLWA 3NAEA 3DLEA 3IHQB 3HM9A 1JLBA 3ULDA 1S97A 3B6OA 3TAEA 4K8ZA 5IIIA 1RNHA 2FBXA 4BGDA 8ICSA 3PW2A 4C8OA 3DRSA 5KG6A 1SV5A 1T4GA 1JL1A 3QZ7A 4I2GA 2IDOA 4I2AA 4HUEA 4CGHA 4DTPA 1N56A 3MEEA 1SKRA 4CF1A 7ICKA 3A2FA 4BDYA 4IRKA 3C2KA 1J9AA 4FBTA 1T03A 1AROP 4RQ3A 1V9PA 3UXPA 2XY6A 1TKXA 3V9WA 3G0ZA 1A5WA 3SQ1A 3IRXA 3T1AA 5J2KA 3RAQA 3PO5A 3MFIA 3RWUA 4DTMA 1IKYA 3AVFA 3VN5A 2ZUDA 1ZQJA 2V4QA 1ZQQA 3PX6A 5KFHA 4M9HA 1LW0A 2AU0A 3OS2A 3ZSZA 1Z00B 4KLJA 3BQ2A 2G8UA 4CEBA 2P51A 2FPLA 4W5NA 2UVRA 1YVUA 4F91B 3AVLA 3QIOA 2OZSA 4E1MA 4PGQA 3OGUA 3KK1A 1ZQTA 4LZDA 1K1SA 3RJFA 2DFEA 4JLHA 3OHBA 4GC6A 4R65A 1C1AA 1C1CA 5KT7A 5J0UA 4FS1A 9ICOA 3OYLA 1RXVA 2R8GA 1TV9A 3KLGA 3CM5A 4EBEA 3UXNA 4FCYA 4YN4A 3TABA 2NRZA 1RILA 3C6TA 1TK0A 1HUZA 4I2EA 1BCOA 4LH5A 4KB1A 3OYMA 5KFZA 4I2BA 3F73A 3V9XA 3Q8MA 1KFSA 5DDYA 2ITGA 3HPHA 4MF2A 4YMNA 1RT4A 5J2GA 1BPYA 2G8IA 1KVAA 1J53A 5HBMA 3K59A 5F9LA 1NK0A 3GV7B 3VQDA 4CJ4A 2JEGA 4CERA 3PMLA 1TAQA 4CHQA 5DG7A 3TQ1A 2BDPA 2IHMA 4CFBA 1L3UA 4E3SA 3GIJA 3RB4A 4J9NA 4CECA 4FJKA 3PV8A 4FVMA 8ICBA 3MAQA 4P4OA 5HROA 5KG1A 1LB2B 2VA2A 8ICYA 3LAKA 5HP4A 2PFOA 4FJLA 1HNIA 3V1QA 4I7FA 3PX0A 3RR7A 2R8HA 9ICIA 9ICKA 3V81A 1FXXA 5J2MA 4NCBA 4QCLA 2UVWA 4BACA 3AA4A 4OGCA 4IKFA 9ICEA 4ED8A 2RN2A 2XGPA 4CJ3A 1BI4A 4PQUA 1TK8A 8ICOA 3TWHA 4HTUA 3GV5B 2G8WA 2HHWA 2EHGA 4OLBA 3OYAA 1FKOA 2JGUA 4FW2A 2NRTA 8ICTA 5C42A 4KI6A 4DL4A 4YR2A 4RT3A 4YCXA 2W9AA 5KFEA 1BIUA 4KV8A 3Q8RB 2AQ0A 3MXMA 1KTQA 9ICHA 9ICSA 1T05A 3ZT0A 1ASUA 3AO2A 4RT2A 2AGPA 4RNOA 3EWAA 3L2VA 2X74A 1NOMA 4JRPA 4I2HA 4UBBA 2IBKA 4H8KA 3ZSQA 2ZQBA 1U9LA 3I0SA 2YNGA 1A76A 3L8BA 1RTJA 3WNHA 4CJKA 4J9QA 3QEXA 1GOAA 1TL3A 1RDBA 1VK0A 4W5OA 4TURA 3BQ0A 2G8KA 4HCBA 4OVLA 2DPJA 1EXNA 3ISCA 4Z4HA 4OPKA 1WSIA 2ZJ8A 3UQ0A 1MQ2A 2ISOA 3AO5A 3O3FA 2UVVA 3QZ8A 1HJPA 1H38A 3LP2A 4FJ5A 5J2EA 1TL1A 2Y1IA 3ZDAA 1WSGA 5DQIA 4UAWA 3C23A 4PUOA 5DDMA 3AO1A 2PFQA 3BDPA 3V9SA 4CHYA 5FROA 3BGRA 1S1XA 3ZDBA 2OPQA 2B6AA 1C7YA 4UAYA 1EETA 4MFFA 2FBYA 4IFVA 4FJHA 5L1JA 4I27A 2PYJA 4QZGA 4RW4A 4I2DA 3ZT1A 4HHTA 4ED7A 5KFTA 1T3NA 1DGSA 4CESA 1ZQDA 3C5FA 3NBPA 4DSKA 3B0XA 1NJZA 4TUQA 3JYTA 4DSLA 1BPZA 2ZJAA 1VSDA 1RBVA 2JLEA 7ICMA 4O3RA 1ZJNA 5KFIA 9ICLA 3MGIA 1D9FA 3LPTA 1X9WA 3OSNA 5CYMA 5KT3A 2FPKA 2YKNA 4Z6EA 2VWKA 3K75D 1UT8A 1SUQA 1S1VA 3LWLA 4DQSA 3CFOA 1B92A 4DFKA 4W5QA 3T3FA 3LP1A 3DLHA 3MR5A 5SZTA 4O55A 5KFCA 3EYZA 3HJFA 1BHLA 2HHQA 4DL5A 1SL1A 2ZUCA 1XSNA 3NDKA 4QZIA 3ZT4A 1DOQA 4ID1A 2VG5A 1C0TA 1K1QA 2BE2A 2I9GA 2IA6A 3EY1A 2IAJA 3OYFA 4F4WA 4FO6A 3VQ4A 4B9UA 3RH5A 1S0VA 3RTVA 3CM6A 5KFJA 3SI6A 4TSXA 4YVZA 1ZBIA 3HP9A 3SCXA 4PWDA 3KHHA 1BPBA 1MC8A 1XSLA 1JXLA 3NTUA 1HJRA 4EYHB 1JLAA 3JSMA 5DB6A 3GIIA 3TR8A 3LALA 3TAMA 4F5PA 5DBCA 4ED3A 5EOZA 3H8WA 1JLFA 4QZEA 1KLMA 7ICEA 4M04A 5HLFA 4FJIA 1KEJA 4M9GA 9ICBA 3V6HA 4N76A 1TKDA 4DTSA 4E89A 2KFZA 1NOYA 1SL2A 3RMBA 7ICHA 2JZBB 4F5RA 4IR1A 3ZT3A 1WSHA 4PHPA 2LSNA 3K5LA 4QZ8A 4K8XA 3G10A 1TV6A 2D5RA 4BXOA 2BCRA 1B22A 2HMIA 3EW9A 3DI6A 1YTUA 1RDAA 4R63A 1RT3A 3KK2A 4CJSA 1RZTA 9ICMA 3GFKB 3C6UA 5KFPA 4YFKA 1RYSA 4DEZA 1BL3A 4KB0A 4P4PA 3HX0A 2PXIA 2F8TA 1WSFA 2KZ3A 2RF2A 1D8LA 5KFRA 4I9QA 3SUOA 4NLNA 4CE9A 5BOLA 5DLFA 1BPDA 4HCCA 3QEBZ 3C94A 2XHBA 3NGIA 4KTZA 2PY5A 3RB0A 4YG2A 1ZQFA 4CGIA 1RBUA 1RBSA 1WSJA 5E41A 1ZQLA 4H4OA 3OJUA 4QW9A 3VQEA 1NKEA 1MU2A 1DLOA 3MEDA 3VQAA 4PGXA 1HRHA 2BPCA 1C1BA 4Z6FA 4KTQA 5DGAA 4MFAA 7ICNA 3PO4A 8ICGA 3EPGA 4Z6DA 2OA8A 1Y88A 1BI4B 4RQ5A 3I8DA 3M8QA 4M3YA 5HMMA 1SKSA 5KFMA 1ZQVA 3VA3A 4QZ9A 4B8AB 4CJQA 3GDXA 3QEIA 1QS4A 5HHIA 4YP3A 1D5AA 2I1QA 2C2EA 3DRRA 4J9SA 1S9EA 5DK5A 2AQ4A 1CUKA 4JUZA 3SV3A 4B9SA 2HB5A 1TKTA 3RBDA 1QTMA 2QXFA 2BR0A 1ASWA 3OHAA 5J2CA 5CZ1A 5L1KA 4CF2A 3SPZA 4KLQA 4CF0A 2AJQA 1ZQKA 4M6WB 5KFGA 4QOZB 3KD5E 1WAFA 2KTQA 4EZ6A 4UAZA 1JLCA 8ICQA 4DQPA 4ECZA 4KLEA 2XCPA 1S1TA 4WE1A 3L3UA 3M8SA 1ZQGA 2OPSA 1QLNA 4IRCA 4ICLA 4CHNA 3V6JA 4B9TA 2A1SA 5J2PA 3H4BA 8ICRA 4RZRA 1S6QA 4R5PA 3OY9A 4KLTA 3T5KA 4RQ8A 1LAWA 4DFMA 3V9UA 4DTXA 4GXKA 3SI8A 2W8LA 4CEEA 4QZHA 4FK2A 4DO9A 3M9OB 3V9ZA 4IG3A 7ICPA 4ELUA 4DOCA 2VWJA 4ECYA 4IQWA 3C1ZA 3M9NB 1TAUA 3VQ9A 4C8MA 4F3TA 1FKPA 2KZMA 5CR0A 4KLMA 4CJPA 4B9MA 4NY8A 4CJEA 2ETJA 3MDCA 1S5JA 3JPPA 5C25A 3DOLA 4IFYA 4M3XA 1C0MA 3F9KA 5KG3A 4I2FA 1YT3A 1NK6A 4OLAA 3ZDDA 1S1UA 2KQ2A 5EWFA 1ZQEA 2MAXA 5CJ7A 4UQGA 2I5JA 3LK9A 2E4LA 4FZYA 3DM2A 5J0YA 3RH6A 5JUMA 3KD1E 3WNGA 1UT5A 1S9FA 3QESA 2Z1HA 2QKBA 5J2DA 2DTUA 4IDKA 4DTOA 2YKMA 1VSHA 3MXIA 1KVBA 2C28A 4TQRA 3M8RA 1U4BA 3B6PA 5EWEA 2P66A 1J5OA 5DQGA 2QKKA 4ED0A 1VSLA 2PI4A 3P83D 1BCMA 3RMAA 5KG7A 5J29A 5KFUA 