1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
1VSFA 4DL2A 3GIKA 5DGBA 4EBEA 3SV3A 3PO5A 4M6WB 2GUIA 1QLNA 4CK1A 3S3MA 1VSHA 9ICCA 1BVSA 3AVCA 1XSNA 2XGQA 4F4KA 3AU2A 3QERA 4O3NA 3BQTA 8ICHA 4IQUA 3AVKA 3OS2A 8ICTA 1B22A 2QKKA 3G0ZA 2Y1IA 1ZQWA 1D8LA 3ZT1A 2HNYA 1WCNA 3UPQA 9ICBA 4KHQA 1WSJA 5KG5A 1B92A 3LZIA 4E7KA 2C2DA 3THVA 4M42A 1JN3A 3OYEA 3AO4A 4QZGA 3DRRA 2YHAA 4P4OA 3T5HA 2ITGA 4CJQA 1Z25A 1COOA 5DKWA 1HMVA 1UWBA 4LH5A 1ZQZA 3CM5A 1KRPA 5J2QA 2RF2A 4YXJA 4IQWA 3V6DA 4QWBA 4PGXA 3EZ5A 7ICRA 3VQ4A 2ZTEA 2FBVA 4Z0UA 4CJ4A 4JWNA 5KT5A 3HM9A 1JLGA 4I2GA 4FLUA 3H8SA 4RNOA 3C1ZA 1S6QA 5DQIA 3SPYA 4ZH4A 2W9BA 3AVMA 7ICFA 4OPKA 4E1MA 1ZQVA 1WLJA 5KFNA 3V6JA 3AVAA 4FS1A 3DLKA 4Y1CA 2DFHA 5KFUA 3OJSA 1WNSA 2O4GA 1XO1A 3O3GA 8ICFA 4YP3A 4Q45A 3IG1A 4YQWA 4M3YA 3HK2A 4LVSA 1S1XA 2X6SA 3AA2A 4CIFA 2MUTB 2AU0A 2IOCA 2DFFA 1RDDA 4FK4A 1NKEA 5J0PA 1RTJA 5J2MA 8ICRA 4IDKA 3VQQA 8ICXA 4CE9A 1IKWA 1V9PA 3JPPA 3FFIA 4FZYA 3C21A 2AQ4A 4I2QA 2XY7A 3HYFA 4P4PA 5CYMA 4IR1A 2Z1GA 2YV0X 4AHTA 3S9HA 5KFWA 1C0TA 4KLOA 4DOBA 1S1UA 3L3UA 4UB2A 8ICMA 4ECXA 1HNVA 1KVBA 4IRCA 4PH5A 4M3TA 1IKYA 4KHNA 1TFRA 4PY5A 3LAMA 3RTVA 3ZT2A 4FJGA 4O44A 3H4BA 3VQDA 9ICKA 3N97B 4BACA 4UAWA 3RMBA 5L1KA 1FKOA 4IR9A 3DLGA 4DSFA 3RJEA 5E41A 3OS1A 4DLGA 1NOMA 3P1GA 2DFLA 3PR5B 1C7YA 3NH0A 3T1AA 4DTOA 3BQ0A 9ICRA 3WNEA 1BGXT 4LZGA 2NRTA 3C95A 4JLHA 4CK2A 1ZQDA 5KG2A 4F5PA 4B08A 5DB9A 3TR8A 5KG1A 2W8KA 4CFBA 5JS2A 5JS1A 4ECRA 3NTUA 3C5GA 4DS5A 3BDPA 3NF7A 4BXOA 3DLBA 5KFZA 2BR0A 2ZJ5A 3OYIA 1A5WA 3K59A 1NK9A 1I39A 1RTDA 3BQ1A 4GW6A 4KLDA 4NLNA 1TV6A 2BGGA 2OPRA 3MXMA 3V6KA 2YNFA 1UAXA 4N5SA 4RZRA 3QLHA 1VSMA 3VQBA 4IFYA 4M9HA 2JEIA 4QW9A 4NLZA 4ECYA 3ZD8A 1Z3EB 5FROA 4L8RB 4F93B 2D0AA 4CHNA 5J0YA 3BJYA 4JRQA 4DOAA 3P5JA 1EXNA 3AUOA 3H4DA 1ZBIA 1BI4A 4B9VA 2FMSA 3P83D 4QZBA 3GIIA 5IIOA 2G8VA 4O3PA 2ZE2A 4KHSA 2ALZA 4ECUA 2Z1HA 3HX0A 2QK9A 2DFEA 1RT7A 4M41A 3AVHA 5IIJA 3M9MB 2YNIA 5KFOA 4F5RA 4DLEA 4RW6A 5KG0A 4UAZA 2OPQA 1SZPA 2X6NA 7ICSA 4J2EA 4J9OA 4M0AA 2KZ3A 1S0NA 4R63A 3VA3A 4BE2A 8ICJA 2E6MA 4Q8FA 4PHAA 1J9AA 2VANA 5J2GA 3PX6A 1A5XA 2AQ0A 1UA1A 3Q8MA 4J9PA 2Z1JA 1LW0A 2I5JA 3QINA 4FK2A 3SI6A 4FZXC 1SV5A 4K8XA 4CJVA 4J9KA 1B9DA 9ICSA 3NH2A 5CP2A 3ZCMA 3SUQA 1JL2A 3M9OB 4FJNA 3GIMA 4E89A 2C22A 4JV1A 3SCXA 1DOQA 1YVUA 3Q8SB 3EYZA 1B43A 4Z4EA 4UB5A 3MDCA 3OGUA 3RR8A 1ZBHA 4YR2A 9ICPA 1XSLA 4N47A 1QTMA 1S1VA 4R64A 5KFRA 4FM0A 4LD0A 2VG6A 4J9LA 3DYAA 1TAQA 3HL8A 3V9WA 3OJUA 2W9MA 2IC3A 3G6VA 4F4YA 4CFDA 3KD1E 4WE1A 1DTQA 4PPXA 9ICAA 2J6UA 4QZEA 3HW8A 4DO9A 1W0HA 2PI5A 5DQGA 4F50A 2ISOA 2WONA 4ZTFA 5CR0A 1YT3A 2JEJA 5IIMA 3M9NB 4TSXA 5J2PA 4J9QA 3V4IA 1JX4A 3MR5A 1XSPA 3Q8QB 1JLAA 4JV2A 1S9GA 1KTQA 3U3GA 5J2FA 3TAPA 1WAJA 1A76A 4CEFA 4MFCA 4BDZA 3PW2A 2UVRA 4KITB 3AVBA 4YG2A 5KT6A 5KFSA 4Z4CA 4E3SA 3E01A 3B0XA 5CJ7A 4RT3A 2FLLA 2A1SA 2HHWA 3EY1A 4GXKA 2F1JA 4KN4A 5J2KA 1A77A 3GV7B 1EX4A 3HWTA 1LWEA 3ZDEA 5CWRA 2IAJA 2PFQA 1QSLA 4CJUA 2QXFA 1JXBA 4CEEA 4N56A 3OYHA 9ICQA 3RBDA 4KN7A 4MFBA 2DPIA 1Z26A 1SKWA 3CFRA 1J5OA 4IKFA 2BKEA 1KFTA 4HUFA 3NE6A 3C5FA 4CCHA 5FDLA 5DBBA 3K75D 1RBTA 3RH5A 4FLWA 5C24A 1VSKA 1JXLA 4CK3A 4BXOB 4R8UB 4BWJA 3SQ4A 8ICOA 4CJRA 3E2EA 2BCQA 3NFAA 2JGUA 2MUTA 4NM1A 1CEZA 2IMWP 5KFJA 1K1QA 9ICFA 4W5QA 4DEZA 4O3OA 2PFNA 4CJKA 5IILA 3JPTA 4LSLA 3RB3A 4RW8A 4M9NA 9ICUA 3V7LA 1HJPA 4XRHA 4P2HA 1Y88A 3MGHA 4RPYA 1RCHA 4GC6A 1ZYQA 3NBPA 1XHXA 3AVNA 2XY6A 1SKSA 3MEGA 1U4BA 3QIOA 3Q8RB 4DL5A 4F2SA 1RTHA 4FW1A 4RQ0A 3LP0A 3DOKA 1ZQMA 3LWMA 3MR6A 3VQ9A 1ZQAA 4HHTA 5KG4A 4Z4GA 2ZQBA 1ASWA 3QEIA 4FO6A 4QZHA 2HVHA 1ZQYA 4CGJA 4KTQA 3HO1A 2R8KA 3D45A 4GXIA 5J2JA 4F5QA 1S6PA 5J2AA 2XC9A 1VSEA 1A5VA 1IH7A 2I9GA 2XCAA 5KFCA 5L1LA 4QOZB 4FBUA 1TL1A 3EW9A 1HUZA 4AHUA 4Z4IA 3DRPA 3NF6A 1X1PA 3VQCA 5J0RA 2P1JA 1D8YA 2BQ3A 3K2PA 3RJIA 3V72A 2G8HA 4ECVA 5I42A 4RW7A 4EBDA 1ZQQA 3GQCA 1Q9XA 4FCYA 5J2EA 5J1EA 8ICQA 1CXUA 3V9SA 1UT5A 3RRHA 2F1HA 1RT4A 1KVCA 4CIEA 1RZTA 7ICGA 2KFNA 4IQTA 3OYLA 4TURA 3K5OA 3SZ2A 5EWEA 3ZSWA 4E7HA 2GWSA 8ICBA 2I1QA 1HYVA 3WNFA 1BQMA 1S77D 4CEZA 1ZQGA 4W5TA 4RQ5A 4DSIA 3PW7A 4YD2A 3JPQA 4I2AA 3LK9A 3N4MB 4B8AB 8ICWA 4HUGA 3LALA 1MC8A 3ZSQA 4DL6A 2ATQA 2BCUA 3RR7A 2G8KA 3LP1A 4ECWA 1ZQPA 4I2PA 2FC0A 2GBZA 1TAUA 3T3FA 1BPDA 5HROA 4FJKA 4O0IA 2BCVA 4Z4FA 3TFRA 4J2BA 4ELTA 2RPIA 3RJHA 1NOZA 3ISDA 2KTQA 3RMCA 2UVWA 3NGDA 5KT7A 5IIKA 1TKDA 4UB1A 1ZQLA 4TUSA 4B9UA 3GIJA 3LDAA 5KGWA 1RT6A 1WAFA 1XHZA 4OGEA 1KLMA 4B9LA 4I2EA 1X9SA 1ZQJA 2OWOA 2W9AA 4O4GA 1TK5A 5K14A 4CEBA 2NUBA 1W9HA 3B0YA 3ISBA 1C1AA 4DF8A 2PFOA 3PUFA 3ULDA 1NK8A 1NJXA 3M8RA 5KT4A 4PWDA 2HNZA 1ITGA 2W8LA 3KTQA 4DTPA 3QNOA 3C6UA 2PI4A 5HNKA 1X2IA 5C25A 3PX0A 2BQUA 3QEXA 4FJ9A 2HHUA 4HCCA 2DPJA 1L3UA 2BHNA 4AH9A 1KFDA 1IM4A 4IRDA 4DSEA 4YVZA 2J6TA 3ORYA 4DF4A 2BANA 2P51A 1X9WA 5KG3A 4BDPA 3TANA 1DLOA 4FLXA 4M9LA 4FJ7A 5HHHA 4O3RA 1YTUA 4DL3A 1C1BA 4CGFA 3OYFA 4KLQA 3Q8PB 1VSJA 2PYJA 4KHUA 4KLSA 4KI4A 2PFPA 3NGIA 3L8BA 