1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA PRIMER STRAND
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
1LB2B 3V6JA 4ZTJA 8ICTA 2P6UA 1ZJMA 4J2BA 4O3QA 2F1IA 3C5GA 1UOCA 1WSEA 3LDSA 4JRPA 1RBTA 4IR1A 1S97A 2RDIA 2C28A 1WSGA 4I2FA 1GOCA 2VG6A 5KGWA 1KRPA 4CEDA 2NRZA 2PZSA 7ICHA 5DDMA 3AV9A 3SUOA 4JV2A 5FRMA 4F91B 4OGCA 3AU6A 1KTQA 1GOAA 3V9UA 5HRSA 4YD2A 3LP1A 3QEVA 8ICAA 9ICXA 4FVMA 2V4QA 1FKPA 2Y1IA 1BCOA 3T19A 3DOLA 4QAGA 4Q0BA 4Z6CA 1N5YA 1UA0A 1B9FA 5HBMA 3ZDCA 4RQ1A 1C1CA 5EWFA 3O4QA 4JS5A 1HYZA 3EZ5A 4JWMA 4DSJA 2JGUA 4F4ZA 2B21A 2UVWA 3SPZA 3BGRA 5CYMA 2HHXA 2V9WA 4CIFA 4FM2A 1NK5A 4C8KA 1TKZA 4K8ZA 2YNHA 4BWJA 4Z4FA 1XSLA 3Q8QB 3DLRA 2C2EA 2F96A 1TL1A 2DFLA 2FBYA 4J9NA 4KB0A 1XS9D 3KTQA 4FJ7A 3JPQA 7ICEA 2F1JA 3PW4A 3NF7A 3TABA 1NOMA 1LWCA 3AO2A 1V9PA 4FW1A 1JLAA 3SUQA 3S3NA 4IBNA 4CJTA 3PV8A 4YR0A 3BQ2A 4B9UA 4O3PA 4FK4A 3KHHA 3AA3A 3ZDBA 3WNGA 4QWCA 4I2AA 3QEWA 5J2DA 4KHUA 9ICNA 4DL6A 4KHYA 4ECWA 3LALA 4KFBA 3FDSA 3AA4A 4OVLA 4I2CA 4DSFA 3HT3A 4F4XA 4B8AB 4E1NA 3CM5A 4Z6DA 2YHAA 4DFMA 3K57A 2BHNA 3M9OB 3VQ8A 4OLAA 3LPUA 2ITGA 4EZ9A 3T1AA 3K4GA 4NCGA 4MFBA 4PGYA 2D5RA 3VQDA 2HHVA 2QKBA 4EBEA 5CY4A 1QE1A 3H8SA 5KG7A 4RNMA 1DLOA 1T8EA 1LV5A 4CHZA 1SKSA 4CEOA 4ECXA 5KG1A 9ICCA 1WAJA 4QZEA 1NKBA 2KTQA 3V1RA 3RJGA 5KT7A 2ZJ8A 3C5FA 1TKXA 5HROA 4BXOB 4IFVA 4J9OA 5EU7A 3OHBA 3ZT0A 4O9MA 3VQQA 4F4KA 2ZE2A 4CF8A 4CIEA 1C0MA 4PPXA 5DB6A 3JPTA 2HHTA 3BQ1A 4DTRA 2J6SA 9ICPA 9ICEA 1S5JA 4RT2A 1HQUA 3AVHA 4E1MA 3TFRA 1ZQYA 1JLQA 4RQ2A 1RT4A 3KK2A 4C8NA 2IOCA 4CGDA 4MFFA 5KFEA 1BI4A 3C1YA 2M9NA 4QZIA 1ZQSA 4UAYA 4M9LA 3OYMA 8ICOA 4BXOA 4KLHA 1JIHA 1JXEA 4DMNA 2W9AA 3G10A 1JMSA 8ICHA 1MSWD 5J2QA 1ZBHA 4NYNA 7ICIA 4LVSA 4I27A 4MFAA 4FLUA 4OKJA 3U3YA 2XHBA 2G8HA 1TVAA 3OYNA 2G8VA 4CGGA 3RWUA 4KPYA 4L8RB 1TV9A 3PUFA 3RR7A 4FLXA 4R63A 3EW9A 3O3GA 2JLEA 4FLWA 4YNQA 1ZQWA 9ICKA 4CERA 4FM1A 4IFYA 4O55A 3V9ZA 5KFXA 2WONA 1HMVA 3A2FA 4I2DA 4XA5A 3VN5A 4UB3A 2UVVA 5KT3A 4CFDA 3CFRA 3UXNA 3AVNA 3KD5E 2O4GA 5HP4A 2FPMA 1O1WA 4F5PA 1BL3A 4DTMA 3SUPA 1NJZA 5HP1A 4CFAA 1UT5A 1ZQCA 3L2VA 2C2DA 3VQPA 1RT7A 2ZTCA 2AQ4A 4M04A 1F21A 4DS5A 3OSPA 3ZSYA 5KFMA 8ICJA 3AO4A 7ICRA 3GDXA 3ALYA 1TK0A 2Q3SA 3MFHA 4DQSA 1EXQA 4W5NA 3HXMA 1S9EA 4YN4A 8ICEA 9ICJA 2HVHA 4CJUA 1ZQAA 3P5JA 5KFQA 2OA8A 1BPYA 4IQVA 2XY8A 4Q5VA 1RDCA 1I3AA 4DQQA 1KLMA 4CHYA 4DU4A 4M45A 1KSPA 3HP9A 2FBXA 7ICLA 4YFUA 4KI4A 9ICHA 4DSLA 5TZVA 1ZBIA 3RH5A 3N4MB 3KLIA 4RW7A 1CXUA 2FPKA 3LDAA 1ZETA 2XCAA 3HP6A 4ECYA 3UIQA 4MQ3A 1RNHA 4CGFA 5IIOA 4W5TA 3LZIA 3C2KA 1KFSA 5KFRA 2Z1IA 4CK2A 2V4RA 2G8UA 5C5JA 3T5LA 1HYVA 2VG7A 3CFOA 2AU0A 1HNVA 3K75D 3FFIA 4DSKA 1D5AA 1U47A 2ISOA 3QEBZ 1DOQA 3EWAA 3OYCA 5FROA 1X9SA 4FJXA 1U04A 3B0YA 4CJVA 4CJRA 1MQ3A 1YVUA 3AVBA 4M3XA 4DU1A 1BHLA 3MEEA 4ED0A 1ZQBA 2KFNA 2P51A 1JL1A 1AROP 2WOMA 4RUAA 1KCFA 5KG3A 2MUTA 2ALZA 4MEXA 2MUTB 4EBDA 3V6KA 1C7YA 2BCRA 2IHMA 3HJFA 3ETLA 4ECZA 1QTMA 9ICUA 4O3RA 4IR9A 4DQPA 4CIGA 3TARA 2X78A 4CJPA 4J2DA 4M9JA 1D9FA 2R8HA 9ICOA 5KFPA 3ZSOA 4O4GA 4NM2A 3MEDA 5J0YA 1ZQXA 4O5EA 1B43A 4FJJA 3ULDA 1RZTA 1U49A 4RG8A 2DFFA 2NRTA 1IKVA 1VSIA 2MAXA 1ZQPA 4RQ7A 7ICUA 2BGWA 4M9GA 3KHLA 1LAWA 2HHQA 2YHBA 1MC8A 1ZQKA 4J2AA 3GV5B 2I1QA 4HYKA 1RYRA 4YMNA 1TK8A 4AHVA 4UAZA 1RBRA 2PI4A 3B6OA 3MFIA 3CYMA 4RUCA 3MR2A 2ATLA 4RW9A 5J0PA 4TQRA 5KFKA 3QEXA 1S0MA 3NFAA 4E89A 3M8PA 1SKWA 9ICAA 2O4IA 3Q8PB 4R64A 2ATQA 3VQBA 3RAXA 2ZJAA 1CLQA 1JKHA 3LAKA 4NCAA 1QSLA 4MF2A 4ELUA 3RBDA 8ICFA 4KMUA 1WSJA 1G15A 1SKRA 2IA6A 3V9SA 4FJ9A 1RYSA 1VSDA 4CGJA 1ZBFA 3HK2A 5FDLA 4DF8A 3LP2A 3HO1A 4TURA 5J2NA 2A1JB 3BQTA 2W42A 1RTJA 2ZUCA 4NXZA 4DS4A 1R0AA 3U3GA 1TKDA 3QE9Y 3PO4A 3OYGA 2FMSA 5CA7A 5KG6A 4RPXA 4Z4EA 3AVGA 1FKOA 3BDPA 3K2PA 1WCNA 3P1GA 3NGIA 1T3NA 1Q8IA 1ZJNA 4J9MA 1A5VA 5BOMA 2PY5A 4B8CA 3RH6A 3QO9A 3L2RA 1TL3A 1ZQRA 1YTUA 3NF8A 9ICVA 1CXQA 3DLBA 3IG1A 2BE2A 3K59A 4DL4A 3T5JA 1N48A 4B9SA 3MGIA 5EOZA 5HMMA 2IDOA 3VA3A 4GMJB 4ECTA 1HRHA 3V6DA 3MAQA 3OS1A 3WNFA 5L1KA 4QZ9A 4G1QA 4IRDA 1ZQTA 2Y1JA 1B92A 4HTUA 1BISA 4J9PA 3T3FA 4R5PA 2PFQA 3VA0A 2A1JA 5J2JA 2G8IA 4JWNA 1TAUA 1VRTA 5CWRA 4KLFA 2F8TA 4E7IA 1N6QA 4KLLA 4ELTA 4CF0A 3OYDA 1NKEA 4GW6A 2ASLA 2BDPA 4CGHA 4AH9A 5KT5A 4KKOA 1RTHA 3OYIA 4FLZA 8ICCA 1DTTA 4Q43A 8ICGA 5J1EA 4DLEA 2A1RA 3H8WA 2QXFA 4KRFA 3UXPA 2IHNA 4F4WA 3HPGA 2YNFA 1T4GA 3JPPA 2X6SA 1GOBA 4KLIA 3O3HA 1WCLA 2XGQA 4FO6A 4W5OA 1VSMA 5HMLA 2BQ3A 1HYSA 4UB1A 4XRHA 3NGZA 2BQRA 9ICRA 1TGOA 5KFZA 2HB5A 3KIOA 5KTQA 2QK9A 4RQ5A 4CK3A 4KLQA 3GILA 3SNNA 1ZYQA 4QZGA 4FW2A 2BR0A 3KK1A 1ZQUA 3SI6A 8ICUA 3RJHA 3OYKA 4F5RA 4FS2A 1ZQMA 2BKEA 4F92B 5BOLA 2OPRA 1HPZA 5D3GA 8ICZA 4B3OA 3QIPA 4O0JA 3MGHA 3QLHA 2ISPA 3RMBA 4AHCA 5L1IA 4JRQA 3OVNA 4M9NA 1WLJA 4IRCA 1RDDA 3P83D 3CM6A 3HWTA 4I2GA 3QIOA 3DLKA 4LH4A 4E3SA 4ED8A 4EYHB 4KLDA 4XIUA 3B6PA 1BPDA 4I9QA 3QESA 1S0OA 3AVJA 4DTOA 2KN7A 4OKKA 3PVXA 5DBAA 4CESA 4TQSA 2BCSA 1ASWA 2W8LA 3E01A 5F9LA 4MF8A 3I0SA 5HRNA 1A76A 1VSLA 5DDYA 