5D3GA 1CLQA 2D0BA 4F4KA 7ICOA 2Y1JA 4O5KA 3SUNA 3T5LA 3OYJA 2RDIA 1B9DA 4M3ZA 3QO9A 3KHLA 5IILA 1T8EA 1KDHA 1I39A 3NF7A 2AGOA 4OJRA 3LDAA 3JPSA 2ATLA 1D9DA 3KTQA 4KN7A 2HHUA 8ICNA 1S76D 2B5JA 4I2JA 1GOCA 2P1JA 4GMJB 1NOZA 5HMLA 2G8VA 1Z00A 1S77D 1LWCA 4TUSA 1HMVA 5CYQA 2UVUA 4B9LA 3HPGA 4CK2A 2M9NA 1RCHA 3RJIA 3DOKA 4OKJA 4JWNA 2XO7A 9ICNA 2E6MA 3E01A 4DL7A 1B9FA 1KCFA 3TANA 1WCNA 3HVRA 3PVXA 1X2IA 2ZE2A 3TI0A 3SYZA 3AV9A 3AVKA 3ISBA 1PZNA 4NXZA 4DLGA 2BQUA 4KFBA 4CJWA 4J9RA 9ICFA 1RT7A 4AILC 3AVBA 4RW9A 4KLFA 2YHAA 5FDLA 2W9BA 3NH0A 4DSFA 4ECWA 4J9OA 4E1NA 5KFFA 1IO2A 2KW4A 5DBBA 4KAZA 1S0NA 3H8JA 1RT2A 4G1QA 4IQTA 2OWOA 1Z25A 4KHSA 5KTQA 5HNKA 1ZQRA 3DLGA 4NLKA 1A5XA 4CJTA 3M8PA 4KLIA 3MR6A 4KREA 2HVIA 4MFCA 5J0WA 2VG7A 2XY5A 3V4IA 2ZTEA 2HNZA 1RBTA 4CK1A 1UA1A 4BE2A 5DGBA 4DF4A 4Y1CA 4EP5A 4AHUA 2ZUBA 4DTNA 4CGGA 4I2PA 4YFUA 3VQ6A 2DFLA 4PA1A 4E7HA 1Q8IA 3NF8A 1XO1A 4KLUA 2O4IA 4UB4A 3AVJA 4O0JA 2YNHA 4KHNA 4P4MA 5C5JA 4J9KA 8ICFA 4AHVA 2HHSA 4IR9A 2P6UA 3PR4A 2B4JA 1XHXA 5KGWA 4CIFA 4DOBA 4J2BA 4BE0A 3KHRA 4NYFA 4O3OA 3CQ8A 5DG9A 4UBCA 4EP4A 4Z4FA 4M0AA 4KHUA 1YTAA 4RQ7A 1RTIA 1LWEA 4J2EA 4L8RB 4CHPA 3GIKA 4KTWA 1REVA 1CZBA 3VQCA 3MECA 2Q0ZX 5KGXA 3PR5B 4AHSA 1TVRA 4Q45A 3PW4A 3ZSVA 2XC9A 2A1JB 2RKIA 3QNOA 1VSJA 3HT3A 1NK9A 3GILA 9ICCA 4JV1A 3FYHA 4O0IA 4F92B 3V7KA 3OYCA 1RXWA 4YMMA 3QETA 2VG6A 2OPRA 4NLGA 1SL0A 3ZT2A 1Y97A 4O3PA 1KFTA 8ICZA 3NFAA 3HP6A 4HYKA 1JXBA 2JEJA 4W5RA 2BHNA 4KHYA 3MABA 4DSIA 5J0PA 2R8IA 3GQCA 2JZBA 4MF8A 4BE1A 4CEQA 1U47A 2J6TA 2PFPA 4FLXA 2BQRA 2HW3A 3G6VA 3KLHA 4CHOA 1ASVA 2X6NA 7ICLA 4QWBA 4MFBA 2YV0X 4E0DA 3D45A 1J54A 3U3YA 3I0RA 3OYEA 4YR3A 2HNYA 5KT4A 2JEIA 3H8SA 1JN3A 4C8NA 3QERA 2Z1IA 3ZSWA 4FJMA 2NRXA 5KFXA 2PYLA 5KFNA 2WTFA 4Q8FA 4F4XA 4RUCA 3C5GA 1WN7A 1QQCA 2Z1JA 4DU4A 3DLBA 3O3GA 3HW8A 1SZPA 3LP0A 5CWRA 5HRNA 1BGXT 4RU9A 2BCVA 3IAYA 4PH5A 1XI1A 5DBAA 2R8KA 4HUFA 4R8UB 4PHEA 5J0RA 3TAQA 4R64A 3P5JA 1COOA 4KITB 2W9CA 4CJVA 1L5UA 3RJEA 3ZSOA 3L2RA 4DL6A 1IG9A 1UA0A 2P5GA 5KFWA 8ICLA 2GBZA 3AVNA 3AU6A 1RYRA 5DKWA 4CJUA 2HHTA 4CJLA 4Z4EA 3ZD9A 4YR0A 4ECXA 5IIJA 1QSSA 4RW8A 4CF8A 4I2IA 1S0MA 1Z26A 1ITGA 3L2QA 1Q9YA 3V7JA 2WONA 4KHWA 4O3SA 5T7BA 4ELVA 3OVNA 3PW5A 3P1GA 5DG8A 1JKHA 2MUTA 4M6WA 4LH4A 5J2AA 7ICGA 4CIEA 3OYKA 4I2CA 3ZSXA 8ICWA 3ORYA 4BDPA 1S1WA 5J0SA 3KKRA 3O4QA 4B08A 4DL3A 4ID5A 4XA5A 1C6VA 5J0TA 5DMRA 4IQVA 1ZQOA 7ICTA 2FMPA 4NCAA 1UWBA 3K4GA 1JL2A 1JX4A 3SPYA 4Z4IA 3H08A 4DQIA 3DYAA 3UQ2A 1RDCA 1X1PA 3AVHA 4QWDA 1RDDA 3OS1A 4ED1A 1ZQPA 3RR8A 3Q8LA 1NK8A 2FLPA 3IG1A 1IM4A 4O5CA 2D0AA 2ALZA 4O3QA 3HL8A 4XRHA 3OYHA 8ICCA 2V4RA 1TFRA 1W9HA 2ATQA 4ZHRA 5KFSA 1LW2A 1KSPA 3EZ5A 4NLZA 4N56A 4KPYA 3BQTA 7ICIA 1S0OA 2BANA 1JXEA 3RBEA 2ASDA 4O3NA 3M9MB 4GLXA 4GC7A 4E7JA 4CCHA 1O1WA 1NKBA 1BQNA 3RB6A 3AO3A 5J2HA 4CFAA 4IRDA 1CXUA 4E7IA 3KHGA 3LAMA 4M3WA 4QWCA 3S3NA 2P6RA 2C22A 2X78A 1DTTA 4KLLA 1Z3EB 2GV9A 3MDAA 4YD2A 3VQ7A 3WNEA 2ISPA 4J9PA 4RG8A 3B0YA 3KLIA 3NCIA 2ZTCA 5DB7A 3C2LA 5J1EA 1ZQHA 8ICPA 4M9JA 3IM1A 2HNDA 1NKCA 3VQ8A 4CEZA 5FRNA 4QZBA 4QWEA 9ICPA 2F96A 4KLOA 1BVSA 4BWJA 2VA8A 4KLSA 1VSKA 1BPXA 3PW0A 3Q8KA 1TK5A 4FW1A 4R8UA 1QSLA 9ICTA 3AA3A 4QZAA 3PW7A 4DOAA 4FLTA 4IG0A 3NF6A 3KK3A 3LZIA 4K4IA 3OSPA 9ICVA 4RQ1A 3K5OA 1RBRA 5L9XA 4CJ5A 4FLUA 2KN7A 3SQ4A 1L3VA 1RPLA 4F5OA 1VSFA 4E19A 4FJ7A 3QEWA 3ISNC 1Q9XA 3AVCA 4Q5VA 3LANA 4FYDA 4CGFA 1SKWA 4RQ4A 5IINA 4JWMA 1QHTA 3FFIA 2HHXA 5J2BA 1ZBLA 2XY7A 4RPXA 4DFPA 1A5VA 3OYBA 2F1IA 2NRVA 3V72A 1NK5A 7ICSA 4E7LA 4DFJA 5K14A 4CEOA 3DLRA 1S10A 3KLFA 2ZTDA 2BGWA 3L3VA 4FJXA 5HRPA 4RQ2A 2IS3A 5CZ2A 4FZXC 4CEFA 3LP3A 4LSLA 4B9VA 1BQMA 1JLGA 2W8KA 4RPZA 4YD1A 4EYIB 3JPTA 1TGOA 4QZDA 4CEDA 2PFNA 3S9HA 3K58A 8ICJA 2IOCA 4J9MA 4GXJA 1ZQBA 2IMWP 4M3RA 3RAXA 4M9NA 3SUQA 4LY7A 3HK2A 3HYFA 1S9GA 1XS9D 1KFDA 4OPJA 8ICKA 1KLNA 4YQWA 5KG2A 3FDSA 5L1IA 4FM1A 3NGZA 5J0OA 3SQ2A 2YHBA 5I3UA 4FM2A 4F50A 3V7LA 1NJYA 1TVAA 5J2JA 1NJXA 9ICWA 3AVMA 3BJYA 3RRGA 4C8LA 2XGQA 1BPEA 7ICRA 1XHZA 3NGYA 1VSEA 4EZ9A 2Q3SA 8ICEA 4RW7A 1IKWA 3RH4A 4CGJA 5FRMA 3NH2A 5J0XA 1VSIA 5L1LA 2BGGA 4DTJA 2BKEA 4MEYA 4N5SA 3TARA 5EU7A 4EEYA 4HUGA 4G3IA 3RMCA 3DMJA 2R7YA 3PY8A 3PUFA 3D0PA 2O4GA 2W9CB 1C0UA 3CFPA 2FBTA 3S3MA 3NH1A 1ZQNA 4H4MA 4O9MA 1L3TA 1ZQXA 3K57A 5EWGA 3MR3A 1RT1A 1EX4A 4UB5A 1NK4A 4FLYA 8ICMA 1T7PA 1ZETA 2DFFA 5D46A 4F5NA 5KFVA 4FJ9A 1U48A 3LWMA 2IGIA 2DPIA 5TZVA 4FJ8A 4TQSA 1JLEA 5KI6A 7ICUA 5I42A 3KJVA 5IIMA 1HQEA 9ICAA 4LD0A 2VA3A 4DSJA 3Q8QB 3ALYA 4B9NA 4ELTA 4Q43A 3RJJA 1F21A 4I29A 1U49A 3AVAA 5HP1A 8ICUA 3ASMA 1VSMA 3GIMA 3ZSYA 3THVA 2JEFA 4Z4GA 5D4BA 4BWMA 5D49A 5J2FA 3K2PA 1EXQA 2WOMA 4F2RA 4N41A 4JK1A 1B43A 3AA5X 3UXOA 3MR2A 3TFRA 3AO4A 2J6SA 2W9MA 2BCQA 3T5HA 2F1HA 1MQ3A 5KFLA 9ICJA 3ETLA 4QZFA 4BXOB 3RJGA 1WAJA 4O5EA 1WNSA 2ASJA 4CFDA 4KLHA 3V6KA 4CF9A 4UB2A 5CHGA 5KG4A 3SV4A 3VQ5A 4W5TA 9ICRA 2GUIA 2FC0A 4B3OA 3MXJA 1LV5A 3CYMA 4RNNA 4ECSA 2VANA 1ZQWA 5HHHA 2OZMA 5BPCA 4O44A 1NK7A 1QE1A 1ZYQA 2HHVA 9ICGA