1IO2A 2ZJAA 1D9FA 4CEDA 3CYMA 4CGHA 4F5OA 3RAQA 4GLXA 1BL3A 1RBUA 3KJVA 5L1IA 3NGYA 5DG9A 1NKCA 4CEAA 1EKEA 3KLGA 3L2WA 3JPSA 1TKTA 5J0QA 2FPKA 1UOCA 1PZNA 3V1QA 1KEJA 4PGQA 2VA2A 4C8OA 3V1RA 5KFYA 3AV9A 3HPGA 4CESA 1N5YA 3OYGA 4CJTA 4CJSA 5D46A 8ICZA 3HP6A 4CHPA 7ICHA 2D5RA 5KFPA 1CXQA 1BQNA 1MU2A 4Z4HA 4FW2A 4Q0BA 3C2LA 3OYNA 4KKOA 1ASVA 1QE1A 8ICEA 4NCGA 4ECQA 3JPNA 1N56A 9ICTA 4QW8A 4B9SA 3PX4A 4KTZA 4DQPA 5IINA 1SUQA 2HHVA 1D5AA 4MEXA 1RPLA 9ICGA 3DRSA 4KLGA 1NKBA 3JYTA 3ISNC 3K5LA 5J2BA 1BPYA 3OYAA 3QZ8A 3QIPA 4YMOA 5D49A 1XU4A 1HPZA 5KFAA 4R8UA 5KFLA 3ZDCA 3RAXA 4CIGA 4RNNA 3VQ7A 3H8WA 4M9JA 3TARA 3ZSOA 4OKJA 4QZFA 1S9FA 4TQRA 4KB1A 1HQUA 1SL0A 3OYJA 3PMLA 5J29A 1MQ2A 3VQAA 2VA3A 3C2MA 2IHNA 2G8WA 3QESA 4CHZA 4Z6FA 7ICJA 2NRZA 3CQ8A 1BIUA 2XHBA 4QCLA 5DLGA 3JPOA 3B6OA 5HP1A 4P4MA 4KI6A 4RQ6A 5CZ2A 1QHTA 1EETA 1XWLA 1BCMA 4RQ4A 4FJIA 1T4GA 3AVIA 3MAQA 1TVAA 1NJYA 4HYKA 3T5LA 3FDSA 1H38A 5J0WA 4KHWA 4ED1A 3RH4A 3SUNA 4RUAA 4FJJA 3TAQA 1HUOA 2VG5A 5DGAA 2AGPA 3PR4A 4I2HA 5BOLA 4DWIA 4H4MA 3ZSXA 3JPRA 3C2KA 2HHQA 2C2RA 2XRIA 3UXPA 3AVGA 2MAXA 5CZ1A 5L9XA 3V9XA 2A1RA 3HXMA 3LWLA 3RB4A 4I28A 1JLFA 4BWMA 2HB5A 4AILC 8ICGA 4CEQA 2HNDA 3KK2A 2Y1JA 4DQRA 4FBTA 3IRXA 4B3OA 5CA7A 2KQ2A 3AVJA 3U6FA 2BE2A 2E4LA 2ASJA 4I2JA 2DTUA 1MSWD 3S3OA 4I9QA 2XY5A 5DK5A 4EP4A 5TZVA 2J6SA 4O5BA 4YN4A 3LANA 3LZJA 9ICOA 2RDJA 5KGXA 4FM2A 4LH4A 3WNHA 2ZUBA 4NLGA 4CFAA 4N41A 9ICVA 4CEOA 7ICVA 3C1YA 1TVRA 1IKXA 2G8UA 2JLEA 1T3NA 3IHQB 4EYIB 4JV0A 4ECTA 3DLRA 5BOMA 4NYFA 4F4ZA 3L2QA 3PVXA 3NDKA 3SNNA 4F91B 5DG7A 2FLNA 3RWUA 2JZBB 3GFKB 1JL1A 2VA8A 5HMLA 4CGGA 2YHBA 4CHQA 1NK7A 1HYSA 2HMIA 3AA3A 4ZHRA 2PY5A 4I29A 3PW4A 3MDAA 2R8IA 4X5VA 1UT8A 2F1IA 4Z6EA 3RRGA 4RW9A 5HP4A 4B9NA 4K4IA 4CF0A 4CECA 1NJWA 3NAEA 3DM2A 4W5NA 1C1CA 4RW4A 3MFIA 3ZT0A 3G6YA 1VSIA 3G6XA 2X78A 1JXEA 4B9TA 4XA5A 2W42A 4JWMA 4IBNA 4J9NA 3ZSRA 1LW2A 3NF9A 3HVTA 3AU6A 4CGDA 4KMUA 3VQPA 3F9KA 4FLTA 4RQ7A 4F4XA 2B4JA 3OSNA 2PZSA 2IS3A 3ZD9A 4GC7A 4NLKA 4B8CA 4M3UA 2ATLA 2C2EA 4F92B 4IRKA 4RPZA 2F96A 2YKNA 2ZUDA 1KVAA 4O3QA 5KRSA 1RDBA 4F3OA 2GV9A 4RT2A 1RDCA 9ICHA 3TQ1A 3ETLA 4OLBA 1VK0A 2ZJ8A 4RQ8A 3C6TA 4AHSA 3ALYA 2ETJA 4M9GA 1IG9A 8ICSA 4PA1A 3QO9A 5HRNA 1VRUA 3H8JA 3ZDDA 2IGIA 4LZDA 4CHYA 1I3AA 4I2BA 1J53A 5DMRA 3BQ2A 1RBSA 3K5MA 4KLMA 4MFFA 4NM2A 4E7IA 1HJRA 3QEWA 1S5JA 1XC9A 5F9LA 4CF8A 3ZSYA 3LDSA 4NCBA 2YNHA 1SL2A 3AVFA 1WSGA 5F9NA 5KFMA 1RNHA 4QAGA 3PY8A 1BISA 1KDHA 4R65A 1T03A 3OSPA 4O0JA 4MFAA 3KHLA 3TWHA 3VN5A 1L3SA 1IXRA 3LPUA 1IKVA 1TK0A 4XUSA 3OYCA 4ED0A 1S9EA 4KHYA 4DS4A 1TK8A 3KIOA 4FXDA 8ICVA 1XS9D 3VQ5A 4BE0A 1HNIA 3HSTB 2JEGA 3ITHA 4TUQA 2HVIA 3RB0A 5EWGA 4M2YA 3PW5A 5SWMA 3KLHA 3TAFA 3L2VA 3IM1A 7ICTA 2VWJA 5HLFA 4CF2A 2BQRA 1GOAA 2LSNA 4ED3A 5J2IA 2D0CA 4I7FA 1DTTA 4ED6A 1NJZA 2BDPA 1KCFA 4KLTA 4J9MA 1T7PA 4JS5A 3L2UA 1ZBLA 1ASUA 4G1QA 5D3GA 4DSLA 1TGOA 3AO2A 4YMMA 2G8IA 1LV5A 3GDXA 4EZ9A 7ICPA 2PXIA 1ZQCA 3VA0A 1UA0A 4CJWA 4KLFA 3TAMA 4MEYA 1ZQHA 2PYLA 3DI6A 4RQ3A 3UIQA 5C42A 4FLVA 4CJ5A 3ZSVA 3K4GA 4ED7A 4H4OA 5KG7A 1L3TA 3NF8A 4E7LA 5CB1A 2R8HA 5KT3A 3V7JA 1REVA 3SYZA 3RH6A 4FJXA 3HVRA 1ZETA 3I0SA 1S0VA 2NRXA 4ICLA 4OVLA 4KREA 1Y97A 2UVVA 3PNCA 3MXIA 4I2CA 8ICYA 2HHTA 1BIZA 2KN7A 1U45A 1U9LA 4DTSA 2FBTA 4KLEA 2P6UA 7ICOA 4XIUA 2RKIA 3MFHA 2ZTDA 3GV5B 5KG6A 2OPPA 3UQ0A 2R8GA 4Q44A 1HYZA 4J9RA 4MQ3A 4YFKA 4DOCA 1DGSA 3V7KA 3VQ6A 3RJFA 1LWFA 3MBYA 4MF2A 5EOZA 3LP2A 4OPJA 4K4GA 1ZQFA 1NK4A 3B6PA 4Z6DA 2H5XA 5J2CA 2O4IA 4KLJA 5DDYA 3QEBZ 1Q9YA 4Y1DA 4DTUA 2KZZA 1ZJMA 1ZJNA 1C0UA 4CJEA 3MEEA 2Q3SA 1LWCA 4I2DA 1C0MA 5EWFA 4N76A 5J0UA 1JLCA 7ICNA 4UQGA 1ZQEA 1O1WA 3O3HA 4PQUA 9ICNA 2B5JA 1NK6A 5J2NA 3PV8A 1ZQOA 4FJMA 2QKBA 8ICCA 2F8SA 2OYQA 2HHXA 4YR0A 3MABA 4UBCA 1ZQUA 3MECA 4Q43A 3RJGA 4ZTJA 3QETA 9ICJA 7ICQA 5DDMA 4F4WA 4DU1A 2RDIA 4DL7A 1TKZA 3CFPA 2A1JB 4LSNA 3WNGA 1U04A 2FLPA 4I9LA 3QEAZ 5DB8A 4DSKA 3MGIA 4DQSA 4QWAA 2D0BA 4YMNA 1WSFA 5CHGA 1WSEA 9ICXA 3ASMA 3MR2A 2FPLA 2JZBA 1X9MA 4EZ6A 4EP5A 3SQ2A 2M9NA 2RN2A 3KK3A 1RXWA 3ZT3A 4ED8A 2E6LA 1F21A 4YD1A 4KV8A 5KFFA 4RQ1A 2IHMA 3TABA 7ICKA 2UVUA 2R8JA 3KLFA 2AGOA 5HHIA 5KFTA 3TI0A 4PHDA 4IFVA 2C28A 7ICLA 4CGIA 4FJ8A 8ICUA 2ASDA 2V4QA 4TUPA 2AJQA 1WCLA 1FKPA 5FRMA 3QNNA 1S0OA 2KZMA 2AGQA 5KRTA 1NK0A 1RBVA 4F3TA 2P66A 4Z6CA 4LY7A 3KKSA 2W9CB 3SJJA 3UXOA 4QZCA 3EWAA 1S76D 5DBCA 1BPBA 1TV9A 3NCIA 4J2DA 3PW0A 4ED2A 4FYDA 4GVMA 3OY9A 3I8DA 4C8NA 3SV4A 5IIIA 3OYBA 1ZBFA 3UXNA 1HRHA 1JIHA 4UAYA 5DLFA 3QZ7A 4K4HA 4ID5A 4CF9A 3C94A 4E19A 4F2RA 4M04A 2WTFA 1QQCA 5J0TA 4RU9A 5JUMA 1HQEA 1KLNA 1RDAA 1N6QA 1JMSA 3HP9A 4E7JA 4O3SA 1CZBA 5KTQA 3I0RA 9ICIA 4PGYA 1EXQA 3SUPA 2BPGA 2YKMA 5SZTA 2IA6A 1U49A 4EYHB 5J2DA 4J2AA 4M3ZA 4Q8EA 4JK1A 4DSJA 5HRPA 3U3YA 4YCXA 4YR3A 4UB3A 1RTIA 3KK1A 2P6RA 4EBCA 5DG8A 1BPXA 1KSPA 4DFKA 3OYDA 4HCBA 3PMNA 2JEFA 4I2IA 4K8ZA 3QE9Y 1L3VA 4DU3A 1VSLA 1KFSA 4FLYA 2Z1IA 2VG7A 4CFCA 1K6YA 5EU7A 4DTNA 1G15A 4E1NA 3SQ1A 2BCSA 4KLIA 4RNMA 3K57A 