4DEZA 4CJSA 5DKWA 4FJKA 4CK1A 5J2MA 5KT6A 4ZTFA 1X2IA 1L3UA 1KVBA 2R8IA 1T05A 4PHEA 1DGSA 2B5JA 2ZTDA 3RTVA 9ICWA 1JN3A 5L1LA 2ZUDA 3F9KA 1LW0A 1KVAA 1XC9A 3V4IA 5T7BA 8ICQA 2LYHA 1U9LA 4ED7A 1C1AA 5KRSA 1IKYA 1C0UA 3SQ0A 3VQ7A 5F9NA 4P4PA 2W9CA 2RF2A 2QKKA 3DMJA 1ZQZA 2RDJA 1L3VA 3NH1A 2B4JA 5DB9A 3NF9A 5KFLA 5KFBA 3C94A 2B6AA 4PHDA 3ISNC 3RJKA 4RT3A 3NF6A 2NRWA 2XY5A 2RPIA 4CF1A 3E2EA 4JUZA 2XGPA 4LZDA 1SZPA 5L9XA 1Z26A 4IG3A 4RNNA 3C6UA 3M9NB 1ZQHA 2KFZA 3H4DA 2FMPA 4YR3A 3ZDDA 4N47A 3NCIA 9ICLA 2W9MA 5DLFA 1NOYA 1RDAA 4B08A 5CJ7A 4AILC 3O3FA 5KFGA 4KLMA 4E0DA 3ZD9A 4FS1A 8ICXA 3SQ4A 3NDKA 4M6WA 4HCCA 4PWDA 1HJPA 1NK6A 4ED6A 2HW3A 1QSYA 4ID5A 3OYEA 1KFDA 2LSNA 4RU9A 1T7PA 3RJJA 3OHAA 3AVIA 4I2JA 3MBYA 3VQ5A 4FJNA 4X5VA 1U48A 4OPJA 3ZT2A 1BVSA 5KFAA 4P4OA 2JEIA 4FBUA 1RDBA 2OZSA 3NTUA 4O5KA 3ZSZA 5J0RA 3H40A 1PZNA 4DFKA 3PX6A 5SZTA 4B9TA 4AHTA 1REVA 4FJ5A 1U45A 4TUSA 3QNNA 4C8OA 7ICOA 4KI6A 2WTFA 2JZBB 4B9MA 4QZBA 4GC6A 2GWSA 1YTAA 4NLNA 3LK9A 8ICSA 9ICIA 2IGIA 4YMOA 2VWJA 3EY1A 4CHPA 3KKRA 4RW8A 4CEEA 5KFCA 1RPLA 1S76D 5HHIA 4F5NA 3GIKA 2P1JA 5HNKA 4BDZA 2OPQA 1WSHA 1BPZA 4PGXA 4CJ5A 3KLFA 4BWMA 3HVTA 2J6UA 1TFRA 2KQ2A 4BACA 4WE1A 3SUNA 3IRXA 1WAFA 4KHNA 3AA5X 2HHSA 5J2EA 2PYJA 4DOAA 1K1QA 1VSEA 2DPIA 7ICTA 1WSIA 1RBVA 5C42A 3UXOA 4K8XA 4FK2A 4IQWA 4RZRA 3I8DA 3L3UA 1Z3EB 4IQUA 3RMDA 3RB0A 4NYFA 1UWBA 4C8MA 4QWEA 2J6TA 5DK5A 3JPOA 2DTUA 4YMMA 1HQEA 5DGAA 1K1SA 1BI4B 3D45A 3PY8A 3MXMA 3NGDA 2AJQA 4LY7A 3QEPA 1S1XA 4KV8A 4E7LA 3OYHA 2IMWP 4EEYA 2HHWA 4KN4A 2GUIA 4DTXA 3OSNA 3V6HA 1IO2A 3C23A 1S1UA 4EP4A 4LSNA 1VSKA 1KEJA 4FLTA 3C2MA 5DG7A 1RCHA 5HRRA 3RMAA 4F2RA 2BCVA 2A1SA 4AHSA 7ICKA 1Z25A 2GBZA 1VRUA 1RXWA 4DWIA 1FK9A 5J2FA 4O5BA 4M47A 4I2EA 1JLEA 4IG0A 4CJFA 4PHPA 4LZGA 1XU4A 1FXXA 1NK9A 2JEJA 4YVZA 4QWDA 3MDAA 4DL7A 5KG2A 1WN7A 2NRXA 3C21A 5CR0A 1ZQFA 3SJJA 3IHQB 3DLEA 2EX3A 4W5QA 2P6RA 4ECUA 1RT1A 4CHQA 5BPCA 5J0SA 2VA3A 3LP0A 8ICWA 1NK7A 3OS2A 4OLBA 4RW4A 2DFHA 3S3MA 4IRKA 1TKTA 1JLGA 3C2LA 4M3RA 3CG7A 3KKSA 2R7YA 1XSPA 7ICGA 1VSJA 3KHRA 4CJ4A 4BE2A 5J2HA 4F5OA 2XY7A 1HJRA 4J9KA 4DG1A 3PMNA 1T03A 1S9GA 2E6MA 4ICLA 4RW6A 1ZQNA 2KW4A 2XC9A 2G8WA 5JUMA 2ASJA 1NK4A 5CB1A 3LPTA 5DG9A 2FMQA 4J2EA 4YCXA 4HVJA 1U4BA 4I2QA 1JXBA 3I0RA 1BCMA 2HMIA 3AVFA 4I2HA 3V7LA 3GV8B 1L3TA 2R8GA 2ZD1A 5DMRA 4DTJA 3DRPA 1S0NA 4RQ4A 3KHGA 1Y97A 1JXLA 4OKEA 5DLGA 4FXDA 5KFFA 3KLHA 1W9HA 4EP5A 2EHGA 3UPQA 1B9DA 4M0AA 4TSXA 3ZSVA 4M3ZA 4UB4A 4I7FA 2FBVA 3OY9A 4M3WA 4FBTA 5J0QA 3V9XA 3RRHA 5KFJA 4PH5A 9ICQA 2P5OA 1JL2A 1X9MA 4F3OA 4QZAA 5KG4A 3PO5A 5J0XA 4KREA 3RJFA 5JS1A 4KLGA 1QHTA 3RMCA 1S6QA 4KHQA 3NHGA 3DYAA 1ZBLA 1TV6A 3DLHA 1NK0A 4J9QA 1J53A 4CHOA 1J5OA 4CCHA 5CYQA 3C6TA 1CUKA 1XO1A 7ICNA 2Z1GA 4KLUA 3HYFA 3BJYA 4Q8EA 4H8KA 3VQ9A 9ICFA 1BQMA 4W5RA 5DB8A 3Q8KA 3AVMA 1COOA 4N76A 4DL2A 3ZSQA 3TQ1A 5IIJA 1WSFA 4FYDA 8ICPA 3UQ2A 5J2GA 1ASUA 3SPYA 3MDCA 4DOCA 5IIKA 4N41A 3VQCA 1ZQDA 3L2UA 2ZTEA 5EWGA 3K5LA 5J0OA 3SZ2A 4CEZA 4DOBA 1LWFA 2AGPA 4M6WB 4H4OA 3DRRA 2HHUA 4GVMA 4F8RA 1RBUA 4CJLA 1ZQEA 4DF4A 3S9HA 1SL1A 3IM1A 4GC7A 5KFOA 2IC3A 2F1HA 2PFNA 5DBBA 4PHAA 3MR3A 3SQ2A 1W0HA 2XRIA 4YD1A 4TUQA 1RT2A 4LH5A 3EPIA 4F4YA 5CP2A 1L3SA 3GIJA 2PYLA 4K4IA 3AVLA 1ZQQA 1SUQA 3V1QA 4CHNA 4R8UA 5KT4A 1NKCA 1ASVA 2YKNA 3LWMA 1S1TA 4YP3A 4FZXC 3GQCA 5J0WA 3O4NA 4DL5A 3RBEA 1KVCA 4KTZA 5C24A 4J9RA 3DM2A 4DL3A 4OGEA 5KFHA 3AUOA 1EKEA 2W9CB 8ICIA 4KAZA 3H8JA 1RILA 3ZSXA 4NCBA 5HHHA 4EYIB 5DQGA 2C2RA 3VQ6A 4PY5A 4PGQA 3V1OA 3OGUA 4M3UA 2KZMA 4QZDA 4FJGA 5J2CA 5KG0A 3NH0A 4NLGA 1A5XA 3WNEA 2YNIA 4QWAA 4CEQA 3T5KA 2KZZA 3NH2A 4Y1DA 1QSSA 4DTPA 4IDKA 3PNCA 1J54A 4B9NA 3EYZA 3C95A 2BPCA 3KLEA 3ISDA 4KLJA 5CHGA 3QETA 3TWHA 5KFDA 3DRSA 2R8KA 4DFJA 3TAEA 3ZDAA 3AU2A 4O3NA 1UAXA 3MR5A 5IIIA 3QZ7A 3Q8LA 3HPOA 4DQRA 2D0CA 4EZ6A 3TAQA 5KG5A 2D0AA 1ZQJA 3PR4A 7ICFA 4F50A 1XI1A 3TANA 5FRNA 7ICMA 3DLGA 2FC0A 4CJQA 4KO0A 4KLOA 3RJIA 1XSNA 4N5SA 4MEYA 4E19A 4KLSA 3H7IA 4Q45A 4EBCA 2BQUA 1JLCA 1BIUA 5J0UA 4RPYA 4DLGA 8ICKA 2KZ3A 3EPGA 2W8KA 4J9LA 4CF9A 4HUEA 1EXNA 3CQ8A 1XHXA 1Y88A 4ECRA 4UBCA 2NRVA 4KLTA 3H4BA 4QZ8A 5IINA 4YR2A 4ZHRA 4FCYA 4HHTA 4KTWA 4YXMA 5KRTA 1ZQGA 3ZSWA 2DPJA 1C1BA 2ZQBA 1I39A 2VA8A 4RQ0A 1MQ2A 4CJEA 3MABA 4CF2A 3HPHA 2VANA 4QW8A 3V7KA 4DSEA 4QZFA 4TUPA 1RT6A 3QNOA 3VQEA 5D4BA 1UA1A 3LZJA 5I42A 3UQ0A 9ICBA 3NBPA 4BE1A 1NJWA 3MXJA 4CE9A 2YNGA 3KD1E 1NJYA 2I5JA 2P66A 3G6YA 2F8SA 4MFCA 5J2IA 3L2QA 4Z4IA 3KJVA 8ICNA 4XQ8A 4RQ6A 3L8BA 3QEIA 1JLBA 7ICSA 4QWBA 4O3SA 2FLPA 1SL2A 1CZ9A 3GIIA 3OYAA 1XHZA 4FJ8A 1S9FA 4CJ3A 2D0BA 4NLKA 3NE6A 1NJXA 3K5MA 3WNHA 3S3OA 3JPNA 1A5WA 1A77A 1X1PA 5JS2A 5CZ2A 4JS4A 4IQTA 8ICLA 2OPPA 1H38A 3T5HA 3Q8RB 5IILA 5KT2A 2ZJ5A 4ECSA 3NGYA 3ZD8A 5D49A 2UVRA 4CJKA 7ICVA 4ID1A 4P4MA 2VWKA 5I3UA 4FJLA 4F5QA 3HL8A 4NM1A 2YKMA 4Z4GA 1JLFA 1IKWA 4ZH4A 4O0IA 1RXVA 5E41A 3QEAZ 3LAMA 3NAEA 3PX0A 4FLYA 3TAGA 4Z6EA 4BDYA 1IKXA 4QOZB 8ICVA 3G6VA 5CZ1A 4IKFA 4M3TA 3JPSA 3OYFA 4M9HA 2BCQA 4B9LA 