1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
3QZ8A 3RMAA 4HUFA 1KVCA 4RQ6A 1RDCA 9ICMA 3EWAA 2Z1JA 3MAQA 4FJGA 2F1IA 4R65A 9ICVA 1S1WA 4CFAA 3PNCA 8ICCA 4EZ9A 1QTMA 3MXMA 2PYJA 1SKSA 4KHUA 4ED2A 4NY8A 2ASDA 1HYZA 4HUEA 3ZT3A 4E7HA 4XQ8A 4IFYA 4DL2A 5J2EA 3S9HA 1S0NA 1JLEA 3DLHA 4H4MA 4CHPA 1RTJA 4CJ4A 1VSFA 2XY7A 1BIUA 4KHSA 4IR1A 2WTFA 1S1XA 5K14A 4CEBA 1CEZA 4FLYA 4TUPA 1B43A 4I2IA 1T03A 3NTUA 4GMJB 3PX6A 5CYMA 2AJQA 2P5GA 4X5VA 4ID1A 4RW6A 4BACA 4CJPA 3RH5A 5J2MA 3KHRA 4JS4A 8ICXA 1YTAA 4YFUA 4M41A 1BI4B 4E1MA 4PWDA 4BXOB 1XU4A 1DLOA 4BDYA 4Z6DA 4IQUA 4PHAA 4R8UB 3QEWA 5DK5A 4DLEA 1YTUA 4DSKA 3EPGA 2DFFA 3SPZA 3VA0A 4F5NA 4CJ3A 3JPPA 4O0IA 4FK0A 4HCCA 3QIOA 3VN5A 3V81A 4F5RA 1BI4A 1I39A 4BE1A 4BXOA 4DTJA 5KFHA 1IKXA 1RPLA 3ZSZA 5E41A 2Y1JA 5DBCA 4FJJA 1JXEA 4YMNA 4GXKA 1SKWA 4CJKA 1RXVA 4RW4A 3FYHA 1HQEA 4YXMA 3NGZA 4NCGA 1EX4A 3AO3A 3LANA 3QEPA 4KI6A 4DQQA 3RJKA 3PW0A 3KHGA 8ICLA 2KFNA 4KITB 3U3GA 3RJHA 1X1PA 2ZD1A 1TFRA 4F8RA 3CFOA 4YR3A 5DLGA 3KIOA 1XO1A 3QE9Y 3TANA 5C25A 4YN4A 4CJLA 4I2BA 1B9FA 2J6UA 4HVJA 2P6RA 5J0QA 4KLUA 4EBDA 1WSJA 5J1EA 4UB4A 5JS1A 1S76D 3JPNA 3S3NA 2QKKA 4QZ8A 3KD5E 3AVBA 3C21A 2O4IA 4J9QA 1KDHA 5DGAA 2YNFA 4IR9A 3V72A 4MQ3A 2UVWA 4PGQA 1HPZA 5HHHA 4DOAA 3V9XA 1Z00B 3CM5A 2Q0ZX 1ZQLA 1BPEA 5J2HA 2ZUBA 3AVGA 2G8KA 5I3UA 2BDPA 5CA7A 2J6SA 2AGPA 1CLQA 4M0AA 4ELTA 2EX3A 4YP3A 5IILA 1BPXA 2Z1HA 5HRRA 3OYIA 2KN7A 4Z4GA 4CEOA 4N76A 2KW4A 5HNKA 3VQAA 4AHRA 3SYZA 3LP1A 3GILA 2IBKA 3KK1A 1X9WA 3EZ5A 4AH9A 3TAPA 3AA2A 3FFIA 1KVAA 5DB9A 5KFEA 4QZIA 4LY7A 4DL5A 3ZSYA 4AHVA 4PHPA 1ZQFA 1QSSA 3KK3A 1A5VA 3QEBZ 1BPYA 4I2JA 4CEFA 5DGBA 2PFOA 4J9MA 1L3SA 1RDAA 2BKEA 5BOLA 4M9LA 1IKVA 5CZ1A 3ALYA 1CZBA 3TI0A 4OGCA 1ZQTA 5KFUA 3GIJA 2ZTDA 3AVLA 3K5NA 3DMJA 4IG3A 4I2CA 4HTUA 1NJZA 4B9MA 2QK9A 1S1UA 8ICPA 3HPGA 1WSIA 1RZTA 1KRPA 4LH4A 1ZQMA 3O4NA 3OYJA 3VQ8A 4I9LA 3MDCA 1DOQA 5J2BA 3DLEA 3HO1A 3P1GA 3PX0A 2FMPA 4KO0A 1TV6A 2XO7A 3BGRA 5J2PA 4I9QA 3AVAA 3OYDA 4I2AA 4J9LA 3HPHA 4EP4A 5KFMA 4CJEA 5HRSA 1MU2A 2YKNA 3KLEA 4Z0UA 3OS1A 1A5WA 4BDPA 1ZQJA 3T1AA 2ATLA 1RT7A 3NCIA 5KFFA 3MEEA 4FO6A 4M3TA 4KLFA 2A1RA 3Q8RB 1UA0A 3B0YA 1ZQZA 4Q8FA 2OZSA 3L3UA 3MR6A 9ICIA 3SZ2A 5BOMA 2W8KA 3N4MB 1ZQAA 4J2EA 4Z4FA 1ZQEA 1KLMA 4M3XA 1T4GA 4RU9A 4ECTA 3AO2A 4DQIA 4F5OA 3L3VA 3I8DA 2MUTB 3VQ5A 4QZBA 4FJMA 4N41A 2IA6A 1TAQA 3LDAA 4ED6A 4RQ5A 2DY4A 3RJGA 4LSNA 5KT2A 4FJKA 4CEQA 4CGJA 4O5EA 2VWJA 7ICVA 5DQGA 1B22A 4B9NA 2MUTA 4NLKA 1WAFA 4HYKA 4DQRA 3H08A 1IG9A 4MFBA 5KFJA 5CJ7A 2C2EA 4ZTFA 3PX4A 4Z6FA 3V6JA 1JXBA 4PA1A 5KT7A 3G0ZA 4DTUA 4CHQA 3NE6A 1N5YA 3KD1E 1HYSA 4ECQA 4O3PA 5KI6A 3VQ9A 5HHIA 4CGGA 2PFPA 2A1JA 8ICNA 1W0HA 4YMMA 1C0MA 4FZXC 1VSHA 3DLRA 1REVA 4RW9A 3OY9A 4KN4A 4P4PA 1XI1A 1D8LA 4R5PA 3NGIA 4CF0A 1XHXA 3RH6A 1N56A 2PYLA 1JN3A 4W5NA 5D49A 1KFSA 1NK6A 1BCMA 1ZQXA 1ZQVA 2ISPA 4FLXA 3ORYA 1TL3A 3DLKA 1RILA 3AU2A 4FBUA 3OYAA 5KFKA 1RBSA 1ZQBA 2Y1IA 1T8EA 3IHQB 4M3WA 4KV8A 4CJVA 3B0XA 3HX0A 2OWOA 2YHAA 4M3RA 3AO4A 2HW3A 4UB2A 3K5OA 3BDPA 4BE2A 1TKXA 3MXIA 4UBBA 2F8TA 1NK7A 2IMWP 8ICZA 4RQ0A 4J9PA 4KFBA 4JRQA 2I1QA 1BCOA 4OLAA 3ZT1A 2G8FA 3C95A 4G1QA 4BDZA 1XS9D 4B9VA 4I7FA 4CEZA 1ZQNA 4QZGA 4ZHRA 4E19A 3C6TA 5J2QA 4KLMA 4B8CA 2P1JA 4Y1DA 7ICKA 4UBCA 3CFRA 2DPIA 2M9NA 1T7PA 3OGUA 3JPQA 2NRXA 7ICIA 2PZSA 3VQ6A 3SV3A 3HSTB 2F8SA 5KFNA 3VQCA 4DTPA 3SPYA 2RN2A 3RB0A 4DF4A 5KFYA 1IH7A 2QKBA 2XCAA 4RQ4A 5KGWA 3RB6A 2W42A 1B9DA 3K75D 4DL4A 3M9NB 2BPFA 4DTOA 1C1BA 4CJ5A 1UA1A 4YD2A 3C2LA 3Q8KA 1WSFA 8ICHA 4KHNA 4F2RA 2OZMA 2NRTA 2DTUA 4J2AA 4DSEA 4TQSA 4CERA 4F91B 5EU7A 3O3GA 4FLUA 1RCHA 1YT3A 2XGQA 2KTQA 3PW4A 3ZSXA 4RW7A 3Q8MA 3NBPA 4DMNA 5L1KA 3EPIA 4ED0A 1IKWA 4JK1A 4QZDA 1WNSA 2I9GA 3WNHA 4KI4A 4I2QA 3OYEA 1X9SA 4FK4A 1TV9A 3RAXA 5KG0A 3ZSRA 5EWGA 4E3SA 4EBEA 3F9KA 9ICJA 2F96A 4IQWA 2LSNA 4FJ7A 3OVNA 1QSYA 2PFQA 3IRXA 4R63A 4E7IA 4Q44A 8ICYA 3L2RA 4W5TA 3LDSA 3QNNA 2ZTCA 5KT5A 1U48A 3QNOA 4CGFA 3D45A 5IINA 1JL2A 1S6QA 3ZDDA 1QSLA 3EW9A 5DB7A 1ZQOA 4M3YA 2XCPA 2HHTA 1TVRA 1C1AA 4ECXA 2RF2A 2ITGA 1LW0A 4L8RB 7ICEA 4ECWA 1ZQCA 5HMLA 3IM1A 2JLEA 2HHUA 3MR5A 4PQUA 2Q3SA 4UAYA 2HNZA 3T5LA 4BGDA 2FBYA 5DG7A 5KT4A 4JV2A 4CHOA 4PGYA 4CCHA 4Q43A 4DG1A 2DPJA 2D0BA 4FK2A 4KHQA 3EY1A 2W9AA 4AHUA 2FLLA 3TAGA 4FJ9A 8ICEA 3ITHA 7ICSA 3TAFA 5CY4A 3PR4A 1W9HA 3UIQA 3HWTA 1MQ2A 2ZUCA 4LZGA 3B6OA 9ICXA 1HNVA 4BWMA 3RTVA 2HHSA 4JV1A 8ICFA 7ICPA 3PVXA 2PI4A 3V9UA 3LP2A 3HT3A 4F5PA 1H38A 1SZPA 4UB5A 3ISCA 4ECYA 4QOZB 4CJUA 2OPRA 2OPQA 4E1NA 3OYLA 4C8KA 1TK0A 1RNHA 4KB0A 1FK9A 1S6PA 2ZTEA 3TAMA 1BQMA 4R8UA 5KFPA 1TKDA 3QZ7A 7ICGA 4NYFA 5J0SA 5J2GA 2Z1IA 2HHWA 3TR8A 5J2NA 4IRDA 4KLSA 4E89A 5KFDA 2GBZA 1KFTA 1F21A 3DLGA 3DRSA 1ZBHA 4YG2A 4KLQA 4C8MA 4Z4IA 3NF6A 4KLHA 1UWBA 4DWIA 2W8LA 4IRKA 1ZQQA 3MDAA 2P6UA 4M04A 4ICLA 5C42A 4IRCA 3UPQA 3NF8A 3RBEA 4ZH4A 4ID5A 2AGOA 2R8KA 3NH1A 4O0JA 3VA3A 4UAZA 3VQPA 4ED1A 1RBTA 2IDOA 3AVMA 3MEDA 2I5JA 1FXXA 4CEEA 4KLDA 1HUZA 1BIZA 2FBTA 5DG8A 