4RQ2A 3HPHA 3HPOA 4E0DA 4H8KA 5J0XA 3L2RA 3OHAA 1B9FA 3AA5X 3VQ8A 1ZQBA 4YFUA 1SKRA 2XY8A 5J2HA 1LB2B 4OLAA 1BPEA 4QZIA 1U47A 2LYHA 4CF1A 3EPIA 4RUCA 4OKEA 4CJPA 1ZQXA 3MEDA 4YNQA 4RPXA 4BDYA 4KB0A 3F73A 1EP4A 1VSDA 4O5EA 3ZDBA 4DU4A 4FK0A 3BGRA 4IQVA 1JLEA 2VWKA 1YTAA 4O55A 2IBKA 3AO5A 4M3XA 5KFVA 4C8LA 4AHRA 1QSSA 3HT3A 4J9SA 4JS4A 1WN7A 1RILA 5HBMA 4CJ3A 4DMNA 4DFPA 4G3IA 4OJRA 5KFDA 3PO4A 1ZQNA 3IS9A 1ZBUA 3DMJA 1BPZA 4R66A 4CHOA 4FLZA 1JKHA 1RT3A 2XO7A 2BGWA 3KLEA 4Q5VA 2XGPA 1JLBA 1RT5A 1XI1A 4ELUA 3FYHA 3O4QA 8ICPA 3AO1A 4EEYA 1Z00A 2OPSA 2X74A 3CG7A 3DOLA 1S1WA 2FMPA 1RT2A 3DLHA 4RG8A 2EHGA 8ICIA 4YXMA 4KTWA 2IDOA 2ISPA 3CM6A 1LAWA 3RMDA 3O4NA 4KLHA 5DBAA 4F5NA 4ECZA 1LAVA 2FMQA 2BCRA 2P5OA 4KPYA 3OYMA 1VRTA 3KHRA 4KAZA 5HRSA 3MXJA 5BPCA 1BHLA 5CY4A 3OVNA 3H08A 2BPCA 5DQHA 4O5CA 5C5JA 2W9BB 4ECSA 1GOBA 2HHSA 3GILA 2ZUCA 4OKKA 2NRWA 3LP3A 1T05A 4M6WA 3V1OA 3T19A 8ICKA 3TAEA 4TQSA 3VQEA 1D9DA 5KI6A 2G8FA 3D0PA 3ZDAA 8ICAA 1NOYA 1S1TA 3OYKA 3QEVA 3SQ0A 3GV8B 4DQQA 2ZTCA 1J54A 2YNGA 4C8MA 2KFZA 1U48A 5I3UA 5KFXA 3LPTA 4NXZA 3NH1A 2Q0ZX 3RJKA 4DFMA 7ICMA 2R7YA 1TKXA 3V9ZA 1RBRA 4M3RA 3OHBA 4PHEA 1AROP 2KW4A 2P5GA 4NCAA 4B9MA 1TL3A 4KO0A 4DTXA 2FBXA 5KFIA 1QSYA 3JSMA 3KKRA 2A1JA 4QZ8A 4ID1A 4KLLA 3S3NA 9ICLA 3V81A 4HVJA 5DB6A 3IAYA 3SI8A 4CJFA 7ICEA 3KD5E 4QWCA 4BE1A 4DTJA 2OA8A 4O9MA 4DG1A 4KLUA 3NHGA 5KT2A 1ZQIA 2FPMA 2ASLA 2EX3A 3MR3A 3O3FA 4I27A 3EPGA 3RMAA 2F8TA 1GOCA 4M3WA 4FM1A 4UBBA 2BPFA 4R5PA 1S97A 5J0OA 1ZQTA 5HMMA 1WSHA 4KFBA 3AO3A 3AVLA 4AHVA 3H40A 2V9WA 3M8SA 4GXJA 4FZZA 4W5OA 1ZQSA 3UQ2A 4QZDA 5KFBA 3T5KA 1K1SA 5T7BA 2B6AA 1T8EA 9ICEA 1QS4A 4DL4A 3LAKA 1FK9A 3KLIA 4XQ8A 4FVMA 3G10A 4DQIA 3HJFA 2OZMA 3RBEA 4QWDA 2W9CA 4JRPA 4QWEA 4PUOA 5L1JA 4OGCA 4QZ9A 1C6VA 2V4RA 4O5KA 3CFOA 1SL1A 3KHHA 5KFHA 3RB6A 9ICWA 4UB4A 1BCOA 1RYRA 3OS0A 4F8RA 3QEPA 4HTUA 4M47A 5KFGA 1Q8IA 3K58A 4IG3A 3V9UA 4PHPA 7ICUA 9ICMA 1MQ3A 4FJ5A 3L3VA 4NY8A 4KRFA 5KFQA 3TAGA 4CERA 1BI4B 1CZ9A 3ZSZA 1S0MA 2FBYA 4HUEA 1L5UA 3Q8KA 5CYQA 4BGDA 3Q8LA 3RJJA 3NGZA 4AHCA 4ELVA 2NRVA 2WOMA 7ICIA 1RXVA 3ISCA 3C23A 1JLQA 3M8QA 4IG0A 3T5JA 4NYNA 1NK5A 5DB7A 8ICNA 3V6HA 4FJHA 1N48A 4M45A 4GMJB 2HW3A 4FJLA 1FXXA 1Z00B 4C8KA 3TFSA 5FRNA 3SUOA 3A2FA 1ZQKA 2OZSA 2B21A 3H7IA 3DLEA 2DY4A 4MF8A 4I2FA 3SPZA 3AA4A 4DTRA 5KFKA 4DTMA 8ICLA 4CJLA 1R0AA 5HRRA 1S10A 1RYSA 1ZQRA 5J0SA 2XCPA 3M8PA 1CLQA 3K5NA 4JUZA 3KHGA 4FS2A 2ZD1A 5KFEA 4W5RA 4QZAA 1RT1A 3ZT4A 1WSIA 1CUKA 5D4BA 4DFJA
chains in the Genus database with same CATH superfamily
1H3DA 4ZN3A 4M95A 4DL2A 4BVPA 2X1FA 1VQ9N 2ILYA 1KR4A 5L1MA 4M6WB 1QLNA 1J27A 1S7HA 4CK1A 1VSHA 2W41A 1YJTA 3TX8A 5GTHU 2HYIB 2QL7B 2KVQE 3IR5B 4Z7YA 1XMQK 2VG6B 3AVKA 3KFUF 1CS4A 8ICTA 4H4KA 3R27A 3OL7A 3FJ2A 5L38A 1VQ8S 2XQCA 1D8LA 2DYAA 4LFCJ 9ICBA 4KHQA 5AHXA 4JI2J 1FD2A 4DB3A 4E7KA 1N54B 3THVA 4M42A 2RU3A 3W63A 2IYIA 3DRRA 2HMXA 1JLAB 4DV2F 2ITGA 4CJQA 1Z25A 1D1UA 1EKSA 2FUG9 2P9KB 1K73T 2E9ZA 1UWBA 4U8VA 2NZ4A 1ZD2P 2CWKA 3CM5A 3G4SS 1GLEG 2CKWA 5J2QA 4QWBA 3EZ5A 2COLA 1VBZA 1HBUA 1I94K 4I2GA 4WFXA 4FLUA 3CJ2A 4LF5J 3C1ZA 4PQAA 1QUPA 1S6QA 2HDOA 1WC6A 2CQ0A 3ZEUB 3AVMA 2MY8A 2VGMA 3C28A 1HI0P 4E1MA 3G25A 1VHFA 5GVQA 2ZJPL 5FDLB 4QU6A 4FS1A 4JKFA 4Y1CA 3M6XA 1WNSA 3OJSA 3SEIA 4ZVTB 2O4GA 1CJTB 1XO1A 3O3GA 4NRTA 3IG1A 3JXOA 2PA8D 1YBAA 4YQWA 3TWZA 2A18A 4IFEA 4PYAA 2DFFA 3C65A 3EGNA 1RDDA 1M1GA 2EDUA 5J0PA 8ICXA 2I2YA 3QYPA 1V9PA 3KZIU 1RJJA 3NP5A 4FZYA 4D3HA 3ID6A 4P4PA 4AM7A 2KKPA 2Z1GA 3TO8A 2H3ZA 2YV0X 4ISGA 2AP6A 3N28A 1C0TA 4KLOA 1RTHB 2G06A 2IJNA 5M2RA 1HNVA 1KVBA 4IRCA 3M2VB 3Q7CA 5HR6A 3IC1A 2OMOA 4JI7J 2YHXA 1SQEA 3OR2A 1YIJN 3ZT2A 4O44A 4F9OA 9ICKA 3N97B 4LFCK 2RS2A 2F9JA 1OVYA 2N7YA 3RMBA 5L1KA 1UQVA 5JLHA 2HOIA 4JI2K 3IWLA 4NYOA 3O08A 5E41A 2A5XA 5AQWA 3T6JA 4UOCA 2DNPA 1KW4A 2DFLA 1P27B 2HURA 5L46A 1UJ4A 2YWWA 2D1CA 4DTOA 1GLAG 2LI6A 1XO0A 3TP2A 2N4DA 4LZGA 3C95A 4CK2A 4WFAL 5KG2A 1RWXB 1T94A 3RFAA 2POKA 3MUMP 2W8KA 2WF8A 5JS1A 3TA0A 3NTUA 1OUQA 4CW7B 1VQKN 4DS5A 1FRJA 1RQ0A 3F44A 2ZJ5A 1KP6A 2ZWOA 3KUEA 1A5WA 3K59A 3OYIA 2GUPA 5BR8J 5LMNJ 5C0YA 1H73A 2ZH8A 4LF5K 1NAQA 4OJ3A 1BQMB 2YNFA 3WIVA 4QPTA 5HR7A 3QLHA 1FRMA 1K9MT 4UATA 2O8CA 5D0GA 4FWMA 4QW9A 1PJ7A 3ZD8A 2CQDA 2R7QA 2HS4A 1LKYA 3KNGA 1EXNA 4OJ6A 3CC7N 3NS7B 3P83D 1FO4A 3GIIA 4CZLA 3R1HA 2GTDA 4BRAA 2V4JB 2Y1LB 2JH7A 2B9EA 2G8VA 2FJ6A 1RDUA 2ALZA 4ECUA 4X65K 4OJ1A 1BHNA 2HNYB 5CA5A 4JI6F 4YY3F 3EKUA 1KAZA 1NCLA 5IIJA 1L7PA 3M9MB 2E1EA 2W4CA 4KJIA 1SZPA 5IWAF 7ICSA 2MMYA 3CJRA 3W7BA 2QB1A 5ALLA 4Y2UA 1GK8A 2LKYA 2CH5A 4YB6A 3BZCA 2RMLA 1YQHA 3BGFA 5DM7L 1NDPA 4JI7K 4I68A 3DGPA 4PHAA 1Z2LA 3CMAS 3PX6A 1UA1A 3TUPA 3RYLA 2Z1JA 2HNZB 2CNKB 4FK2A 1Y0HA 1F2GA 2EZZA 4OX6A 3QRQA 5H1SQ 3NOGA 3CSKA 2RAQA 4K8XA 4KBOA 4CJVA 2A3JA 5C25B 1X6IA 1OY8A 2FY8A 4DV7J 1FJGF 2Y3YA 3UB5A 3LGMA 4ICAA 2DR7A 2QARB 1S4EA 1YRXA 3OTEA 2R7WA 4DXLA 4U7UK 2Q2RA 3JSYA 2PKEA 4URQU 4LR8A 1DLOB 1D09B 3BSNA 1C1BB 4NPOA 4DV4F 2UP1A 