2RN2A 4R66A 4AHUA 4Q8FA 4YG2A 1NOZA 2BANA 5KFWA 4M42A 4PQUA 4JK1A 1MU2A 4KB1A 5K14A 2PXIA 4HUFA 3RB3A 3BQ0A 1N56A 2GV9A 4CFCA 3SCXA 1D8YA 3M8QA 4DSIA 3ZT4A 3SQ1A 3DI6A 4ECQA 3PX4A 4I2PA 5EWEA 4FZZA 3AVCA 3F73A 4RQ8A 4FM0A 4I29A 5DGBA 3MR6A 2HNDA 3OS0A 3CFPA 2P5GA 4FLVA 4DO9A 2VG5A 3DOKA 3MECA 3QZ8A 4NLZA 4DQIA 4CECA 4G3IA 3FYHA 1HUZA 3ISBA 3K58A 3G0ZA 1S0VA 1EX4A 4F2SA 2UVUA 4E7KA 4YFKA 3JSMA 2BPFA 4I28A 8ICBA 4N56A 5KFUA 1S6PA 2RKIA 5C25A 1VSHA 8ICMA 2JEFA 1S1WA 4YXJA 3JYTA 1QS4A 3L2WA 3N97B 3IS9A 1SL0A 3V7JA 2I9GA 4PUOA 3RB6A 1QQCA 2IAJA 3KLGA 3AO5A 3OJUA 1C6VA 3PW7A 4BE0A 4Z4HA 3MEGA 4GXKA 3M9MB 4GXIA 2PI5A 2JEGA 3SI8A 3OYJA 4UQGA 3RR8A 1IM4A 3K5NA 4Q44A 3PR5B 4LD0A 4FJIA 2PFOA 4CEFA 3PW2A 4J9SA 5J2AA 4B9VA 4CFBA 2XO7A 1VSFA 5SWMA 1S1VA 4BDPA 4QZHA 2DFEA 1BIZA 3ITHA 3ZDEA 1Z00A 4KHWA 2YV0X 4RQ3A 2C22A 4LSLA 5KFIA 1RBSA 1BQNA 3TFSA 7ICPA 5KFSA 9ICMA 4GXJA 5J0TA 3SV3A 3L3VA 4GLXA 1ZQOA 3C1ZA 1KFTA 2ETJA 4KHSA 3HM9A 2OWOA 4ED2A 2PFPA 1Q9XA 2FBTA 4CEBA 9ICSA 1KDHA 5DBCA 2BGGA 4ELVA 1UT8A 5KI6A 4UBBA 2W9BB 1RTDA 4I9LA 1XWLA 2H5XA 1SV5A 4DTUA 1KLNA 3PMLA 1CEZA 1EETA 3AVAA 1IH7A 3GV7B 1EP4A 3SV4A 5J2KA 1LAVA 1S77D 3LP3A 4DTNA 4R8UB 3AVKA 5J2PA 4FK0A 1DTQA 1TAQA 4QZCA 3RH4A 1S10A 2HNZA 4XUSA 1TK5A 1HUOA 3ZCMA 2Z1HA 2AGQA 3RB4A 1BGXT 3AO1A 3V9WA 4YQWA 2X74A 1ZBUA 1RT5A 3TI0A 3QINA 1D8LA 1Q9YA 2OYQA 5D46A 1C0TA 2FLNA 9ICTA 1YT3A 4ED3A 1K6YA 2IS3A 3JPRA 1VK0A 4O5CA 2W9BA 2AQ0A 3VQAA 1IXRA 2R8JA 4KLEA 4C8LA 5IIMA 2HNYA 4I2IA 3AO3A 1BPEA 2OZMA 9ICGA 2DY4A 4PA1A 3HVRA 3RAQA 4FJHA 4CEAA 5HRPA 4OPKA 1QLNA 4AHRA 4F93B 2XY6A 4P2HA 4KN7A 4Z0UA 2IBKA 4M2YA 1D9DA 4RNOA 5DB7A 4O3OA 3M8RA 4UB2A 1X9WA 2FPLA 5KFVA 1RT3A 2NUBA 4CGIA 4QCLA 4OJRA 5J29A 4UAWA 3LANA 1B22A 5DQIA 5KGXA 4RPZA 4O44A 3MXIA 1ITGA 3THVA 4DTSA 3ZSRA 3HX0A 3D0PA 1NK8A 4DU3A 3G6XA 4BGDA 3OYBA 4CJWA 3GFKB 4QW9A 3ASMA 8ICYA 5HLFA 2HVIA 3TAPA 4JV1A 3U6FA 2Q0ZX 3V72A 3RJEA 1ZQVA 3H08A 3V81A 3AA2A 4F3TA 4E7HA 2ASDA 2G8FA 3TAFA 1RTIA 4Z6FA 1L5UA 3K5OA 3B0XA 1ZQIA 5DQHA 3ZT3A 5J2BA 7ICJA 1ZQLA 4M41A 2ZUBA 3HSTB 2JZBA 3TR8A 2G8KA 5KFNA 1JX4A 4JLHA 2XCPA 3ZT1A 3ORYA 3VQ4A 2Z1JA 3RRGA 1TVRA 3SYZA 4ED1A 4I2BA 5L1JA 1BPBA 3OYLA 3PW5A 4Z4CA 3Q8MA 4JV0A 1J9AA 2E6LA 3ISCA 2E4LA 4KTQA 3HW8A 4E7JA 4ECVA 2X6NA 1IG9A 1BPXA 8ICRA 1CZBA 4H4MA 4NY8A 3Q8SB 4DFPA 1Z00B 3LWLA 5KFYA 4K4GA 3GIMA 5DG8A 2AGOA 4K4HA 1LW2A 4FJMA 1LWEA 3KK3A 2BPGA 2BCUA 7ICQA 2OPSA 3IAYA 4HCBA 2VA2A 2FLLA 4Y1CA 4UB5A 4FZYA 3M8SA 4R65A 3TAMA 1WNSA 4HUGA 1HNIA 3PW0A 4M3YA 4KITB 5KFTA 3OJSA 3QERA
chains in the Genus database with same CATH superfamily
4ZTJA 3M2UB 2P6UA 3QIPB 3MM9B 2XI3A 2DNZA 2UUCK 2P9UA 1BA0A 2VBZA 5HANA 4JI0J 3LDSA 2RDIA 5CCMA 5AK6A 4JKDA 1WSGA 1X4AA 1FW6A 4I2FA 3D67A 4DKWA 4IJNA 2BJ1A 2J8SA 3BPSP 4JV2A 2V2VA 1B99A 1Z4OA 1PCAA 1KTQA 3CDEA 4CI6A 3V9UA 3OHRA 1KTVA 2MZJA 9ICXA 1NNEA 4FVMA 1BQNB 1PVPA 2HZCA 3DOLA 4DR2J 1WC6A 4Z6CA 4CLFA 2PN6A 2KG1A 3IWNC 4YMEA 1WG1A 4DJBA 2BKNA 2AP6A 4X62J 1QUPA 4JS5A 2ZVSA 1K5OA 4BROA 1MMLA 1X8DA 1IJFB 4PG7A 2V6AA 4JWMA 2B21A 2CPXA 1XK8A 4ZJLA 4I68A 3D6JA 1VJWA 4LF1A 4DCCA 2UVWA 1UJ5A 2EKYA 3BGRA 1VMBA 1IG8A 2HHXA 3EKUA 3EE8A 4RW9B 1N32F 4QS8A 4FPIA 1K9MO 4LC9B 1HQ2A 3AFGA 4OL8A 3R27A 3BGUA 4Z4FA 2EAMA 4MIAA 3T7ZA 1HBOB 1R8HA 3AHPA 2EKNA 3QFWA 2FBYA 4RBUA 4Y2VA 2C1EB 4WXOA 3UCGA 1HWLA 2CPJA 1JLQB 7ICEA 4AL5A 2F1JA 3MM6B 2JHEA 3PW4A 4OV1A 3TABA 4DCPB 5GINA 1GMUA 5AZIB 1HD1A 3LVWA 3KG1A 2K8GA 2POKA 1YG0A 4FW1A 1C0TB 2E7VA 3LP2B 3SUQA 1Z4NA 1E4FT 3L7PA 3S3NA 3QBXA 5AQYA 2QFJA 4CZFA 5JMNA 3TWZA 2UUBF 3CJKA 2HG4A 9ICNA 1S1UB 1RAGB 3U1NA 3H5SA 1EIYB 4BRLA 3UMCA 3FFKB 2DGOA 5C15A 4I2CA 2UUCJ 2KOBA 3HT3A 4EO6A 5C42B 4F4XA 2G5HB 1J2MA 4FSVA 4B3TK 3T79A 1WTBA 2MLYA 3CM5A 2YHAA 2BZ2A 4WFYA 5FP0A 3K57A 1S5ZA 1R7IA 3UN2A 2ITGA 1X9JA 2DEJA 4QIGA 4JI8K 2Y0SC 1EWRA 1WTFA 4FVCA 3JTPA 3W61A 4MFBA 2E9TA 4PGYA 4EAHD 2D5RA 4H5WA 1UZDA 4M5GA 3D6FB 3BR9A 4CQ1A 1DLOA 1XMQF 2JWNA 4CHZA 1DRGA 1P8GA 4KGXB 5KG1A 1WAJA 3BF1A 4C0HA 2VQFK 4QZEA 1D1UA 5B09A 1D8BA 1TKXA 3C5FA 3O8WA 2ZM6K 3RW7A 4BXOB 3I96A 3UKUB 5EU7A 1SQGA 4K2XA 3VQQA 3MTKA 3THXA 5ADXH 4CIEA 1E3MA 4PPXA 4B3MJ 5DB6A 4X66K 1SV5B 3SCIE 2HLTA 4RBVA 4CRJA 1QUVA 3CIMA 1HQUA 3A5OC 2M70A 2FJAB 2NLWA 4HWIA 2UXDF 4Y28C 3HMJG 1URNA 3M1VA 4CGDA 2F8LA 3ZX2A 2I5JB 4QIWC 4KLHA 1A0PA 3E66A 2WBNA 4DMNA 1UFLA 2W6LA 2IJRA 1RE1B 1QQNA 2HFOA 1Q0NA 2LU1A 3SFUA 4LVSA 3W2VA 4MFAA 3EXYA 5AQRA 4M94A 2XHBA 3EKSA 4ZLNA 1RYUA 3BV8A 3IKMA 1M90O 3RWUA 5H9EK 2RUGA 1TV9A 3PUFA 3RR7A 1ZOTA 1NZBA 4YNQA 2COLA 1DQ8A 1ZQWA 4OJ3A 5E3QA 4FM1A 1D0EA 4O55A 1VHXA 1H3DA 1R6VA 3NRWA 5HVHA 2OMOA 2KT2A 1COKA 3RGIA 3CFRA 1ZBSA 5F0WA 2ZH7A 2H5JB 1H73A 1NJZA 3VETA 1VR6A 2EFVA 4CWBA 5AQUA 5BN9A 4OZ3A 4DDFA 1B0TA 5D0RA 2PMZD 3VQPA 4Y2XA 1HBMA 1RT7A 1F21A 5AR0A 4I0WA 1U8WA 2OEHA 4B3OB 2Q1LA 4OYOA 3AO4A 1TK0A 3CDBA 1EKSA 4DQSA 3IBCB 1U24A 1YJWS 1WSRA 4DR1K 3M32A 2NR0A 8ICEA 2OCEA 4BR4A 2GIRA 4V19S 3P5JA 4IQVA 1P8ZA 4Q5VA 3IC1A 1I3AA 1KLMA 1KSPA 