1NK8A

A bacillus dna polymerase i product complex bound to a guanine-thymine mismatch after a single round of primer extension, following incorporation of dctp.
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PRIMER STRAND
publication title Structures of mismatch replication errors observed in a DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2003-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1nk8A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1nk8A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nk8A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1nk8A01
2YHBA 3MR6A 1GOAA 4BWJA 3HP6A 2G8FA 3THVA 4FYDA 3EW9A 3PO4A 4TUPA 5FDLA 3ZSXA 3AO4A 2BQRA 2RF2A 2BGGA 1L3SA 1IKXA 3GV7B 1UA1A 3SUQA 3RH6A 3G6VA 3IM1A 3DMJA 1MU2A 3KD1E 4OPJA 3V9UA 3ETLA 3TAMA 4M04A 9ICOA 1JLAA 4CIGA 4BE1A 4K4GA 3SUPA 1C0UA 1ZJMA 4I2IA 5J2FA 5J1EA 4O3RA 3HPOA 3WNFA 2XRIA 4ICLA 5HRRA 3HW8A 4QWEA 4KB0A 1S1WA 1ZQYA 4GVMA 1RPLA 3QNNA 4RPZA 1TKXA 1BQMA 1JXLA 4OKEA 2X74A 4KLMA 2PYJA 3T19A 2IS3A 2BCSA 2HHUA 2ZUBA 3DYAA 2UVVA 1KFDA 3BQ0A 4IQUA 4DMNA 4CJVA 2B21A 2PFQA 1RTJA 4C8KA 3ASMA 1RT2A 5KG4A 1KEJA 2NRWA 1N6QA 3V7JA 1QTMA 2DPIA 5KFQA 4PGYA 3HXMA 2PXIA 1HNIA 3D45A 3ZSQA 3IRXA 7ICNA 4NLKA 3NGYA 4DL5A 3EYZA 4X5VA 5KGWA 3AU2A 1HMVA 1QHTA 5DLGA 1XI1A 3MEEA 3OSPA 4TSXA 1A77A 1JLBA 4F3OA 2XO7A 2Z1GA 4YMNA 5KFBA 3MABA 1BL3A 4JLHA 4OGEA 1EXNA 1RCHA 2D0AA 3C94A 4RT3A 9ICIA 2I1QA 1X9MA 4F4XA 7ICJA 4FBUA 2F1HA 3M8SA 4I2DA 4RNNA 4DU4A 2HHVA 3SQ1A 3T5KA 4CFAA 4ECUA 4LH5A 4Z0UA 1T7PA 2PI4A 3OYIA 2MUTB 4RQ0A 4O3OA 3TABA 3L3UA 2ISPA 1FXXA 4FJKA 4FW2A 1G15A 4CHNA 1LWEA 4W5TA 1ZQWA 1TAUA 1K6YA 3KLFA 1GOCA 3G0ZA 8ICNA 4BE2A 2JEJA 5DBAA 2P5GA 2J6UA 4DSFA 2G8HA 1JL2A 5DG7A 4DFPA 2OWOA 4PGXA 2AQ4A 3PUFA 5J2HA 1Q8IA 3K5OA 4KRFA 4QZHA 1VSHA 1B92A 5J2EA 3SZ2A 2RKIA 4RNMA 