3OGUA 5KAKA 2E2PA 2KSOA 2VBWA 3SMVA 3QBXA 5BR8K 1S1VA 3WHIA 4R64A 1XERA 5LMNK 3O0FA 3CC2S 1HNZF 2V94A 2MKKA 2GAGC 3VENA 4H0PA 4IQMA 2WF7A 2W9MA 1R27B 3RUBL 2F9WA 1QQ5A 4OZJA 1X40A 4CFDA 1VQNS 3FFIB 3TSUA 2J6UA 1VQ6N 2J0QD 2PI5A 5DQGA 1TUVA 5G4DA 1H98A 2WONA 1FVSA 3HT0A 4NI2B 4PRFA 1IJEB 2M2BA 1NGFA 2N3LA 4NX9A 3R5JB 4LF4F 5J2PA 4J9QA 1ZAWA 3V4IA 2CPRA 1X0PA 1QM9A 5J2FA 1WAJA 4ILMA 3BF1A 1LK7A 4MFCA 3PW2A 5F3TA 3R9PA 4OFZA 3NGUA 4YG2A 1KQQA 4E3SA 2I5HA 5D4NA 2F4VF 3H42A 1XNQK 4KN4A 3GV7B 2W3SA 2J9DE 3OTCA 4KGKA 1OH6A 2J7UA 3HWTA 5CWRA 1U2VB 1FXRA 1JXBA 4N56A 1CBKA 1P8ZA 3MX5A 3JYTB 4E1JA 2BKEA 2YN4A 1KFTA 2Y1RI 2P9PB 3MN5A 3NE6A 2HQDA 3N0VA 2A19A 1BWVA 3ENBA 4FLWA 5C24A 5EE0A 1R6VA 2DIUA 4CK3A 3O6WA 4BXOB 2XULA 4YOWA 2N7CA 4OX7A 1MWMA 4DV7K 2JGUA 2MUTA 3H5UA 1ZPWX 5LL6Z 4XPCA 4ZVSB 1FI4A 1U1OA 5J1NA 1COKA 2PFNA 2K06A 3M6KA 3AQPA 3U27A 2YTUA 2IBOA 3IR6B 4P2HA 4OYAA 2V69A 4BC5A 4RPYA 1RCHA 4GC6A 1VGYA 1ZYQA 4ZVQB 3VQSA 1NB7A 5ETQA 2RS8A 3Q8RB 1EETB 1WTFA 2LDIA 2N3OA 4A8KA 1YJNS 4IO1A 3IRWP 2IOFA 1KD1T 3BPSP 3EZOA 4DCHA 1Q3VA 2ZQBA 4C0BA 1ASWA 1YVFA 3QFUA 1RCOB 1N61A 1Y5NB 3HO1A 3D45A 4GXIA 4B3TF 5AK3A 1TQLA 2XC9A 1VSEA 4A4JA 4C4WA 2YWFA 3M6ZA 2IDLA 1KHVA 2SXLA 3RG6A 3M6UA 5HI7A 4WP8A 3EW9A 4Z4IA 1F5SA 1SQKA 4ZJOA 3KUHA 1QAXA 5DM6Q 1KC8O 5LOQA 3V72A 4ECVA 4CYUB 8AT1B 2YWEA 4QIEA 2NYHA 1Q9XA 2KG0A 2ZHAA 4RQNA 1TVRB 1UT5A 4FNIA 1U1LA 1KVCA 3GR0A 3Q2SC 3KWGA 3I31A 2NQPA 4TURA 1V3ZA 1Z19A 4OIXA 2GWSA 2I1QA 5K8OA 3DGVA 4CEZA 4RQ5A 2KT5A 4AD6A 4YOEA 3PW7A 1AZSA 4ES2A 4HHUA 1WC3A 4F71A 3H2UB 4PXEA 2DGZA 8ICWA 5EX5A 1MC8A 1B99A 2G8KA 2Z30B 4USIA 2FC0A 1TAUA 2RUSA 4L3KA 2L3MA 3SDEA 5C12A 3AGRA 4KQZA 7FDRA 3FCWA 1V4SA 3MMCB 4Z4FA 3TFRA 4C98A 2MJNA 3NGTA 4CLSA 2RPIA 5E26A 5HVHA 3A3OB 4WIIA 1Q7YO 2GIQA 1UCVA 3NVWA 3NGDA 3DWLA 1WKKA 3OTOF 1TKDA 5LXRA 1JALA 3R9LA 2D1KA 1HNXF 4TUSA 3AJ2A 5AQIA 2G2YA 1IR0A 3M30B 4I2EA 1QVFR 2OWOA 1DQAA 4O4GA 5K14A 2F76X 3U26A 1J2VA 1QQ7A 2CN1A 4FSVA 1TAMA 4DPWA 3UVJB 2IVFB 4PWDA 5KT4A 3BZQA 2FYXA 2PI4A 4Y2QA 1PIEA 2F8HA 3J81U 2BQUA 3NCQA 2PT0A 1RI7A 3ULHA 1KFDA 3MI7X 3U8XA 5K20B 1IBKF 3I9V9 4DSEA 4YDXA 3MMBA 1ZOLA 3ORYA 4DF4A 2BANA 2MZ1A 4JI4F 2DXDA 1X9WA 3POTA 1S5ZA 3TANA 5HHHA 4DJBA 1T9UA 4FWNA 3OYFA 1P1TA 1WI6A 2PYJA 4ZPAA 1MN7A 4X4QA 1U6BA 3WK7A 3W2WB 4KPCA 3R7NB 1CJVA 2VUGA 4IDHA 3L8BA 4M1KA 2Y0BB 5HMXA 2ZJAA 2LQ8A 3KXDA 4F5OA 4GLXA 5A8WA 1AUDA 1BL3A 2BM0A 1Q7LB 1RBUA 2AYEA 5DG9A 1NKCA 1EKEA 2IVNA 3L2WA 3GFHA 3OTDA 3N6MA 5J0QA 2NSCA 1RGVA 1KEJA 3AV9A 3HPGA 4CESA 4EHUA 1UFKA 1Y9OA 3K8WA 1QQOA 5ADXA 1U8SA 2FC8A 4MIBA 4CJSA 4CF5A 3NMAA 5D46A 8ICZA 4M5JA 3O9UA 2D3ZA 4CHPA 3LDOA 1YGYA 2D4WA 2PE8A 2LDYA 1MU2A 2B56A 3HZGA 3KOOA 4Q0BA 1BXNA 1HBMA 1UJ5A 3NGKA 8ICEA 1WI8A 1S6PB 3WEEA 1YJWN 1Q82O 4OJLA 2YX8A 1N56A 3SAGA 4B9SA 3VETA 3OXGA 2IM3A 5IINA 4NL9C 1SUQA 5FIIA 1D5AA 3CJ9A 3AXMA 2UV8G 2J8AA 1YSJA 3ISNC 3SXLA 3B82A 2IDEA 2DXFA 5J2BA 3OYAA 3PFOA 1NMEB 4DR6F 1TL7A 1UETA 1E6VB 1HPZA 2A6OA 2CDQA 3QUQA 3RAXA 1R59O 1CSJA 4CIGA 4CLFA 3TARA 4OKJA 4FWSA 4WXWA 3BS5B 5E79U 4CWBA 4BRFA 2XM3A 4KB1A 4Y28C 1HQUA 3OYJA 1OH5A 1YBTA 2E2QA 2VA3A 3QESA 4ZS6A 4JD2A 7ICJA 3ONNA 3HD2A 3C19A 3OFFA 2B4VA 5DLGA 3JPOA 5HP1A 4P4MA 4RQ6A 3VAMA 1QHTA 3Q2TC 2Q43A 3CCUS 1BCMA 4RQ4A 3BEGB 1T4GA 3AVIA 5KOWA 3MAQA 3KD3A 1TVAA 1FA0A 4MAKA 4HL9A 5GAEP 3M6VA 4ED1A 1FCAA 3DXKB 5EXWA 4ILHA 4P2FA 5DGAA 2AGPA 2QB0B 4CZJA 3TKAA 3T1HJ 2BKOA 1KQSR 3JPRA 3THYA 2XRIA 3AVGA 1HQ2A 3HXMA 5J2NB 4AILC 4CEQA 2HNDA 3KK2A 2Y1JA 1UVLA 4B3OA 3ATVA 1RT6B 2R18A 1NGBA 2E4LA 2ASJA 2GHVC 3S3OA 3LZJA 4YN4A 1HLWA 9ICOA 4FM2A 4CLYA 2WSCC 4X64K 1Z4UA 4LH4A 2VDHA 4O4RA 2KVCA 3C1YA 1UVNA 4UB8U 3G8TA 1IKXA 5I4MA 2JLEA 2MZSA 2FF3B 4EYIB 5BOMA 4F4ZA 4A5BA 3SNNA 2YWHA 1B4FA 5DG7A 3OW2R 2FLNA 3RWUA 5HMLA 2YHBA 1HYSA 3AA3A 3UN3A 4ZHRA 4KHRA 2R8IA 3I8BA 4LF9J 2HHPA 3N7PD 2YPZA 5HQMA 3O1BA 4ZMMA 4CECA 3KLFB 2LVWA 4ZOSA 1C1CA 1T11A 4IFVB 4RW4A 2AZ1A 3TADA 3QUTA 2QMUB 3KJVB 2V52B 5L39A 1M5KC 1HARA 4NLPA 4B9TA 5ALVA 5A8KA 2W42A 4C1NI 4JWMA 3O9RA 2VICA 2CPYA 3ZSRA 1Z4OA 3LW5C 1LW2A 3HVTA 2I8EA 4KMUA 1Q46A 3VQPA 3F9KA 4FLTA 3SBMA 2E8MA 2NS1B 5AE2A 4B1VA 4NLKA 4GC7A 4FKYA 4UUWA 3S6EA 4IRKA 2C2EA 1HX1A 4ZPCA 2H51B 3I5BA 4JI8J 2HVEA 4J9UE 3ET6A 1RDCA 2WB1F 3T1HK 4DX7A 1NPPA 1N5TA 1UVIA 4YDUA 3C6TA 4RO0A 3ALYA 1GEHA 3I0RB 3G9CA 5LT5A 8ICSA 2GQQA 3H8JA 3ZDDA 2W7PA 1C4CA 3CRXA 2NO4A 2DRDA 5HAOA 4UOGA 4CHYA 4I2BA 1A7GE 1HR0F 2MGZA 4NA3A 1RBSA 1X42A 2J4RA 5A0LA 4MFFA 3SSSA 4E7IA 3QEWA 2XMTA 4CF8A 2J0SD 3ZSYA 2YNHA 1VQOS 3BR9A 2PMZF 3ED5A 4Y2SA 3M05A 4P75A 1RNHA 4QAGA 5AQPA 2V9KA 2ZJPQ 1T03A 4I6AA 2YKOA 3G2XA 3DDKA 2VG7B 5JRTA 1FXLA 1W26A 2AJ2A 2W2PP 4A47A 1NU0A 2V63A 5GAEU 4DU8A 5AM0A 1S9EA 4KHYA 3F53A 4OI0A 4GV6A 1TK8A 8ICVA 1XS9D 1TL4A 1X5PA 1RDWX 4BE0A 1HNIA 3OD2A 3IM9A 3ITHA 3VAFA 4TUQA 4AYBF 2HVIA 4LF9K 3KLHA 5SWMA 4DV0F 4MHVA 2R2UA 2IVYA 3IM1A 4H5NA 1JCGA 3S7RA 4NASA 2JZ5A 1GOAA 2LSNA 5J2IA 3C15A 4I7FA 3M8YA 3LDPA 1S59A 3AA9A 