3D68A 3VVTA 3ELHA 2B9WA 3MX5A 3HHLB 1U1OA 2CPFA 1EJ7L 1RCXB 5TKYA 5TZVA 4UOFA 3OTDA 3CF5Q 3RH5A 1KR4A 4DPWA 5KNIA 3MGVA 2QIFA 2F9TA 1ZETA 3HP6A 3UIQA 2VPZB 2V67A 5CHCB 3C2KA 1SC1B 5HLFB 3MECB 1N61A 1KXPA 2HQDA 1JJ4A 4LF4J 4F9OA 2DNKA 3BSCA 2IOFK 4NLBA 3DC2A 1VFJA 2V4RA 5C5JA 2AU0A 2QT7A 1D5AA 3TRGA 1U47A 4DUYK 3E01B 2G0JA 4WP9A 3OFGA 5LL6Z 2VKZG 3OYCA 1X9SA 1KKHA 4LR8A 3QPIA 2VIHA 2GGPA 1V3ZA 4CJRA 1URRA 1YVUA 3QT7A 4ED0A 1IQTA 2VGMA 1ZAXA 4E1JA 3NGSA 2MUTA 3JTNA 1ECWA 3G4SS 4HKQA 4EBDA 1AZSB 4UAUA 1N36K 4E2FB 1SJ1A 3ETLA 4BG9A 5CABA 9ICUA 3CO0P 4OYBA 1NGHA 4CJPA 4F0HA 3VAJA 3DCAA 4J2DA 4X4QA 1NZPA 4M5IA 5KFPA 4KB7A 1ZQXA 4QZVB 2QV6A 4LFBF 3PLAA 3ULDA 1M90T 4P71A 4USIA 3F2BA 1S48A 2CG4A 1RSCA 3MN7A 3ZLJA 1LNQA 5AE1A 3UKRB 2MAXA 4H5RA 2MJNA 1J5OB 4NXNJ 3HFZB 3VWSA 4UASA 3F2CA 2A18A 3AJ2A 1GX5A 3TZZA 2I1QA 2DNNA 3NVMA 2CH5A 1UP1A 3HVTB 1T6CA 3MFIA 2P9EA 1HKAA 4P0PB 2RJZA 3I4PA 3U7JA 4UOCA 2ATLA 4RW9A 5J0PA 5KFKA 2JFDA 3HZGA 3G87A 3M8PA 2RILA 1SKWA 2QA4S 1L3KA 4CVNE 2K4IA 4UATA 4PUOB 2QEXS 3GR1A 1WC4A 1WC3A 3BF3A 3IV6A 2QGFB 1QSLA 3CETA 3P3DA 4UOGA 3MN5A 1SKRA 4J03A 2HFVA 3V9SA 3SCJE 4FJ9A 1XMOF 1RYSA 5C12A 2QE5A 4X65F 2CVEA 1VSDA 1X5OA 1NCLA 5FDLA 4DF8A 3LP2A 5ETNA 2M0NA 2P9LA 2IMOA 1RTJA 3GIRA 4LR7A 3U3GA 3VEXA 2GUPA 3CDWA 4RPXA 2BM0A 1F5BA 1FFSB 4Z4EA 1ZZNA 4H0TB 3BS5B 2V9KA 3FR0A 2RH3A 5ALLA 5KPRA 4IDKB 1ZJNA 2DNYA 5AJ3F 2GV1A 3RH6A 4F0KA 4B3RF 2QFIA 1UJ6A 3NF8A 5ETTA 4BRQA 1CXQA 2YQ1A 3D2EA 3O9SA 3VGUA 4O8UA 5AZIA 2PFFB 3T5JA 3KOOA 3GG0A 2J76E 5D4LA 2BJ8A 2BACA 3NVYA 1J2VA 5HMMA 3I9V9 4IO1A 2IDOA 4OV6A 4GMJB 3RF9A 3MAQA 4UARA 3WNFA 4BGAA 1KAZA 1V5VA 4G1QA 1EZZB 2VBXA 3S1TA 1B92A 4HTUA 1T9TA 1NGCA 4MLEA 2RU9A 2A1JA 2KHDA 1TAUA 1XQSC 3VGTA 1M0SA 5CWRA 1NZAA 1BC6A 1N54B 1MROB 3ILIA 3ZZOA 1VBXA 2LM4A 4KLLA 3AH6A 4YOEA 2ZXIA 2VUGA 4DV1K 4EFAC 4ZOSA 2E88A 2G13A 3ZEUB 2V8VA 1RQLA 8ICCA 4KT0C 2ZJQL 2VFRA 1FDAA 3VGVA 4DLEA 5G5HA 2CPZA 1JROA 1SQKA 2WVEA 3UXPA 4DR5J 4F4WA 3HPGA 3QIDA 3TA0A 4ZLLA 5I3UB 4IFEA 1T4GA 2X6SA 4UW9A 3DGPB 2QLTA 1WCLA 2XGQA 4R5PB 5HMLA 2NYHA 1DBDA 5AXMA 2JWLA 3DLLQ 4ATNA 2BQRA 9ICRA 1XR5A 2YTCA 4CK3A 4KBOA 1ZBTA 4IQMA 1IQZA 1ZYQA 3D9BA 3H2UB 1LXJA 3SI6A 2IYIA 8ICUA 4DR3K 3K8VA 3Q83A 3RJHA 3OYKA 4F5RA 3IP0A 1MU2B 3Q23A 1BQXA 4Y34A 4QIFA 1FO1A 2F3NA 1GLBG 4O0JA 2VJVA 4RTFD 2C2OB 3QLHA 3I5BA 3RAMA 1Y0HA 2O3DA 4USWA 1VQLS 3VPZA 5L1IA 5CD4A 4M9NA 2WVCA 3G25A 3TVYA 4EYHB 2DR9A 5D4OA 3DU5A 3O5BA 4U7UD 4CBUA 2UXDK 2Z57B 3HKZC 3WXKA 2ERRA 4DTOA 2KN7A 4OLPA 4OKKA 2V63A 5AFUH 2DR8A 3BR8A 2H3IA 3PTWA 1ACMB 4G9BA 3CCSS 3QMQA 1YSJA 2DR6A 3VTIA 4X4RA 2D3OR 5F9LA 2ZG6A 5J2PB 5HRNA 4P74A 3AQEA 2E5LK 3T69A 3MMVA 2V8PA 2W24A 1VGYA 1KVBA 2R8IA 3F44A 4P10A 2DTJA 2CPYA 5EE1A 3WKCA 2YMPA 3TTDA 3ILOA 5EN1A 3F9KA 3H59A 4K4UA 4NLSA 3CCQS 4CZLA 3CJRA 2LCWA 8ICQA 2LYHA 4ED7A 1KQFB 3QDKA 3QBWA 2E9RX 3CD6N 1OH7A 3UR0A 3LW5C 5F9NA 4ZVHA 4P4PA 4PABA 2RF2A 1ZQZA 1LEOA 1UEKA 1IM6A 3I0SB 2A41A 5KFLA 2GO8A 2Y1RI 1WUAA 3G6ES 4X64K 2BUPA 4ZCMA 4PHDA 4JI8J 1M5OC 2NRWA 2XY5A 4CF1A 4JUZA 3E2EA 3N28A 2XGPA 4C8YA 4X4VA 4OJLA 4FZLA 3ZDDA 4I7FB 4P2SA 3BUZB 3GR0A 2OEMA 4B08A 1SIJA 1NBWA 4R0JA 3QFHA 3IGNA 5T41A 3O80A 3J7Z5 3IN5A 4FS1A 4H4OB 2FJXA 1HJPA 2HW3A 2OTJN 4ID5A 1GTHA 2QWOA 1Q53A 4PR6A 1WG4A 1T7PA 4DV6F 2XLJA 2EI5A 1FKPB 3BY5A 5BYQA 2XO6A 3AVIA 4JI4F 3CCJN 4JEPA 5C2CA 1N8RO 5L8RC 1CRXA 4NRUA 4P4OA 4A59A 1I51B 1WUUA 4NLYA 2JEIA 2Y0SD 4NRTA 2OZSA 2JLFA 1YBAA 5B0DA 1PZNA 3BS9A 2W3RA 1Z1BA 3I31A 4P2FA 2GWJA 5B8HA 3R7BB 3HILA 3SXLA 4ZPDA 3KD3A 2MKHA 3CQYA 7ICOA 5GADI 4ZPTR 1OW5A 4C48A 3HD2A 1M5VC 2ADBA 4YORA 3THXB 2QEXN 4ZLPA 9ICIA 1V4TA 1XBWA 1S6QB 2QSWA 2IGIA 4OX9K 3UR3C 1IBMK 3FZMA 2OXOA 2EK6A 4DX5A 3JQKA 4I6MA 5ALZA 3IM8A 4NB4A 1SWWA 4CF5A 3BP8A 5E26A 4CBXA 1HQUB 4DV3F 3U1MA 3D2FB 5G0RA 1ZTTA 1R8PA 1K8KA 4CE6A 5LMNJ 5HNKA 5T14A 3PZPA 2DR7A 3HVTA 1RBLA 2KQ2A 5DZ7A 1OH5A 2VPWB 3IMXA 4KHNA 3GZ7A 4HHHA 2NZTA 1BUXA 3AAPA 3A0HU 2XS2A 1S1TB 4DOAA 3NL0A 1K1QA 3PIPL 2HEKA 3CJSA 2BE2B 2QC3A 5JVHL 1RBVA 3U26A 2AEFA 2E2PA 2FF3B 3QRQA 5GAGP 1G4CA 2WK4A 2WONB 1RHUB 4FK2A 4LFCF 5ALEA 4JI2F 4IQWA 2LP4A 4PZVA 3I8DA 1JJ2R 4PRFA 3RB0A 1UWBA 2ZBPA 3B4MA 4QWEA 2R7VA 3IBPA 3JPOA 2DTUA 5HP1B 3EL2A 1U2RA 3PY8A 1NU4A 1YK9A 3U02A 3QUTA 2C3MA 3G2XA 1K8AO 4LIRA 1S1XA 2I9SA 4KV8A 4A61A 5LJWA 4E7LA 3PSPA 2DNRA 2IMWP 2YNFB 1RWXB 2YQ0A 2GUIA 3THYB 3OSNA 3M6VA 3V6HA 3C23A 4W4MA 3SQIA 3SBTA 1KEJA 3VR1A 1DKGD 3C2MA 4OZLA 2YQ3A 3MR7A 1O03A 4K4WA 1VRUA 3H0MB 1RXWA 2EPIA 3WQUA 1K0TA 3OTOK 4L73A 2O8DB 4O5BA 4I2EA 4PHPA 1PILA 2FJVA 3M2VA 2B6GA 3KUEA 1LW0B 5AKIA 2GX8A 4BRHA 1PUZA 4CLUA 1ZQFA 2FZKB 4NEYA 2EX3A 4ECUA 3ETMA 4KH5A 4YN3B 4FF1A 5BPCA 2O8DA 1VQ4S 4DR6F 3EJMA 3R3LA 1N8RT 8ICWA 3BBCA 5K5MA 2DFHA 1KVIA 3S3MA 3CG7A 4JYAF 1MNEA 3O1LA 1OO0B 3O6WA 7ICGA 2FJWA 2HOFA 4UY85 4H0VB 3J7YI 4DUYF 5J2HA 4UTGA 3MWPA 4J9KA 1ZAWA 3GFXA 1T03A 1S9GA 1SH3A 2E6MA 1C1BB 2DL0A 2RLTA 3QWUA 4CO3A 2XC9A 2G8WA 5AQIA 7AT1B 5JUMA 4DR1F 5CB1A 1YJUA 