chains in the Genus database with same CATH superfamily
2GUPA 2QMUB 1LKYB 4FBUA 3C29A 1SCJB 3KZIU 3C1YA 2R7QA 4LFBJ 2FMQA 1JJCB 2A40A 3MAHA 2YPZA 5HAOA 1UZDA 2EKYA 3DRPA 4M5NA 4FN5A 1HYZA 1OY6A 4UT4A 3IWLA 2ZH1A 1FJEB 1Y00A 1VQ8N 1HLWA 4DV6J 5KT2A 3C7NA 3NE6A 1QH9A 2OTJN 4CK3A 2BDUA 3FMWA 4M41A 4OL8A 3ZSRA 4IOAQ 1MG7A 4CJRA 4FJNA 3RJHA 4V1Ak 2OPQB 4ECTA 1ED1A 1H1VA 1DQ9A 3CMAN 2QK9A 3HD2A 2C2OB 5IZHA 2F1JA 3CFRA 2MQNA 2RDDA 2VQFJ 3OS0A 3QEAZ 4MKBA 1J2VA 1FRLA 4QAGA 5ALTA 3J81U 2RU3A 2HVHA 4DMNA 1P6TA 1D8YA 2HS0A 4RX6A 3F2BA 3FRZA 3NVKA 4QBUA 1ZRNA 4KLGA 2JH3A 2W7OA 1SH2A 5L9NA 2R8JA 1YITS 4FL9A 5IT4A 4H5RA 4AHCA 4M42A 4DF8A 2W2MP 3ADAC 1IBCB 1K6YA 4PL2A 3HHLD 4A47A 4IDHA 4OYAA 3TOQA 1M90O 4CZFA 4ECUA 3G6XA 4MLHA 1S6PA 3VZHA 1QCKA 5H1SQ 1KD1T 4M47A 3CNHA 3MMAB 4F2SA 4EBCA 3KIOA 2IM1A 1PUZA 2E1RA 2DJWA 1GOBA 4F3OA 3AB2B 1IR1A 3ZEUA 2JVRA 1VQMN 2MRLA 1HBNA 1JMSA 1WEXA 2J0XA 1T05B 2KXNB 3CCJS 3A8IA 4FZVA 2NREA 4YOEA 5C24A 3FQLA 2A1RA 4DL2A 5LMNJ 1UCNA 2IVYA 1VQLS 4LSLB 3C3LA 3N4MB 4HVJA 2GW8A 2V52B 1CPZA 1FTRA 2FJVA 4BR9A 4KN4A 8ICIA 4WU3A 3UO0A 2CQPA 2PE8A 1RK8A 4L73A 5AQLA 4I6YA 2R7WA 3TRGA 1HQ2A 1J5EF 4NYNA 4GVMA 2BCSA 3QJLA 1QSYA 4F93B 4WF9L 4J2AA 1W0HA 3QGHA 1WSEA 4NMLA 3V2UC 4NXMF 3D0IE 2VASA 2E1CA 1HYVA 5F1XA 1BUXA 3F44A 1R89A 4HACA 1UJ5A 3NNCA 3UIQA 1S7IA 4QWAA 4RNMA 1RI7A 4P71A 5LL6d 1KVCA 4OGEA 5B66U 2VF3A 4Y2XA 4UY8O 3VQBA 2FBVA 2H5XA 4WYLA 2W9BB 1HKCA 1TYQA 3PRVA 2JWLA 1LXNA 1R27B 5B08A 1SB6A 3F5TA 1WHWA 2MKSA 4I69A 4RW4B 5F9NA 4EBDA 1RTZA 1IVZA 2F4FA 4ZTJA 2PD1A 3HO1A 2LECA 3MM7A 1XBWA 1SQFA 4DTUA 4ZLNA 3M8ZA 4YXJA 3OJSA 1FRMA 1ZC6A 2NUBA 4FZZA 3TVKA 2MKCA 4FK0A 1FFSB 3ENWA 3H6EA 4O4GA 3P96A 3L09A 2QLFB 5KRSA 1ZQSA 4DLEA 4OO1J 1HEKA 1TKTB 4ANCA 1RAAB 2QJ3A 1U1NA 1YSJA 3EO3A 4DR6F 3OYGA 3VQQA 4IJNA 1R0AA 3D2EB 4P2SA 4CZLA 2XSJA 1N6QA 5KG5A 3KHYA 3CB4A 3CJTA 2OHDA 2RDJA 2F8EX 2C2KB 3GR0A 4IO9L 4NXNF 4CJFA 1XMOK 3L2UA 2ZBRA 4WE1B 4LF6K 3I5BA 4FJGA 4DU1A 1NGGA 3VQTA 1JIHA 3IRWP 1K8KA 4QNLA 1JCFA 1VRUA 3F56A 2KM8C 4U7BA 3GCXP 1HWLA 5A2QU 1HBNB 1B3TA 4TN2A 2VJ4A 3QE9Y 2I7PA 3PHEA 2F8KA 4A5BA 3AOCA 1CXQA 2GIRA 4LRFA 3G6YA 2ZM6J 3TA0A 2Z1GA 2H5EA 5LSOA 3BM7A 1HNVA 3N5FA 1ZQZA 1ZJMA 1VQNS 1X5PA 1FK9B 5IIKA 3JTPA 4DR6J 1YZ7A 2L9WA 5C7PA 3X3UA 3TFSA 4C4RA 2KYXA 2W03A 1XR7A 3MTJA 4I1TA 3KMSA 3U3GA 5KG0A 3V5RA 3CJ2A 4EMDA 4R0JA 5KFAA 2OHFA 4K4VA 1S5ZA 2Q31A 1VJWA 1GLJO 1CULB 1HNIB 2PI5A 3EPIA 4XPCA 5K8OA 1GMWA 1YBAA 3ENHA 2QWLA 4WFAL 3V1OA 2BUPA 3TAFA 3QSYB 2I6WA 4DV5J 4PHDA 4BRFA 3PMNA 3R97A 1U2FA 3Q8SB 2IOHA 2MQQA 1WC3A 2C2RA 2EKNA 2DWQA 3BKTA 4LQ3A 2FJAB 4A48A 2BMBA 3ZD8A 1I3AA 4IQUA 4NM2A 2ZJ5A 1VQ6N 1C4CA 4ID8A 5AQOA 2FHOB 3H4DA 2BQ3A 4C80A 2ROPA 2ZBCA 2ODGA 3ZDCA 4DV3J 4KHPJ 2IY5B 1RT6A 3LTOA 6AT1B 2YNIA 3SFUA 5HRSA 2VG5B 3PFOA 2F77X 3TSUA 4KRFA 3MBYA 5IM0A 3SCKE 4FZMA 1AB8A 3IHQB 1KD1O 5IQ6A 4BGDA 2UUBK 2GAHC 2HZCA 1TZ0A 1T4GA 4WCEQ 3MM7B 2EC0A 1V97A 2D3ZA 4CGHA 4DZ6A 4CF1A 3A2FA 2HSTA 1AFIA 4GVEA 2O8EB 3CPWR 4IJAA 1T03A 2N7YA 3ZX0A 2CYYA 3UMBA 4LF4K 1TKXA 1PJ7A 3V9WA 3O8MA 1JLAB 1KW4A 3T1AA 3HKWA 1IKYA 2BYCA 2CADA 3PCOB 1JQGA 1LW0A 1X4FA 2DNQA 4KLJA 5JLFA 3BQ2A 5CYQB 3RJMB 1XMOF 5AFUH 2E1PA 5B0BA 1OVQA 3LM2A 2OCEA 1L6NA 4IS7A 3HCXA 3UCGA 4E1MA 3OGUA 4A8QA 4U6PA 4Y2QA 1LKZA 2DFEA 4JLHA 4QOTA 3OHBA 4R65A 3RW7A 1RXVA 2OXOA 4FCYA 3RYLA 4USHA 2EH9A 1GEHA 5HMXA 1TFYA 2PFFB 3NVMA 3CC4N 3M8WA 4B3MJ 3BH6B 3ICXA 1TK0A 2YHXA 4I2EA 3HHNB 3L4IA 1YJTA 1V85A 5KFZA 3V9XA 2CNNB 3CC2S 1RT4A 1Y7PA 5J2GA 1BPYA 3ICLA 3C2PA 4FO0A 4JKCA 3VQDA 2MKKA 2EAMA 4CHQA 4L3QA 1OVYA 4DV7J 2BDPA 1WSVA 3KZXA 4LR7A 5BR8J 5HQ8A 4E3SA 3GIJA 4J9NA 3I55N 1RFQA 1WHXA 3PV8A 3MEDB 2EFVA 2E2PA 1FD8A 2NXJA 3MAQA 5HROA 4B3RK 8ICYA 5CD4A 3KLGB 2OTLS 4FJLA 1KAXA 1HNIA 4B6JA 3T1YF 4MJKA 2XYHB 5BPMA 3CJ1A 5EVZA 9ICEA 1CI4A 4FXWA 4PQUA 1MW7A 8ICOA 4RL1A 4HTUA 3EX7B 4LRCA 3US5A 2AJ0A 4DUYF 2EHGA 4OLBA 2UXCK 3DDIA 3W8GA 5J8YA 2NRTA 1OH7A 5EN1A 3JB9k 1S9EB 5ALGA 2GS8A 4RBUA 2SXLA 1N5XA 4PEOA 3H2UB 2LEPA 4KV8A 2QARA 2ZH2A 3W9IA 2Q2RA 2Q97A 2AQ0A 5FJ4A 4WQ4A 1W7WA 4O4GB 3I1YA 3R9LA 2LA4A 1KTQA 3Q8VA 2GV1A 4I7FB 3SAGA 3DLJA 3ED5A 2IRXA 2HVZA 3EWAA 2G2YA 2CJBA 3L2VA 2X74A 5M1FA 3BGUA 4UBBA 5AXMA 1FVSA 1VQ6S 2PC6A 2KJ5A 1U9LA 2M0GB 