1T7PA 4MK9A 4DSLA 1TGOA 1EP4B 1RXOB 1LV5A 4GRSA 3GDXA 1HWLA 2P9IB 5D77A 4EZ9A 4AM6A 2YQ1A 3GYNA 3VA0A 3DDIA 2G13A 1UA0A 3VF4A 4UARA 4KAIA 4JI5J 4ZJQA 4B3MJ 1HWUA 2W4PA 5C42A 3M6GA 3CMES 2LKZA 3GE1A 4H4OA 5KG7A 1L3TA 2Z56B 2H3QA 2O3DA 3NY0A 2R8HA 4JI8K 1W2IA 3DNCA 6FDRA 2ZBCA 2VC1A 2B7BB 3VC8A 1JLBB 4DDFA 1S0VA 4WFAQ 2NRXA 4OX9F 1WEXA 4QR0A 4OVLA 3M1VA 2UVVA 1CC8A 4M5IA 2ZZMA 1BIZA 3C6AA 1P9QC 3MZIA 2HK3A 3BPDA 1U45A 5A8RB 2DNOA 2W2OP 1RT2B 2Z2ZA 3OR1A 3DXSX 2OYYA 1U1KA 2D8CA 2P6UA 4KLEA 2VYPA 4OI1A 2O8BA 2IOFK 2R2TA 3I4PA 3UQ0A 1X5TA 3GB0A 2ZFHA 1RWMB 3HHLB 1NZBA 4Q44A 4C7ZA 2G08A 4A46A 1VRTB 2F40A 2CGKA 1M5SA 5EOZA 2VBYA 1ZQFA 1NK4A 3R7BB 1UEUA 1WSRA 2KM8C 4KLJA 4DCCA 3UD3P 1YTYA 1L7MA 4B1ZA 2KZZA 1C0UA 2Q3SA 4F72A 4NLVA 4N76A 4DR7J 4FPRA 4OPAA 1JLCA 3Q0AA 1U1QA 1NLVA 9ICNA 4IH7A 1S1TB 2HS0A 4FJMA 2YNGB 3C16A 1U2RA 5AK4A 2HHXA 2Q6CA 3T9NA 2ROEA 1YITN 2O8DA 5GAGI 4ZTJA 3VGUA 3QXGA 5DDMA 4E2FB 3HD1A 2YMLA 2DB1A 5DM7Q 1TKZA 2GQCA 4PZVA 3D7EO 4LSNA 4JI5K 4B3MK 2Z4PA 3QEAZ 3CB4A 4ID8A 1UHUA 2DHHA 2VJUA 2UUCJ 1PO6A 3FC4A 2OELA 5CH7B 4DG1B 9ICXA 1VHIA 4JI0F 4NXMJ 3AHPA 4PWUA 1FFGB 5AICA 4YB1P 3WK5A 2KT3A 2M9NA 5HJYA 2CGLA 2VIHA 1VQ5S 4CLKA 3KK3A 1RXWA 2FDNA 4D3GA 2ZKUA 3SLCA 2VONA 1F21A 4YD1A 3VEWA 4DV3F 3D0IE 4OI6A 4GIBA 2IHMA 3TUJC 4KFBB 3E9PA 4PEOA 1WF0A 5CQGA 3KKFA 4MIAA 5F41A 4CBUA 3H8MA 3NS5A 5HHIA 3PSTA 3NXZA 3R5DA 3JQMA 4CGIA 2ASDA 1IKVB 1B7YB 2J5AA 3M4XA 2AJQA 2M88A 1WCLA 4ZPTR 2V8VA 2GEMA 3I76A 2AGQA 2VBXA 3TA2A 1YVNA 1RBVA 3J81O 2K4PA 2HFVA 2ZH2A 2K1RB 1U26A 3QT5A 3KKSA 2PFFB 3BB5A 3SQGB 2W9CB 4ANEA 3UXOA 2JV3A 4QZCA 3MR7A 1S76D 5DBCA 1BPBA 3PW0A 2ZM6J 5LSOA 2H3EB 3KWMA 4XPEA 2NREA 2MSTA 2ZDPA 4KGVB 2IVPA 3HSGA 5IIIA 1RHKB 3IO1A 2HRTA 3PACA 3QYYA 4UAYA 3QZ7A 5THWA 5AQOA 3NCRA 4WJBA 4DR7K 2LXFA 4E19A 4CM0A 1QQCA 2WTFA 3JSRA 1WUDA 5J0TA 4RU9A 2MQNA 5B08A 2ZOFA 1Q95G 5HVGA 4RWXA 2BPGA 2YKMA 5SZTA 1N62A 5J2DA 4NLRA 4YOUA 4Q8EA 2OO4A 4WZMA 2OJ3A 4GO5X 3J7Z5 3K5PA 2M8DB 3RZAA 4YR3A 3RSEA 1RTIA 1G99A 1BPXA 3Q8YA 2VPWB 5IT0A 1F60B 1L3VA 4DR4J 2P9SA 2XTJP 3SFGA 1W97L 2W7AA 4BRPA 2M0NA 4CD1A 1M5HA 1WKJA 2CZ9A 1IV8A 3CDBA 2UUCK 5EU7A 4BC4A 4RBTA 1GMWD 2F9DA 2W7OA 4NXMK 1EWQA 5B0EA 5CXTA 1LVHA 5D4PA 3K0SA 3GZFA 4RQ2A 3UCUP 1UCNA 3HPHA 1Y5LB 3NOCA 3HPOA 4H8KA 5J0XA 3L2RA 4ZIVA 3KVGA 2LYHA 3FZ2A 1VS3A 4LRAA 2CVIA 3GCWP 2VQEJ 2H3FA 2EAMA 4FXVA 1ZQXA 3MEDA 3H3OB 4BBYA 3UKUA 1IR2A 1R43A 3KK7A 3Q24A 1JLEA 2WB4A 5SUHA 1JUDA 2DJWA 4ITSA 1AFJA 4C8LA 3BSAA 3VGTA 4DR1J 4PQUB 2H5EA 4Y2KA 4NZ0A 4JS4A 1RILA 2ZM6K 4KR0B 4K42A 4DFPA 1VFJA 5HMZA 4P74A 4EAHD 2LBOA 1CS4B 2BACA 3PO4A 1VLOA 4RWWA 1QH9A 1R8AA 1FRXA 4ZP8A 3DMJA 2PN6A 1Q78A 4PG8A 3VTIA 4DV6F 3ETMA 4FLZA 2CPJA 3OTQA 3VGMA 2XO6A 3QU5A 1QTNB 4MIWA 3HOSA 1SQGA 3QGGA 2CG8A 5JICA 2OPSA 3CG7A 3M1YA 5F0XA 3DRRB 5T14A 4TU8A 1H72C 3DLHA 5BPLA 2OEKA 3F56A 2HAFA 3OLBA 1BU6O 4F36A 4KTWA 2IDOA 3J80Y 3OBWA 1LXJA 3VF2A 1SJFA 1SVDA 4DV1F 1UWBB 3A5OC 3EM1A 5DBAA 3D2EA 1WC5A 2FMQA 5EE3A 4KPYA 2HGNA 3W2VA 1RFQA 5J1PA 5AM2A 4DR4K 1CC7A 4KAZA 3MXJA 1XK8A 1HBUB 3U1MA 1YJ9S 1WSVA 3PNIA 3OVNA 3D6HB 2W6KA 1IBLF 1S6QB 4I64A 4O5CA 3N4WA 3A0BU 2GAHC 1T05A 1KVKA 4M6WA 5AXNA 2D69A 4TLRA 3LUYA 5I3PA 3VQEA 3IG1B 4NXNF 5KI6A 3D0PA 8ICAA 2ZNZA 4GKKF 3QEVA 3SQ0A 1I51B 3W5ZA 3TTFA 4KB7A 5I3UA 2RHQB 5KFXA 4NXZA 4O23A 2VQEK 3VMFB 1OIAA 7ICMA 5IC6B 1AFIA 3CW2C 4OJHA 5KOXA 4X84A 2G5IB 4X4TA 1K0VA 1VQPN 5GTIU 3F5EA 1KVJA 1TL3A 4KO0A 4DTXA 1QSYA 4QZ8A 4DR1K 1C0TB 3S3NA 4HVJA 1XR7A 1HNVB 4XTTA 3KHYA 2WF5A 4CJFA 1N5QA 4G9BA 4ILRA 1IG8A 5DZ6A 4O9MA 4XH1A 3NHGA 5D0EA 3OR2B 1ZQIA 1NI3A 2QJ3A 4CO0A 4O44B 3MC1A 1F9HA 4U96A 3FSIA 3RMAA 4BRMA 1FWLA 2F8TA 4I67A 1PC5A 1S57A 3JAMU 4C4RA 4UBBA 3B9JA 3FC9A 4Z7CA 3J80U 3AVLA 3ZNUA 4AHVA 3ENQA 5ALTA 2J7KA 1FESA 4GXJA 4LF1A 4K4VA 4W5OA 3UQ2A 2GHWA 3EDRB 2DD8S 1N5VA 3EJMA 2B6AA 1VJ5A 1NGDA 1YKWA 2E29A 9ICEA 1AXQA 4XQ8A 1P7DA 4DQIA 3HJFA 1E4FT 5CD4H 5E3RA 4QWDA 2DHXA 1QQNA 2A6AA 3EGWB 3HI0A 5AQGA 5LJ3Y 4QZ9A 2E5LJ 1SL1A 3H20A 2ZIWA 3AD7C 5KFHA 4YUDA 3G87A 3QLHB 2JVRA 1WWUA 3CD6N 2Q4TA 1XMQF 4OJ5A 2O8CB 1X4BA 1BCOA 3MGJA 1RYRA 2DH8A 3NVMA 3QEPA 2JWLA 2GW8A 1Q8IA 4ZVFA 3V9UA 1X5OA 1KTVA 2BEFA 4FJ5A 1VC0A 3D3CJ 4NYPA 1LKYB 1EWRA 2AX0A 2D6FC 3ZX2A 2VC0A 3IGNA 2FBYA 2ITMA 1UPMB 4FWOA 3H5SA 1H7WA 4EX6A 7ICIA 2B43A 1RXVA 2HHHJ 3KNAA 3QNWB 1JLQA 5AK6A 3M8QA 1WC0A 2VHGA 3ZXWA 2OEHA 1U6ZA 4PZNA 4K2XA 2AT1B 3L95X 4M45A 2JC0A 1NDKA 4WYLA 1NMNA 1Z00B 4ED5A 3A2FA 4H0YB 2H4WB 3AJ1A 4FVUA 1MN8A 3DGPB 3SPZA 1I94F 1NM1A 3TZXA 3AA4A 5KFKA 4DTMA 1R0AA 1FRIA 3ILJA 2V2ZA 3CCQS 4QZVB 3VGKA 1U8WA 5AQRA 1UFLA 4I6YA 5RUBA 2RQ4A 3FSYA 5G5HA 2VU5A 2ZH9A 2GA7A 4IOBA 3DOMB 2HQIA 2QTDA 4DFJA 1HKCA 2G0AA 3GIKA 3CULA 1PYOB 1BVSA 2KSOB 2DEJA 2O66A 5ETSA 1XSNA 3N5FA 3PRDA 4CNQA 2XGQA 3MMJA 4O3NA 3BQTA 2DVIA 8ICHA 3JSBA 4ERDA 2E5LK 2F2AB 2DKZA 5C7PA 3J7ZO 3FEZA 2F1FA 3HBTA 3BUZB 1YHQN 1ZQWA 3BV8A 5C2CA 4U8YA 2HNYA 4OHWA 1P8GA 3G71N 4GKJJ 3EE8A 2B3TB 4ETZA 1FXDA 3T1YJ 4OYXA 