3QO9A 5KFVA 1QS4A 3ASMA 4OPKA 8ICJA 4DTRA 4ECVA 3CQ8A 5L1JA 2X74A 1ZJNA 4AHTA 4CFCA 3B6PA 3OYHA 1UT8A 4CJRA 3V9WA 4CK2A 4BE0A 3SNNA 2BANA 5HBMA 8ICUA 2ZQBA 4F4WA 4E7KA 9ICKA 5KFIA 5KG5A 8ICSA 1U04A 3GV8B 4IQTA 4DTNA 1BPZA 4FJXA 4MEYA 4DEZA 5HROA 4PPXA 2IC3A 4AILC 1S97A 4O4GA 2BR0A 1J54A 1BPDA 1T3NA 4DTSA 5DQHA 3MGIA 3V1OA 4JWNA 4E7JA 4RNOA 4M2YA 3SCXA 3HPOA 2X6SA 4CJWA 5KGXA 1J5OA 1Z00A 2KZ3A 3LALA 3KJVA 2RDIA 2G8VA 9ICOA 3DM2A 1DTQA 3CFPA 3RR7A 4CEAA 1NKEA 2ATQA 3SUPA 3RMCA 3Q8QB 5TZVA 3G10A 3SQ0A 3DLBA 4ZTJA 2R8IA 5DB8A 5BPCA 3TQ1A 3UQ0A 1GOBA 2E4LA 3KLGA 1HJPA 2BE2A 1SL1A 2BQUA 1G15A 3RMBA 4DU4A 3DI6A 3V1QA 4K4IA 3QEAZ 3T5HA 5KFTA 3ZDBA 3KTQA 2HVHA 3C1ZA 4DS4A 3ZSOA 3OYBA 3RRHA 1EXNA 2P51A 4K4GA 4XIUA 4DSJA 1VSEA 3PO4A 5F9NA 3K57A 4N5SA 5I42A 1S10A 1EXQA 3MXJA 5KG3A 3AVKA 4M6WB 1HUOA 3DOLA 3NHGA 8ICIA 1C1CA 2JZBB 1XWLA 2ASJA 1TVAA 2KZZA 2WOMA 4KMUA 2R7YA 2B6AA 2ZJ5A 5KFAA 4DSFA 4LVSA 1RDDA 5DDYA 4CIGA 3Q8SB 4LH5A 4FJHA 5J2KA 1SUQA 4OGEA 3SJJA 5CP2A 4GXJA 2VA3A 3QEXA 1WCLA 4P4OA 4TQRA 2BCUA 4NXZA 3PUFA 5DMRA 4M6WA 5HRNA 2JZBA 4DFPA 3NAEA 1VSJA 4DU3A 3C6UA 7ICHA 1ZETA 1CZ9A 2BCSA 3VQ4A 1SL0A 4QZHA 4OKEA 3AVCA 4NLZA 2VA2A 4IKFA 1HJRA 1VRUA 1NJYA 4ECSA 4O3QA 1JLBA 4I2FA 2FPKA 5C24A 4CHYA 4NYNA 4BWJA 3WNEA 4RPZA 1ZBIA 3OJUA 5HMMA 1S5JA 2V4RA 4KREA 2YV0X 1X9MA 3HVTA 1QLNA 3M8RA 4QAGA 1VSKA 2GUIA 3PW7A 4IQVA 3RAQA 4CGDA 4KB1A 2QXFA 4FBTA 4F3OA 4DF8A 5SZTA 4QW8A 3M9OB 2BQRA 2UVRA 1BVSA 1Y88A 3C2MA 3ZD8A 1ZQHA 2D5RA 4QW9A 5HP1A 3IS9A 3SI8A 1NJWA 1CXUA 4FXDA 1ZQGA 4O5CA 4TUSA 3T19A 1A5XA 4MF2A 5JS2A 2X78A 2UVVA 1TK5A 3TAQA 3IG1A 5J0WA 2AU0A 1TAUA 4AHCA 1CUKA 3LP3A 3AA4A 1NK8A 4CEDA 5C5JA 4CHNA 1S1TA 1JLCA 3MECA 2VG6A 4KHYA 5KT6A 3BJYA 4H4OA 3I0SA 1RT3A 1L3VA 3SV4A 2IHMA 3ISDA 2XRIA 3PMNA 2KZMA 4CF1A 4M47A 9ICPA 1VSDA 4RW8A 4WE1A 3ZT4A 3GDXA 4MFCA 3E2EA 2IAJA 2MAXA 4FLZA 4GVMA 4XRHA 3SQ1A 2DFLA 3LWLA 3SI6A 2KQ2A 1JMSA 4PH5A 3RJIA 2BCRA 4XA5A 2BCQA 1YVUA 4QWEA 2OPPA 2NRWA 1XSLA 3H40A 4O44A 4F92B 3ZSQA 4UQGA 4NCAA 4TSXA 5D4BA 3OSNA 1O1WA 3BQTA 5DDMA 5IIIA 3HVRA 2JEGA 1RDBA 4PHEA 3T3FA 5J29A 5KFBA 2UVUA 1TKZA 1EP4A 2NRVA 3GIMA 4CIEA 3AO1A 4JWMA 3OHBA 1HYVA 4ED7A 3WNFA 4MF8A 1BL3A 3L2QA 3C23A 2XGPA 3DRPA 7ICUA 4K8XA 4C8NA 3SQ2A 4F5QA 3MGHA 1ZQRA 8ICOA 3HK2A 4RNNA 8ICTA 2C28A 3JYTA 3RB3A 4B9TA 1PZNA 5CWRA 2PY5A 7ICOA 3Q8PB 2XY5A 2JGUA 3RWUA 4NM1A 4M9GA 4EYHB 3GIKA 3RBDA 1EKEA 1VK0A 3OYNA 3ZDCA 4FVMA 3V6HA 4ELVA 1XHZA 4DQPA 5DKWA 5CR0A 4H8KA 3JPTA 3TAEA 4B08A 2HNYA 3KHLA 3ZD9A 4RZRA 1RT6A 3LP0A 9ICLA 8ICBA 3TFRA 4J9NA 4ED3A 1XC9A 4DFJA 8ICKA 5L9XA 1NOMA 3MR2A 7ICQA 4LD0A 3SUQA 3NF9A 5IIOA 1BISA 2ZJ8A 3THVA 3V7JA 4F3TA 4IG0A 1MC8A 2YNHA 3U3YA 1RYSA 3NDKA 5KG4A 5KFZA 5KFSA 4ECUA 2C2RA 3RJFA 5DBBA 3LK9A 4OPJA 4KTQA 3A2FA 4FZYA 4FLVA 3V6DA 3S3MA 4CFBA 4YCXA 1ASUA 4FYDA 4GC7A 2ISOA 5KFQA 2YHBA 2EHGA 1L5UA 4ECRA 4O55A 2VA8A 3LZJA 3H8WA 1TL1A 3NF7A 3LWMA 1Z26A 4J9OA 3E01A 3C5GA 4DTXA 5JUMA 1ASVA 3L2WA 5J2AA 3PR5B 4KRFA 1L3UA 4FLWA 4YNQA 3AVJA 4YQWA 1NK4A 2R8HA 3SQ4A 1ZBUA 2BCVA 4DU1A 3HM9A 2D0CA 4Q45A 3QETA 2OA8A 4KHWA 3AV9A 1RTIA 5J2FA 3TFSA 3V9SA 3M8SA 4OKKA 3G6XA 4B9SA 4M3ZA 9ICFA 4EZ6A 4NLNA 1S0VA 1WCNA 5KFCA 3K2PA 2P66A 3JSMA 4B9UA 3OS2A 4RT2A 5J0TA 3KKRA 1K1SA 1RXWA 1VRTA 2FMQA 2HNDA 1DGSA 4EEYA 1NK0A 3QEVA 4DSIA 4QWBA 2VG5A 4DL6A 3PO5A 9ICQA 4KTWA 2NUBA 2VG7A 9ICAA 4F2SA 1UAXA 3H8SA 4CF2A 3ZCMA 3L2UA 2RKIA 3LPTA 5J0YA 1CXQA 2ASLA 2GWSA 4ELUA 4OJRA 4RT3A 2O4GA 3RJEA 4TURA 4PUOA 2YNIA 4M45A 1XSPA 4K8ZA 4RQ7A 3DRRA 3GV5B 1NK9A 1NJXA 3BQ0A 4P4MA 3OYGA 3QLHA 3PV8A 2BPCA 3RR8A 4MFFA 3DYAA 8ICMA 3GIIA 5KRTA 1JXLA 3CM6A 3V6KA 2P5OA 5D46A 4KLOA 2F1HA 4EYIB 2C2DA 4RQ2A 1QE1A 4KLGA 1S9GA 1SV5A 1LAVA 1S1VA 5KG7A 3UXPA 3NFAA 1ZQWA 4CJSA 2FMSA 2R8GA 5J2JA 2IGIA 4FJ8A 1U47A 4KKOA 3LAKA 1R0AA 3UXOA 4YD1A 2IHNA 3HL8A 4FS2A 4DL7A 4N56A 1BGXT 4I2GA 4O9MA 1ZQUA 3K4GA 1IM4A 2VANA 3CG7A 1JLQA 4NM2A 3HW8A 2IOCA 4FCYA 4QCLA 3JPSA 1KFDA 3V1RA 4KTZA 4FM1A 2FPMA 1TK8A 4JV0A 4QZ9A 4O3NA 4UB1A 4K4HA 4FM2A 4M42A 5DBAA 4LSLA 3VQDA 4CK1A 1TGOA 4KLLA 5HRPA 4I2PA 4QZCA 3K59A 3SUOA 3MABA 4FJ5A 3V9ZA 4KLTA 1D9FA 2KFZA 4CESA 4QWCA 3PMLA 3RH4A 3AVFA 4P2HA 4MEXA 9ICCA 3TWHA 3F73A 3QINA 1J9AA 4IBNA 3ETLA 4YMOA 3AO5A 3I0RA 9ICRA 4JLHA 3OYMA 3LPUA 2HVIA 4Z6CA 5KG2A 4M9HA 4QWAA 5IIJA 5CB1A 4GC6A 2B5JA 1NOYA 8ICAA 9ICBA 9ICGA 4YVZA 4CF8A 4OLBA 1RT1A 5KFGA 4KPYA 3AVHA 1K1QA 3U6FA 1QQCA 3NGDA 2PXIA 2YKMA 3FDSA 1JKHA 1NKBA 2XY8A 2W9BB 4GLXA 4EP5A 1ZJMA 1ZQYA 2Z1GA 1X2IA 3GFKB 3K5LA 4RUAA 3ISNC 9ICEA 9ICNA 3QEIA 1S0OA 4CFDA 1JLFA 5L1LA 4I2EA 1KTQA 2BGGA 1RBRA 2W9BA 2JEIA 1V9PA 3M8PA 4KLEA 7ICNA 4FM0A 4DTMA 3MFHA 2IS3A 3BQ1A 4W5QA 7ICFA 1VSIA 5CHGA 4R66A 3ZDAA 3PY8A 4M9JA 4DLGA 5CYQA 3HYFA 1S0MA 3WNGA 1D5AA 3IAYA 3V7LA 3KLIA 1EETA 4DO9A 3ZSVA 4CJFA 4DQSA 2HHVA 3T5KA 3CYMA 1XSNA 2ETJA 9ICTA 2B4JA 3O3HA 9ICHA 1ZQIA 4AHSA 1Q9YA 1UOCA 4RPYA 5KFLA 5HP4A 5KG1A 4F4XA 3QIPA 3NH2A 4FW2A 3LZIA 5J0RA 4ECZA 1LB2B 3JPRA 4CGHA 5EWEA 2G8HA 