1TE2A 4AYBF 2KHCA 3HZEA 2KFYA 4M5DB 5HSPA 1RTJA 2MJUA 1N6QB 4J9QA 4WQ4C 3W65A 1TL3A 5I3QA 2VUGA 3JS9A 4HLBA 4ISEA 4UB6U 9ATCB 2LLZA 3MMBB 2HCFA 7AT1B 3BQ0A 1VLYA 4OVLA 1VQ4N 3MN9A 2ZJ8A 2ISOA 2IDLA 5FLXY 3Q24A 4JKEA 2NSCA 1H38A 3EE9A 3RSEA 4EHUA 2QWRA 4CLFA 2Y1IA 4LFCK 3MPVA 3EZWA 3AO1A 2FGCA 3GTYX 4L3KA 5ADXH 1S1XA 2APOA 2BUNA 3AQOA 3ZDBA 2XEXA 1YJ9S 1N8RO 1C7YA 4G65A 5EE0A 4OI4A 1EETA 1KAZA 2LBOA 5L1JA 2CZ4A 3ZT1A 1VLOA 4IOXA 4ED7A 2R7XA 5GAHP 4LBHA 3C66A 2UXDK 3C5FA 3B0XA 4TUQA 2KM8B 5HMWA 4EX6A 1DRZA 2HWIA 5AJ3F 1RBVA 1JLQB 3QU5A 3QT7A 7ICMA 1ZJNA 3PG9A 4K4YA 5KFIA 4UY8T 4IOAL 3MGIA 4WIQA 3QU9A 1RADB 4I6MA 4ILJA 3WQUA 3FKBA 4Y2KA 3K9JA 2XMUA 2G0AA 4V19X 2QE5A 4PUOB 4TY8A 4MDBA 2X1AA 4Z6EA 3K75D 3EDQB 4C98A 4WXWA 1GK8A 4J8FA 5D0RA 4DR7J 3LUYA 3LP1A 2DGOA 3MR5A 5KFCA 2MJNA 3GDQA 3KOOA 2O8BA 1ZD5A 2QLJB 2K7JA 2AJ2A 3M1VB 3OD2A 4USAA 2CGKA 1O13A 2ZOFA 1BWEA 4DUZK 4AL6A 2G2ZA 4I6WA 4ID1A 2VG5A 3QAEA 1C0TA 1K1QA 3RG6A 3QMQA 5A0YA 4GFJA 3IBFB 4QU6A 1TUVA 2QFJA 1BOTO 4FYXB 3IKMA 1WHVA 5LMUF 3FBBA 4X4RA 3CJAA 4X64K 1P7DA 3CCMN 3AGRA 4BC5A 4AQYF 1D1UA 1MC8A 1FRHA 1S1VB 2XZWA 3K0SA 2BOAA 2RKIB 2BRKA 5IT9O 4KHPF 2XMKA 4F5PA 3BPDA 1X31C 3H8WA 2IA0A 1TKXB 2GGPB 4OCZA 1N36K 2QIFA 1KEJA 3CI5A 4M9GA 4A8SA 1MN8A 4DTSA 4K4ZA 1NOYA 5SUHA 2HFNA 2ZH6A 3RMBA 4IR1A 2Q6CA 3DV9A 2K60A 2CPJA 4ZVSB 3WXIA 4QZ8A 2P5VA 2HFSA 2ZFHA 4CF4A 1QUPA 3A8YA 3DGPB 3BS5A 2WTUA 3THWA 2D5RA 5CYJA 3DM2B 1VHXA 1RDAA 3E0FA 4YB1P 1SPBP 3G8QA 1RT3A 4CJSA 3C6UA 4OI0A 3RVCA 2Z7JA 1RYSA 3C14A 2FJ6A 4IDKB 5AZIB 2F8TA 3ZTOA 2CIMA 3J81O 4I9QA 5BR9A 1B70B 4HCCA 1M5PC 1IIPA 1C0GA 2XHBA 5HBMB 1GFWB 3NGIA 1YI2N 3ZX2A 2LQJA 1ZQFA 2LI6A 1SQEA 4C0HA 3H42A 3TADC 1WSJA 2OD4A 1N33F 1L8LA 3PRBA 3VQEA 1N5TA 1NJIT 1D8BA 4KJIA 1MU2A 1DLOA 3MEDA 4PGXA 3OL7A 2CG4A 4H4KA 5DGAA 4MO5A 5DM6Q 4X4SA 2OA8A 4PQUB 3M8QA 2Q4TA 3L95X 1RM6C 2XLJA 4QZ9A 3VGLA 4B8AB 4TLQA 2GO9A 2M70A 3GDXA 4DFDA 4Y00A 2XVTA 4YP3A 2C2EA 2KDOA 2LCWA 4CF3A 1S9EA 1XNRK 5DK5A 1CUKA 4JUZA 4B9SA 2KJWA 1JJ2R 2QXFA 2BR0A 4CRJA 3DXBA 4IG0B 5BR8F 2ZIWA 4RBVA 1DFDA 1WWVA 2BACA 2WONB 4A5AA 5L1KA 5J1PA 4OYBA 4KLQA 5DDRC 1XJWB 1EX8A 2MKYA 1XMBA 3KD5E 3QIDA 4NA2A 3BGFA 1Y5IB 4FWRA 4EZ6A 3CJKB 2MZ1A 3DRYA 3QU7A 8ICQA 4DQPA 3JSYA 2B43A 3FBFA 4BRPA 4TYAA 2XCPA 3H5UA 1QLNA 4Y34A 3VGKA 1OPIA 4B9TA 3M2UB 1MROB 2FYXA 4S0MA 3IM9A 5J2QB 5J2PA 1Q95G 3H4BA 2Y1RI 2RE2A 2IHR1 1XMQJ 2UV8G 3PRDA 3OY9A 1LAWA 2BKNA 4NASA 1KONA 3GYXB 3SI8A 3R5AA 5ALKA 3M9OB 3V9ZA 3GU0A 4K4SA 2E9RX 4FWMA 4ECYA 4LF1A 3R1HA 3TWZA 3UMGA 3O6QA 1Q0NA 2HLTA 1ZTTA 2YKMB 1PKUA 1NPKA 1U7LA 2KZMA 3N28A 5CR0A 2CUYA 2QN6B 1QVGM 4NY8A 2KT2A 2ETJA 1S5JA 3DOLA 1RT5B 4CO3A 2IVNA 4FZLA 1YITN 4BGBA 2AEMA 3AFGA 5KG3A 1NK6A 1NGEA 3ZDDA 3P39A 2ASOA 5EWFA 2KQ2A 4RO0A 4Y2CA 2MAXA 5BN8A 3BZKA 2KU7A 5ALHA 3DDKA 4EX7A 5E3AA 5EGYA 3RH6A 3QBXA 4MO4A 5JRTA 3QWPA 1JLBB 2Z1HA 4OYXA 2QKBA 3H1QA 1NNLA 1PBUA 4IDKA 4PXCA 1I94J 1V4TA 2VQFK 3C15B 3IR7B 2AX1A 1KVBA 2C28A 3B6PA 2RUSA 5EWEA 4MK9A 1J5OA 1PC5A 2IYGA 1M5OC 2CH6A 1VDHA 4NLYA 2AP1A 5FPDA 1BCMA 1TELA 5J29A 3HM8A 5D3GA 2ZZTA 3O4WA 2D74B 4F4KA 3CMEN 2LEBA 3BBBA 3Q23A 3ZZOA 1KDHA 2MEWA 3NF7A 2AGOA 2ATLA 2CN1A 5L39A 2ROEA 2HHUA 4DCOB 8ICNA 2G9OA 2QA2A 1NOZA 4NLTA 3PKYA 1S22A 4DR5K 4C7QA 5EE3A 1SI9A 4I0WA 3FCHA 2UVUA 3R5BA 2A5XA 2ZWPA 2M9NA 2BOPA 3CO9A 3KK1B 4JKHA 3WHIA 4P7VA 1YX2A 3MCSA 1IBMJ 3OHRA 1YRTA 2MZSA 3G71S 2CRLA 2NXCA 4CZGA 1GLDG 3BSCA 3SSRA 2M4MA 1X2IA 4Y2JA 1WDDA 1RQNA 3W5YA 1PGZA 3H2VE 2CRXA 4ED5A 2VKZG 3VZIA 3ISBA 1PZNA 4DLGA 2F4VF 2BQUA 3QATA 4KFBA 3DRXA 2UUCJ 1Q53A 4OZ3A 4OJ6A 3SEIA 2GHVC 1NI3A 2OSQA 4BRLA 4ZPAA 4ZCLA 1AW0A 3D6MB 3W2WA 2YHAA 3FBCA 3QBWA 4DPUA 4E1NA 5K8NA 2CXYA 2KW4A 3HVAA 5DBBA 4KAZA 4XPEA 3H8JA 1RT2A 2Y0SD 4G1QA 2OWOA 1Z25A 2EC2A 3IP0A 3DLGA 4JB8B 2ESEA 1SZ2A 3G8SA 2HHPA 2J4RA 3MR6A 3AJ2A 3GIRA 3A5LC 2I7NA 1KN6A 4KREA 1SH0A 3SMPA 4RKUC 5I3UB 1XC3A 1V3RA 3CRXA 1R43A 1KVJA 3KLEB 2HNZA 2D41A 1RBTA 2B9XA 2BJ9A 5HI7A 3H2LA 1EQMA 3KUEA 5AQPA 2E5IA 2WHOA 2O66A 3WQPA 4I2PA 3VQ6A 2DFLA 3RBZA 3HZ6A 1RU2A 1APSA 4UB4A 3AVJA 1Z4OA 2YNHA 1Y11A 2K8BB 4P4MA 2OKQA 2ZM6K 2VH7A 1RWXB 2HHSA 4IR9A 2P6UA 3PR4A 3JSRA 3HLUA 2QC3A 1RGVA 3KHRA 3GG1A 3HJVA 2H3IA 2XS5A 4KHUA 1YTAA 1SV0A 2NYHA 4KB7A 1QDUB 1IWGA 1K8AO 2XMVA 5K20B 2MZTA 3WEEA 2BE7D 4G1PA 3PR5B 1TVRA 5H2FU 4Q45A 2FXUA 1HLUA 5B0CA 3I55S 3OLAA 2A1JB 2E1YA 1W25A 2DEJA 5F41A 2W7PA 2LDIA 4PABA 1YJWS 4F92B 1RGIA 3ZO7A 3MR7A 1RWUA 3QETA 2B8QA 4EHTA 5M1NA 2FQQB 2AIRB 4CE6A 2YMPA 1P27B 3MMCA 1YBTA 2QFIA 1Z4UA 3OR2B 1VYAA 1VI7A 5AKEA 4DV5F 2JEJA 2QGFB 3AA9A 2ZIVB 2PA8D 1U8SA 1I3OB 3CETA 3O9QA 3TUIC 