1T9VA 1WSJA 2AEMA 1W2BR 5KG5A 1VQYA 4JB3A 2D3OR 4CO2A 2C2DA 5J2PB 3V4IB 4LFCF 4EHTA 1SQFA 3V81B 5J8YA 4JI2F 2AIRB 1FE0A 5MLCV 4OZLA 4B3TK 2AP1A 3CCEN 2HHHK 4LR9A 2DUYA 3DC2A 4OL8A 2FSJA 3CC4S 4YXJA 4IQWA 2ZOMA 7ICRA 1E6YA 2GZOA 2ZTEA 1RHJB 4ZP9A 2FBVA 2MY7A 4Z37A 4CJ4A 4UW9A 3ENHA 3L4PA 2K2PA 5DQIA 3SPYA 4ZH4A 2W9BA 4NLQA 1HUXA 3W9JA 1WLJA 3F9MA 3MMVA 5KFNA 1S72N 5C24B 4LF5F 2DFHA 5KFUA 2O8FA 4RX6A 1IG6A 1U02A 3GBTA 8ICFA 2DCUB 4LVSA 3AA2A 4CIFA 2P9CA 2MUTB 3BH7B 3QRRA 2DY1A 2Q31A 1OQ6A 1HFEL 1RWPB 1NKEA 3VQTA 3LPYA 3I56S 4DKWA 5J2MA 1TTHB 3LYSA 1IKWA 3D1OA 3FFIA 3GSDA 3W61A 4I2QA 1Z05A 9ATCB 3D6RA 1XN9A 2H1YA 2CH6A 5DRKA 4UB2A 5IM0A 3P4UB 3O1LA 3CT9A 3WK4A 4NO7A 1N5XA 1IKYA 3OT9A 4JI3J 1X4CA 1U0HA 1NO8A 3K0JA 4PY5A 4FJGA 2XMKA 4M5GA 1NSQA 4A48A 2GJ2A 4GKJK 3F2DA 3L4BC 1QY7A 4J9VA 5M2UA 4UAWA 1QAJA 2YJFA 3T1YK 4JI7F 4IR9A 3MN6A 2XLJA 1NOMA 2UV8A 4JP8A 2JWKA 3NH0A 4FZNA 5D78A 5GADI 1WOQA 3BQ0A 2F5GA 2PA3A 2YHWA 1OQ3A 1URRA 4JLHA 2XNQA 1RG6A 3BN4A 3DU6A 3QU2A 1YZ7A 4OI3A 4GY2B 2E7XA 2ZH6A 5JS2A 4ECRA 1WACA 4BXOA 1PILA 3SFUA 3F5AA 3DLBA 5F0UA 5KFZA 3MURP 3G8QA 2KG1A 3O44A 1NK9A 2QEXS 1DKGD 1HD0A 1ZXOA 2YQ3A 1H74A 4LRBA 4JEPA 3AFGA 1PCAA 2GX8A 4IEEA 1J5EJ 3V6KA 5BR8F 2HBLA 4IYQA 1VSMA 3VQBA 1AZSB 1H0HB 2ILZA 2GJFA 1FNOA 1SPBP 2VPYB 1V5VA 5LL6d 4N8NA 1L7OA 5J0YA 3SSQA 3BJYA 3D6FB 3SDEB 4NLBA 2L41A 1X9JA 4PG5A 4JN4A 3H4DA 1NHKL 4MLHA 1BI4A 4HHHA 1OJ4A 3VZHA 3ZZRA 4QZBA 3GCXP 4ISEA 3LDLA 2L5YA 4C48A 4K4TA 2ZE2A 4TYBA 3EO3A 2QMWA 2NPFA 3D2NA 5KFOA 1T6CA 4F5RA 1Y7PA 4K4ZA 4UAZA 4CZCA 2OPQA 2X6NA 1SIZA 4J2EA 2CQ2A 4M0AA 2KZ3A 2F3JA 1S0NA 2CQPA 3LDNA 4O4GB 1U24A 5K14B 5IT9Y 4JI3K 4ENOA 4Q8FA 1J9AA 5I9EB 2KV2A 1A5XA 2BM1A 1M5OC 4LREA 4FPIA 4PWDB 3CQXA 1GTHA 3N7RC 3QINA 1VQSA 3SI6A 4FE3A 1Q4RA 4FZXC 1SV5A 4J03A 2BDUA 1M5VC 3QQCD 5CHIA 2WB1D 3N4PA 2YQ0A 1JL2A 3SUQA 1CRXA 3WUHA 3GIMA 3MMBB 3THPA 3CP8A 1B7FA 2BANB 2NZCA 3DJCA 2ZJRQ 4FDFA 2YI1A 2VJ5A 2C22A 2B9YA 4DV7F 3A5MC 2E8NA 3POTB 1XQSC 5ETTA 3A8JA 4NA1A 1F2HA 3MDCA 3D66A 5ALSA 1ZBHA 4OHYA 4X2BA 9ICPA 4TN2A 1CJVB 2JJ4D 3CJ7A 5F8MA 4N47A 2V0NA 4Y2IA 1S1XB 2LMIA 3MF5A 2DO0A 3G96A 2CQ1A 4ZCIA 4J9LA 5A8WB 1SKUB 1SJ1A 3OJUA 2AJFE 1J5EK 2FF6A 5AI8A 2PMZD 3AY0A 1RAAB 4F4YA 4WE1A 1DTQA 5DJBA 4U95A 4B02A 4O5FA 1NLKL 2GGPA 3HW8A 2OTJS 1W0HA 1ZAVA 3KDNA 2KN4A 2QSWA 3G6EN 1KBUA 3QPIA 4M8LA 5IIMA 4TSXA 1KKHA 4YDDB 2HOEA 2W40A 3Q8QB 4JV2A 1S9GA 3KJNB 3QJLA 4AYBD 1P9YA 2CIMA 5JVGQ 3AVBA 5KFSA 4OZ2A 3B0XA 1MU2B 2E5HA 2DGTA 4RT3A 2FLLA 2A1SA 4IXCA 3R6LB 3EY1A 5HVFA 4Q0BB 3JTPA 1HBMB 1A77A 3QATA 3DLGB 3WEEB 5HMYA 5IS2A 4UY85 1H2TZ 3ZDEA 2DBBA 2PFQA 2IYGA 2W54A 4HT7A 1RBAA 3A5LC 1P6TA 1UL3A 1SUQB 5AXLA 4CEEA 2KT2A 3OYHA 3RBDA 4KN7A 2DPIA 1SKWA 4ZLPA 4U7CA 1KXPA 3TZZA 4HUFA 4CCHA 5DBBA 4OJOA 2EFNA 4NZ7A 1TL7B 4H5RA 2DEIA 1TUGB 2W3RA 2BX6A 2APOA 1K0TA 3SQ4A 4E8UA 2P9NA 4CJRA 1NWKA 2HBJA 1VQ7S 3CIZA 2QLTA 2Q36A 4NZ6A 3QFWA 2IMWP 2DKOB 2WRMA 2HFUA 1GTEA 4YB5A 2F3NA 5IILA 1X66A 1O0PA 1QAYA 4JNEA 4M9NA 4JD2B 1QQMA 1HJPA 1U09A 4OYBA 2AWZA 5F8NA 5LM7E 4QYZJ 5ALJA 3J80O 3MGHA 1RHQB 5HP1B 3O3LA 3AVNA 1RAIB 2V8PA 1FX4A 2K8AA 1U4BA 3QIOA 2IM2A 3K89A 2RNEA 2BJ9A 4K43A 4RQ0A 4Y2YA 4EU0A 1XUPO 3LWMA 4PKHA 5AQVA 3VQ9A 1ZQAA 4QR2A 5E2QA 2B0CA 3UKRB 1Q79A 3MAHA 2VGNA 4JOUA 4HLBA 3THYB 1X5SA 3IM8A 2LEAA 3I55N 2R8KA 3KMQA 3ZZZA 2UXDJ 1S6PA 5AQMA 3TPQA 2HNDB 3KK2B 4WU3A 2OD6A 3KBBA 5AT1B 5L1LA 2R4FA 1NJIO 2DR8A 2F65A 1TL1A 2IMOA 3DRPA 3NRZA 1X1PA 3DDHA 3U1NA 3LQVA 1D8YA 3DLJA 1DQ9A 3RJIA 3K2PA 2G8HA 5I42A 1CJUA 1NHVA 3LM2A 1ZQQA 3G8SA 4FCYA 3P4IA 2R2RA 8ICQA 1IKXB 2F1HA 2XI3A 1Y3KA 3P31A 4CIEA 3PHTA 5M1KA 3E0FA 2KFNA 3D2SA 4IQTA 2JVOA 5BR9A 3ZSWA 1VMBA 1S8OA 4ALZA 3WNFA 4H0XB 1WOPA 4W5TA 1HYSB 3KG1A 4ZHRB 1A6LA 4CI6A 4I2AA 3CJCA 3LK9A 3N4MB 4HUGA 1SH3A 4DL6A 3LM9A 2ATQA 2BCUA 5GMKa 4JK7A 1BG3A 3RR7A 4G65A 3LP1A 5IQQA 4WCEL 4I2PA 2GBZA 1C1CB 5HROA 4RW4B 4FJKA 2Z2YB 4I6MB 4ISFA 2RLTA 4J2BA 4DHYA 2G0CA 2IC3B 2KTQA 5A8KB 1S22A 1Y10A 4QS9A 4QYZK 3UPFA 3NWRA 4MK8A 4L6V3 1PJ5A 1ZQLA 3HVTB 3GIJA 2JOQA 2G0IA 3PDNA 5KGWA 3OPKA 1RT6A 2XBPA 1WAFA 2OFHX 1JJHA 1KLMA 1SS6A 4WQ5C 1ZQJA 4ATNA 3PEHA 4CEBA 3R8EA 3KJQB 1GLFO 1W9HA 3FK4A 3DKDA 1T9YA 1ATSA 1NHUA 3SAFA 2ZUGA 3ET6B 3GIRA 4DF8A 3Q8VA 2PFOA 1R6YA 1VR6A 2BJEA 1G2EA 3ULDA 1NK8A 1NJXA 3M8RA 2JR5A 1KOHA 1ZBSA 3C6TB 3KTQA 3VOVA 3DU5A 2V51B 2UXDK 1V85A 5AM4A 5HNKA 4NLDA 2WAQC 4BRHA 2KG5A 3PX0A 1L3UA 4JI1J 4EWTA 1LWEB 5A0YA 2F63A 2MGZB 2QM1A 1MWQA 3M8WA 1FDDA 2LYAA 3CCQN 5KG3A 3OLAA 1M1KT 5AK5A 4M9LA 1KQGB 2KM8B 2YNHB 3NVZA 4F02A 4OHZA 4KLQA 5BYQA 2OM6A 4MYUA 4KLSA 1T03B 1NU4A 3BBBA 2RB7A 1O03A 4DR3J 2LXIA 1RKJA 4A2BA 4UASA 3KJVA 1S9EB 4OYIA 4CEAA 1T9TA 4LSLB 3KLGA 1HNIB 2GELA 3ITHB 4JKHA 4WFYA 2HQCA 3KZBA 2FPKA 1UOCA 4BR0A 3WK8A 2PGCA 2HI0A 1FHTA 5KQ8A 3AD9C 3FBBA 3OYGA 4CJTA 4I7FB 4QIFA 4OO1J 3DOKB 3AGKA 4OJPA 2D3UA 3OL8A 2XMMA 2JXJA 4F67A 2VPZB 4MLEA 1T9WA 4FW2A 3ATUA 4DPUA 3M7DA 3JPNA 5F8HA 3IV6A 5C42B 4QW8A 4H4OB 5ALMA 