5HNKA 3TI0A 3AVAA 8ICPA 4E7IA 5KFDA 1EXQA 3OGUA 3VQ7A 1C1BA 3OHAA 1LW2A 4KV8A 5J2AA 4I28A 4YMOA 3IS9A 3TAFA 3LALA 3HPHA 1NOYA 4EP4A 2FBXA 1WSIA 2BANA 4QZGA 4ID5A 2FBYA 4DLGA 1TK8A 4PHPA 3LPUA 1HRHA 4YNQA 2MUTA 4Q8FA 2YNFA 1TKTA 4BWMA 4QZ8A 1JKHA 1S1VA 1ZQZA 4UB1A 2W9CB 4F5RA 1YT3A 4FJGA 2B4JA 5DB8A 4J9OA 3K2PA 2ATLA 3NE6A 3ZD8A 8ICEA 3N4MB 3M9NB 1ZQXA 4E3SA 4EZ9A 3RB6A 4QWDA 1RTDA 4GC7A 2ZJAA 4IQWA 5DBBA 3DOKA 3T1AA 4R8UB 1RBRA 4J9RA 1ZQQA 4B08A 1RBTA 5DB9A 4Z6FA 2GWSA 4DL3A 9ICHA 2X78A 2WOMA 4HTUA 4KHWA 4O5EA 4DLEA 4I2QA 4CF9A 3VQ4A 2BDPA 3RR7A 3F73A 3V81A 2HNYA 3U3GA 5KFYA 1ZQTA 3LDSA 3K4GA 1RYSA 4ELVA 2F96A 4TURA 1UWBA 3MR2A 4EBDA 1RT4A 4AHCA 2JEGA 3MGIA 3HM9A 1LWCA 2KTQA 4FM2A 3D0PA 3B0YA 2XCPA 4TUQA 2VG6A 2BR0A 1U45A 3JYTA 5KFHA 1I39A 3KLHA 4O44A 1RT3A 5HMMA 4F3TA 5KFGA 2MAXA 4DF8A 2NUBA 4IG0A 2UVUA 2FC0A 1QE1A 2IDOA 1UAXA 3I0SA 1ZQNA 2D0BA 3ZDAA 3RAXA 1WNSA 2ISOA 4PPXA 1KFSA 4J9SA 4ELTA 3K58A 2E6MA 4R8UA 3HO1A 5J2QA 1VRUA 4JRQA 3PW4A 3OYNA 2IMWP 3KK1A 4MF8A 5FRNA 4CEEA 2ITGA 3ZSYA 5J2PA 4CJ5A 5KG1A 4CJQA 3LP3A 4YD1A 4Q5VA 4QOZB 5KFOA 5KG6A 3EWAA 3RB4A 3TAPA 2AGQA 3SNNA 4ID1A 3KKRA 4P2HA 2KFNA 3PW2A 1NJXA 4FJHA 4E1NA 2DTUA 3BQTA 3QEXA 5CWRA 4F92B 3TAEA 3C21A 2XC9A 1MC8A 4YN4A 3QIPA 4GXJA 5DG9A 3C23A 3VA0A 4UB3A 3EPIA 8ICAA 4I9QA 3ZCMA 4CEBA 1RXVA 3OYJA 3RB0A 3SI8A 3NGIA 2ASDA 1XU4A 2Y1IA 8ICBA 4ECWA 4M9LA 7ICUA 3SI6A 2Z1HA 4DFMA 4CJTA 4KLQA 4FZYA 1S0NA 3H7IA 1S10A 1S0MA 4B8CA 1S1UA 2M9NA 2RN2A 4Z4FA 3MECA 9ICUA 4N56A 4FS1A 4RUCA 3AA2A 4I7FA 2B5JA 1B22A 2P6UA 4MFAA 3T5LA 3MEDA 2DFLA 1TGOA 5CB1A 4CJWA 3AVKA 4OKKA 2ZD1A 2V9WA 4F5OA 1FKPA 2KZ3A 4BE0A 3RJKA 1DLOA 4RNOA 5KT5A 1JLQA 4HUGA 4RQ4A 2Y1JA 8ICFA 5C24A 4KLJA 9ICEA 2DFFA 5CY4A 1Z00A 4KPYA 4CK2A 3L2WA 4EEYA 1ASUA 2RDJA 3Q8MA 3NGZA 5FRMA 4YG2A 1IH7A 5KG0A 4CJEA 4AHVA 3NH2A 4J2BA 5SZTA 