4LVNP 3GJSB 3ULEA 3B4MA 2CQ2A 1JROA 3OR1B 2BQRA 5D4LA 2V94A 3BSOA 2X6NA 1EB0A 2XWXA 2YV0X 2QI2A 1HW8A 5EDWA 2QYGA 3M4XA 2JEIA 3H8SA 4C8NA 4TU9A 1IBMK 5DO2A 4FJMA 5KFXA 3WX4A 2PYLA 1V3ZA 4EI2A 2QLTA 2VBXA 2WTFA 2LFVA 3L7UA 4F4XA 1IKYB 2A3ZA 4CI6A 3C5GA 4DX5A 2Z1JA 4ZK7M 1FXDA 3VESA 3ISZA 5HRNA 4Z7CA 2QWQA 4CJ7A 1A9NB 5LJ3Y 1COKA 3IAYA 3C16B 2BEFA 2HDOA 4B3MF 3W3SA 3IAM9 5AJ3K 3QU4A 1KBRA 5J1NA 3M1FA 4NL9C 3E1YA 3E3XA 4NL9A 4IFEA 4KH5A 4CLPA 3LF0A 1VC0A 4B1UB 3PIOL 4NLPA 1QQ6A 4CJVA 3M2VB 3KKAA 1CJTA 2F8LA 1W7AA 2AHOB 4LF6F 2VBZA 2P5GA 1IQZA 4O23A 2GBZA 1HBUB 1HIYA 4FYWB 2IAJB 5H9EK 3AVNA 4Z4EA 1U2RA 3ZD9A 1SKUB 4H5WA 3IRXB 3J7AN 2VOPA 4US9A 4DR2F 1NHUA 4CF8A 1Z26A 1PJ6A 4U9RA 3W9JA 3I4PA 1ITGA 2IVPA 3BN4A 4GIBA 3V7JA 1WHYA 4ER8A 4KHWA 1NDCA 2WOMB 2LXUA 3N0VA 3P1GA 4UW2A 5LMNK 5DG8A 2QEXS 5BR8K 5AI0A 4OX6A 1SC3B 7ICGA 3HSZA 5IT0A 3OYKA 1VC5A 1RABB 1DGJA 1GNKA 2QL7B 4B1VA 4BDPA 2P8IA 4DL3A 4ID5A 3NS1A 5A0LA 1C6VA 4C48A 1W2BR 1WG1A 1TU0B 1QY7A 4NCAA 3K4GA 1WG5A 5JXSA 5AK6A 3Q2SC 3U02A 5AT1B 1BE4A 2CQ0A 2XMMA 1VFJA 3VEOA 2QW9A 4DV0K 3THYA 3H08A 2E9TA 1U2VA 4DHYA 6FD1A 4ZLJA 1S8OA 1X1PA 5A76A 3OL6A 3AVHA 2NO4A 4EK2A 3RR8A 1NK8A 2JVOA 2V8GA 5J8YC 3JAMY 2FLPA 3VHQA 3THXA 4O3QA 1SBRA 4XRHA 4RTFD 2DO4A 4NLBA 1TFRA 2ATQA 4ZHRA 5KFSA 1ATRA 3ENOA 2ZGYA 4OHYA 3V6DB 2AWZA 3T41A 4PG8A 4KPYA 5HR6A 3FGUA 1Y5NB 1EP4B 3HVTB 2D3DA 3MXHP 1AQ6A 4HH0A 3DLGB 3UDLA 3CDAA 4QS9A 1LEOA 3OVAA 1FWLA 4Z7YA 2UUBF 4DV7F 2VQEJ 2X3GA 1IKXB 2DR6A 1VJQA 3CDUA 1SQGA 1DTTA 4JI6J 4LF5J 1E6VA 3L4PA 2GV9A 3DKDA 4YOXA 4DBQA 3O08A 2BJEA 3DXSX 5CZVA 5CCMA 4RG8A 3KLIA 3C7NB 5IWAF 2ZTCA 3C2LA 2GX8A 2L08A 1VQ7N 3G8TA 8ICPA 3QGGA 1NKCA 2IM2A 2QWNA 5B09A 4CEZA 2MDAA 2F96A 3HSJA 2B56A 3Q22A 2AT1B 2VA8A 1K8AT 3Q8KA 1TK5A 1QSLA 3CXCM 4C8ZA 1IBLF 1HW9A 3CJBA 2DHGA 4HH1A 4NYZA 4K4IA 1T0TV 3MCMA 9ICVA 3QT6A 5L9XA 4QYRA 5DM6L 2PMZF 4OZ5A 3ISNC 2O8FB 1FE0A 3MPDA 2HQ3A 3A0BU 4CGFA 1SKWA 1XNQF 2AA4A 3DRSB 2LU2A 2DBYA 5IINA 1CJKB 4DV5K 4JI1J 4Y2RA 5CCLA 5IT9Y 1ZBLA 1KN5A 1K0TA 3OYBA 3EDRB 1S1TB 1TFWA 2F1IA 2NRVA 1FXRA 3H1VX 2KB2A 2V2VA 2NZ4A 2ZZMA 4E7LA 3UE5A 4DFJA 1GLEG 3KLFA 2VL1A 3UN2A 2BGWA 1T9YA 4CEFA 4B9VA 1JLGA 4A8XA 2JH7A 4YD1A 3RAMA 4LF4F 2O8BB 5ALVA 1S1WB 5BRHA 3W64A 4RQNA 3K58A 3LOUA 3TTCA 2K4IA 2MSTA 4DUZJ 4M3RA 3RAXA 4M9NA 2VJ5A 4OV6A 3CCZA 1SWWA 1S9GA 3PDNA 4BLGA 5DJBA 3CCQS 1EKSA 3THYB 3B9JA 4P0PA 8ICKA 2FHMA 4YQWA 2ZH3A 3FDSA 5AKXA 4ZPBA 1WI8A 4BRQA 2RB7A 1HA1A 1E4GT 4FM1A 4JI8K 3NGZA 4OHVA 4OYZA 4IG3B 1HI0P 5CZXA 2HOFA 4FNIA 1TVAA 4P7TA 5KAIU 1ICEB 5AK4A 4MFBB 4M5GA 2FJEB 5GADU 3ZX3A 2W24A 3AB4B 1A0PA 1UW9A 1VSEA 3P49B 4NI2B 4RW7A 1O8BA 3KG0A 2UV8A 3ZNUA 2ZD1B 2XMTA 5L1LA 3EVMA 3L9ZA 3TARA 2WFAA 4BJQA 3FQKA 3NMUA 1CS4A 3PY8A 2DRDA 3D0PA 4YOUA 3FC9A 4ILMA 2OANA 3CFPA 4A57A 3NH1A 2IBOA 1L3TA 5AE2A 5EWGA 4LFCJ 5AKHA 1NSPA 1RDWX 2X1BA 2EG1A 8ICMA 3PFEA 5AKLA 3Q89A 1HNZF 2GO8A 2UUWA 1IBMF 5GAEP 4FJ9A 4P2MA 1FNMA 2FJXA 5GAGP 3BGLA 2V69A 2IJFA 4CLWA 4FJ8A 3R2DJ 4TQSA 1JLEA 7ICUA 3OTDA 1IN0A 5I42A 2ZHOA 3FZBA 4HT5A 5LMUJ 3KJVA 4JOUA 1YJWN 2K2PA 2KH9A 3POTB 4C23A 5IIMA 9ICAA 1PJ5A 4LD0A 4DSJA 1FEHA 4USUA 4W98A 8ICUA 4AYBD 3ASMA 1ZZFA 3E01B 3JQKA 3BS7A 2FUG9 4K2JA 5ETOA 4BWMA 2MLXA 5J2FA 2UP1A 3BEGB 1W2IA 2WOMA 1JJHA 3NGSA 4N41A 4JK1A 1B43A 2MXYA 3UXOA 2HPUA 4IH7A 3AO4A 2BCQA 4GKJJ 4LIRA 5FDLB 3ENAA 2YWEA 1RHMB 5DDQC 3JXOA 2VIXA 3RJGA 1WAJA 1T9VA 4NEZA 1WNSA 3BKFA 4CFDA 2E20A 4KLHA 3M6XA 3V6KA 1BWFO 4UB2A 3SSQA 4GY2B 4NWBA 2HQFA 1YTYA 4W5TA 4U8YA 1HHSA 1LV5A 1NZAA 4JHDB 4RNNA 4WP3A 1OYEA 1ZQWA 5HHHA 5AM2A 2OZMA 1ZYQA 3QWUA 3CJQA 1YWXA 2NXUA 1HKBA 2FZCB 3SEOA 5BYQA 4A46A 4B3RJ 4GXIA 3JAMU 2E6LA 1X4CA 2WSFC 4M5KA 3K5MA 5B5EU 3FZ2A 5HANA 2BPFA 2KRBA 3S1TA 2D0PA 3IS9A 3BF1A 1FEEA 3VAGA 5M1OA 3S8SA 4PPDA 3TUJC 3TU5A 2UU9F 3LDSA 2FJBB 1ZM9A 4P2HA 1HYSA 2ZXIA 2KJ9A 1U6BA 3MM5A 1FDAA 4Z0UA 1V3SA 5H1SV 2DO0A 5G5HA 1ZAVA 1QHAA 2FMSA 3LPUA 2C2DA 4OYOA 2OMLA 5LJWA 3D1QA 3R1LA 3SQ0A 2HBQB 4ED4A 2GJIA 2WBRA 2Y9TA 2ZD1A 1IKVB 4DJBA 4F8RA 3HSTB 1VISA 5JS2A 1TL5A 1N33K 3CQYA 3C19A 1U26A 5J2NB 4ILLA 1NZ8A 1GX6A 3BBFA 4M3UA 4I2QA 1QUVA 4P73A 5AQMA 2VFUA 4DSEA 1CJUB 1WCLA 4KE5A 2V9WA 3F2KA 2Q0UA 2MQPA 4IO8A 3K5PA 4PWWA 5D4PA 4UTGA 1IV8A 1X66A 1NGFA 1XC9A 4DN9A 1HKAA 1PG5B 5M2PA 1ZA2B 1L3SA 2KLAA 1TL4A 5K9FA 1MWQA 1QVFR 2HLUA 1ZQUA 3SQOP 2YCHA 3H8MA 1FKOB 2MHEA 3KLFB 3G2XA 4NZ7A 4DQQA 1RDUA 1DT9A 1Q7LB 4NJ8A 1ESVA 1X5TA 5CY4A 1KQQA 3PACA 4CZHA 4R66A 2W43A 2BJDA 4WFXA 1SAZA 1A77A 3QX7A 1D3WA 1FDDA 3FNNA 1S3XA 1T6CA 1RHKB 5ETMA 3OYNA 1IXKA 1WDTA 3SQIA 4JI0F 5JMNA 3DFEA 1NPPA 4OKKA 1N5YB 3H5YA 5ALYA 2QWMA 5HMYA 