4LF6J 4KTZA 1E3MA 4NJ8A 4MEXA 4DV5F 9ICGA 5ALUA 2J8SA 3DRSA 5LJVA 2HSTA 4RUHA 3QZ8A 1C20A 2DHSA 3QIPA 3M1VB 5D49A 3D2QA 2DNMA 5KFAA 5J1EB 1KN5A 4R8UA 1SH0A 1SC1B 4PABA 3L09A 5DM6L 1VDVA 3VQ7A 4M9JA 3C14A 1XMOJ 4QZFA 3OVAA 1WOOA 4JI1K 1UZHA 5EE1A 3OR1B 4K5RA 4TQRA 5AIAA 4RL1A 1GO3F 5J29A 3TOQA 4C2MA 3C2MA 4ZP6A 2G8WA 2B0GA 4Z6FA 1YRTA 3CCMN 3TZYA 4KIAA 4C4TA 4TU7A 2L9NA 1VI7A 1BIUA 5EN1A 4H0OA 4ZKAA 4NLWA 2H54B 2ZIVA 2HKEA 5KAIU 3CCLN 1M0SA 1NJYA 3T5LA 3GSIA 4X4OA 2AV5A 5J0WA 4DR3K 4KGMA 1C0UB 2VG5A 1ZZNA 2XHCA 3CE8A 2KK0A 4QS8A 1WG1A 5ETOA 4USWA 3VPZA 1N36J 1IUJA 1JLCB 4RBUA 3HJEA 3ZSXA 3C2KA 3DHXA 3KFWX 4HR2A 1Q0NA 3V9XA 4UY8O 3RB4A 4I28A 3GE9A 3EDQB 3SENA 4XDDA 3JQKA 4DV6J 4JBCA 2HB5A 3C16B 2KQ2A 2OTLN 4ZCLA 3H1VX 4JKEA 4CZFA 2Y0SC 2BE2A 4KC5A 2O8DB 2B9WA 2OFGX 4UAUA 5TZVA 2V7ZA 2RDJA 1RLDA 2PBDA 5BN8A 3WNHA 4NLGA 1TKZB 4N41A 3ETRA 2RRNA 1FJCA 4ZA1A 4LSNB 2YWKA 1T3NA 3IHQB 1NGJA 3GYXB 1WWHA 2PIIA 3L2QA 3NDKA 1WC4A 2JX2A 4LF6K 1WG5A 2L08A 1TP7A 2OANA 2GX9A 5A6PA 4CGGA 4CHQA 5LSLA 1NK7A 2X1GA 3KK3B 3RVCA 3MDAA 4X5VA 2IRUA 1UT8A 3QT8A 3T79A 3RRGA 4YOXA 1OWXA 4LVNP 3KKAA 4B9NA 4CF0A 4WYBA 5ETPA 4A59A 1XMOK 1VQLN 1HI8A 3NNHA 2FB0A 3CJQA 4LF9F 2MB0B 3CCRN 1UPHA 1CJKA 1HHQA 3VGSA 1JQGA 2W04A 4MK7A 4PKDB 4BR4A 3QSYB 3D1HA 4WJ3B 2X78A 1DT9A 1X6JA 4XA5A 4A61A 3QIDA 1APSA 2YX4A 1PBAA 2P5VA 2AX1A 3L6QA 4L73A 2E7WA 3AU6A 4CGDA 2NCKL 3M7VA 2EQYA 4RQ7A 3FUYA 3K17A 4QIWD 4LF7F 4BC7A 1RU1A 2I1RA 4F4XA 4I1TA 2IS3A 3CERA 3ZD9A 1FTRA 4M3UA 2QN6B 2DNLA 3EZUA 4RPZA 4BREA 2ZUDA 2CQCA 4F3OA 3FEXB 3KWIA 2OHFA 1N4LA 2GV9A 1ZC6A 1N36K 9ICHA 2CPIA 1VK0A 4MTPA 4JI8F 2IHR1 3AAWB 4AHSA 4UF4A 2M52A 4M9GA 4DV6K 5AKIA 2YKMB 2YHYA 2ZHBA 4AP9A 2X1AA 3BKFA 3F41A 5B0DA 5AJ3J 3JTOA 1HBOA 4CF4A 3MCSA 4EELA 2PC6A 3D3BJ 3BQ2A 4K7QA 2DPNA 5DMRA 4KLMA 2LFVA 1VOMA 3J7AP 5CCMA 1HJRA 4RQMA 1TFWA 1BY9A 1XC9A 1UW9A 3RSEB 1RTIB 3VF6A 2GVDA 3LDSA 2FIUA 1VISA 2IRYA 2ADCA 3AVFA 4H5TA 2ACYA 2KHCA 1WSGA 1SH2A 1AQ6A 2P9SB 1BISA 2MLXA 2ABYA 5KAFU 2CQGA 1X3NA 2HQ3A 3KHLA 3TWHA 3F0NA 1Q81O 3H0LB 1IKVA 3MD1A 4XUSA 1T02A 1U1RA 2YWGA 4BX9C 3TU5A 1Q53A 3A8IA 4DS4A 2DGOA 1G4CA 1RWVB 4FL9A 3HSTB 4G6VB 3IWXA 3LH2S 4IH5A 4OV6A 4FZLA 3I82A 3TUIC 2IA0A 3TAFA 1U1NA 3WBZA 2HPUA 3D5MA 3I5CA 4A8OA 3EE9A 2VWJA 2VASA 2XIDA 2BQRA 1ULRA 5FPDA 1WELA 1DTTA 4ED6A 1NJZA 3MEDB 3N6LA 2KP7A 4YB7A 3KKAC 3Q86A 5D3GA 3UKUB 1ZA2B 2AMCB 4U67L 1L8LA 1NSPA 4DL0C 1JLEB 7ICPA 4DQ8A 1ZQCA 3Q83A 3CIPA 5ADZA 4CJWA 5AI0A 3K9KA 4KLFA 3SR6A 4C7QA 5EX0A 4MEYA 3TYTA 4CJ5A 3TTDA 3CHWA 1AA1B 4ED7A 5CYJA 3DMJB 4E7LA 5CB1A 4JI5F 3MM8A 1REVA 4B3MF 2GMJA 2WHOA 4FJXA 4PXBA 1N34F 4B1YB 1ZETA 3NUQA 3I0SA 3U9ZA 2VIXA 4C4SA 4ICLA 1Y97A 3MXIA 2OPSB 4NMLA 2HHTA 2HFNA 3CDEA 4OYPA 4FWLA 3W62A 1HNWF 3E58A 2HLTA 3CCJS 2G1DA 2CQHA 5AJ3K 2EAOA 3WK6A 3T6BA 3MFHA 4PHTX 1RDFA 3IBPA 5C15A 3N79A 2OPPA 2KJ8A 2XEXA 1NZPA 3D2EB 2HMIB 1B0TA 2EXUA 3P5TL 4MQ3A 1NGIA 4YFKA 4CJ7A 1DGSA 3W2VB 3VQ6A 5EHHA 5MLCQ 2UUWA 4OPJA 4Z6DA 1J2NA 3AOCA 5B8HA 1RWOB 2CQ3A 2H5XA 2EKNA 3M1FA 3ZZYA 2ADBA 4Y1DA 3CO0P 4UY8T 4CZKA 2GJIA 1YWXA 1T05B 1LWCA 4I2DA 1C0MA 2H5IB 4M63C 5J0UA 3WQPA 3FVYA 1TUWA 1NG9A 1ZQEA 3P8BB 3GG4A 3O3HA 4PQUA 2QFIA 1NK6A 2DRBA 3FM9A 1OPIA 2U2FA 3R5GA 4DR7F 1ZQOA 3Q8UA 4LMZA 3VEOA 2QKBA 4BRGA 8ICCA 2F8SA 5I3UB 5HSPA 3VEZA 2FVSA 2ZXHA 4ED4A 5AI5A 2AYGA 2M7SA 2HBRB 3QETA 4DHVA 1TL3B 4KO0B 2U1AA 5AKLA 5ETLA 3ENWA 3O1WA 3CFPA 2QWNA 2EI5A 3FNNA 3WNGA 2FLPA 2WBMA 3KDOA 3QO9B 3CJ8A 3QBCA 3P96A 1VQMS 2QA4N 2JZBA 1F3VA 2UUCF 4HT5A 1WKLA 4ED8A 4J90A 4NXMF 1FIQA 1SJRA 4KV8A 2ALYB 4WQ4C 3NG8A 4RQ1A 3CDAA 1UMJA 2UUAJ 3ILOA 3TABA 2MSSA 1CI4A 2UZAA 4C1NK 3P38A 5K5MA 3TI0A 4PHDA 2DNHA 2C28A 7ICLA 3TW0A 4FJ8A 1ZZFA 3SEOA 2P9EA 2B6AB 1SXEA 3LDQA 4FYXB 3FR0A 2YH1A 5FRMA 3I5AA 5GAEI 1S5LU 2BA9A 2KZMA 2WFAA 3ZX3A 1NK0A 2E5IA 4HHJA 3A8KA 4C9DA 2GWJA 3SJJA 3EWAA 3EEQA 3BEXA 1TV9A 2HOQA 1VDHA 2AYBA 4FYDA 4GVMA 3IR7B 5BYRA 3I8DA 2G2OA 1P1LA 3SV4A 4FWQA 1HIWA 1AT1B 1ZBFA 4AL7A 2HWIA 2YJEA 2ZIWB 1IR1A 4U7UD 4ID5A 2ZM6F 1GXUA 1SJQA 5HQLA 4F2RA 4M04A 1RDAA 5JUMA 3PRVA 4OHXA 4MT1A 3WKCA 4ZPWR 1G6BA 3HP9A 3FZHA 1TFYA 1X7VA 4E7JA 4O3SA 4PYDA 5KTQA 1YJUA 4PGYA 1ATRA 2QWQA 3NCPA 3O9QA 1TE2A 2DR5A 1SC4B 2LCWA 1VIOA 2IA6A 4BCAA 1U49A 3DI6B 1Y4ZB 1OY9A 4M3ZA 4URSA 2J0WA 4P7TA 5CZVA 3WU2U 4DSJA 3RJMB 5HRPA 3U3YA 3J7YP 4UB3A 1AYEA 1JLQB 3M8QB 5IV4A 1RBLA 2ZGYA 2JC1A 4EBCA 3OYDA 4AXJA 4DFKA 3AQFA 4DPTA 1BD6A 2WVFA 3HHLD 2QWRA 3QE9Y 3ZZ0A 4DU3A 1VSLA 4AXIA 2FC9A 2DWQA 5IZHA 3UMBA 1K6YA 1X4FA 2QC3A 1L8OA 4DTNA 4DR4F 1U25A 2BRKA 4O8KA 2WVEA 4ZCKA 2HWTA 3SQ1A 2AYMA 1R0AB 2BCSA 1Q5YA 3IRUA 1IBMF 1DY3A 3AA5X 2UUAK 4K5SA 1SKRA 1OSCA 2XY8A 3LP2B 3MCNA 3D6TB 4OLAA 3CTRA 1U47A 1RAJA 3QU4A 1HD1A 3WQUA 3BSCA 4YNQA 1HI1A 4KB0A 3F73A 1VSDA 4O5EA 3ZDBA 4DU4A 3BGRA 2VQEF 2JMGA 3ONQA 3AO5A 1SWWA 1QSSA 1YI2S 4J9SA 2G9OA 1O8BA 3GU0A 3FGUA 2VQFJ 2C42A 3OFGA 3MHYA 3I28A 2XZWA 2KJ9A 4OJRA 4P2MA 2OMLA 3GP9A 1ZQNA 4DR1F 2L9WA 3IS9A 5M1OA 2F7TA 