3G6YA 4J2DA 1KSPA 4Q8EA 4CJTA 3MR3A 1WN7A 3C2KA 1RBVA 4O3RA 1N6QA 4RQ3A 2BPGA 4JS5A 1JL1A 3H7IA 2V9WA 2G8UA 3ZT0A 5T7BA 1C0UA 2ZJAA 8ICGA 4F4KA 4CHZA 1WSGA 4IFVA 4O3SA 4FZZA 3OS0A 1HRHA 3VQBA 3OJSA 1RTHA 1J53A 1S77D 4W5RA 8ICRA 4J9SA 4G3IA 3AA5X 3DOKA 4LZDA 4OVLA 2DFEA 5EOZA 2ALZA 3RRGA 3KLHA 4RQ8A 1Y97A 3OYFA 4F50A 3L2VA 7ICMA 4DFKA 3N97B 1BHLA 5J2DA 8ICVA 3G6VA 2FLPA 2LYHA 4Q0BA 3KK2A 3MBYA 5DB6A 2BGWA 4PHDA 2RPIA 4F4YA 5KFRA 4HHTA 4Q5VA 1S9FA 3O4QA 4B3OA 2NRZA 1S9EA 1C0TA 5IIMA 2C22A 3TARA 5CZ2A 3RJJA 1I3AA 3T5JA 2OPSA 4NCBA 2FBXA 5KTQA 1IO2A 4CIFA 2FBVA 5L1IA 2E6MA 4O5BA 4UAWA 7ICRA 1SKRA 1D8YA 3KHHA 1ASWA 4JUZA 1B92A 4CGIA 3TABA 5FDLA 1T05A 3NGYA 2HHQA 1A77A 3HJFA 3HXMA 3V7KA 4W5OA 1GOCA 3S3OA 4FJNA 4J2BA 2H5XA 5EWFA 3P83D 4J9KA 1A76A 3LAMA 5D3GA 5SWMA 1Q8IA 4CE9A 4KN7A 4M3UA 2AGQA 3ISBA 4R64A 3OYKA 2HHXA 1ZYQA 4B9LA 3H4BA 4QWDA 4CF9A 1LAWA 4YR2A 4FS1A 1WSHA 4I28A 5FRMA 2A1JB 4N47A 4DOBA 3MFIA 1LWFA 5KFOA 9ICWA 2G8WA 2G8IA 1U9LA 3D0PA 1HMVA 5F9LA 2BHNA 4I29A 1UT5A 4XUSA 4J9RA 2A1SA 5DG9A 3VQEA 3OHAA 4IDKA 1BPBA 4GW6A 2B21A 1C6VA 4CK3A 1RT4A 2RDJA 1FKOA 1U45A 1BQNA 5KG6A 3H8JA 3AVNA 4Z6EA 2W9MA 1K6YA 2J6TA 2X6NA 4KAZA 1GOAA 4QZEA 2OYQA 1RBUA 1ZBFA 1JLAA 5J0UA 1NOZA 3C5FA 1AROP 5J2IA 2F1JA 3KLFA 5KRSA 1KEJA 2WONA 4KLJA 3GV7B 4RNMA 2AQ0A 4UB3A 3L8BA 4HUGA 4FJLA 5J0OA 1ZQDA 3QERA 3AUOA 3VQQA 4KLIA 1RYRA 4RPXA 4Z4CA 4ED8A 4CECA 4CJQA 5DLFA 1WSEA 1JX4A 4F4ZA 1WLJA 3ZSWA 1JIHA 1COOA 1NK5A 2XHBA 4O5KA 9ICUA 2ZUDA 1LWEA 3QESA 1IXRA 5J0XA 1SL2A 4Z4EA 5HLFA 5KFWA 4MFAA 4I27A 1FKPA 4TUQA 3V4IA 1MQ3A 3Q8LA 3HP6A 1LWCA 4YR0A 3KKSA 3ZT2A 4E7LA 2AQ4A 1C7YA 3EYZA 3VQ7A 8ICWA 3RB4A 2V4QA 1ZQPA 2HMIA 5FROA 1ZQKA 4PGXA 4DOCA 3JPOA 4QZFA 4O3OA 3ZDEA 1N48A 2R8JA 4RUCA 1HQUA 4F93B 4NLGA 9ICSA 5IIKA 2VWKA 2E6LA 4E0DA 3C94A 3MEGA 1WAJA 4I2HA 2GV9A 1HNIA 2DFHA 1DTTA 1TKTA 1VSMA 3M8QA 4C8LA 2JEFA 3PW2A 1KCFA 4OKJA 2HB5A 5KT3A 3OSPA 4JRPA 4YFKA 4YXJA 4RG8A 2JEJA 1Q9XA 3K58A 7ICLA 4B8AB 3AU6A 1MSWD 1U49A 3ULDA 8ICQA 7ICJA 2XY6A 1ZBLA 4FJIA 4HCBA 1Z3EB 1IKYA 1KVBA 2D0AA 1RT5A 4M9NA 2FPLA 4DFMA 4Z4HA 4FLTA 3BQ2A 2FLNA 4GXIA 1KLNA 3RMDA 3AA3A 4QZAA 2FC0A 5J0PA 1JLGA 4PY5A 5DQIA 1NKCA 1RTDA 3HP9A 3OYCA 3K5MA 5FRNA 2W9CB 3NH0A 4DL3A 2BQ3A 4C8OA 5KFXA 2ZE2A 7ICTA 3AVIA 3GQCA 2XC9A 4DSLA 3PW5A 1QHTA 1D9DA 3P5JA 3SUNA 4I2DA 5J2CA 4RQ1A 1VSLA 1LW2A 3O3FA 1U4BA 3M9MB 4FW1A 4EBCA 3UXNA 2PFNA 1ITGA 4Y1CA 2W9CA 1LV5A 4DS5A 1L3TA 2PI5A 1Z25A 3UQ2A 3H4DA 1ZQSA 2YNGA 1RT2A 3C1YA
chains in the Genus database with same CATH superfamily
3QZ8A 2CPJA 3DOMB 4MKVA 3MAQA 4PKGA 4CI6A 4EZ9A 3O6QA 4UUXA 5B0FA 2IIRA 2EFQA 2NYIA 4RX6A 3HZ6A 3PYFA 1JJ2R 4O4RA 4CIOA 4KHPJ 4NY8A 2K8AA 3CC2S 3PRVA 4E7HA 4XQ8A 2CJQA 4IFYA 3S9HA 3O80A 4RW6B 4CHPA 3ITHB 2ZGYA 4CJ4A 2DR6A 2XY7A 4KHSA 2JGAA 1JCGA 2P9SB 2DKOB 2UZAA 4EO8A 2LKZA 1B43A 3NTUA 4GMJB 1RAFB 5BXIA 2P5GA 1B99A 3ZC4A 4YFUA 2D1CA 1R8PA 3UVJB 3CD6S 2HK2A 1S6PB 4BXOB 1DLOA 5CAAA 1BO5O 4Z6DA 2WUSA 4EHUA 3QEWA 4C7ZA 2VFSA 4DLEA 1C4AA 4ED4A 4C0BA 2F4VK 5JRTA 5J2NB 1KVJA 4X4VA 1Z1ZA 3VA0A 1Y00A 3HKZC 4EELA 3GP9A 3JPPA 4USIA 4O0IA 2GNKA 4FK0A 4HCCA 1EZZB 4RR5A 2KSOB 1NEEA 3V81A 1BI4A 4FYYB 2CNLB 4BE1A 2BTFA 5GAEU 3ZEUB 2VBXA 3MCSA 5AXMA 1AB8A 3NCQA 2VOPA 3H46O 2A6MA 3D2EB 1NDLA 1WOPA 5E41A 2HG4A 1XNQF 1P27B 4WYWA 4NMXA 3KJNB 1U2RA 3PIOL 5AI5A 4DV5F 5AQQA 3R9KA 4OX6A 1WG1A 2A0FB 4NJ8A 5G4DA 2GHVC 2JVRA 3NS5A 5AXLA 3KHGA 3IRWP 5E3RA 2H51B 1WWVA 3EICA 4B3RF 1RGIA 3SXLA 3RJHA 4WIQA 1X1PA 4OHWA 4BRAA 3VERA 4F8RA 4YR3A 3CC2N 3QE9Y 5C25A 4GVEA 4CJLA 2CPHA 2IRYA 4H03B 2P6RA 5A8KA 4CLUA 4JI5F 5D0RA 4EBDA 4P74A 3ZZYA 4OYXA 3KD5E 4CRJA 3OFHA 1KDHA 3UB5A 2YNFA 4ZOHC 2CPDA 4IR9A 3R5GA 3QUCA 2CQIA 5FD1A 3CM5A 5AQIA 1UVKA 1BPEA 3ATUA 2ZUBA 2OMLA 2VKZG 2YKPA 2DCLA 3DM2B 4MO5A 2BDPA 5CA7A 2QO3A 4ISGA 1NH7A 4M63A 1CLQA 4M0AA 5IILA 2WF6A 2G2ZA 5HRRA 5HK4A 2VFTA 3OYIA 3LDPA 3F9MA 3KK1B 2BJDA 2HBRB 3IR5B 4A47A 4E2FB 4ZCKA 4DV2F 2DNRA 2N4DA 3HFVA 3I9ZA 4B6JA 3SYZA 3KK3B 3MMAA 5F0UA 1O0PA 3GILA 5HQLA 2F9TA 4ZCIA 1FNOA 1X4AA 2HIYA 5D4NA 4MDBA 4DR7F 2XTJP 4QIWF 1R8BA 2LU2A 1PK3A 1KVAA 1PC5A 1TL7B 1S6OA 2UUBF 3ZSYA 1ZQFA 1C1CB 5HMXA 3F56A 1L8LA 3EVWA 1QAIA 2P9NA 1NUEA 4ZIWA 3VC8A 1FE0A 1RU1A 4WIIA 1NB7A 4XEIA 1Q79A 1VQNN 1C4CA 3WEEB 2MQPA 3THWA 1NZ8A 4DUTA 4J9MA 4Y2SA 1L3SA 4L76A 1RDAA 1GNKA 4FZLA 2XMJA 2QIFA 3TI0A 5C2DA 1ZQTA 5KFUA 2YKOA 4FOIA 1TFWA 3AVLA 4I2CA 1CBKA 3BGRB 1BWEA 1NJZA 2Q79A 2EKYA 1X3NA 2CQGA 4CLPA 3MDCA 1RT7B 2GGPA 4NWIA 3PX0A 1SJ1A 3MEEB 2XO7A 5C24B 1OVYA 3VQSA 4I9QA 3OYDA 1E6YA 4EP4A 5KFMA 1JXVA 5HRSA 2X3GA 1MU2A 2YKNA 2FDNA 2MKYA 4BDPA 4A4JA 5AR0A 4FO6A 1T9UA 3TA0A 4C80A 4M3TA 3LVVA 4EEKA 3DXMB 3L7PA 1U02A 2A1RA 1UA0A 1FFUA 3MZIA 4OX9K 1ZQZA 2XNRA 2ZIXB 3FC4A 3L3UA 2GELA 4HACA 2RT3A 3SZ2A 2W8KA 3N4MB 5CR4A 1KLMA 4M3XA 1YI2S 2Q1NA 2GH1A 4DQIA 2LBOA 1HARA 4F5OA 2BRKA 2FTRA 3NXZA 1CLFA 2OHFA 3NP5A 3VQ5A 4QZBA 1WI8A 4DR5F 4B1ZA 1VBXA 4DUYK 2KU7A 4BR7A 1B0VA 4PWWA 3L3FX 2LMIA 1F5AA 