1RILA 4LVSA 3DOLA 5DLFA 2RDIA 3V6DA 4M9HA 3ISCA 1SUQA 4QZDA 1IM4A 3GIJA 4FJ9A 3Q8LA 3QINA 4MFBA 1XSLA 1QSYA 2OZSA 1ZQKA 7ICMA 3RMDA 1TV9A 1S9EA 4AHUA 3GIMA 1D5AA 4O3NA 9ICVA 1YTAA 4CGDA 4M47A 2KFZA 1JMSA 5FROA 4CJUA 2ZTDA 3TFSA 2LSNA 4DWIA 4I27A 1UOCA 3RJGA 3PW7A 1RT7A 2FPLA 3SPZA 1L3VA 3IAYA 2J6TA 4IQVA 1K1SA 4RW4A 1HYZA 4DF4A 4B8AB 3C1ZA 3KJVA 3HK2A 2ZUCA 3OS1A 3K5NA 4JV2A 3AV9A 5KFJA 1Q9YA 4NCBA 5F9NA 3L2UA 4EBEA 4KLGA 4DTSA 5KFPA 5KT4A 2W9MA 2C2EA 3LAMA 1B9DA 2ZQBA 4UQGA 4M6WB 3OHBA 3ISBA 5IIJA 2P6RA 3RJJA 5KRTA 3VQDA 3JPQA 4BDYA 5KFNA 1T4GA 4Z4CA 5KT7A 5KFLA 4QZ9A 2X6NA 4ECSA 2ASLA 4NYNA 4MEXA 4DG1A 4NYFA 1KCFA 3WNGA 1WN7A 3Q8PB 1J54A 1RDAA 3PX4A 4CESA 3PV8A 2OA8A 5KFSA 2HHQA 5CR0A 4HVJA 4N5SA 4FJ7A 2BHNA 3QEVA 4ED3A 4FW1A 4J2AA 2BGWA 9ICLA 3AVMA 4KLSA 2PFNA 5KFRA 4CFBA 4O55A 4H4MA 4OPKA 2R8JA 2VWJA 2JEFA 5DB7A 1TK0A 3SQ4A 4RQ7A 5IILA 5KFCA 1WLJA 1NK9A 5CP2A 4KTQA 1C1CA 4UAYA 5J0YA 4R66A 2VG5A 3QE9Y 2JGUA 3IHQB 5IIOA 4ED7A 1SZPA 2FLLA 3S3OA 1JL1A 8ICUA 5KGXA 4DTJA 1ASWA 4P4MA 4Z6CA 4FBTA 4KKOA 1S76D 4XIUA 8ICVA 3L2VA 4F50A 2GUIA 3GQCA 4KHYA 5EWFA 4RZRA 4KLDA 3PX6A 2YV0X 3CFRA 3OJSA 5KFEA 3AA5X 2H5XA 3JPOA 4E19A 1NK4A 4J9LA 4FJXA 2C2RA 2W8KA 5C25A 4LY7A 4CECA 4QZBA 1AROP 4ECRA 1C6VA 3OS2A 3A2FA 1GOBA 5DDYA 4DQIA 3ZT1A 1SL2A 4MQ3A 2LYHA 1BPZA 5J2IA 4RW9A 4F4KA 3AUOA 2ZJ8A 5L9XA 3L2QA 4IBNA 4DSJA 3N97B 4XA5A 2UVWA 2JEIA 4FLTA 8ICGA 4CJ4A 4FJJA 9ICTA 4XRHA 4BDZA 4Q43A 3QETA 5HHHA 2BE2A 1EKEA 5J0QA 1WSHA 9ICPA 4CEOA 5D3GA 2VA3A 3G6XA 3DLHA 4CEFA 1SL1A 3ZDEA 1IO2A 4UBCA 4O3QA 3RH5A 4R63A 5E41A 1BPXA 4I9LA 1BQNA 5DQGA 3NF6A 2G8WA 3JPTA 4RQ5A 9ICAA 2JLEA 3GIKA 3CFPA 3OYGA 9ICFA 1S97A 8ICHA 4F4WA 4CJ3A 3EY1A 3DLKA 9ICBA 4CCHA 4H8KA 1I3AA 2VANA 1NJZA 1V9PA 1XS9D 1ZYQA 1SKWA 4XQ8A 4FM0A 2EHGA 1BI4A 4Z6DA 1HJRA 3DLEA 5DK5A 4ED6A 7ICOA 4DSIA 1RTIA 3ZSRA 