2QL9B 3UW1A 3IG8A 2MKHA 2BGWA 2FHJA 2XGPA 1HW8A 5HK4A 1RA7A 4ELUA 3O4QA 1N8RO 4C3KA 4EEYA 1Z00A 5E0OA 1RGIA 2X74A 2G09A 4Y3CA 3DN9A 3E9OA 1S1WA 4V19X 2FMPA 1UVMA 3D2WA 4RG8A 4K41A 2A10A 4OI2A 5HL7Q 3TVKA 3QBWA 2QFJA 1WUUA 3L3FX 1LAWA 2E8AA 2C3PA 5KNIA 3O9TA 1F1BB 2PO4A 2P5OA 3NEKA 3UN2A 1NEEA 1E6YB 3SK3A 2QYGA 1MG7A 4CRJA 1S12A 5BPCA 1GXTA 4H0TB 4Y2RA 2DNQA 1VJQA 3DEEA 1BHLA 5CY4A 3RF9A 5DQHA 2PAVA 1CQNA 5B09A 3DOMA 2W9BB 4ECSA 4WCEQ 3GTYX 2DGXA 1GOBA 1LCUA 2HHSA 3R3LA 2ZUCA 2YCHA 4OKKA 5AZJA 3LP3A 4OMFG 4DR5J 4M5KA 1X4GA 3EGVA 4PAAA 3ZZOA 2O8FB 3L7PA 3LA0A 1H1VA 2QO3A 2H48B 3ZDAA 1X3MA 3CJBA 2GIRA 2KFZA 1DFDA 1YZ6A 5GAGU 1WF1A 3LPTA 3NH1A 2CUYA 3JS9A 4QOTA 5J2MB 4DFMA 1ITPA 2W6LA 1RBRA 1IKWB 2K60A 1PK3A 2FPHX 3J7YU 2EFPA 4YOTA 4K8RA 4I2QB 4PHEA 2KW4A 2NXEA 3KKRA 4P52A 3FKBA 3V81A 5IM0B 2VQFK 2OSQA 4NWIA 2XHWA 5DB6A 1LKZA 3IAYA 3SI8A 1BOTO 7ICEA 3KD5E 2E1MC 1IKYB 4BVOA 2XS2A 1U0HB 3TJ9A 5MAOA 2BW7A 2BW2A 2UXCF 2FPMA 4F26A 3A4TA 2EX3A 1X31C 2EH9A 1YJ7A 3MR3A 3F5TA 4MH8A 4ZPVR 1GOCA 2V2QA 3BKTA 4M3WA 4MKVA 3THTA 4BRLA 1WBDA 4J7CA 1WSHA 5DDPC 4BRDA 2ZOGA 3R1LA 3VAIA 5KFBA 3T9ZA 4EEKA 1QVGM 3T5KA 4Y2JA 1F44A 2QGFB 2LQJA 4ZLLA 1M6YA 3FBEA 1K8AO 2R7TA 1FK9A 3KLIA 1DJ0A 3IP4B 4FVMA 4JYAJ 3G10A 1W7AA 4YHHF 2XZDB 3RBEA 3VERA 1ZAXA 3WC2A 4PUOA 1VQ9S 4X4VA 4KGZB 4BLGA 2VCPA 4P2XA 1C6VA 2P9LA 4O5KA 3CFOA 2GO9A 2QA1A 4TKTA 5B0AA 4C7YA 1J97A 4DR5K 2E5LF 2MYFA 3DAWA 4HTUA 1N2XA 1NDLA 2ZVSA 1S48A 5D0RA 3H46O 4QIGA 1SWVA 3NGRA 3L3VA 3HFZB 2MKYA 3KUGA 2XMVA 3PKMA 4CERA 1BI4B 3ZSZA 1BLUA 3WKAA 4GV3A 1MLAA 4BGDA 3Q8LA 3RJJA 3L7OA 2WOMA 2ZE2B 4EFAC 1RT3B 1XBWA 2NRRA 2OHDA 1ICEB 4NYNA 2QSFA 3V6HA 4IOCQ 4PG7A 2E66A 2OPQB 2HHHF 1KOOA 4FJLA 1FXXA 2EFOA 3IP0A 3TR5A 3R5AA 3OL9A 3TVZA 1FDNA 3V4MA 3J81Y 2DY4A 2DR9A 1XJWB 2KFYA 2KYXA 4DUYF 4DCJB 4DTRA 2XLKA 4CJLA 2MTLA 1S10A 1RAHB 3CPWR 3CXCR 3B4MA 1SV5B 5J0SA 3SQOP 1WB9A 1YX2A 1JI7A 1XEZA 3OTBA 2XWXA 1L3KA 3HHEA 4XH4A 3KHGA 1MW7A 2IRXA 2GQ2A 4FS2A 2ZD1A 2FJAB 4FWRA 4K0KF 2XS5A 1VQ4N 2QA2A 4QZAA 4KT0C 2FLOA 3BYRA 3ZTOA 2MQPA 4CBXA 4QS7A 5ETMA 2CPXA 3SV3A 3CCVN 4JYAK 9ICCA 1PVQA 3AVCA 3US5A 3AOAA 1RU2A 2LPEA 4F4KA 2C3YA 2JLFA 4H54A 3QERA 1C0FA 1SXDA 3FZLA 5F3ZA 4P10A 4A57A 3OS2A 3U1LA 1PYSB 1B22A 2KOBA 3G0ZA 2Y1IA 1BO5O 3H0MB 1DTQB 4WE1B 3JTNA 2N4CA 4AQYJ 2BOAA 3FRYA 2GGPB 3HVWA 2P9UA 4V19J 4RU2A 4NL9A 5E5NA 1A6SA 2QE5A 2CXEA 3CNHA 1YIJS 1DGKN 4RBVA 3VVUA 2RVJA 4GKJF 1ROFA 1JN3A 1EQMA 4QZGA 2CZ4A 2XSFA 3T1YF 1S9GB 4A8QA 4BC9A 3QUBA 5DKWA 4OJGA 4QIWC 4UAVA 2IJFA 3CVKA 5DDRC 2K3IA 4ZVGA 3UNGC 3NL0A 4PR6A 4H5VA 2RF2A 1IVZA 1JK9B 2ZH1A 3HRDD 3VQ4A 3UDVA 4RCHA 4KH1B 5KT5A 3HM9A 5AQKA 1VQKS 3CCSN 4IJAA 2ZEJA 4RNOA 4B3SJ 1ZM4A 2W55A 2CPDA 3ZO7A 2EWSA 2KHQA 7ICFA 3D0GE 1P90A 3AVAA 3DLKA 1X0FA 3FZKA 2NV3A 5HN0A 4YP3A 1WG8A 1O08A 4Q45A 4B1XB 3F2BA 5FLXY 1ZPVA 4M3YA 3HK2A 2P9NB 4FP9A 2NPIA 1S1XA 2X6SA 1Q86O 2BV3A 2D7SA 3SBGA 2HIQA 2XMUA 4FK4A 1DAXA 2VFSA 1RTJA 5JMNA 8ICRA 2NXUA 3CJSA 2ASMA 3VQQA 3DXMA 4CE9A 3E3XA 1FEZA 4DI6A 3U7JA 2XY7A 1JJ2R 3CC7S 2EK1A 1FJEB 1WDDA 2KB2A 5DDOC 3S9HA 3N7SC 3MOJB 3QU7A 2FHJD 4DCOB 4DOBA 1S1UA 3VV2B 2ZIUA 1G1XA 1VQ8N 3GJQB 8ICMA 1JXVA 4ECXA 2KLAA 3ZETA 4CO1A 2BH1A 4LR7A 4KHNA 3L9ZA 2VV5A 2K8CB 1A9NB 2HBQB 2CADA 3CD7A 4IH6A 3OVBA 4KRWA 4GMKA 4AQYK 3H4BA 3BH6B 4J5OA 3OHRA 3VQDA 3AAPA 5D4LA 5E3QA 4BACA 1WORA 4JI3F 1FKAF 1BMQB 3VCBA 1N33J 3AM9A 3DLGA 4DSFA 3RJEA 4DV5J 3P1GA 4XDCA 3PR5B 2XYGB 1C7YA 2LA4A 2LA6A 1TL1B 1T3VA 1EX8A 1FO1A 2ZF5O 3G4SN 3IUCA 3DRPB 1OO0B 9ICRA 3WNEA 1BGXT 4EGLA 2NRTA 1G7CB 4OYWA 1ZQDA 1DRZA 3NMUA 1B64A 4B08A 3TR8A 5JJBA 5KG1A 2O67A 3BGLA 5I42B 1CJUB 5FPNA 2GO8A 1ECWA 3BDPA 3NF7A 1Q5VA 2PDAA 2IIRA 2BR0A 3B6BA 3DRYA 1PJ6A 1I39A 1RTDA 2YVSA 3BQ1A 3UCZP 4GW6A 3D6MB 4XEIA 5ALRA 3NVYA 4B1UB 3C29A 4DUZJ 4NLNA 1TV6A 2OPRA 4B3SK 1VRQC 4IWVA 2Z57B 1HKBA 3HSJA 3X3UA 5BN9A 1UAXA 3EGZA 5FLXU 4N5SA 4RNFA 4IFYA 4M9HA 2JEIA 2NR0A 4HWIA 4GV9A 1J5EF 1D8ZA 1M90O 4ECYA 5FROA 1S3XA 3PSIA 4L8RB 3LP1B 2D0AA 5F0WA 4CHNA 4IO9Q 1SCJB 4U67Q 4I2PB 4PXCA 1VQ6S 3WQTA 4JRQA 3C46A 5HROB 4DOAA 3CEDA 1WD6A 3AUOA 3H5YA 1HEKA 4B9VA 2E1YA 1YJRA 4BR9A 1RE1B 3UKRA 5JMVA 2BOPA 5AQZA 2KHOA 1YG0A 5IIOA 2RSQA 1DZ5A 2Z1HA 2QK9A 4FFDA 4M41A 4X4NA 5EVZA 2WC9A 5AQFA 1IBCB 4UOFA 2CYYA 3O8MA 2YNIA 3LO3A 3TEHB 1KC8T 4LVOP 1YK9A 2G2ZA 5KG0A 2KDOA 5A6WA 4PL8A 1V97A 2MA1A 1KLMB 3PIPQ 2AKWB 5E7OB 4USJC 2DXEA 3VA3A 1RHMB 1CPZA 4Y00A 2IPOB 2AH5A 3OFHA 2YX7A 3U9DA 2E6MA 1S79A 2CJQA 5F8GA 2QI2A 2MZTA 3Q8MA 2F8MA 3M2UA 5C2DA 1RLCL 4X4SA 1LW0A 3L4IA 1X9XA 1VJWA 4EFHA 2UXBJ 5GADP 1N33K 4EK2A 4JV5J 3N01A 4DV5K 4J9KA 1B9DA 9ICSA 3UNYA 1K73O 3ZCMA 5A0YB 1IWAA 2RQKA 2YMPA 4E89A 5KPTA 1FWPA 2UUTA 4I6WA 1XIQA 2E20A 5AE1A 3SCXA 4B9QA 1B43A 4Z4EA 1RABB 4UB5A 2C3OA 1FNMA 1MMDA 4ANCA 3CQYA 3RR8A 1Q7YT 3I1YA 4AF1A 5FJ4A 3MMAA 4FM0A 4I6MA 4LD0A 3DYAA 4DUZK 4FNHA 3HL8A 1VK8A 2IC3A 3NNCA 5ALNA 2E7VA 3KLGB 3KD1E 4LF7J 1GFWB 2I7PA 2XS7A 4PPXA 9ICAA 4QZEA 5BRFA 4DO9A 5E3AA 2RQCA