2WVDA 3KUGA 4B9NA 4H5TA 1JK9B 3MX5A 5AM4A 1HR0J 4NLKA 1C0GA 5ALQA 1RT3B 3KZXA 1IG9A 1REVB 2C2EA 3MM8B 4WE1B 2BZFA 2VICA 4CZJA 4CF3A 1N5YA 3CPWM 4ECQA 2OMOA 1P1LA 2PFPA 1YX2A 4UAVA 3SD7A 2QMWA 2ZH8A 2DGSA 8ICNA 1HW8A 1C0MA 4EK2A 4RW9A 1MWMA 4A61A 3OY9A 3IA0A 5EN1A 3M6XA 2UXDF 5BRFA 4JHDB 2GAGC 4KB7A 1HWIA 1RCXB 5K9FA 3MWTA 3F2DA 5U47A 4FVCA 1KFSA 2X1BA 1NK6A 3I4HX 4ER8A 1BCMA 4LFCJ 3MM6A 1ZQXA 1T95A 4FLXA 5AZJA 1IJJA 2LI6A 3EGZA 3HHLD 4ANCA 3OYAA 1RISA 3G8QA 3F2BA 3I8BA 1T8EA 3D6MB 4M3WA 2YH0A 4CJVA 2OWOA 3HX0A 2YHAA 3JYTB 1OH8A 4M3RA 5KQ8A 4C3LA 1XTZA 3BDPA 2O8CA 2G0IA 4BCAA 4F26A 4YDUA 2F8TA 4CZKA 3C6TB 4GKJJ 4ZS6A 3PXGa 3QT6A 1DK2A 2VWBA 1OY9A 3UQSA 4CO1A 4EU0A 1X40A 3C95A 4BDZA 2VKQA 1IWAA 5IC6B 4ZHRA 4CLSA 4XDCA 1R43A 4DBQA 3ZLJA 1EQMA 2DPIA 2M9NA 3VQTA 4QBUA 4WP8A 1IWGA 2DBYA 1YJ9S 7ICIA 2ZWHA 2VF3A 1PGZA 4ANDA 3VQCA 2MQOA 2K7KA 4M5LA 2DHAA 2X1GA 2RN2A 3RSEA 1WF2A 4DF4A 5KFYA 1IH7A 2MXYA 4JI3J 1KTVA 3AQFA 1WKLA 2JNJA 4NXNJ 4UZBA 4WFAQ 1N32F 4UB6U 1YRXA 3ETMA 1ZM4A 3M9NB 3NGKA 2BPFA 2D9PA 4CJ5A 4YD2A 3C2LA 4KHNA 3C19A 1DT9A 2IYGA 2DTUA 4GV6A 1JI7A 4J2AA 2MGZA 2CQHA 2XZWA 4CERA 3NGSA 1R3NA 4JI6J 4FWMA 1RTIB 3DRXA 4RBTA 3ZSXA 3Q8MA 2EBGA 1F2GA 1IKWA 4ZJOA 4CT8A 3HRGA 1TYQB 2GC8A 2KYXA 2JDJA 1X9SA 1R0BG 4FK4A 3O1BA 3RAXA 2CWXA 2E20A 4NASA 3ZSRA 4KHMA 3M7VA 3F9KA 1YITN 1UW9A 2NREA 1TVRB 2DGZA 3MXHP 5LMNF 4YOWA 1G7CB 2YY6A 1X4GA 3L2RA 1FRIA 3BH7B 4AXJA 2EAOA 2Q1LA 3PEJA 4OHVA 3QNOA 4CGFA 4C3KA 3VAKA 1T3QA 1TUGB 1LOTB 5A8RB 1ZQOA 4PRFA 2BM1A 2Z2LA 5IT4A 3R5JB 1ZQCA 5AIBA 2DVIA 2CADA 3UN5A 1D1UA 2HHUA 4BC4A 1YZ6A 3NAIA 2H3IA 3DU5A 2IYIA 1E6VA 4LRDA 5IT0A 2APOA 4PGYA 2H3QA 4DG1A 2D0BA 1FERA 2W9AA 4AHUA 2LP4A 1S5ZA 2RUSA 2W2PP 2ZM6F 5C15A 1PBAA 3C2PA 4ISEA 3ILJA 2DISA 4CLZA 8AT1B 2XSFA 1W9HA 2HQFA 3LQVA 2ZZMA 1XC3A 4LZGA 1MWZA 3M30B 4ZPCA 2H3ZA 4JV1A 3CNHA 3JSBA 3SENA 1KQFB 3LP2A 4LMZA 4F5PA 2WAQD 2NPFA 4CBWA 3GG0A 1ZH5A 3PZPA 3QNWB 1YBUA 2RD5C 4KB0A 3MOZA 4CTAB 3CMAS 2ZTEA 5GMDA 1M1KT 4R8UA 5KFPA 1TKDA 4KC5A 1F3FA 4KGKA 3K5PA 5KFDA 1KFTA 1XN9A 3LW5C 2OXOA 3PCOB 2XO6A 3FZLA 3KFUF 4KLQA 4Z4IA 1LCUA 3VEXA 4KLHA 5H1SQ 4DWIA 1ZBSA 2VFUA 4CJ7A 2JXJA 3MDAA 2W55A 4NLSA 2K1RA 3TZWA 3TACB 3E66A 1WD6A 5C42A 4IRCA 3VF0B 3UPQA 3RBEA 2FJ6A 4ID5A 2AGOA 2CZ9A 2MPUA 3VA3A 2M7SA 3V4MA 2I5JA 4PR6A 2RE2A 5FLXO 1RWNB 3TUJC 1UPPA 1HHTP 4NPOA 2OFHX 4XH1A 1RT1B 4DZDA 3ASMA 4OPKA 8ICJA 5ALOA 3WIUA 3CQ8A 1ZJNA 1Q8LA 3B6PA 3OYHA 1V4SA 4O4GB 5KG5A 4CT9A 1HWJA 1FE4A 1F44A 3QIDA 2CQBA 1RWVB 2GFFA 4FJXA 4EMDA 4X4UA 3OBWA 2O8EA 3M8PB 2E5GA 4IH7A 2E5SA 4DTSA 3MGIA 1KNZA 2RB7A 3PJWA 5LSLA 4YOYA 4F3QA 4YDDB 4CJWA 3KJVA 3LALA 4M5DB 3M5RA 1ZPVA 2XMMA 4TNOA 1YIJS 4YEAA 1F9HA 4YOTA 1JCEA 2A42A 2OYYA 2MQ8A 2FVRA 4MMOA 1NKEA 4DQ8A 2AEFA 4NRTA 1N5XA 2W4DA 4Z94A 3ENOA 5TZVA 5BYSA 3H3NO 5BPNA 4PG5A 4ZTJA 2R8IA 5DB8A 5BPCA 3W2VB 1S48A 3UQ0A 1LK5A 3KLGA 1HR0K 3IR7B 3X3UA 4CLKA 2G9OA 2MLZA 3RRKA 2BQUA 2KL8A 1BDGA 3QX7A 1N61A 3BP8A 5I42B 3DI6A 2CPXA 4XDDA 3FAHA 3N7RC 3QEAZ 3ZDBA 2HVHA 2WOMB 1N6QB 3RRHA 4FWNA 2B6AB 4QYRA 1WTBA 3RBXA 4DSJA 4K8RA 3PO4A 5F9NA 5E84A 3VEZA 4IFVB 1EXQA 1YJ7A 1G99A 1GMWD 1HUOA 2JZBB 3FEZA 5IQ6A 4UOCA 5KFAA 2CKWA 4IEEA 2KVCA 2BDUA 1XNQJ 3UN3A 2XMUA 1SUQA 1V5VA 2C3UA 4OGEA 4Y2UA 4G9ZA 3AA8A 4LFCK 4GVBA 4NX9A 4GXJA 2KHQA 3BS5B 1FJGF 4I4BA 5HRNA 3MGJA 4IDHA 1L7NA 1COKA 2DXFA 1CZ9A 4OX8A 3A5NC 2JSXA 2BCSA 2BKNA 4OKEA 3AD8C 3TWZA 3OBYA 2UV8A 5BR9A 2F8EX 4B3RJ 3BY5A 4ECSA 4OPAA 3VGKA 4DU8A 3UR3C 4I2FA 1VQ7N 1OIAA 4XAKA 4CHYA 3DLLL 4QPXA 3WNEA 1UW4A 5HMMA 2YHYA 4P2XA 2CH5A 2W4CA 3WXLA 2QWQA 3ZZPA 3MC1A 2Y9TA 1VSKA 4R0JA 1TTHB 2EBEA 5A2QY 3PW7A 4IQVA 3RAQA 2YQ1A 4KB1A 5ALZA 2QXFA 2A18A 5AK5A 5EE1A 5DDQC 1JJ4A 4DCPB 5THWA 3SMVA 4DF8A 5SZTA 3K1RB 4H0YB 3MUMP 3M9OB 3EE8A 1RACB 1J2MA 2G07A 2CXEA 3BZKA 1VQMN 3IG1B 5JU5A 1NHUA 2D3ZA 1ZQHA 5AZIA 1FNXH 4A8QA 3IS9A 1GLAG 3VVTA 1I6JA 2PN6A 1WOOA 1CXUA 1VQ4N 2K4HA 1ZQGA 3KJFB 4C3MA 1Q8BA 4BRNA 1AQ6A 2V7YA 4JI3K 1SB6A 2RE1A 4MLHA 1J6ZA 4LFAF 2VJ5A 1TK5A 3TAQA 3CCSN 5J0WA 4NXNK 3A0IX 1VCTA 4PZVA 3A4TA 3HHLB 5GADI 5C5JA 4DV2J 3D0GE 4TYBA 2H3GX 1S1TA 1JLCA 2VG6A 2RQ5A 1PK1B 3MOJB 3FQKA 4K41A 3I0SA 2L5YA 3DV9A 1N33J 2C2ZB 4JI6K 5DM7Q 4DR7J 2VGNA 1Y10A 3MPUB 9ICPA 3K89A 1VSDA 2MAXA 3L3CA 1S4FA 2DFLA 2LHTA 2KQ2A 4XA5A 1NXIA 4JV5F 4QWEA 4GV9A 2OPPA 2WONB 2W04A 4O44A 3A5LC 4TSXA 2YPYA 3SAHA 2KHCA 1VIOA 1HD0A 4GKKJ 1TP7A 3J7YU 1RDBA 2UVUA 3M2RA 1JB0C 3GIMA 4CIEA 3AO1A 5HLFB 3E8OA 4QYZJ 3HD2A 2XGPA 1XO0A 1FKPB 3V4IB 4C8NA 1FEHA 3A13A 2A6AA 1LWCB 3BH6B 4F5QA 5ALDA 1ZQRA 8ICOA 3HK2A 2L48A 2K2PA 4DUZF 3UD4P 3U27A 3WKCA 1PZNA 5CWRA 1TUWA 3NVZA 1CQNA 3LP0B 7ICOA 3QUQA 1Q78A 4JN4A 3RWUA 5EDWA 5I4MA 4JP8A 2V8HA 1EKEA 5GAHI 1VK0A 3OYNA 3ZDCA 4K2XA 2DNZA 4NV0A 3KJQB 4JI0F 3RG6A 3AMZA 1TMJA 4DQPA 3PSTA 2PFDA 5CR0A 4BRCA 5AK3A 4B08A 4PAAA 3FK4A 2NRRA 9ICLA 1KC8O 4ED3A 1HNIB 4BUGA 2E1RA 1DTTB 3KYLA 4LD0A 1UTAA 4LBHA 4MN4C 2VQFF 3SUQA 2M0NA 3CJ2A 1BISA 2ZJ8A 3EXYA 5IXUA 3THTA 