2J6UA 4J37A 4ZIVA 2MZRA 4RUAA 4PXBA 2KK0A 2ZH9A 4DB3A 2IM3A 1O6XA 1SC4B 1XU4A 1YBUA 4QW8A 1P8GA 3CJ8A 4DV1F 5SWMA 4AHTA 3QEVA 2ASLA 5E3CA 4FM0A 4F3QA 3ULHA 1Q7YO 1CZ9A 4FJJA 3R7NB 5GINA 3IFRA 1GX5A 4RQ0A 2X7IA 3CF5Q 2CQ4A 3KKSA 1N52B 4URQU 4J9VA 1RAIB 5AIBA 2K1RA 3QT8A 4RPYA 3PNCA 3HI0A 4CW7B 5CB1A 3VCBA 4DV4K 4NM1A 3I33A 4UZCA 4ED6A 5DB8A 3MEGA 3UKRB 4NL5A 3EWGA 1SS6A 2YB4A 2BCUA 2D0CA 1UEKA 4G1IA 3JPRA 2F8HA 1Y10A 1IR0A 3OYIA 4XIUA 1RKIA 2QG9B 3QUCA 2FIUA 3DRPB 3SJJA 4K2XA 4KY3A 4EENA 2OI2A 2R7SA 3KUHA 3BR8A 4I9LA 1VK3A 3ZDEA 3PIPQ 3SBTA 4ICAA 4ZVOB 5AQNA 3MGHA 1UWAA 1J6ZA 2F9WA 1WC1A 3C2MA 5ALSA 1YQHA 5DB9A 4RPFA 2NRWA 2KVIA 4OI1A 4AH9A 5B0FA 4A8MP 3G25A 4I28A 3V1RA 2KMDA 1IKVA 3TYTA 5KFOA 3UD4P 4LFAF 4U7UD 1VQ5S 2M3DA 2EZXA 5J2NA 1GXLA 2FLNA 1G15A 2P2CB 2QARB 3IO1A 3O4NA 1QJHA 4OPAA 1YIJS 2IHNA 1DRGA 2WMMA 3WDOA 3ISDA 2F5GA 2OEMA 1UAXA 4KKOA 2H5JB 3QIPA 2GWSA 4EU0A 2QSWA 1EIYB 2A6AA 5B8HA 1FK9A 3T9NA 2FY8A 2PKEA 3CQXA 2YWGA 2F9JA 3RRHA 3FZHA 3NWRA 4CBWA 2J8SA 3KKAC 4OX9F 3QEPA 1T9WA 2D3UA 4M9LA 2FB0A 3ALRA 1RAHB 3TUZC 1VC6A 4DS5A 2FZKB 2A1JA 4UARA 1UMJA 4ZITA 1N62A 5F8IA 2YNFA 4G6VB 4CTAA 3O3HA 5KFBA 4MQ3A 4LF9K 4KLDA 6FDRA 2LKZA 4ILRA 4LZGA 3ATUA 3DXKA 2B7CB 1DTQA 2WW8A 3NLCA 3MMCB 1Q16B 2Q0RA 3UI3A 3JTNA 2D6FC 4Q0BA 4BVOA 1GMWD 2Z30B 4DCCA 1QZ5A 3W60A 4URGA 3BY5A 3VGSA 2XY8A 3CDBA 4J2DA 2HF4A 3BO2A 3NVVA 3Q8PB 3HXMA 4RNFA 4Y2SA 5AM1A 3M30A 4XTTA 2DQNB 1UPHA 4AD6A 4DR5F 1UOCA 4XQ8A 2LYHA 5ETNA 5HATA 4BDZA 3K17A 3P31A 2ZC4A 4URSA 3NS6A 4M63C 4BRGA 1F2HA 4JI2K 1RQ0A 4EAHD 2QRRA 4PQAA 1H72C 3SMZA 2IIRA 4DV0J 1NMEB 1L7PA 1KC8T 4Y2MA 2OTJS 2PFUA 2OAUA 1FRJA 2O8EA 3W66A 3NHGA 1ZQCA 3SNNA 5AKGA 3KUGA 1S1UB 2YMLA 4WK3A 1BIZA 3DDNA 2MSNA 4PL7A 2DR9A 2DNHA 1LOTB 3NAEA 1LW0B 3DLEA 2R2TA 2FGOA 2DGXA 1S97A 2FJDB 4K8ZA 5IIIA 8ICSA 2FBXA 1YLXA 1HBOA 2GO7A 2YH1A 2YKQA 5KG6A 4PKDB 1SV5A 2IDOA 3AHPA 2D3OR 5H9FK 5AICA 3BV8A 5F0XA 3MEEA 4JYAJ 1N33J 1SKRA 4M5IA 4A2AA 1UPPA 4IRKA 1J9AA 5K14B 1IJFB 1AROP 2JMGA 1G7CB 2KVSA 1KLMB 2ZH8A 1EQ0A 3G0ZA 1RISA 5J2KA 4DTMA 3MK6A 3VN5A 5AZJA 3BYRA 4M9HA 4MIAA 5D78A 3OS2A 2C3OA 5GAHI 1Z00B 2MPUA 4E8UA 4CLUA 1DBDA 4W5NA 4DR4K 1YVUA 3QIPB 3MX2A 4F91B 3AVLA 1Z05A 7FD1A 3C6AA 1VBKA 1JLCB 2VJVA 4RJVA 1LKYA 1HFEL 4ZCMA 2RE1A 4Z94A 3RJFA 2V67A 4XK8C 4USKA 4N7TA 1C1CA 4PZOA 5J0UA 4FS1A 2IIHA 1NAQA 2HS3A 4CLSA 2WC9A 1IBKF 4K50A 3UXNA 4U7CA 1V9OA 1B0TA 4YN4A 4ISFA 4KGXB 2JC1A 5C0YA 3GJQB 3C6TA 3MM8B 3I76A 4KB1A 1X9JA 3W7BA 1SWVA 2WZ1A 3HPHA 4MF2A 4OV1A 2G8IA 1J53A 1NK0A 3GV7B 1XERA 3R7BB 1TAQA 5DG7A 1OYDA 4Q0BB 4TU7A 3DWLA 2BW7A 1J2MA 4P4OA 3LAKA 3IBWA 1TUUA 2RP5A 4WTOB 1F0MA 1M6YA 1DURA 1HNXK 1YJVA 2D7SA 3RR7A 4GKJF 2W2PP 2R8HA 9ICIA 3V81A 4NCBA 4QCLA 4CYUA 2ERRA 4BACA 3MCAB 3ET6A 1F3FA 3MCPA 4OGCA 3FAHA 3T79A 2M9KA 3V4MA 2RN2A 2BX6A 1U1LA 2D3O1 2XGPA 4GV9A 4CJ3A 2XZDB 1YRXA 2E29A 2YNGB 3GV5B 1XNRF 3OYAA 4FW2A 2QMXA 2KEYA 8ICTA 5C42A 4DL4A 5ETLA 2RHFA 4RT3A 3QUBA 3D7EO 4CLTA 2V2QA 3UMCA 5KFEA 3MM6B 1BIUA 2DHXA 1HUXA 3LVVA 3VEZA 4DMZA 2Y0SF 2N4CA 2VQEF 3ZT0A 3P38A 2H3GX 4EFAC 5D6GA 1FX4A 4RNOA 1QTNB 1NOMA 4I2HA 3VAHA 2IBKA 2ZOGA 3DU5A 4NLDA 2DK2A 3L8BA 2ADCA 2GIQA 4FF1A 3QEXA 3T6BA 4P10A 4KX5A 1RWPB 4W5OA 4F9OA 4TURA 1X9XA 1F9HA 3QPIA 5LXYA 2G8KA 4HCBA 1EXNA 3ISCA 5ETSA 4Z4HA 4OPKA 4UF4A 4Y0FA 3DI6B 4YDDB 3IFEA 4FYVB 1FDNA 3O3FA 4H0OA 2X51A 2EZYA 2RMLA 3LP2A 4XH5A 3DXKB 3SQGB 3QUTA 3X1LB 3S41A 2GCFA 4US8A 4FFDA 5DQIA 3T1YK 2XI9A 3A13A 1T9UA 2B4PA 4PUOA 4UOGA 5DDMA 4OZNA 2M0NA 1U0HB 1TUGB 3QLHB 3BGRA 3G96A 1D9AA 2OPQA 1DTQB 4O8KA 4ALZA 3W61A 1HHTP 2XNQA 4UAYA 4IFVA 2FBYA 4MKYA 4IH5A 1L7NA 2K8CB 2B51A 1J2NA 4IFYB 2HI0A 4BC4A 3M1VA 3D68A 3AQEA 5FLXU 4HHTA 2ZBQA 3AAPA 3IGNA 4USMA 3NBPA 2ZDPA 3JYTA 2BJ1A 4DSLA 1VSDA 4JI5K 2MLYA 4DHVA 1UHUA 4O3RA 2ZJQL 2RQ5A 3VTHA 9ICLA 4Y2UA 2HFOA 2YQ0A 4C0BA 3FM9A 5DZ7A 3R3LA 2GVDA 1BG3A 2O8DA 2DNNA 5KT3A 2FPKA 5GAGI 1NPRA 2YKNA 1WF0A 5GAEI 3EXCX 5HOOA 1BQMB 4J5OA 3MOJB 3CFOA 2DH8A 2FVSA 4O55A 3GFHA 3O9SA 1BHLA 3D2QA 3G6EN 2HHQA 4DL5A 1OH6A 2EFQA 4WFNL 1R8PA 3HILA 4NEYA 3UWTA 3ZEUB 2YNIB 4QZIA 3G82A 4TY9A 3ZT4A 3KD3A 2BE2A 2IA6A 3AL0B 2GJ2A 1N54B 5LM7E 1DQ8A 3WUHA 2OJ3A 2F4VJ 3RH5A 2Y0SC 1ZZNA 4KR0B 2KI2A 5IFMA 3KYLA 5G4DA 4XEIA 3VGUA 4C9DA 3IR6B 1R0CB 2D0OA 4YVZA 3IM8A 3Q2TC 1BPBA 1XSLA 1JXLA 1HJRA 2MTLA 2F4VK 4JKGA 3ZZ0A 3MEEB 1WI6A 4BHQA 4DV3F 5DB6A 3GIIA 1SJ4P 3TR8A 4LC9B 3TAMA 1CC7A 3KK7A 4KHMA 2CNKB 5DBCA 4ED3A 1T6DA 3QU2A 2Z8QA 1JLFA 4QZEA 1Q8KA 4QIGA 1KLMA 1FKAF 7ICEA 5MLCV 1IUJA 4FJIA 1BUPA 1IKWB 1VIXA 1NXIA 1NBWA 1B0VA 2EK1A 1P90A 1EJ7L 1HI1A 1UQVA 3QRRA 4OZLA 3CNQP 3M32B 2KFZA 