1QQ7A 2BH1A 5DG9A 1YVNA 2AP1A 2MQMA 1U4BA 3NOCA 4I2QA 3I0RA 1S9EB 3AVFA 1JLFB 1T3OA 3V7LA 4H03B 5HR6A 1GXUA 2CVIA 2Q6CA 2YJEA 1S0NA 5BPNA 5LXRA 1JJ2M 4WK1A 4RQ4A 1Y97A 5ALUA 5DLGA 4FXDA 2MZ1A 5KFFA 2HDOA 3AOAA 3UQSA 2KKVA 3O8MA 3KLHA 2KRBA 5F8NA 1RHJB 3H6EA 5M2UA 4FVUA 4UB4A 5ETKA 1QQOA 1WOOA 5J0QA 3OL6A 3V9XA 2YX8A 3CCVS 4WFAQ 5LJVA 3D1QA 3O6QA 4Y2JA 3P5TL 2FHJD 4O23A 5J0XA 1VBYA 1DTTB 5EVZA 3N6LA 1NPKA 5ETOA 1X5PA 5JS1A 5H2FU 3VQSA 4KLGA 1QHTA 3OUYA 2O8EB 4CTAA 2R7UA 4DR7J 2B9XA 2A10A 1SGGA 5GTHU 1KD1O 3ETRA 4LFBJ 1WF1A 4CHOA 2B4UA 5KAIU 1VIOA 3OL9A 3PSIA 5EE9A 1J5OA 2P35A 1VQMN 4CCHA 3RBZA 3AXKA 4NEZA 1RTDB 1XO1A 7ICNA 2Z1GA 3FMWA 4M5JA 1FXRA 1F9FA 2W7PA 4X62F 3TEGA 4JD2B 1PYOB 2QG9B 1BQMA 2CADA 4YOUA 4CM2A 2U2FA 5CR4A 1COOA 3UN3A 3NKYA 5IIJA 5DRKA 2J9CA 1DAXA 5AT1B 3VF2A 1X4FA 1VIXA 4AYBC 1EQYA 4IXCA 3MDCA 1KVJA 3VZHA 1E4GT 2E29A 4C1NI 3Q7BA 2MGZA 3O08A 1TFYA 1KBRA 3MWBA 5EWGA 2D8CA 1LWFA 5E84A 4NXMJ 3DRRA 4GV9A 4GVMA 4UB8U 3FRZA 4HTLA 1ZQEA 2K3IA 3OR2B 2AX1A 1S6PB 3MN6A 1YJ9N 4U9RA 4GC7A 4JV5J 2UZAA 4ZPVR 3HZEA 4O4GB 4KHPF 3WK4A 3SQ2A 4P9SA 3W9IA 1W0HA 4MO5A 2R7QA 4H54A 4PKHA 4WCEL 3UDVA 5CP2A 3BBFA 3B9JA 4M5LA 1ZQQA 5KT4A 2QYGA 1NKCA 2YKNA 2D6FC 5AQWA 4NXNF 3O4NA 1VHFA 2VB6A 4MFBB 4GKKJ 1W25A 4M5DA 2LKYA 3R5GA 4A8WA 2C2ZB 2GS8A 3DM2A 4BC3A 2CGKA 2ZBCA 3VOVA 5KFHA 3N9UC 1O8BA 3WX4A 3CJ7A 1ZM4A 3PYFA 4KAZA 3ZSXA 5HHHA 4EYIB 2MKYA 4NXNK 5AQZA 2C2RA 2HNYB 4PGQA 4FWRA 2VOOA 4M3UA 3R1XA 3TVZA 2H3ZA 1FFUA 4QR1A 4I6AA 3WNEA 2DGVA 3EE9A 5EOYA 3H5YA 3LH2S 2IM1A 1YX2A 2IA0A 2B56A 1I1GA 4OX9J 1NPRA 3PNCA 3NVZA 3EYZA 2BPCA 2HBJA 2VKQA 5CHGA 1RHMB 4DV5J 5KFDA 1Y5IB 2R8KA 2GVDA 5FLXO 1S4FA 2WB1D 2ZJRQ 2CDQA 4CZCA 1UAXA 3IG1B 2VFTA 3HLUA 4JK9A 3MR5A 5AI9A 5IIIA 3QATA 4Q7AA 4WZMA 2CG8A 2ZH5A 3BO3A 5MLCV 3WHIA 2BW7A 1DT9A 4F50A 2DRBA 2L9DA 2LYAA 1EP4B 1YWXA 2FC0A 6AT1B 3RJIA 4N5SA 5HAOA 4E19A 3H0LB 2CXYA 3H7IA 1CLFA 3SBGA 2AWZA 3A3OB 2YX4A 3F5EA 5I42B 5ALXA 2HZVA 1XUPO 4RPYA 4DLGA 2KZ3A 4ES3A 4HUEA 2LKZA 3PRVA 2KJ9A 4KV8B 3OR1B 2E5LJ 2MA1A 1Y64A 1Z1VA 3H5UA 4P72A 2NRVA 3ZX0A 4EMDA 2F4VK 4NLRA 1AFJA 1HIWA 4RUHA 1KWMA 1L8LA 5KRTA 2YNGB 3TNVA 3ZSWA 4JI1J 1JWWA 2NO4A 3CTRA 2VICA 1I39A 2ZQBA 3K1ZA 4MKYA 1NEEA 3QYYA 3CCEN 2ZBQA 1LW2B 4DSEA 4OZ5A 1RT6A 3PYDA 3UQ0A 9ICBA 1N62A 4RKUC 3OFFA 3B6BA 2YNGA 4CLWA 2V8HA 2P66A 2GQQA 4MFCA 2E8PA 3V6DB 3UDLA 1BQMB 4XQ8A 2MZSA 3QEIA 7ICSA 2FLPA 4I6YA 2ZFHA 1CZ9A 2EK1A 2QL9B 2BKPA 3TEHB 1S9FA 1HARA 1JJCB 5RUBA 4CJ3A 1Q8BA 2BOPA 3W5ZA 4O0NA 1A77A 3FCVA 5JS2A 3UMBA 2L41A 5FIIA 5AQFA 4EI2A 2FIUA 4W98A 5A8WA 2YMMA 4I64A 2A0FB 4OX8A 1EARA 1S8OA 4ECSA 3NGYA 2FDRA 5KPZA 3I56S 7ICVA 5DO2A 2H51B 2GHVC 3M05A 1JLFA 1HBNA 4GVBB 4K2JA 1AFIA 1S1VB 5I3QA 4DUZK 2DNHA 1PSDA 2FB0A 2BE9B 3LAMA 5B0GA 3NAEA 3LO3A 3PX0A 2GAGC 4Z6EA 4BDYA 4FNIA 3G6VA 5CZ1A 2D1KA 4ZK7M 2BCQA 3D5MA 4ZVFA 1YI2N 2RUSA 3N79A 2G0IA 1U2VA 4PQUA 4M42A 4OI1A 4JK1A 3DJCA 5K14A 4HUFA 3RB3A 1QHAA 1KOHA 4K5RA 2HRUA 1D8YA 1DXSA 3A8IA 4GRSA 4ECQA 3O5TB 1MWMA 4NASA 1JUDA 4RO0A 2ASPA 2VOPA 1UVMA 2APOA 1X66A 3MR6A 3ENQA 3CFPA 1PVQA 3DOKA 4M5MA 1UVIA 1WYGA 4CECA 4LF9F 1HUZA 5CA5A 2CGJA 4A2AA 3G0ZA 2W4CA 1S0VA 2GNKA 1EX4A 3TX8A 4NYOA 1BUPA 8ICBA 2QM1A 2RKIA 4EX7A 5C25A 1F1BB 8ICMA 3JYTA 4YXJA 3ENAA 5F0XA 1RABB 4JI6J 4YOVA 2H3QA 1QQCA 2JH3A 4BE0A 1Z4UA 4GXKA 2N7YA 5IOLA 3SI8A 3TJAA 5IT9U 4DR1J 2YCHA 4U96A 3M30B 5M1OA 4Q44A 2M0GB 1YITN 2KICA 4KHMA 5AQLA 4FJIA 1FF2A 3CERA 4J9SA 4B9VA 2CPRA 2EAOA 5GAHU 1FHTA 5ALQA 3UKUA 2DD8S 3S6JA 3I56N 3AJDA 2DFEA 2EWSA 1VQ5N 4UF4A 3HHNB 3U9ZA 1RAIB 2R7SA 4H5NA 2OO4A 4RQ3A 2LA6A 5E5NA 4JP8A 5KFIA 5GTIU 1BQNA 3N01A 1UVKA 3DXMA 4KHSA 2YTUA 4OMFG 2EH9A 4CEBA 1TP7A 2X3GA 2B3TB 1VC6A 1VQNS 1NH7A 3KZIU 4FWKA 2O8BB 1WOQA 2J7KA 1RTDA 2LU2A 2YWGA 2BKOA 5A8KA 4B1YB 5HJYA 2E1AA 1KLNA 5TKWA 3W62A 2F7TA 3OXLA 3RFAA 3MEDB 5JVGL 1S77D 1NBEB 4A57A 1FTCA 5J2PA 1TAQA 3DOMB 2VD3A 4QZCA 3RH4A 1S10A 2XZTB 1M1KT 1F3VA 2DH7A 1TK5A 4LF8J 3KZXA 3ZTOA 1UCNA 3AO1A 2IOFA 4YQWA 3TADA 4C4WA 1RT5A 2Z2ZA 3I76A 4NWIA 5BPMA 1C0TA 2F77X 9ICTA 2DT9A 3CWJA 3VEOA 1OY8A 2F8MA 3ED5A 1U25A 1RM6C 2W9BA 4USHA 3LM9A 1IXRA 2H65B 2PBDA 2YX7A 1RADB 2VONA 3RSEB 2AW0A 2D1CA 1HJOA 2G4BA 3OLAA 3LF0A 1IG6A 4U67Q 2GO9A 4ZN3A 4FE3A 3FEZA 3CCZA 5E3PA 4KN7A 4YDXA 5LT5A 5AQTA 4TY8A 4BRDA 1R59O 4UB2A 4CLPA 4DHYA 2FPLA 3UCZP 4CGIA 4QCLA 2PKEA 5J29A 4UAWA 3RG6A 1CI4A 4Y2CA 1NNDA 1B22A 2UXCF 3VESA 3E51A 5GVQA 3A3NB 5KGXA 4AXJA 4O44A 3QU2A 4DFDA 3NGRA 5LXYA 1W7WA 3MXHP 1R43A 3HX0A 4Z37A 4TY8B 3CCUN 8ICYA 2HVIA 1WEZA 5F41A 4ZCLA 3V72A 2HBKA 2HLUA 1URJA 3N4WA 4C97A 2B9EA 1ZQVA 4DV0K 4TU7A 4LR9A 1RDUA 3H08A 1QZ5A 3KWIA 4F3TA 2FVRA 3KHYA 2CJXB 3TAFA 3DLKB 3NVVA 4FP9A 5L9NA 4KKOB 1Z6RA 5AKXA 2E5HA 3B0XA 2KG0A 1ZQIA 5J2BA 2NS1B 3HSTB 3TR8A 4P0QB 3IDHA 2XCPA 5HBMB 3ZT1A 5K8OA 1JCEA 3VQ4A 1SV0C 2Z1JA 3I0RB 2HSEB 2YB1A 3M8YA 4H4MB 5E3AA 3SYZA 1RDRA 4OIXA 4ID8A 2AXTU 4Z4CA 1FA0A 4JV0A 1J9AA 3NAIA 3W8GA 3D6TB 3KLHB 2NNWA 4NLCA 4ECVA 4PKIA 1IG9A 1BPXA 