3UDEA 2OD6A 2YNHA 3U9ZA 5KL8B 2AJ2A 4ECUA 1MROA 2C2RA 1X60A 3CPEA 3LK9A 1QTNB 2EWHA 4B9QA 3QQCD 5AKYA 2LQBA 4FZYA 4PXBA 3HSGA 3V6DA 2DYAA 3ETOA 3WHIA 2HS3A 1Y9OA 1RDUA 2ISOA 2VIXA 5KFQA 2KT2A 3FM9A 3OTOK 3EJMA 4P9SA 2IDEA 1T6CA 1RTDB 3N01A 3MURP 1UFKA 2LDIA 3LWMA 1RA6A 1R31A 5SUHA 3PR5B 1NMDA 2RDDA 1PIEA 5AKJA 3H8YA 1ZA2B 2E2QA 2FYXA 3M1VA 4KRFA 5LY3A 3FJ2A 3N4PA 3RYLA 3AVJA 1D4XA 1NK4A 4ILRA 2VQEF 2HBZB 4U67L 3LDOA 1KQQA 4FWRA 3ZXWA 3HM9A 3VTHA 4Q45A 2OA8A 4BQLA 3AV9A 2HBYB 5J2FA 3B8HA 4EIAA 4WTOB 3TFSA 2Q31A 3UKUB 2J7KA 3GBTA 3G6XA 4UW2A 1SWVA 2CJBA 1FJCA 4EZ6A 1AUDA 1S0VA 2FF6A 2IVMA 3WK4A 2P9PB 1OWXA 3SSSA 4PKHA 2AT1B 4WFYA 5F3TA 3JSMA 2BVZA 4B9UA 5HMYA 3OS2A 3SQGB 2IRXA 3THYA 1K1SA 2M70A 2MKSA 2OI2A 1MA7A 3P8BB 2ES6A 1NK0A 1EHWA 1VRQC 4DSIA 4A8MP 3QLHB 4QR2A 1VQ9S 2Q2RA 1RTJB 2VG7A 4I6WA 4PXCA 3H25A 4G1PA 1UAXA 1NCLA 1Q95G 1S1XB 2RKIA 3FCVA 1CXQA 2GWSA 4OJRA 4PUOA 5AXKA 2YNIA 3H5UA 3DRRA 1NK9A 3P96A 2A1BA 3UMBA 1HUXA 4X2BA 3PV8A 2BPCA 2MJUA 3DYAA 4YS2A 3TKAA 1X3MA 3X1LB 4NLRA 2ADBA 3CM6A 3V6KA 4KLOA 2Y9HA 3OFGA 2C2DA 1YJWS 1S9GA 2YQ3A 2YKAA 2P9GA 1LAVA 4A59A 5KG7A 2NRHA 3MWPA 4B3SF 2IGIA 2VODA 3ZX2A 4KKOA 3CCVS 1R0AA 3C6HA 4YD1A 3CCQN 1X4EA 3EO3A 2KG5A 1PC4A 4USKA 1IKXB 2NO4A 1ZQUA 3K4GA 1GTHA 4FWOA 4NM2A 2IOCA 2CJAA 1KFDA 3THPA 3CCUS 2BOPA 4I56A 2RRDA 4O3NA 2Z4PA 4OZ2A 5D0EA 1AA1B 4FM2A 4UQTA 2HS0A 3HOTA 1Q16B 4CNQA 3H7HB 2LM1A 1T0TV 4I2PA 2P9IA 3R7BB 1G1XA 1XNQK 1Y11A 1D9FA 3IWLA 2O6KA 2J5AA 4FWPA 4FYXB 1VQPS 3HBTA 1ZM2A 4P2HA 3IM9A 3EDQB 2ZH6A 3TWHA 2IJRA 2JC0A 1UEVA 3F73A 3QINA 4J37A 2GVZB 3AO5A 3I0RA 3LPUA 3EUNA 4B3RK 5IIJA 5CB1A 2WSEC 1NOYA 2PBDA 3CW2C 3ET6B 3IBWA 4JI4F 1OMSA 1K1QA 2H9ZA 3U6FA 4L3KA 2IM0A 1ULRA 2E2PA 3FDSA 4NL9C 4E98A 4JI1J 2KV2A 5LMNJ 2W9BB 2B7CB 4EP5A 4WK1A 1ZJMA 1YJWN 5ETRA 1X5TA 2F8MA 3P4IA 2Z1GA 3GFKB 3DDKA 9ICNA 5J1PA 3QEIA 1SWWA 1JLFA 3Q89A 2CPIA 3D9BA 3T6JA 1KTQA 3G87A 3W0LA 3QAUA 1RBRA 4KLEA 4FWLA 3TOQA 7ICNA 4OLPA 1SH0A 4OYIA 3PYDA 4W5QA 5AE2A 7ICFA 4R66A 3F41A 4PKDB 3QUTA 1A9NB 3ENBA 2W7OA 3HYFA 4GIBA 2B4OA 2B43A 1D5AA 2OO4A 3KLIA 2KNJA 3FFIB 2BA9A 2PC6A 2KKVA 3C66A 3ETRA 3NCRA 1CQMA 3T5KA 1VC5A 1XSNA 2ETJA 1V97A 3QFPA 4DV2K 3O3HA 1I3OB 5ETMA 3FC9A 2UU9J 4RPYA 5T7LA 5HP4A 5KG1A 3M6WA 4F4XA 3QIPA 2AHOB 2B51A 4DX5A 3LZIA 2A3ZA 1N33K 3J8AA 4DR7K 3SK3A 2RVJA 4J2DA 4RJVA 1UJ6A 1NWKA 1X66A 4CWBA 4KRWA 2XQCA 2ZIWB 4JS5A 2CDRB 4RPFA 2CFXA 5T7BA 1U0HB 3AJ2A 2ZJAA 1VISA 3FEXB 1S12A 1ACMB 2BJ8A 4FL9A 2Q36A 4HEA9 3OS0A 4MJKA 5HMZA 4GKKK 3ADAC 3D2WA 1RTHA 5ETKA 1J53A 2V63A 8ICRA 4Z7CA 4OVLA 3KLEB 4AP9A 2HZVA 1LEOA 3ZNUA 4RQ8A 2M2BA 2D7SA 2QARB 2KKZA 4QYZK 5D8HB 1ESVA 4P0PB 3N97B 2MKHA 5J2DA 8ICVA 5KOWA 3GYNA 3I5BA 2O1PA 3GWCA 5AHXA 1S9EB 5ALEA 4DXLA 2RNEA 2FSNA 1SJQA 2F40A 4I69A 2PMZF 4BG8A 4F4YA 3QGGA 3K1ZA 5KFRA 4MIWA 2NXUA 5E3AA 2PA8D 4BR2A 1HNXF 5ALSA 4DR3F 3L0QA 1FF2A 3CCJS 1C0TA 5IIMA 2C22A 1HHQA 3C16A 2OUGA 5ETLA 2QLBB 4Y0FA 2V94A 5KTQA 3IG5A 2FBVA 4WCEQ 4WFXA 1JWWA 1KW4A 2CGLA 3GTYX 2M5YA 4LSNB 4JUZA 1B92A 1K44A 1BC6A 1T11A 2ZJRQ 2MMYA 3TABA 5FDLA 4C1NK 2KMDA 2HHQA 3W60A 2LQ5A 4X4QA 4PHTX 2ZWOA 1UVLA 3V7KA 1GOCA 3S3OA 3HKWA 1Y3KA 4J2BA 1KHVA 4J9KA 1A76A 2QA4S 5DO2A 3EEQA 3K9KA 2AGQA 3BPDA 3O9SA 2HHXA 5AJ3F 2KD1A 2FHOB 5GINA 2BABA 3MDFA 4FS1A 2P9LA 1PYSB 2LU1A 2WB1D 4I28A 3UCGA 5FRMA 2A1JB 4PYDA 4FVUA 1OQ3A 1R7IA 2QW9A 3UR0A 4I29A 2BHNA 4LQ9A 4XUSA 2AP1A 3HI9A 4BS2A 1HHSA 5B7WA 2YMPA 4OZJA 1RQLA 2O01C 2B21A 4DB3A 4JD2A 3CIPA 2QV6A 4I1TA 1M90T 2XB2D 2X6NA 5DZ7A 3NNHA 2ZNZA 1RBUA 3DLKB 1ZBFA 2KHDA 5J0UA 4IQMA 1AROP 3DFEA 4LF4F 1FRHA 3WX8A 3F53A 5KRSA 3GV7B 5CHIA 4RNMA 2AQ0A 1TL4A 4TU9A 3A1YG 4AL7A 5GAHP 3W64A 1TKXB 3CCJN 2HLUA 3H0LB 3QERA 4NA1A 3AUOA 2X51A 2DO0A 3Q83A 1FJGJ 4RPXA 3NVVA 4KFBB 1WSEA 4C0HA 2CPFA 5AKXA 4TY8B 4IKAA 4F4ZA 1T6DA 3ZSWA 2XHBA 3WXKA 4O5KA 3BO3A 4G1QB 5IM0A 3QESA 4Z4EA 2C2OB 4AQYF 4ICAA 4TUQA 4I67A 3MM5A 1MQ3A 3Q8LA 5ETVA 2HHPA 4YR0A 3KKSA 2DD8S 1ZD4A 1LOUA 3TP2A 2AQ4A 1C7YA 2XS7A 3TZYA 5AQMA 2ASYA 5FROA 3QATA 4PGXA 4DOCA 4DPXA 3JPOA 4QZFA 2FHJD 4O3OA 3VGTA 1WKKA 3MUVP 2R8JA 1HQUA 3CMQA 5H1SV 1PSDA 1SI9A 3MEGA 3HHNB 4I2HA 1H2VZ 4LJMA 4A8FA 1XMOF 3M8QA 5A76A 1RT5B 2KM8C 4OKJA 4K4XA 2HB5A 4YFKA 3AU6A 3ULDA 2CA9A 3EWGA 5AQNA 2KFYA 2RHKA 1ZBLA 2GX9A 3OUYA 3T7ZA 1RKJA 5AKHA 5HI7A 4IUFA 4M9NA 4RW7B 3NBPB 1RG6A 3CCWA 4FLTA 2K06A 2PMZC 2FLNA 4FKXA 1KLNA 2FVQA 3RMDA 1Y5IB 5EE0A 1NZBA 2Y0BB 2FC0A 1H72C 5F2RA 1JLGA 3TSUA 2G1DA 4W98A 1PYTA 3HP9A 1RBLA 1R8HA 1B0TA 2W9CB 4A8YA 4NXMF 2BQ3A 3VEOA 3DCAA 2CQ0A 2DNYA 4NRUA 4CZCA 3GQCA 1S7IA 3SUNA 4I2DA 1VSLA 1LW2A 4CQ1A 3BO2A 1BHNA 4JV5J 4Y1CA 2WTUA 1LV5A 2RF2B 4IC9A 1N4LA 1Z25A 3MAAA 3UQ2A 4H0TB 3GFXA 3C1YA 4JI1K 3TRGA 1JCFA 5LMNK 4IFYB 3GZ7A 4PQUB 3H45C 3PYGA 2F1IA 4IJNA 3HZEA 3AY9A 4WFAL 3NVMA 4PL2A 4CZHA 3TVYA 4TY9A 4Y2QA 4E8UA 3QBWA 1F0MA 1SKSA 3KKFA 2ASDA 5C0YA 4CZEA 4HUEA 4QR1A 4ZLNA 1NGJA 3Q2TC 3UW1A 2QZ8A 1JLEA 2YMMA 2N4CA 1VSFA 5BN9A 1UJ5A 4MIAA 4AXIA 1XQIA 5K14A 2F44A 