5IC6B 4Y3CA 7ICHA 5AQIA 2JZBB 4A8WA 4K0KF 1O0PA 2YMMA 4PHPA 1FRXA 2HBYB 1SXDA 3DCAA 3VAFA 1NM2A 2K8AA 5HVGA 2M8HA 4BXOA 3O8WA 2P9PA 1B22A 2Y9HA 2HMIA 2VWBA 3GL1A 3DI6A 4M5JA 4FPAA 3O9UA 2F63A 1YTUA 4R63A 2DNRA 4DR4J 2PEHA 1RBAA 1RZTA 3THTA 9ICMA 3GCWP 3MM9A 5KFPA 4YFKA 1BL3A 2Q1NA 4KB0A 2PXIA 1T9TA 3OXGA 4HWIA 1YJ7A 1WSFA 5D0HA 1NB2A 3ITHB 4CD3A 3BS9A 5BOLA 2BA9A 3GZ7A 3LP0B 1NU4A 2YHWA 3QEBZ 4KTZA 1JXVA 2PY5A 3RB0A 1QE1B 2NQPA 1WKLA 1RBUA 3KWGA 1RBSA 3VWSA 1ZQLA 2CPDA 3QMLA 1FXLA 3OJUA 4ZVTB 2BJ3A 1X6JA 1S49A 3KNAA 4RQMA 4DUYK 4B1WB 3OVSA 2R3VA 2IOFA 4KBOA 4Z6DA 3KFUF 3C0BA 4C3KA 2VOOA 3CWJA 2UXDJ 2KG5A 4M3YA 4Y2TA 3AQFA 1MWZA 4JI5J 1N34K 1SJQA 4RW6B 1N88A 4CYUB 5A2QY 4BS2A 1HYSB 3W62A 3O0FA 2GVZB 2RF2B 5CE3A 1D5AA 2BW2A 2I1QA 1T03B 4J9SA 5C42B 1KDNA 2JX2A 2Q43A 3SV3A 5AHXA 1RWVB 4K0KK 1QTMA 3U27A 5A8RA 1HPZB 2N3LA 1YI2S 1SC6A 1E6YA 3QAUA 4CF2A 1M1KO 3UN3A 4GV3A 3MEKA 2AJQA 3MPUB 2H65B 4M6WB 3NGTA 3I31A 4QOZB 1P1TA 2BKPA 3H0MB 1WAFA 2W1BA 1DEJA 2XB2D 3M6VA 4Y65A 3KLHB 4ECZA 2V50A 1CVJA 2E8NA 1BQXA 4Q2LA 2OPSA 3HHEA 2BRLA 4NZ6A 3BEXA 2H4YB 2YPYA 2I2YA 3ENQA 4QPTA 2VICA 4RQ8A 5AQUA 1VQNN 3V9UA 3ZNJ1 4Y2PA 3TTFA 2OUGA 1FRIA 4DO9A 2RRDA 4AXIA 3IG1B 7ICPA 4ELUA 3DEEA 4DOCA 1TUYA 4J91A 5ALWA 1NSKL 4LF9J 3ETRA 3M9NB 1ZS6A 1RAFB 4P52A 3NXZA 4U96A 4ZVPB 1TAUA 4C8MA 4C8YA 1XNQK 1NMNA 3TQEA 1QM9A 2Z2YB 5EX5A 2PBDA 2UU9K 4CJPA 5CHIA 4CJEA 5C25A 4IFYA 1C0MA 4CZEA 3A0HU 2ZJRQ 3F9KA 4QIVA 1BQNB 5ALPA 2FHKA 2KKHA 2F7TA 5ALIA 4OPHA 2I5JA 4UW9A 3DM2A 3WNGA 3GFYA 3CCUS 1UT5A 1V6HA 1WACA 5HK4A 3ZTSA 3L4BC 5J2DA 2CPIA 2LM1A 2YKNB 2UUAF 2OSRA 2LQ5A 3MMVA 3MXIA 2WB4A 3PYFA 3QFWA 2PEBA 2UXBF 3DMJB 3T1HK 5DQGA 4Y2IA 3WKBA 1C0UB 2RSQA 2PI4A 3P83D 4ZVGA 2C3MA 4PAAA 2MZQA 3RMAA 2WSEC 1NGCA 4LF9F 2D0BA 1UFWA 3CIPA 4Q7AA 4A8OA 2RDIA 2X1GA 4DV1J 3O1LA 4ZVQB 3PYGA 1T8EA 2H1YA 1SV0C 4ZPCA 3LDAA 3JPSA 2PIIA 4I2JA 1PVRA 1RHUB 1NG9A 2DF4B 1ZM3A 4B9QA 2KL8A 3KBBA 4EELA 1F3VA 1Y5LB 1HMVA 5CYQA 2WB1C 1VS3A 4KAIA 4BC9A 5CXTA 2DNMA 1X3MA 2ZNYA 3LO3A 3DOKA 5EX3A 3UR0A 1ZD3A 1LWXA 1YJNS 4PZVA 3TPQA 3P3DA 4DL7A 3TANA 1WCNA 1C20A 2ZE2A 3U1MA 3J7ZT 1E6YB 2OEHA 2ACYA 1OMSA 4FP9A 4X4QA 4MAKA 2VIHA 4B1ZA 4BC2A 2E1FA 3P45B 3VAKA 4MKAA 5JJBA 4BVPA 3QFHA 4AILC 3AVBA 2I8EA 3ZZUA 2OYYA 4KLFA 1HI8A 3NH0A 3QUQA 1O08A 1LFWA 4J9OA 3WK7A 2Q66A 2BABA 3IDWA 2HBKA 3CPWM 1ILYA 4KHSA 3OPKA 4UATA 4B3MK 1RA7A 5HNKA 2DKOB 1A5XA 3DJCA 2ZBPA 4CJTA 3M8PA 4JI3F 1KKHA 2DRAA 2GA7A 3FZKA 3MUVP 2UUCK 2U2FA 1U6FA 4X65F 4DUZF 3NVWA 1JB0C 2HVIA 1D0EA 5D4NA 5J0WA 1QQ5A 3ILLA 3NUQA 1Q46A 3IUCA 3QRQA 3FMBA 3C8YA 1UA1A 4HAIA 4GVLA 1VQ9N 5A6WA 2DH9A 4Y2VA 4DTNA 4CGGA 4YFUA 1SIJA 1HPMA 3NY0A 3VEXA 4E7HA 1Q8IA 3K8VA 4XAKA 2R7UA 3FSYA 4WZMA 2VDHA 2F3JA 3G4SN 2O4IA 2RU9A 2W2OP 1U1PA 5MAOA 3W0LA 3K2YA 2B4JA 3PEJA 1XHXA 2G13A 4OLOA 1KS2A 4CIFA 4DOBA 2Z57B 4BE0A 1HWKA 3O9TA 4K5RA 1SVDA 3CHWA 4GKKJ 5DG9A 4UBCA 4EP4A 4Z4FA 3HHLA 2KKVA 5GTHU 2DCUB 4RQ7A 2GIFA 3DU6A 5FIIA 1T44A 1RTIA 1LWEA 1NHKL 3DLLQ 3ENBA 4J2EA 3NASA 4DCJB 4IOCQ 3CCMS 1OUQA 5KGXA 3I6PA 2E8MA 1MN9A 3A3NB 4M5DA 2AH5A 1QAIA 3HT3A 1NK9A 9ICCA 4F72A 5KNIA 5FPEA 1MA7A 3FYHA 4O0IA 4LFCF 1X0PA 3OYCA 4M7XA 1K44A 3LW5C 1RXWA 2DXEA 3HOSA 4KHPK 4NLGA 4DV3K 1SL0A 3CCSS 4N77A 3OFHA 4F36A 1FNOA 4OJHA 3PM9A 3H46O 3FK4A 2XS7A 1S72S 3K9KA 3PYEA 2KT3A 1P1LA 2HOEA 3HKZF 2BJ7A 2HSEB 4KHYA 4USJC 4BRMA 2R7RA 1CG2A 1NM1A 3CD7A 1RTJB 1LWFB 4DSIA 5J0PA 3CCVN 1ZD4A 4MF8A 1S57A 2X3DA 2DGQA 3ID8A 3VEVA 1B4FA 4FLXA 4CHOA 7ICLA 2OTLN 4QR0A 4E0DA 2KRRA 1J54A 3J80O 1S4EA 4YR3A 3TNVA 2HNYA 3D2SA 2KVCA 3WK5A 2XI3A 5E0OA 5KFNA 4Q8FA 4B3SJ 3HZGA 2U1AA 1WN7A 2YX4A 3HHDA 4ZVRB 1DK3A 5EE1A 3K8WA 5IWAK 3JS6A 1SZPA 2ZIXA 1VLBA 3TEGA 3IDHA 1T3QA 2JFKA 2R8KA 4HUFA 2V8PA 4JI5F 3GYGA 3DAWA 4R8UB 1AFJA 2BKOA 3N4PA 3P5JA 4BR4A 4BC3A 3AA8A 2R7VA 2J9CA 1E3MA 2V7ZA 1RXOB 4CDGA 4A8KA 1L5UA 3RJEA 3DHWC 3C6HA 1S4FA 4RUBA 3TO8A 2KP7A 3JSBA 3GOIA 4DKWA 4WXOA 2L5YA 3A5MC 1ZTWA 2HHTA 4JBCA 3TZZA 2QT7A 2HFUA 3AD8C 2RH3A 4X4TA 4YR0A 3TA1A 4ECXA 2WBNA 5IIJA 3SSSA 4I2IA 1Q3VA 4IYQA 3HHLC 3L2QA 1Q9YA 4P2XA 3AEVA 5E84A 4RWWA 5D0GA 5T7BA 2ASMA 3PW5A 1BA1A 4O5FA 5AK3A 2DXFA 3AY0A 5J2AA 2Y8WA 4ZOSA 1Q1KA 1PK3A 1HR0J 5A0YB 4I2CA 3ZSXA 2M88A 3ORYA 2B8PA 2I1RA 2JL9A 3KKRA 3O4QA 4B08A 4FNHA 1FO1A 2AJ1A 1ULRA 1S99A 1SJ1A 4IQVA 3Q83A 7ICTA 3AQPA 1Y4ZB 1UWBA 4DV2F 3W2VB 3HSGA 1BY9A 4WFBQ 5ITHA 1JX4A 4YORA 2WSCC 2G0CA 3WIVA 1VDVA 4DQIA 4IO9Q 5BREA 3UQ2A 1ELOA 3NAIA 2J0SD 1EAYC 3I56S 2UUAJ 1RWNB 2YBVA 3VOVA 1CC8A 3SDEA 3ZC4A 4X84A 8AT1B 1JWWA 1ZQPA 1JNRB 3MMAA 2ZE2B 4BG8A 1ECWA 2DTJA 4O5CA 2ALZA 4F26A 3OYHA 4AYBC 4IXCA 2MKJA 