4H4MA 2UU9F 1CZBA 3Q8SB 5D3GB 3LWLA 3GIMA 4NZ7A 1LW2A 2W2MP 3KK3A 2BCUA 3P96A 1RTHB 2NUHA 4KSEB 3VAFA 4R65A 4BLGA 2WZ1A 3A5MC 1XMQK 2CQ3A 4PWWA 2KT5A 4ZP6A 1KLMB 4KITB 5M2RA 3MAHA 3O0FA 3R9LA 2DO0A 5F8MA 3H3NO 2DWQA 4AYBF 1ZJMA 3B8HA 1Y9OA 3I55S 3DXKB 2QL7B 1WSEA 3KK3B 3CQXA 1RBTA 1D8ZA 2QXLA 4JRPA 4OD0A 1RFQA 2VG6A 1GOCA 1KRPA 2FSNA 4CEDA 2NRZA 3MM8B 4PG6A 4B1VA 2VYPA 5HMWA 3M6WA 4J9UE 3J7YP 5AKYA 3AV9A 3SUOA 3KDNA 3N5FA 4Y2UA 3TQEA 3CJBA 3AU6A 1GOAA 2LBOA 4PXDA 5F2RA 4CZMA 3W60A 8ICAA 1VK8A 5JRTA 3H5XA 3K9JA 5AXLA 1FKPA 5KOWA 1BCOA 3ULEB 3A4TA 3WK8A 1TQLA 1EQMA 4QAGA 1KHWA 1RWVB 3R6GB 2MGZB 5EWFA 2N82B 2AKWB 3CJCA 5ALNA 1X0FA 4DV2F 3O4QA 4IOBA 2CWKA 2Y9HA 2GA7A 1X42A 4G6VB 3EZ5A 2JGUA 4FWOA 2NCKL 3BBBA 4X64J 2CJAA 4DV1F 2W55A 3I5AA 3OD2A 2V9WA 2EZYA 4FF4A 2BVZA 2CQPA 2UV8G 2Q79A 4K8ZA 2GCFA 3WZ0A 4BWJA 3J7ZT 3O44A 3Q8QB 1FEEA 2IVOA 1TL1A 2DFLA 3HHLA 1HBUB 2LDYA 4J9NA 4KB0A 1VBZA 1XS9D 1R27B 4WXWA 3P39A 2GX9A 3PRDA 4FJ7A 3ISZA 7FDRA 3JPQA 1RAHB 2ES6A 1AXQA 3AO2A 4OYIA 3F41A 3L7OA 3PYEA 1S6UA 4ZVRB 3BQ2A 1RBAA 5AQVA 3ZDBA 3WNGA 3QEWA 4KHUA 3W5YA 4DL6A 1HIYA 4KHYA 2MQ8A 1N5YB 3GFHA 2F9DA 3ZO7A 4DSFA 1XNRF 1DURA 4PWDB 1NJIT 5G0RB 2KEYA 5ALTA 5IWAK 4CNYA 4DFMA 1NHUA 2BHNA 4HHUA 5U47A 3CJQA 2MB0B 3K4GA 3UDCA 4U7BA 2QKBA 4EBEA 2YMLA 5CY4A 3L3CA 3NMUA 1QE1A 5KG7A 2ZM6J 6FD1A 1XR7A 2A40A 2B7BB 1LV5A 3L4PA 4A62A 5AM3A 4ECXA 2ROGA 9ICCA 4PPZA 5GADP 1RK8A 1X4HA 3D28A 2KM8C 4DR6J 3V1RA 2GWKA 2L5YA 5KT7A 2YKPA 1WKLA 4IFVA 2CJ9A 2KKPA 3CCRS 3ZT0A 3K9KA 2OFHX 4O3MA 3TZXA 2CNLB 2YNHB 2XMKA 1C0MA 4C7QA 1B7FA 1Q7LB 3MPUB 1RU2A 3UKRA 2J6SA 4RT2A 2DIUA 4E1MA 1HHTP 3TFRA 4DV5K 4TYAA 2OH2A 4OPAA 2LA4A 4OJ6A 3MM7B 4IG0B 3KK2A 4C8NA 1AUSL 3HHKA 3AA8A 5KFEA 1BI4A 2KSOB 2M9NA 4QZIA 4NCGB 4ZVPB 1WORA 1NDKA 3ID8A 4UAYA 1RHQB 1WDDA 1JXEA 3ETOA 2V7YA 1ZAVA 2GC8A 8ICHA 1ZBHA 3P49B 5EXWA 2F4VJ 2W4DA 4I27A 3M2VB 5GAHP 2MZTA 3W2VB 2ZWPA 3U3YA 2G8HA 4DB3A 1TVAA 2Z2LA 1SBRA 4CGGA 2P9KA 4L8RB 4FLXA 4R63A 3EW9A 1ITPA 3M8WA 2JRZA 2PA8D 3ZZZA 2ZZNA 1ZPWX 5ETMA 4PQUB 5KFXA 1HNWJ 1RTJB 5AHXA 3G96A 3A5LC 4ILGB 4P0QA 3DLJA 2G0AA 4B3TJ 3QQCD 2O4GA 2JVRA 5HP4A 2ABYA 3GJSB 2FPMA 4F5PA 2CQCA 4O44B 4F7VA 3R2CJ 1UT5A 3AMZA 4CRXA 2WVDA 3L2VA 2C2DA 4C11A 4LBHA 1M5SA 4K59A 4ZA1A 3VGMA 4L75A 4M04A 4DS5A 1YBUA 3MPYA 3TZWA 1T11A 3S6EA 3WQTA 3MHYA 3VEVA 4JI7F 1I5OB 2Z2YB 1S9EA 2HVHA 1IBMF 1IIPA 4UY8T 2CPHA 3P4UB 2ZHAA 2XY8A 3O9QA 1WOPA 4DQQA 1IV8A 4M45A 4DV3K 1KAXA 3AODA 3D2QA 7ICLA 2WRMA 4J9VA 2HGNA 9ICHA 1F60B 3MC1A 2LLZA 1SIWB 3EMTA 3TACB 1TL4A 3M30A 4DUZJ 1RNHA 1NDLA 4W5TA 3LZIA 1OY6A 4WZQA 3VERA 3PIOQ 2Z1IA 4YDUA 3GJRB 3FK4A 3T5LA 2VG7A 1HNVA 3L4BC 1UCVA 1KN6A 1NWKA 1YRTA 2ISOA 2MQOA 2QARB 5FPMA 2LHTA 3EWAA 2KFYA 5FROA 1U02A 2LQ9A 2Q6BA 1FX4A 3B0YA 1U04A 4CJVA 4F4AA 1MQ3A 2XQCA 1QE1B 4JI4J 4Q2MA 4DV4K 4DU1A 4GKJK 3MEEA 2NSCA 4K4ZA 3EDRB 3AQOA 1HW8A 2KD1A 1KCFA 5KG3A 4MEXA 1QQ5A 2MUTB 9ATCB 2F9WA 2M52A 1C7YA 2F65A 2BCRA 2IHMA 4P2MA 1KVKA 3CRXA 2K1RA 4PL2A 1SV4A 2NSBA 1HYSB 1PJ6A 4O3RA 1Q81O 4DQPA 4P7TA 4PYDA 1O13A 4OX9F 3DOLB 2Z2MA 1DQ9A 5FDLB 2DNGA 9ICOA 3OTCA 1XJWB 1LVHA 4CO0A 5EHHA 3MEDA 5J0YA 4O5EA 2KIWA 4NMLA 1FE0A 4B3TF 1U49A 4OI2A 2KVIA 3KJNB 2CYYA 2P2CB 2DFFA 3C28A 5B5EU 2A2CA 5GMDA 3JTOA 5BJRA 3CIPA 3BKUA 2XLKA 3K0JA 4NYPA 3T9ZA 2ZHOA 4LQ9A 2KHQA 4C9DA 2ZXHA 1BA1A 4WYWA 3EX7B 2Y8WA 3O4WA 7ICUA 4RW7B 4KHPK 4M63C 4FYWB 3H7HB 3F2KA 3DYAB 1PIEA 1KP6A 4AXIA 4YMNA 5D0GA 2W1BA 1RBRA 2PI4A 3LL3A 3Q8UA 3WKBA 4TQRA 3QEXA 2R2SA 1S0MA 2HBRB 3BH7B 4E89A 3C3LA 9ICAA 2KJVA 3Q8PB 5AM1A 2ATQA 3RAXA 3TUZC 1PBAA 1CLQA 3LAKA 4C0BA 2M4MA 3CC4S 4BY9C 3KDOA 3ET6B 2D41A 1BU6O 1VQMS 4ZIVA 3RBDA 1JI7A 2IA6A 2DISA 2ZKUA 1IR2A 2FHMA 1UW4A 2J8AA 3FNNA 5DM6L 3HO1A 1FCAA 5GAEU 3QNMA 2ZUCA 4DS4A 1TKDA 2Y9TA 3OYGA 1SJQA 3IR5B 4EK2A 2BX6A 4IUFA 4LBIA 1FKOA 1XIQA 3BDPA 3K2PA 1WCNA 5F3XB 3P1GA 2PSZA 3Q8VA 5IV4A 2X1BA 1UPMB 3HCXA 3GE9A 4J9MA 3DDHA 5BOMA 4DV0F 5L38A 4B8CA 3NP5A 4LSLB 2ZM6F 2DK2A 3R5BA 4BRMA 1TL3A 2AJ1A 1HNWF 2ADCA 5F3ZA 1LFPA 2F44A 3MD3A 2KU7A 1PK3A 2BE2A 3K59A 4DL4A 2BJ3A 4E98A 1O0PA 4A8YA 2DGXA 3FLCO 4B9SA 1IWGA 1YJ7A 1SXLA 1S57A 2JNJA 3UE5A 1KNZA 3BN7A 3V6DA 4CBWA 1O08A 2RAQA 4HTJA 1U0SA 8AT1B 1S72S 2E1ZA 1ZQTA 2Y1JA 3LPYA 4CZHA 4IOCL 4R5PA 1NGDA 1T6DA 1TFWA 2D69A 1JNRB 3SSQA 1YLXA 4AQYK 1VQ9S 2B0GA 1NSAA 4JWNA 1Y5LB 3MM5B 2UUAK 2FJDB 4KLFA 1KC8O 2F8TA 5LSRA 3WK7A 1U26A 2DCLA 3NGKA 3ZTPA 1N6QA 3OYDA 1ZRMA 3EE3A 2ASLA 5KT5A 1E6YB 3KFUF 3I8BA 3OYIA 4FLZA 1DTTA 3GTYX 3JS9A 8ICGA 1N32K 1HFEL 2Z8QA 1YJVA 2A1RA 2QXFA 3SK3A 3PFEA 2J0SD 3W63A 3FEYB 2VPXB 3JPPA 1GOBA 2GFFA 1VSMA 1HYSA 2HMIB 3NGZA 1DQAA 5KFZA 2JC0A 2ILYA 2QK9A 3VEZA 4KLQA 3GILA 3O2IA 4KR0B 4IJAA 3M8QB 4KH1B 1SQFA 4FW2A 4QQBA 4GKJF 4DV0J 1UVNA 4RNHA 1V4SA 2UXBF 2H3EB 3QYPA 1GMWD 1HNZF 2OPRA 5D3GA 2DKXA 1SI9A 1VQ8S 1LKYA 5ITHA 3PJWA 2VQEK 2ZHBA 5K4LA 4AHCA 3RMBA 2IBOA 1IBCB 3MPVA 4WFAL 3HWTA 2XSJA 4E3SA 2JR5A 4LF6J 3QMLA 3AARA 1QH9A 4XIUA 2KSOA 1BPDA 1ZQ1C 2JH7A 3G71N 3QESA 