1CEZA 2D41A 4C48A 4I2IA 2MZRA 2ILZA 5CYMA 1QQ5A 4X5VA 1VJQA 3NWRA 4ID1A 2UV8G 5J2MA 3TADA 4GO5X 3HKZD 3R1XA 3CDUA 8ICXA 1YTAA 4BR4A 3V81B 2DGOA 1BI4B 4JS4A 1MWYA 3O9UA 2F7VA 4BDYA 4PHAA 3TAMB 2F4VF 3G2XA 2CIMA 2J7WA 4ITSA 1AW0A 4RQMA 1WEYA 3AB2B 5ADXH 4NLDA 1FWLA 2W3RA 3C0BA 4K25A 4OJGA 2UU9K 2VQFJ 3QIOA 3MUTP 4C98A 4OJLA 1S99A 3NEKA 1WJ9A 4DR1F 4DTJA 5KFHA 3A3PB 3C7NA 2JOQA 1RPLA 2VH7A 3FZHA 3ZSZA 2JRSA 4NL9A 1EJ7L 2Y1JA 2DH8A 1VI7A 2IHR1 2K4PA 1ZZFA 4FJJA 2KK0A 4X4RA 1SKWA 5K20B 1FKAF 4WP3A 2JFKA 4RW4A 3FYHA 1HQEA 4RO0A 1HI1A 5FLXU 4K43A 3QO9B 1LWXA 3SFUA 3GJTB 1DBDA 1J97A 3RJKA 5A8KB 8ICLA 1IJEB 2YHXA 1FVSA 2LQJA 4M1KA 2ZD1A 2VQEJ 4IS7A 2LDYA 3CFOA 5DLGA 4RU2A 1CJVB 2OEMA 2K8GA 4S0MA 1B9FA 1B0XA 2J6UA 3TA2A 2R9LA 1T9WA 2ILYA 5J0QA 2HBQB 4GY2B 3MX2A 4UB4A 1VQ8N 4CM0A 3MCNA 3FE1A 5HROB 3O0FA 3MMBA 4QZ8A 4ZJQA 4CZLA 2CYYA 2A40A 3H90A 1G4CA 1FT8A 3QJLA 4B3MF 3WIVA 2P6SA 2G0JA 1IBCB 5D4OA 2MA1A 2HWHA 1HPZA 3V9XA 3GIRA 1Z00B 3VGMA 1F9FA 4NZ7A 5J2HA 3K17A 3ZTOA 4DHYA 3G4SS 1Y5LB 2J6SA 2HF4A 5ALRA 3VAJA 3MMAB 4FWKA 5IS2A 4EFAC 2ZUGA 3JB9k 3TU5A 5HAOA 5HR7A 3QJJA 1UCVA 3BS7A 3VQAA 1SB3C 3D2SA 1ZAWA 1Q86T 2F7TA 2ZIUA 3CCLS 2YWFA 4AHRA 5A8WA 1KQSM 4M5NA 2P9NB 3UD5A 1AXQA 3EZ5A 3TAPA 2IFXA 3HZGA 4NZ0A 3AA2A 3KKAC 3THWB 4A8OA 3ICXA 4WYBA 4UW9A 5DB9A 4TLRA 2DEIA 2H65B 4MO4A 4LY7A 4DL5A 2YQ0A 4LF7J 4PHPA 3DOLB 1QSSA 4XO0A 4Q2MA 3OR1A 4LT6A 1HWLA 1BPYA 4I2JA 3GPAA 5DGBA 3ZI4A 2JFDA 5BOLA 2EZXA 3R2DJ 5GAGU 1CZBA 2DNHA 4OGCA 3CJQA 3GIJA 2ZTDA 2GGPB 4DJBA 3DMJA 4IG3A 1WC5A 3C6UB 3C3LA 1RUSA 3OXLA 2QK9A 1S1UA 3OBIA 1E6YB 3AD9C 1WSIA 1P7DA 1MU2B 2RIJA 3H5YA 3OVBA 3O9TA 2YKNB 1CJUB 3CCRN 3NG8A 3SR6A 2V4JB 2VPXB 1VRUB 1DOQA 2E1ZA 3EKSA 4KO0A 2FMPA 1JLBB 1FJGK 3NL0A 3K8WA 3AVAA 4I2AA 4J9LA 2H4WB 3IRUA 3A8JA 1ATRA 4WFNQ 4OZLA 4ZP7A 2EKNA 3G4SN 2CQ4A 3QBXA 2GW8A 4Z0UA 1ZQJA 3T1AA 1Y3JA 4HACB 2MSNA 1RBOB 1NGHA 1PVRA 1KLMB 2P2CB 4OX9F 3DHXA 4JI4J 1BD6A 4RWXA 3Q8RB 3AQPA 1XBWA 3HJEA 1MLAA 5CCMA 2OZSA 1I1GA 3MDQA 3MR6A 3CCLN 4UOFA 3I76A 1ZQAA 3FSXA 4L3QA 3PKMA 2E5HA 2KRRA 2GMLA 4AFFA 2HAIA 3BREA 3CDBA 5ETOA 3BSNA 2GO9A 1G6BA 3VHQA 4MK9A 3L3VA 2DNOA 2GWKA 2M8HA 1KAXA 4CO2A 4USUA 3I8DA 2CRXA 1H3DA 4ZITA 4DUYF 4N41A 2KKPA 3M6UA 4DV0K 3LDAA 4RQ5A 2V8DA 1REGX 4QPTA 2DY4A 2FXUA 2IVOA 5ADZA 4X84A 3ZETA 4CEQA 4O5EA 5JVHQ 7FDRA 1IN0A 2I2YA 1J27A 2HQIA 3UMCA 4F67A 3BDEA 5KFJA 3VEVA 1XK8A 3DXBA 4NLXA 4Z6FA 1JXBA 3NVKA 5KT7A 3G0ZA 3I55N 3AGRA 3JS6A 3NE6A 3J80O 3KD1E 5KI6A 4J8FA 3VQ9A 3TJ9A 4CGGA 1V3RA 2SXLA 1VDHA 4V19X 1W0HA 2XLIA 2QWLA 3GE9A 1VSHA 2XHWA 3WBZA 1NHKL 3QGHA 4KN4A 1D8LA 5AZJB 2CXYA 1OY6A 3G71S 4CF0A 2B3TB 3CUNA 5AI6A 2VU5A 1UETA 1XHXA 2JV3A 3RH6A 3SLCA 1N56A 2PYLA 1JN3A 2B0CA 5D49A 2GHPA 4DN0A 4CYUA 2XI2A 3V5RA 2F8LA 3OV7A 1FD8A 3IAS9 4JV5K 1ZQVA 4DOZA 2AYBA 1TL3A 4LF1A 3AU2A 1RBSA 1ZQBA 4F0HA 4A57A 2ROEA 1HJOA 3AO4A 4ZN1A 2F77X 5DZ6A 4BE2A 4K5RA 5JICA 4UBBA 3CXCR 2XSJB 8ICZA 4ZHRB 1UP1A 3WC0A 3SAGA 4XPEA 5B0AA 1NJIT 3DDNA 2I1QA 4OLAA 4N8OA 4QU6A 2HNYB 1QM9A 1RT6B 1YJNS 4LF5J 5DM7L 5AKKA 4HTIA 3WK9A 4I7FA 1ZQNA 3QGIA 3QSIA 3CQXA 4E1JA 4KLMA 4B8CA 1U1OA 4LF9F 2P1JA 1ZD2P 7ICKA 5HVFA 1NZAA 1HNXJ 3RSEB 4DR3J 2MYFA 1WB9A 2DR5A 1DHMA 3R6LB 3Q86A 3VQ6A 2WHEA 1WSRA 3SV3A 3H0RB 2WVEA 3Q7CA 1CI4A 1RWXB 3KZIU 1ZAXA 2BX6A 2MRLA 4U8YA 3MD3A 4K4VA 2VQFK 3W7BA 1YHQS 2QKBA 3EZWA 3HD1A 2W42A 2QN6B 2MGZB 3SMPA 2CNNB 3K75D 4UZCA 3N6LA 1TR0A 4OYWA 5ETNA 1RAIB 1C1BA 2NXNA 4H0OA 3NMAA 2GMJA 4U95A 4M5IA 1WSFA 3BKFA 5AJ3J 1FFGB 1BG3A 2YTUA 2NRTA 2O8FA 2EWSA 2YWKA 3G9CA 1RCHA 2JHEA 2XGQA 3CMEN 2XICA 2ZVIA 4HVZA 4NI2A 4QZDA 1ED1A 3WNHA 4I2QA 2J8SA 1WG8A 3TA1A 3OYEA 2D6FC 1TV9A 3JXOA 4NB4A 2C3MA 3LM9A 9RUBA 2LXFA 4EBEA 4HL9A 2ZJQQ 2BE9B 2LSNA 3DWLA 4OJ3A 1BU6O 1FEZA 3OVNA 2NO5A 3OTDA 2PFQA 4HWIA 2EAPA 4WQ4C 2EG2A 2ZTCA 2HIQA 1U48A 5IINA 1VOMA 4LF4J 1S6QA 1E6VB 3ZDDA 2JH7A 1QSLA 2KJ5A 1WC0A 2XCPA 2E8NA 4CZFA 2WVCA 2ITGA 1LW0A 4L8RB 5J1NA 3F2KA 4NA3A 3IM1A 4F0KA 3HFKA 3CNQP 4KHRA 3MR5A 3KOAA 2Y8WA 1YVNA 1MDUB 1RYUA 2PMWA 1NSQA 5LSOA 5DG7A 2DT9A 3G25A 1KN5A 3N4WA 2D3OR 3J81O 4FK2A 4OMFG 3EE9A 2HQCA 1RM6C 3AHPA 5BR8K 3QMQA 3ITHA 7ICSA 1YAGA 4KQZA 1SGGA 5LXRA 5CY4A 3PR4A 4LFBF 2HURA 3UIQA 2Q97A 1XR7A 1S4EA 1LKZA 3QNMA 9ICXA 1WUDA 5M2UA 4BWMA 2HHSA 1R27B 8ICFA 7ICPA 1P90A 3PVXA 2PI4A 4LREA 4IO9Q 4DR2F 3H5XA 4UB5A 1ZOTA 2FQQB 2R7VA 3J80Y 4ECYA 3BBFA 4OZ3A 4CJUA 3R5DA 4E1NA 1RNHA 1FK9A 1S6PA 2R3VA 4LF7K 1WWHA 1BQMA 4BG9A 2K1RB 4NYFA 5J2GA 1XMOJ 4A8EA 5C42B 2HHWA 2H1YA 3TR8A 5J2NA 1NDPA 4IRDA 2B8PA 2H4YB 1K73T 2XNQA 4KLSA 3OPXA 2EK1A 4JK7A 1F21A 2JRZA 1XNSA 1GMUA 3CCMS 4YG2A 4NLYA 4Q2LA 1QVGM 3SDEB 5T14A 3B4MA 2I5JB 1KQKA 4C23A 1QQ7A 1U1NA 4M04A 3D2EA 1GXTA 1ZQ1C 2WBNA 3N5BA 3CERA 1NO8A 5LJ3Y 3WUHA 4O0JA 3NOGA 4UAZA 3NH1A 4HI1A 3VQPA 3DHWC 4CM2A 4CO5A 1RBTA 2IDOA 3E1YA 2DHXA 5EUHA 1FXXA 1S72N 3OVSA 4CEEA 4BY9C 2B5JB 3SFGA 2OHDA 1VQLS 2K4IA 4DTRA 2X7IA 3HDSA 4NXMJ 2V52B 2X74A 4AHTA 3R2CJ 1UT8A 2O8EB 2XS2A 3V2UC 4BE0A 