2DL0A 4YHHK 3R5JB 1RT7B 2G08A 1NO8A 2D1CA 3EZ5A 1PK1A 2K3IA 3M8YA 2ZG6A 4H03B 3BQTA 1S0OA 2BANA 3L7OA 3HT0A 3M6KA 3O9RA 1EKRA 4OLPA 3E66A 3EKUA 2E5SA 2D9PA 3DNCA 3VGTA 1NGHA 4CCHA 1F5CA 1NKBA 2DNLA 3RB6A 5AQZA 4QZVB 3LVWA 2AKWB 2W01A 5J2HA 2KG0A 2L48A 4CFAA 5HJYA 1R8AA 3UD3P 1ZAXA 2JHDA 2P6RA 2HNYB 4ZPWR 4IC9A 4DV2J 3VV2B 1HD0A 4DV1K 1Z3EB 3OL8A 4ZP7A 3MDAA 1T9XA 4YD2A 3WNEA 4J9PA 2DITA 1RB0A 3IR5B 4LF6J 3ZXWA 1CJKA 1VQ4S 4M9JA 3IM1A 2HNDA 4NZ0A 5E3PA 3U4LA 2E1AA 4ZVEA 4JI7F 4QWEA 9ICPA 4KLOA 2DVIA 4ZIWA 4BWJA 3PHTA 4JI2F 5CRXA 2HRUA 1KXPA 4KSEB 4KLSA 4ES1A 3M2RB 1R6VA 2J9DA 1RT6B 4BR5A 3PW7A 4F02A 1OQ6A 3R6GB 3IAS9 4IG0A 4PWUA 3NF6A 3LZIA 3GWCA 2YX7A 3MDFA 2Y8YA 1L3VA 4BRHA 3BQ7A 4OX8A 1RPLA 1RWMB 4E19A 5C2FA 4GVBB 3PJXA 2BVZA 3CCQN 2B9EA 4Q5VA 4RQ4A 2EDUA 2XSFA 3O3LA 3WKEA 3TX0A 5IXUA 5E26A 1X8DA 2HHXA 4Q2MA 1WWHA 2O8CB 4ZP9A 2CJKA 2XY7A 4RPXA 4DFPA 4H5NA 5ALNA 5HR7A 4LSNB 1RTIB 3V72A 1HWIA 2JZ5A 4QIWF 4F0KA 4CEOA 3MMJA 5ALOA 4M7YA 3MCOA 2XNRA 2ZTDA 7FDRA 4FJXA 2IS3A 1VQ5N 1TL1B 1YXQA 3NGRA 1KQSR 1BQMA 2E1EA 2W8KA 4NRUA 1B7FA 2QKQA 3JPTA 1BHNA 4LRBA 4WPAA 1DY3A 3VQSA 4KFBB 8ICJA 1M5SA 1ZQBA 1J27A 5M1PA 3OTOK 5AQYA 3CJRA 1NDLA 3MD1A 3SUQA 4LY7A 4PKHA 2RNEA 4IOCL 4DPTA 3HYFA 4OPJA 1PO6A 2F76X 1D09B 1NBEB 4AUKA 5L38A 5E5NA 1C0FA 4QR1A 4X2BA 5KG2A 4DL0C 1OH5A 1WORA 4NOHA 5AM3A 3AJ1A 2RQKA 4KH1B 1VQSA 3W5ZA 1K8KB 3H5XA 3B4DA 4QJVA 5I3UA 4DXLA 4FM2A 1VQLN 1RACB 1XNQJ 4B3TJ 1NJYA 2HZVA 4JK7A 4ANDA 3FCWA 3CJ7A 1K73O 2UXBJ 3RRGA 3UKUA 1OSCA 4UZBA 1NGJA 2KIVA 3NEKA 1BPEA 1XHZA 4K0KJ 4EEKA 3NGYA 3SIPB 3D2FB 4EZ9A 1JLFB 3I9ZA 1HJOA 2GGPA 3AOBA 3I9V9 3UDEA 4OYIA 4CGJA 2BANB 3DOLB 3NH2A 2KHQA 2HBRB 2BGGA 2BKEA 4N5SA 1GMVA 4EEYA 2XYPB 2KKZA 4HUGA 1RTHB 3RMCA 4ZJLA 3PUFA 1OY8A 4LF2A 3FBEA 4H4MA 3K57A 1Z19A 5AR0A 3UDVA 2G4BA 4NLCA 1BU6O 1EX4A 1AYEA 1XNSA 3BS5B 3FSIA 1N36F 3UVJB 1YAGA 5IQQA 2DFFA 3WKCA 1HQUB 5KFVA 3NP5A 2Z2ZA 1U48A 3LWMA 1OO0B 2IGIA 4B3SF 2DPIA 2JLGA 5TZVA 3UFCX 1VQPS 3G86A 1J5OB 4DCPB 3GJTB 3PLAA 3R2CJ 1PCAA 2DRBA 1X4EA 2P9IB 1Q4RA 2QTDA 2QLBB 3Q8QB 3WBZA 1SQKA 4P0QA 4M1KA 5J2MB 5BYRA 1U49A 3AVAA 3ZSYA 5AM5A 4IQMA 4V19S 3EXYA 4ZJQA 1AZSA 5ETQA 1EXQA 3MR2A 4C2MA 5AQGA 3TFRA 1Y3KA 2Y1LB 1PVQA 2J6SA 1F6TA 2MSSA 1U1RA 3BZCA 3CIZA 4JI3J 2F1HA 3A8KA 1F2GA 2LDYA 5KFLA 9ICJA 3VEWA 3ETLA 1TV6B 1Q3UA 1RUSA 5CA5A 2IMOA 2QSFA 2Q6BA 3MWPA 1TL3B 4JI0K 3I0RB 3F0NA 1DXSA 4CF9A 3NCPA 1YF5L 4KC5A 4CVNE 2YNFB 4LFAK 2GUIA 5F8LA 4J03A 4B3OA 2AX0A 3MXJA 1P8ZA 4WQ5A 1VQKS 2VANA 1U09A 2JJ4D 4O44A 2EPIA 1NK7A 2HNZB 3AM9A 3A12A 4K59A 3ELHA 4JV0A 3GR1A 1FCAA 3UPFA 1P9QC 3R6LB 1VQMS 1GXUA 2GC8A 2R7OA 3V6DA 2OM6A 3AAQA 1PC4A 1GTHA 1X4DA 3ATVA 1X6IA 5AKZA 2MHNA 3D0GE 4BRDA 5J2PB 5J2QA 3SCIE 4JI1K 4LIWA 3CP8A 4O5BA 2P9UB 1DJ0A 4D3HA 2ZUAA 3TTDA 3KLEA 5IOLA 1WC0A 4NA3A 4O0NA 4LF8F 4C8KA 3OLBA 1BLUA 3UKUB 3GLJA 2P9KB 1HIWA 3BPSP 2AGQA 4F4AA 3TVYA 1W2BM 1EKEA 2FPMA 4ILHA 4M45A 1OKJA 3R9KA 4TU8A 3TAPA 9ICQA 4CRXA 1FRKA 1P9YA 4HTJA 2AYMA 3I82A 2EFNA 2BBEA 4IEIA 1RWWB 1UL3A 2OGUA 4I68A 8ICAA 3L7PA 1BISA 4QIWC 4X64J 3CCEN 4DWIA 3ZETB 3OXLA 3MD3A 4FZNA 4BROA 4DS4A 4M3TA 2DGUA 3TSQA 3PX4A 3SUPA 4OJ5A 4F4ZA 1JMTA 1PIEA 1IJJA 2XBPA 4ANEA 4I6MB 2CWKA 3SMSA 4A61A 2RPIA 3LGNA 2WW4A 3GE1A 4PY5A 4XUSA 4NYPA 4C4WA 2L41A 3U6FA 3SK3A 2J7UA 2PMHA 4YB5A 2HHHF 4DU3A 2W4PA 1FW6A 5ADZA 3S3OA 4JI6K 3CIMA 1U45A 3C95A 2DUYA 5BJRA 3H7IA 4TXSA 3UQSA 1WUDA 8ATCB 1T95A 4IO1A 4OFZA 3OUYA 4UAUA 3CC7S 3AVIA 2IVMA 3BYPA 3HHKA 3CJ0A 4ZLPA 2KV2A 2RHKA 2WAQF 1HHQA 4JKFA 4RWTA 2DNKA 2Q3PA 4NA1A 4MEXA 2ILYA 2V0NA 3D2WA 2DY1A 2H48B 2Z0GA 4M5HA 1JLGB 2X6SA 1FE4A 2K7KA 5KFYA 1U1QA 3AARA 3KWMA 1HUOA 2B4UA 1RQLA 2JGAA 4ZMMA 5JICA 2HIQA 2EI5A 1K73T 1TMJA 1ZBUA 1KRPA 5AKKA 4ITSA 5H9EJ 2CA9A 1RG6A 2KD1A 4QQBA 3FRYA 1FHTA 5L1MA 4JB3A 1KOHA 4LVOP 1UJ4A 4JI2J 2HQIA 2XQCA 3ZCMA 2EFPA 1ATNA 1I6JA 4NX9A 3BR9A 2OPPA 2PZSA 5L46A 1B4SA 2A10A 3E2EA 5J0QA 4I67A 5AQJA 3L2WA 4JRQA 3U26A 2EG2A 3VF6A 4HDGA 4KBIA 2W6LA 2CZ9A 3D6HB 4PPXA 2W41A 5JU5A 5LSLA 2IC3A 7ICJA 1XNRJ 3VAMA 3O6WA 1X40A 1AUDA 2RRBA 1Q78A 4JK8A 4FE3A 1GXTA 2K4PA 2QWOA 2CGJA 3VQPA 5BOMA 2N3OA 4DQRA 2O1PA 5J2IA 5CA7A 3DOMB 2MUTB 1X9SA 1RP5A 1LWCB 5IV4A 4Z6CA 4FOEA 1S72N 3J7YU 3C14B 3SBGA 3BDEA 2QLXA 4YOWA 4DTRA 3ET6B 2K3KA 1BWVA 2DFHA 3T5JA 1B99A 3MM5B 4ZPTR 4ACOA 2YWHA 4R25A 3HPOA 4UUWA 3W5XA 4FS2A 1KC8O 4RW8B 3SD7A 4DPYA 4B8CA 4JD2A 4ZP8A 1HR0K 1IWAA 3K7RA 4TY8B 3QINA 1X3NA 2L9NA 2G8HA 4AHRA 3C21A 4ILGB 3MFHA 2GLEA 1AXQA 3PEHA 3VMFB 4LVSA 1NJWA 3T7ZA 4YOTA 4ZVUB 2V9KA 5JLHA 3POTA 5KRTA 3RUBL 3I0SB 5ALXA 5LY3A 4ECVA 2O6KA 2P5OA 2G5HB 2DH7A 5CH7B 3UNYA