5AFUA 4BRNA 3AVJA 1HWJA 1O5JA 2R42A 4QBUA 2QL5B 4CNZA 2G2YA 1ZXOA 4CESA 4GIBA 3K2YA 3E01A 5ELZA 4MF8A 3I0SA 1A76A 2H9ZA 1VSLA 2CZ4A 1SJ3P 2KM8B 4CJSA 4L76A 3D54A 1N60A 4RWTA 1RISA 5J2MA 5KT6A 4ZTFA 1HBOA 2EBGA 4GVEA 2ZTDA 4DCJB 2ZH1A 3Q7CA 1KQKA 1TUYA 2ZUDA 5GMKa 5AM0A 1LW0A 4GNIA 3BF4A 1XC3A 1N33K 3ULEA 1PAEX 3OVAA 1GQEA 1U9LA 1C1AA 3DFEA 4IKAA 2IHR1 4DU7A 2LXFA 1TV6B 3EO3A 2FI1A 3CB4A 1NGEA 4FOIA 4ZVQB 4QU6A 2RDJA 3QAUA 3ENHA 1L3VA 1RA6A 3UNYA 3PSTA 5KFBA 2YH1A 4GV6A 2H54B 1TL7B 1R8CA 1LFWA 2B6AA 2RPIA 2Y9UA 2QZ8A 2YPYA 1J97A 4LZDA 1SZPA 5L9XA 1Z26A 2J0QD 2V8GA 3LTOA 3C6UA 2DGUA 5EE0A 1TL3B 1KC8T 2D3DA 4N47A 2JHDA 4F02A 2QN6B 2W9MA 5DLFA 1NOYA 2AZ1A 5D4PA 4DV2J 1Q5VA 4AILC 4ERDA 3LDLA 1V5IB 3O3FA 2MJUA 1GMVA 2WHOA 2OPPB 3NDKA 4HCCA 2C2MB 4ALZA 4PWDA 1CPZA 3OYEA 1NK6A 4ED6A 4JNEA 1QSYA 3FZ2A 1TAMA 1FI4A 2BRLA 4ID5B 1FFVA 3OHAA 1DLOB 2W25A 4M5NA 4FJNA 1XR6A 3SMZA 3THPA 2VODA 4FYXB 5AQXA 3C16A 4OPJA 2Q0UA 3P5BP 4FWNA 3B4DA 2CJKA 3CJ8A 4JD2A 3ZSZA 1SS6A 3DHXA 4X4UA 5J0RA 4DI6A 3PX6A 5J2NB 4AHTA 4JKFA 4LRFA 1VC5A 1VRQC 3BGRB 2PAVA 4IOAL 1U45A 4YEAA 3Q86A 5AE3A 3Q24A 4ZITA 2Z30B 5JVGQ 2WTFA 4CM0A 3S41A 1QDUB 1YTAA 1MG7A 4CZJA 8ICSA 3LK9A 2A3JA 3CC2N 2VWJA 3DM2B 2D7SA 4AQYJ 4U6PA 1JKHB 3KKRA 5CHIA 4C3MA 2YNIB 4DN0A 3DLEB 1S76D 2KL8A 1SH0A 2NO5A 1U1QA 2BJ7A 4A5BA 3GIKA 2DR5A 3HSZA 2P1JA 4Y6IA 1YJ9S 5LY3A 3ZZ0A 4BDZA 2OPQA 3KNAA 4PGXA 1TE2A 4ED5A 1TFRA 1RT7B 1TMJA 2EXUA 2MY8A 5HL7Q 2WF6A 3IRXA 4MAKA 4K41A 3BS7A 2R7WA 2BEFA 3AA5X 1RGIA 4V19J 1FKOB 2HHSA 4JN4A 2B8PA 4CH1A 3HRGA 5J2EA 2WB1F 4DG1B 3HVWA 4A48A 1VSEA 1REVB 4BCAA 1RAFB 5C42A 3UXOA 4K8XA 1YRXA 3H3OB 1GLFO 1RHKB 2E20A 1CJKB 1LOUA 2OUGA 2CIMA 4U7CA 4J7CA 4ILHA 3CJ4A 3D0IE 3WK5A 3BS5A 2DO4A 2EFNA 5K20B 4NYZA 1BI4B 3D45A 2DH9A 1GTEA 4CD1A 4RR5A 3IFRA 3QEPA 5A0YB 3CXCM 3NWRA 3OYHA 1A9NB 2XYGB 4BRGA 4HEA9 4EP4A 1S1UA 5F8JA 3H42A 1VSKA 5LJ3Y 4GFJA 3AEVA 3GP9A 4FLTA 1NB7A 3CCLS 2XVTA 3DAWA 4CLTA 2BCVA 3CJ3A 3ZYYX 4M47A 2QW9A 4IO8A 2B7CB 4A4JA 4U7UK 1GH8A 4LZGA 3A5NC 2V2KA 1NK9A 2JEJA 4DL7A 1FEZA 1CC7A 3IWLA 5BRFA 3DOKB 5J1EB 2D74B 4JV5K 2KXNB 5ALSA 2VJ5A 3U27A 2YN4A 3KJVB 2NYIA 3LP0A 5T7LA 4A2BA 3OS2A 4OLBA 5GAEP 5HN0A 4M3RA 4FPRA 2RSQA 3VAKA 4DR7K 4C23A 4RQNA 1PYTA 4LFAF 3GONA 1VSJA 1U6FA 4BE2A 1YDLA 1OYDA 3THWA 4F5OA 2XY7A 1B0VA 1HJRA 1RAJA 4QIWD 4PJ0U 3W0LA 2KW4A 2KE7A 1P27B 3LPTA 1MDUB 3QBCA 2QWNA 4LRDA 3CCVN 2PC6A 4XTTA 2HMIA 4KHRA 1VQPS 1X0PA 2R8GA 5CZXA 3S01A 3VZIA 3W65A 1VDHA 2MKJA 1UFWA 2F4FA 3AGRA 3KHGA 1VQ7S 1JXLA 4RJVA 4OKEA 4MMOA 5AQPA 3CNQP 1I94J 3VAGA 2UUCF 2ZH9A 2EHGA 1B9DA 4M0AA 3VEWA 2YJFA 3ZSVA 2OTJS 5B0CA 1NG9A 4M3WA 1P90A 2OPRB 4FBTA 4A8OA 1VHIA 5AKKA 1K47A 1UKUA 2DGQA 4Q0BB 3RRHA 2N4CA 3IR6B 3HSCA 1F3FA 3PACA 1LK7A 1VISA 3FBCA 1DGKN 3KLIB 2QMUB 2H3VA 4KREA 2VFSA 1F44A 3FFIB 2MQQA 4J37A 4IZ9A 4K50A 3W3SA 3RMCA 1S1WB 4MTPA 3OUYB 1VS3A 3NHGA 1ZBLA 1RWMB 1TV6A 3PFOA 2J7UA 4GMKA 2MTLA 1VQ5S 5GMEA 4CJ7A 1H0HB 3PHEA 4A8KA 2AHOB 4BQLA 5CYQA 5KQDA 1CUKA 3OXFA 3DRPB 2Y3YA 4H4KA 4KMOB 3J7YU 1H2VZ 4KLUA 3BJYA 4Q8EA 3W7BA 3Q2TC 3CMAS 1N32J 4H8KA 5ALMA 9ICFA 3CSKA 1N5SA 5A2QY 4DR5K 1NGGA 4N76A 4DL2A 4W90B 3ZSQA 2E1FA 4AQYF 4PG4A 2K4HA 3CPEA 4FYDA 2ASMA 1PC5A 2JX2A 3PEHA 4TVAB 2YX6A 2CPIA 3GYXB 1H7XA 5AQQA 2ZIXA 4WKRA 3D7EO 3CIZA 3WK6A 4F04B 1ASUA 1LQ9A 2VV5A 4OYXA 5IIKA 2CFXA 3QU9A 3VQCA 4NE9C 1FRIA 5A8RA 4DOBA 4KGKA 4M6WB 2YBVA 3HSDA 4UUXA 4F8RA 1RBUA 1SL1A 5KFOA 2Y1LB 1DK2A 4NA1A 3AAQA 4PHAA 3MR3A 4P73A 2WOMB 2GMHA 3RSEA 4FPBA 4ZPCA 2R7TA 1MMNA 2W7AA 2XRIA 4TUQA 3C6UB 3R8YA 4LH5A 4F4YA 1L3SA 2G09A 2PYLA 1X9XA 2XM3A 1SUQA 4R8UA 1ASVA 3M6ZA 2HQGA 3LWMA 4NLWA 2IDEA 2N7CA 4C98A 5J0WA 1XO0A 4C7ZA 2CQGA 4DL5A 1KVCA 2F9JA 5CD4H 1E6VB 3W1YC 3LDQA 3AQPA 3I82A 3BM7A 1GLLO 1SUQB 3MCSA 3V1OA 4LF6K 1X5TA 4OX7A 2KZMA 3G9CA 1JQGA 4FJGA 1ZM9A 5J2CA 2IVPA 2XMVA 1WNEA 3NH0A 4G1PA 4RW8B 2NZ4A 5AKEA 1NDCA 2VF3A 5ALFA 4LMZA 4B9NA 2ESEA 2ZIUA 3X3UA 1RCOB 2VJUA 1XNSA 2HVZA 2V5HG 3MPWA 3CNHA 1TKXB 2H5EA 3ISDA 3MM5A 5HVFA 2KI2A 2KG5A 3RYLA 3AU2A 4PYAA 1BHNA 2GOLA 3DOMA 4FKXA 3HPOA 4KC5A 4LRAA 2D0CA 3TAQA 5KG5A 2D0AA 2WVFA 3CF5L 2V51B 1XI1A 3F9MA 4BC2A 1VQNN 1UVLA 1RXOB 3ZFVA 4KRWA 1XSNA 3QUCA 4MEYA 2UUWA 3GOIA 1U6ZA 4O8KA 4Q45A 1X5SA 4ES1A 3J7AN 4J91A 4Y2QA 5ALYA 1FRMA 8ICKA 1JCGA 2DUYA 4IO9Q 2W8KA 4J9LA 4CF9A 1ROFA 1RAEB 2QWRA 5A0YA 1FRXA 4F0MA 4JK8A 4U8VA 2FJ6A 2ZKTA 1Y88A 2K1RB 1VRUB 1GXLA 5IINA 4OZ0A 4YR2A 1N4LA 2JLGA 3MI7X 1Q82T 5E2QA 2ZBIA 4YXMA 3SMPA 2E66A 1KQSR 2DY1A 4ICLB 4RW6B 2DPJA 2B4PA 5EY4A 4QYRA 3SLCA 1T0TV 4CJEA 3GE1A 5ALIA 3VQEA 3UI3A 4Y3CA 3O9UA 3NNHA 2P6SA 5J1NA 3NBPA 3MURP 4CE9A 2WAQC 5IS2A 5AKGA 2AF6A 3NOGA 1V38A 2XMMA 3NMAA 1N33J 4QJFB 2F8SA 4LBPA 3L2QA 1RT3B 3SDEB 3KJVA 2E1CA 1S6OA 4JI4K 3ISND 2OPSB 1H2TZ 4YHHF 3QRRA 1SL2A 2C3PA 4ISEA 4FJ8A 3SSSA 2K7KA 1NJXA 1KHVA 1X1PA 1FT8A 1NRKA 3EVOA 2ATCB 3MMBB 4IQTA 3IS9B 3MMJA 5AI5A 8ICLA 1NGFA 3GL1A 4LF4K 1NMDA 1QM9A 1F0XA 3WEEA 4ANEA 3E9PA 1J5EK 5AI6A 5AXKA 3D3BJ 4B3SK 1ICEB 