3CETA 3SNNA 3LGNA 5HBMA 2ZG6A 3ISZA 2EVZA 3KMSA 5KFIA 3M6KA 5DDPC 1QVFR 1H73A 3GV8B 1RADB 3K8VA 4JI4K 2HSZA 1BPZA 2MZQA 5AICA 4CLYA 3KJVB 4DEZA 1GXUA 3KKAA 2KB2A 5GIPA 2DRAA 2BR0A 2OTJN 1T3NA 3OXFA 3OR2B 2RMLA 1U7LA 4JWNA 3TVZA 4OI4A 4EFHA 2XEXA 4K4TA 4M2YA 3SCXA 3CTRA 5CD4H 4G1IA 2DGXA 5KGXA 2F2AB 5CYQB 1CJKB 3LL3A 2VD3A 2VPZB 1T94A 1NM2A 2JR5A 3OD2A 4CDGA 3LUYA 3KLGB 4Y00A 2JLGA 2E7XA 2M4MA 1Z1VA 3DM2A 3J7Z5 1DTQA 1HEKA 2ZGZA 1HBNB 3SUPA 3HSDA 3RMCA 1UEKA 3Q8QB 4BRKA 3G10A 3JQJA 1HR0F 3S7RA 1Q81T 1N8RO 3M6VA 2OFGX 2BE2A 3KWIA 1G15A 5T41A 2KXFA 2QMUB 2YXLA 1U6FA 1WC4A 3IO1A 3KTQA 3ILLA 1T9TA 2IIHA 2F9JA 2LEPA 3O5TB 2F4VJ 4RUBA 3QU9A 3M32A 3ENAA 4OJPA 3UDVA 3N7PD 5D78A 2P51A 4K4GA 3KOOA 4WPAA 1U26A 1SUQB 2OJ3A 2JHDA 4CD1A 3K57A 1SZ2A 3O44A 4LF8J 4N5SA 4OZ5A 3MXJA 3KG1A 3AVKA 3ZZOA 3L7OA 1C1CA 5AE3A 3GSIA 4CO3A 1I5OB 4DR1J 3WKDA 1WEZA 2E3TA 2ZJ5A 5DDYA 3TR5A 3LPYA 3Q8SB 3WEEA 3LM2A 3FZMA 3A3OB 1NI3A 3O9QA 2R7UA 2BACA 5CP2A 2QFIA 3E51A 2VA3A 3QEXA 3FLCO 3KLHB 4NXZA 2YX7A 3NAEA 2HFUA 4DU3A 7ICHA 4UY8T 1OYDA 3VQ4A 1SL0A 5L46A 4FWQA 1Q3UA 3MTKA 3CO0P 4IKFA 2VGMA 4QS9A 2EG1A 4O3QA 2YPZA 2H5EA 3CJKA 1Q53A 5C24A 5LOQA 4NYNA 3BZCA 4RPZA 1ZBIA 3OJUA 3J81Y 1S5JA 3PSPA 1X9MA 3HVTA 4C0OC 1W2BR 3FZKA 1L7PA 3BUZB 4DDFA 3M8RA 4LF5K 3I4PA 1FFVA 2BW2A 2GUIA 4CGDA 2JLFA 1YJTA 5AZIB 4B3MJ 1IBMJ 4FBTA 3TJAA 3WK7A 1ZS6A 1CC8A 1HNXK 1N52B 4GFJA 2A1AA 2ZH5A 1T05B 1NGFA 2HAFA 3OA9A 1FVQA 2BQRA 2XBPA 2R18A 2YB4A 1IBLF 1Q4RA 4AL6A 3GE1A 4M94A 2UUWA 1GEHA 5CRXA 1UZHA 2D5RA 5HP1A 2HPUA 3BYPA 2GLEA 1RFQA 1S1TB 2I7PA 4TUSA 1JLCB 1A5XA 2VG6B 2UVVA 3VGVA 1U2VA 2DIVA 4QIFA 1TAUA 4X66J 2LA6A 5D77A 4WQ5A 1CUKA 3CULA 4JYAF 2E8PA 1URNA 3FVYA 1K8AO 5E5NA 5AQSA 2VJ4A 1FXLA 5B09A 3VAMA 5AJ3K 2CNOB 3P5BP 4IDKB 3BJYA 4G65A 4H4OA 3DLJA 5E7OB 4JI6F 2ZH1A 1RT3A 1L3VA 2ZIVA 3SV4A 1RWMB 1FKOB 2VBYA 4ZVRB 1BQNB 4CF1A 1Q8KA 3FKBA 3MM8A 4WE1A 4CE6A 3GDXA 4MFCA 2U2FA 2VASA 4HR2A 4H0PA 1DQ9A 1MNEA 3HT0A 5HJXA 3T9ZA 1JMSA 2BCQA 3M2RB 2NRWA 4BR9A 3WC2A 1UVMA 5L38A 3ZSQA 5AM3A 5D0GA 1LXNA 3G6EN 2ZJRL 4URQU 3AXKA 1R6YA 4PHEA 3T3FA 2HWTA 5M1NA 2IY5B 3AB4B 2CJKA 4LF4K 2WAQF 4JWMA 3ENQA 3CJAA 1Z19A 1M5SA 3AAQA 1VHIA 1BL3A 3C23A 3DRPA 2EFGA 1VQON 2FVSA 3SQ2A 3RFAA 3ILIA 3SSQA 3SIPB 8ICTA 3JYTA 2NLXA 4B9TA 3T9NA 3AJDA 2PY5A 1O13A 2LXIA 2JGUA 4NM1A 3IP4B 3RBDA 3W8PA 2RQMA 1T44A 4FVMA 4ELVA 2W24A 3NLCA 1XHZA 4H8KA 3W8GA 3CF5L 2VDHA 3I5CA 1LKYA 3ZD9A 4OYBA 4RZRA 2CGKA 2XIDA 2EXUA 1VLOA 4KY3A 8ICBA 4MAKA 2NYVA 1XC9A 1OS5A 1R8AA 2NZ4A 4DFJA 3O1LA 8ICKA 1TKTB 3K0SA 5LMUJ 4I6MA 3W5YA 1VQ5N 2UUTA 3THVA 1C0FA 3T69A 2YVSA 4IG0A 3R8EA 4FN5A 2EC2A 3U3YA 4KJIA 1RYSA 1FXRA 1WUAA 1DXSA 5KG4A 2XI3A 4DUYJ 2CDQA 3RJFA 3PLAA 3RF9A 5DBBA 2IBOA 1IQTA 4P2FA 3D2FB 2GX8A 4WQ4A 5D4PA 2ZNYA 5G0RA 3CB4A 4PPZA 2XI9A 5FIIA 4P52A 4YCXA 3N9UC 3OTOF 4WF9Q 1RCOB 2BH1A 3AH6A 2QWPA 2YHBA 5AKEA 2WSFC 1U8SA 4ECRA 3ZZTA 3ULEB 2VA8A 2C3OA 3LZJA 1KP6A 3NF7A 1AYEA 5JUMA 2NSCA 3L2WA 2QX0A 3D66A 2Q43A 2FHMA 3TO8A 4YQWA 3SQ4A 1HD1A 4DU1A 3JSMB 4LUBA 4Z2XA 1RTIA 5AQWA 3TVKA 3QFHA 3V9SA 4KMOB 3AQOA 3VCDA 1L7MA 4FNHA 4OKKA 3OFEA 3PYEA 3EGWB 2WC9A 2K8CB 3QT7A 4B9SA 4M3ZA 9ICFA 5A0YB 4NXMK 5E3QA 5KFCA 2J76E 3KHYA 5DM6L 4C4TA 5DRKA 2P66A 1JJ2M 2VG7B 1S1WB 2DGTA 2EFOA 4X4TA 4RT2A 5IZHA 2RKIB 4CO0A 2FMQA 1M5OC 1FRJA 2YNIB 4A48A 1RWKB 2IOHA 2IRUA 3DRRB 3EVMA 2ROPA 1H0HB 3L95X 2GHWA 5LL6Z 3D67A 2HOQA 3TSQA 4WK3A 3NS1A 3PIOQ 1UVNA 4U9RA 4CF2A 1GLJO 2H3FA 3LPTA 2ASLA 5KPTA 4DPUA 4RT3A 3GDQA 1XSPA 2K89A 4RQ7A 2G1HA 1T03B 1F1BB 4I64A 3EVOA 2MKCA 3TX8A 1RA7A 3RR8A 4MFFA 1M5PC 1AUSL 2VBWA 3GIIA 1U2CA 1R0AB 4OCZA 1Q82O 5D46A 3UDCA 1BUPA 3R5BA 4XH4A 2K4EA 1QE1A 1MWQA 1WBDA 5FP0A 2RSQA 1S1VA 3UXPA 3NFAA 1XMQK 4LF9J 2CG8A 4CZMA 2DR8A 2FPHX 5MAOA 3UE2A 4CJSA 2IDLA 4BRQA 5J2JA 3B78A 2PFUA 4FS2A 4HAIA 1HA1A 2Y0SD 2E1FA 4N56A 3HLUA 4KX3A 4O0NA 1VJWA 3CG7A 1JLQA 3HVWA 2P9IB 4FCYA 4QCLA 2WAQC 2UUAF 3KUEA 3V1RA 5EVZA 5ALTA 3RU0A 2FPMA 2N82B 4QZ9A 2R7WA 4UB1A 5CEHA 4K4HA 2XYHB 4CTAA 4LF8K 5DBAA 2MY7A 4LR9A 2MZ1A 4CK1A 3J7AP 2VFVA 1TGOA 4KLLA 2P9UA 4DR1K 3L4IA 4NCGB 4N7TA 2HVDA 1QY7A 3UFCX 4QZCA 4F7VA 3K59A 4DV1F 3MABA 3D1HA 3RVCA 5HQMA 2KFZA 4CESA 3I0RB 3DNCA 4Y28C 2ODGA 1M0SA 3G96A 5I9EB 1PYOB 4YB5A 3MMCB 1U09A 2AF6A 1F6TA 1N5SA 4IOCQ 2Y1LB 9ICCA 2WSCC 3UKRA 2CPEA 4UT4A 3ETLA 1G2EA 2ZH4A 2BZ2A 3VAHA 3M8ZA 4Z6CA 5KG2A 3PIPL 4NWBA 4J90A 1UL3A 3K0JA 3IN5A 3WX4A 1VBYA 1UJ4A 8ICAA 2DNKA 4WU3A 2RQCA 4CF8A 1RT1A 4ZVSB 5GTHU 1JLFB 2PXIA 3FMWA 1NPKA 1JKHA 1NKBA 3OT9A 2V69A 4UF4A 4USVA 1SIJA 1HIYA 2IVNA 1RJJA 2KVSA 3MPDA 3FCHA 4F72A 3C46A 4FZMA 4YY3J 3VALA 4B3MK 9ICEA 2V34A 3E9LA 1IBMK 5B0GA 5L1LA 3TPQA 4I2EA 4J9UE 3MPYA 3CD6N 4UY85 4ZLLA 3M8PA 4LIWA 1K9MO 4X4NA 4FM0A 2AH5A 1X8DA 1YJUA 1X4BA 2LQ9A 1WKJA 2MQLA 4X64J 3DXKB 4M9JA 1JJHA 3OQ2A 3OFFA 4DLGA 4YORA 4BRFA 2ZDPA 4M5DA 3LP1B 1EWQA 4L75A 2HEKA 3D6FB 2VV5A 2UXCF 1WTFA 3IAYA 1S49A 4PG7A 1JROA 2VCPA 4X66K 3TUPA 4OO1J 1CG2A 4LFBJ 3CYMA 5C2GA 2FB0A 