3I5CA 1NSQA 2E2QA 5D49A 4WJBA 4AL6A 1DRZA 4P4MA 2F3JA 5F3TA 5I3UA 1B4FA 2V2ZA 2RIJA 3KJQB 4YOTA 1Q95G 3R9KA 3FQKA 1JJHA 1PC4A 3JQMA 4PCQA 4O0IA 1RXVA 1PAUB 3QEAZ 3IBFB 1ESVA 4ISFA 4DX6A 5LSLA 4USUA 4ETXA 4MYTA 4F25A 4IKFA 2A1AA 3C2PA 1MN9A 4M9HA 2OSQA 3M4XA 2K8AA 4DV4J 4AHUA 4YG2A 5ALPA 5KFWA 3AAWB 4ZJOA 4LF5F 3M2UA 3BQ0A 1N56A 5L46A 3SCXA 4DSIA 3I4HX 4EEKA 3DMJB 1NGIA 4OZ2A 2J9DA 3AVCA 4FZZA 3M8ZA 4FM0A 4QU7A 5DGBA 3D1HA 2P5GA 2HQCA 4FLVA 2VG5A 4DQIA 4G3IA 3FYHA 3P31A 3K58A 1YQHA 2J0WA 1IBLJ 4JI5F 1RQNA 4YFKA 3JSMA 5D6GA 4N56A 3J7AP 2LXUA 2RE2A 4CTAB 1VQ9N 1QS4A 2AJ4A 3EM1A 3V7JA 2X7IA 3H0PA 3RB6A 3AO5A 3OJUA 4JKGA 3MEGA 4HI1A 5IM0A 2PI5A 5CYMB 1HR0K 1M1HA 4ZPWR 1IM4A 3K5NA 3GCWP 2QA1A 1SCJB 4LD0A 4KGZB 1PBUA 2PFOA 4CEFA 4LF6F 3MMCA 3OVSA 2CJQA 1QAYA 1HI8A 5SWMA 3N6NA 5IWAF 1IKWB 4IFVB 1XMBA 1N2XA 4BDPA 3IMQJ 2VPYB 3D1OA 1QD1A 3K89A 5EGYA 3WIUA 3THYA 3ZDEA 4AE5A 5AQMA 5C10A 2MLZA 1HLUA 4GKKK 4RL1A 1BXNA 8RUCA 1WC1A 1UQVA 1RBSA 1ZPVA 7ICPA 4GO7X 4GXJA 2UXBK 3OXGA 3SV3A 4GLXA 1ZQOA 1KFTA 5ALHA 4ED2A 1CG2A 3D0GE 1UFKA 1Q9XA 1R31A 2QWQA 2OMLA 2OIHA 2FBTA 1KN5A 1LKYB 1N5QA 4B17A 3TJ9A 4PXBA 5DBCA 5F0UA 1W97L 2LM1A 5IQ6A 5KI6A 1FFWB 4N8NA 1CJUB 3G8QA 5IC4B 4X66F 3SAGA 4EX6A 2DITA 1GAOA 4BS2A 4PL8A 2B4OA 5DDPC 1CEZA 4DPXA 1IH7A 3AVAA 1XNRK 3NRBA 4USMA 4H4KC 1LAVA 2HS0A 4KAIA 2WSEC 2V68A 2VZ9A 4R8UB 3D66A 3AVKA 1FDBA 2D3ZA 1DTQA 4BR0A 2FF6A 5FPEA 3TUIC 1FNOA 3CCRN 5CQGA 3WK9A 4YS2A 5F8GA 4XUSA 2C42A 4DPTA 3LM2A 3HRDD 3ZCMA 3N0VA 3THTA 4ZHRB 2G08A 2VKRA 2VQEJ 3CXCR 4LJXA 1NSKL 4OJOA 3QINA 2W41A 2OYQA 5AK4A 3BSAA 3OR1A 3PKYA 2WW8A 4ED3A 2VHGA 1YJRA 2IS3A 1FD2A 2GMLA 4F72A 4LFAJ 3D2FA 2ZOGA 4O5CA 3T1YK 1TUUA 3U8XA 2R8JA 1W2IA 3I33A 5IIMA 2HNYA 5JVHQ 4JB3A 3CP8A 1TTHB 4FZVA 5ADXA 1SB6A 3KOAA 2CDRB 2RS2A 1SAZA 5LMNF 4FJHA 1GX6A 3F56A 4YOWA 1X40A 4CEAA 2EAPA 4OPKA 1QLNA 1B0PA 4XPCA 1B3TA 4Z0UA 3D2EB 4BR7A 4PPDA 1CQMA 2IBKA 4RNOA 1VK3A 2HWHA 4R25A 1S12A 5EE3A 2YH0A 1YXQA 3AB2B 2P9NB 2JSXA 3W2WB 4RPZA 2CJBA 2DY9A 3V5RA 1ITGA 3THVA 4DTSA 3LYSA 3ZSRA 3G6XA 4BGDA 3OYBA 3O3LA 3O1WA 3AQFA 2OEJA 3GFKB 3ASMA 1CJTA 3TAPA 3R1LA 4MH8A 1FERA 3DXKA 4W92B 1K73O 4AM6A 1WC5A 4CO4A 4E7HA 2ASDA 2G8FA 4LFAK 2MYFA 1RBOB 4Z6FA 1L5UA 3K5OA 3T1YF 4K25A 1N5WA 4OJGA 3HJEA 2FTRA 3TA2A 1Z19A 1BE4A 1HBNB 2W03A 2MKCA 3ORYA 1UETA 2P9UB 2HFNA 3WXJA 2XULA 3QRPA 6FDRA 2HFUA 4USTA 2I5HA 2Q31A 2M2BA 1BPBA 3CE8A 3A0IX 3PW5A 3E9OA 1ZTWA 4F26A 2AT1B 2XSJB 1RHRB 3HF5A 4UT4A 3IR7B 4QS7A 3LOUA 2NXUA 2CZ9A 1TUVA 3C46A 2FHOB 2X6NA 5AE2A 4NY8A 2YKNB 4KH0B 3BN4A 1Z00B 2ZOFA 3EZOA 3H8YA 3TOQA 3Q2SC 4K4GA 5A6WA 4K0KJ 5DG8A 3MX2A 1U1NA 4NLTA 1LWEA 4MDAA 2BPGA 3WC0A 3IAYA 4HCBA 2FLLA 4UB5A 3M8SA 4I2PB 3PM9A 3TAMA 4HUGA 1HNIA 3PW0A 4LUBA 1RA7A 5AQGA 3OJSA 2C2NA 3QERA 2X3DA 2MSSA 2K4PA 2UP1A 4ANCA 3V6JA 1DFDA 8ICTA 3DWLA 2WF7A 4J2BA 4O3QA 2F1IA 3K5PA 3RU0A 1UOCA 4USVA 4IR1A 2XYHB 5KGWA 4A8MP 4U67L 4C4TA 3Q8YA 5AI8A 3F53A 2PZSA 4PAAA 7ICHA 5DDMA 4OGCA 1KW4A 2RT3A 3MCAB 4MHVA 2P9KB 2E9ZA 5HRSA 4KHPJ 4X62K 1WHXA 4TLRA 5AKZA 2R2TA 3KMSA 4ILMA 2Q43A 4DV6J 2Y1IA 3T19A 2DNPA 4OJ5A 5D4NA 4DZ6A 5J8YA 2Z58B 5I3PA 4MK8A 2W04A 1NHVA 3IA0A 1HNXJ 2FUG9 1N5YA 3CGIA 3SFGA 1N36F 1B9FA 3ZDCA 1YGYA 1C1CA 3KLGB 5ALKA 1L8OA 1Q78A 2CGLA 1YITS 1OSDA 1TMMA 1ULRA 5C25B 3E9LA 1VQKN 1HYZA 3MMCB 4B9QA 4DSJA 2HS3A 2MEWA 1IBMJ 5MLCQ 2KHVA 5IT9Y 2YKMB 5JJBA 2JZ5A 4PZNA 2EDUA 5ALDA 3CC4N 4CIFA 2GVDB 3CCWA 4WFNQ 4FM2A 3SIPB 1NK5A 1K73T 3OTBA 4US9A 4N8OA 1TKZA 2N3OA 1GT8A 2CKWA 2C2EA 1CVJA 2F96A 2BA9A 4FZNA 4ILJA 3DHWC 3ATUA 1A6LA 4QOTA 4LFCK 1EWQA 2OYYA 3KTQA 2DXEA 3ZETB 3BREA 2QYCA 4IOAQ 2I7PA 3NF7A 4URSA 2MXYA 3QU5A 1LWCA 5H1SV 1N34J 1KS2A 1V9PA 4IYQA 4WFZA 1NM1A 4WCEQ 5E3CA 1JLAA 5I4MA 4P0PA 3BGLA 4CJTA 3BSNA 5A0LA 3PV8A 4YR0A 2HZAA 2RQ4A 5K8PA 1VLBA 1WI8A 4O3PA 4OJ1A 2NYVA 4WF9L 4XDCA 1VQPN 1HNVB 2Q66A 1IJJA 4C0ZA 4QWCA 4I2AA 5J2DA 4JI3F 4WTYA 2HVDA 2AMCB 4BREA 5DDOC 3UD3P 3NNAA 3AD9C 3LALA 3FDSA 3AA4A 2J9EA 4DUTA 4BRKA 5JU5A 4E1NA 5EDWA 4Z6DA 3VQ8A 3LPUA 3T1AA 4EELA 2FPHX 3VQDA 3UFCX 2HHVA 1LCUA 3MN9A 4YDUC 5HVGA 3H8SA 2WAQD 1HNZJ 4NOHA 1T8EA 4CEOA 5D78A 2WVBA 2RRDA 5HL7L 2EQYA 4EO8A 5GAEI 1YJNN 4FDFA 1MA7A 2E8AA 4DUYJ 4AF1A 1KOOA 4LREA 4J9OA 4JOUA 4A8EA 3OHBA 3TPQA 1NH8A 4OZ1A 1ED1A 4NV0A 5IV3A 5A8WB 1N33F 3IG5A 2ZE2A 4QR0A 4CF8A 2EG2A 2VC0A 3SMSA 3VGLA 1YBTA 3R6MA 5A8KB 2XICA 4OQJA 2HHTA 4Y2RA 2FJEB 2F5GA 4C3KA 3PIOL 4DR5F 1S5JA 3TO8A 3AJ1A 1ZQYA 1JLQA 3ZX3A 3L09A 4IOCQ 4K0KF 4RQ2A 4CH0S 1FJCA 2ZE2B 2IOCA 3NLCA 4MFFA 4G65A 4IL6U 2G2ZA 4GV3A 3FGVA 1ZD5A 1U2FA 2RHKA 1ZQSA 4M9LA 2LXIA 5J1PA 1JIHA 4WFXA 2KJ8A 1D3WA 1CJKA 1MSWD 3NWGA 2KH9A 4NYNA 4F3MA 4EHTA 2PMWA 5ETQA 3JXUA 4FLUA 5IFMA 1ATNA 4YB5A 2Q3PA 4B1WB 1LWXA 3BEGB 4OKJA 3MCPA 3FJ2A 2HI0A 1OQ6A 1NGAA 5A2QO 3OYNA 2G8VA 2JXJA 2EEYA 1H7WA 3WKEA 3ENVA 3A8JA 1DGJA 3VGSA 1A0OB 3B54A 1PGZA 3O3GA 5HMYA 2JLEA 4FLWA 4U95A 1A7GE 4C0OC 4KGVB 4KYZA 3VN5A 3OFHA 4UB3A 1ELOA 1JNZB 1RU1A 4CFDA 2B6AB 3AVNA 2P9SA 5J2QB 3KD5E