9ICTA 4UTGA 1NLVA 4JNEA 4DKWA 1BWVA 3R6GB 5DJBA 4NLBA 1QJHA 1N33F 1Q86O 1FRLA 3TEHB 3VMFB 3NMRA 3NH2A 1TUUA 4DR2J 2YMQA 1VIXA 2G8HA 2W2QP 1HBOB 4Q8EA 5E79U 3ENHA 3S8SA 2M3DA 1N6QA 5AQFA 4RQ3A 1JL1A 1RTHB 4TVAB 2DY1A 2E5LF 3ZT0A 1C0UA 2K60A 4QIEA 4RTFD 4CHZA 4IFVA 1HNWF 1U1RA 3DLEB 4GKKF 3D3CJ 5F8MA 2KYZA 3OTBA 1TV6B 1YSJA 4DPOA 3VQBA 3OJSA 4B17A 3DKDA 4W5RA 3QYPA 3HSCA 2MLXA 2C2NA 3DOKA 4C7QA 2QG9B 3LPEA 1HIWA 4GVLA 5EOZA 3RRGA 3OL8A 3BS5A 3ENWA 2MB0B 1Y97A 2D0OA 4F50A 3HSJA 3L2VA 2XWYA 1S22A 3G6VA 2ITMA 1HQ2A 1C0TB 3C16B 4AD6A 3EZUA 3MBYA 1X6JA 4AL5A 3RAMA 4PHDA 5DS7A 2JX2A 3J7ZO 1BY9A 2L9DA 2G2OA 3O4QA 3SBMA 6AT1B 1S79A 4DCJB 3CGIA 5FDLB 3AXMA 5CZ2A 1OH7A 3T5JA 3UD3P 4NCBA 3QXGA 2QA2A 3BF4A 4RCHA 4O5BA 7ICRA 5LMUK 1D8YA 3KHHA 5LSRA 4P0QA 1S7HA 2W2OP 2YX1A 5CD4A 3HJFA 3HXMA 2P9LB 3DRYA 5EWFA 4LRCA 2FJAB 1SCJB 1N5VA 1GFWB 5SWMA 1KOHA 1Q8IA 4CE9A 1J2NA 4KN7A 2QWNA 4R64A 3OYKA 4JMUA 4RL1A 3H4BA 3CE8A 3GFYA 2KVQE 4N8NA 2DRBA 2RRNA 1LAWA 4YR2A 3J80U 4ATNA 4N47A 4KH4A 4MKYA 1LWFA 1BXNA 2YWHA 3QGPA 2GS8A 1CULA 5AM2A 2WVBA 3ZTRA 4ZP8A 4R5PB 2HI0A 4F25A 2ZJPL 3CVKA 3R9LA 4JKEA 1RT4A 3D0IE 3VV2B 1LXJA 1J5EJ 3D7SB 3SCIE 4ZP6A 3H8JA 4Z6EA 2MHEA 2W9MA 3KDNA 1M5KC 1K6YA 1GOAA 3L6QA 3MMVA 1ZRNA 2FI1A 1IR0A 3C5FA 2OKQA 2V6AA 4JKCA 5J2IA 1MMLA 3KLFA 1X4CA 5AE1A 4KV8B 3TNVA 2ASMA 2WONA 4KLJA 5JLFA 1A7GE 3GYXB 1NGDA 4HUGA 1VYAA 3ILOA 2WRMA 2OD4A 5IM0B 4IXCA 2R7OA 1HKCA 3E9OA 1RYRA 3L9ZA 4ED8A 4K4YA 4CECA 3MM5B 1VBZA 5C12A 1TE2A 5DLFA 3JS9A 3O08A 2J0QD 4PJ0U 2UXBF 5HVHA 4B1YB 3WKAA 2AJ4A 1JIHA 1YI2N 9ICUA 2ZUDA 4WKRA 5J0XA 1R0CB 5HLFA 4IOAQ 5KFWA 1FKPA 4PG4A 2XMWA 4C9DA 3V4IA 2MHNA 4QIWC 1LWCA 4EX7A 1K5OA 1HBUB 4C8YA 1HQUB 5F8HA 3CJCA 3VEWA 4E7LA 2LXUA 3MEGB 3EYZA 2LA4A 2XZDB 3VQ7A 3JQMA 8ICWA 3M8QB 2HHHF 2B4VA 1E4FT 2V4QA 1RHUB 4KIAA 5LXYA 4K0KF 1ZQKA 2HQ3A 4LF9K 3ZDEA 1IUJA 3I5AA 4NLGA 2OEJA 2BXJA 2MDAA 4NYZA 1WAJA 3POTB 2GV9A 5ALWA 3CWJA 1HNIA 1DTTA 1IBLJ 3H6EA 4LSZB 3WU2U 3OSPA 2G08A 4YXJA 1Q9XA 2J7UA 2QTWA 2D74B 5GAEI 1U49A 1MSWD 3GR0A 2XY6A 1WI6A 4DL0C 1JLGB 4FJIA 4WZMA 3RW6A 2HBLA 3C6AA 8ATCB 1IKYA 1KVBA 5CQGA 3AL0B 4JYAJ 5F0XA 3C29A 3PFEA 3CJ7A 2FPLA 3KUHA 1FDNA 1RWOB 5EGYA 3DGVA 4GXIA 3UN2A 2QTDA 5DQIA 4LF6F 2LLZA 3BF3A 2D8CA 5ITHA 1RTDA 5AK4A 3AOAA 3JAMO 4V1Ak 1X6IA 2E1PA 3OYCA 5FRNA 3C65A 2ZH2A 4M95A 3RUBL 5B0DA 4C8OA 5KFXA 2ZE2A 3MAAB 3VETA 7ICTA 3AVIA 1VLYA 1FRXA 4FE3A 1QHTA 4X4OA 1CS4B 2QL7B 3FFKB 5J2CA 4LRAA 3VAIA 2E1CA 3M9MB 2F63A 2HFSA 1D9AA 3U7JA 3UXNA 1P9YA 2ZF5O 3AQEA 2PI5A 4JI1F 5AFUA 3H4DA 1TMMA 3NRWA 4QIVA 2A41A 3F5AA 3R97A 4KSEB 2P9PA 2KG1A 4JI2K 4HUFA 1JLEB 1KVCA 4RQ6A 4FJGA 3EWAA 9ICVA 4R65A 3CJ9A 2QEXS 1JQGA 4YY3K 3MXMA 3H2VE 2PYJA 3I33A 4KHUA 4ED2A 1I94K 3B6BA 2K3IA 4K4ZA 1HYZA 1YJ9N 3D1QA 2WFBA 3ZT3A 5CYMB 3J81U 5J2EA 1RK8A 1S0NA 1ELOA 1VR6A 4H4MA 3DLHA 1RTJA 2JH3A 3O5BA 1V9OA 1BIUA 4IR1A 3BKTA 3RJMB 3A5MC 1S1XA 4CEBA 2E8AA 2GQCA 4KYZA 4NLOA 4X64K 1DEJA 4FLYA 1Q5YA 1HNVB 3F5EA 1HKBA 3PX6A 1NB2A 2LVWA 2ZC4A 2DRDA 3DDIA 2FY1A 4EUVA 4CJPA 3RH5A 5A2QO 2ZJQL 4YN3B 5AKGA 3K9JA 3VEYA 4PWDA 4JK9A 4LFBK 3I28A 2NZTA 2V9KA 4L6V3 5DK5A 2UU9F 2MZJA 1YTUA 4DSKA 2HZCA 2DFFA 1GLBG 3SPZA 4F5NA 4CJ3A 4R25A 1RDRA 4PL8A 5KQDA 5JVGL 4BBYA 2GTDA 3FZBA 3DRSB 3VN5A 4JB8B 4DR2K 1Y7PA 2W7AA 1WC1A 2R7XA 4FOEA 3GLJA 1HQEB 3R5CA 2M88A 3M4XA 2JC1A 1WDTA 2P35A 1IKXA 2HBMA 3I32A 4ICLB 4Y65A 3LGMA 1V6HA 4JK8A 3G8SA 3EN9A 2QC3A 3NNAA 4MIBA 3GU3A 1CPZA 1JXEA 4YMNA 4GXKA 3U1NA 4ILHA 3MEDB 3OTOJ 2ZD1B 2EW9A 3S41A 2LPEA 3B4DA 1NZPA 1URRA 4K4SA 3NGZA 1Z2ZA 3UMGA 3LANA 1EX4A 1X4HA 3QEPA 4KI6A 4FF3A 4P10A 4DQQA 3CC4S 5M2PA 3OXGA 4J03A 2KFNA 2GZOA 1BWFO 4KITB 3W2WB 3U3GA 1SIWB 2FHKA 3JTNA 3JTOA 2DGUA 4NEZA 3KIOA 3F2CA 3TANA 1WEXA 4YN4A 2E1YA 5KL1B 2Q3PA 4HVJA 1GH8A 4KLUA 4DN9A 3JQKA 5J1EA 5JS1A 1S76D 3JPNA 2AEMA 4WFBQ 1CJTB 3CJ3A 4PCQA 1VQ6S 2WB1F 3P4UB 2DGQA 2V0NA 5K8PA 3ET6A 5DGAA 1GAOA 2VC0A 5KAKA 9ATCB 2YY3A 3SQOP 3EL2A 2KOBA 3V72A 2UVWA 1H7XA 3WQPA 4HT7A 3EUB2 3N6MA 2HKEA 3T1HJ 2CGJA 1ZQLA 5G5HA 1SV0C 2C2MB 1E3MA 5I3UA 3SQIA 2BJ1A 5E2QA 2I6WA 2J9EA 3ZZUA 4CZGA 1FRMA 2ZIUB 4ELTA 4YP3A 1BPXA 5A8WB 1K0TA 4PWUA 3DGPB 2KN7A 3R8YA 1B0PA 4CEOA 3CMAN 4N76A 4OI1A 1H1VA 4MK8A 1GMWA 4IQXA 5HNKA 2KEYA 5ALHA 2EFPA 3M2VB 5BYQA 1OYEA 1K8KB 1T9YA 4BLGA 3EM1A 5ALYA 4U96A 2QWRA 3OR1B 4Y6IA 2IBKA 3U8XA 1X9WA 2HFNA 3FFIA 5KFEA 2PO4A 3CC4N 2I0XA 3HF5A 4USAA 1OH6A 2HOIA 3BSAA 3JAMY 3WXJA 3VENA 2B9WA 2RQKA 3AGKA 2PA3A 4JAXA 2WHOA 3PTWA 1S1UB 4CEFA 1XMBA 4M5MA 3ZNJ1 2UUAJ 1J5EK 4WWSA 3I31A 4M9LA 1IKVA 4C4RA 1RU2A 3ALYA 1Z6RA 3O4WA 1W7WA 4KO0B 1VGYA 4TXSA 3K5NA 2GOLA 4B9MA 3M2UA 8ICPA 4OJ6A 1B4SA 3HPGA 2PAVA 4UASA 1RZTA 1F5SA 2CH6A 3JTPA 4DV1J 1RWPB 2YI1A 1ZQMA 3VQ8A 4I9LA 1PJ6A 5J2BA 4H5VA 3HO1A 3P1GA 2F76X 4ILLA 2DHGA 2AYEA 5J2PA 1APSA 2FVCA 2KHOA 4QJFB 2F4FA 3HSZA 4AYBF 2PKEA 1UZDA 3E58A 4CJEA 2QWOA 3FGUA 4NLVA 3KLEA 3OS1A 3MHYA 1H6KX 4UY8O 1CVJA 2ATLA 5AT1B 5KFFA 4KGMA 1SAZA 2LEBA 1NNEA 5AQTA 5ALGA 2QRRA 4NE9C