2OPQA 2XCAA 3B6PA 4FJIA 2FBVA 5IINA 4Q0BA 3C1YA 3H08A 1NKEA 4DO9A 4ED0A 5DQIA 4O5BA 3S9HA 3AO2A 2VA8A 2QK9A 1HUZA 4QWCA 1COOA 2C2DA 4I2AA 2ETJA 4O0JA 3V1RA 4KTZA 4CK3A 4I2CA 4GW6A 4FLUA 3LAKA 4FVMA 1A5VA 2YKNA 4KITB 2ZJ5A 1RYRA 4E7HA 4FJ5A 1ZJNA 4W5QA 5DB6A 1U49A 8ICWA 3RBDA 4CJRA 3GILA 4I2PA 3M8PA 1BISA 4IFVA 3RRGA 1JLCA 1NK0A 4CEDA 4J9NA 2P1JA 1S0VA 5HHIA 2W9BA 1K1QA 4IRKA 1XSNA 5D49A 3QEIA 4FJ8A 2W42A 3PY8A 3ZT0A 5KFXA 2F8SA 4IRDA 5DGBA 1L5UA 1ZQJA 4GMJB 4E89A 3BGRA 2GV9A 4PHDA 4B9NA 4DOBA 4I29A 4YFUA 2BCVA 4PHEA 2BCUA 4ECXA 4CIFA 3DRPA 3U3YA 1RXWA 4IR9A 4UAWA 4F4ZA 3UPQA 4M41A 1KVAA 5KFIA 2RPIA 3VQ9A 3QIOA 4F5NA 1ZQCA 2DFHA 5L1LA 2UVRA 1S5JA 3KLGA 4L8RB 2F1JA 4KLFA 9ICXA 1VSKA 3M8QA 4DTOA 4M42A 4JS4A 2P5OA 4IG3A 2IOCA 4CJSA 4JUZA 2G8UA 1MQ2A 4MFCA 5J2BA 1S9FA 3DRRA 4YCXA 3VQ6A 4CEQA 1CLQA 4B9MA 4FS2A 4G1QA 1ZQRA 9ICGA 5HRNA 4FK4A 4M0AA 3QERA 4Y1CA 3C2LA 1ASVA 4ZTFA 4K4IA 3UXPA 3NH1A 1T3NA 1BIUA 3V7LA 2PZSA 3SYZA 1B9FA 3RTVA 2FBTA 3MDCA 1UT5A 4F5QA 1ZQEA 4IDKA 3VQ5A 1S6PA 3P1GA 2DPJA 5L1IA 3K5LA 1J5OA 4LH4A 4M3YA 3RMAA 4NCAA 3MFIA 5L1JA 7ICVA 4KMUA 4KLEA 1VSLA 2NRXA 4DL6A 1JN3A 4FLVA 3DI6A 4QWAA 3TARA 4P4OA 4AHTA 4JWNA 2IA6A 4DEZA 1MSWD 2OPRA 1WSJA 3VQBA 3QEWA 5J0WA 1LW0A 1UA0A 4QZAA 4NXZA 3MFHA 4BACA 4ZTJA 3I0RA 3AVCA 2BKEA 1XO1A 2HHXA 1ZQIA 4ZHRA 3BQ1A 4QZCA 2Q3SA 5HP4A 3JSMA 3ZT4A 3L3VA 1N48A 3BQ2A 4O0IA 4M3ZA 1BGXT 3ZSOA 4TUSA 3L2RA 2I5JA 4KI6A 4F2RA 2ZUDA 2PY5A 3LP2A 4DTUA 3AVJA 4DTPA 4J2EA 4NLGA 3V9ZA 1X1PA 4ECZA 4LSLA 4CGJA 4CF8A 4NLNA 4KHUA 3PO5A 3RR8A 2D0CA 3RH4A 4J9PA 8ICZA 1Z00B 4F5PA 4EBCA 5CA7A 2OYQA 3MR3A 3OY9A 5EOZA 4KI4A 4RQ6A 1L3TA 4CGHA 4LZGA 3OYCA 2PYLA 2DY4A 3BDPA 3NF9A 5J0SA 3GIIA 2WTFA 1U9LA 2C22A 1QLNA 9ICWA 3SV4A 3HWTA 1DOQA 4B3OA 2X6SA 4DSLA 1ZQHA 1A76A 1LAWA 4F8RA 4IFYA 1C0TA 4DL4A 4FJNA 4KN7A 1JLFA 3AVHA 3OVNA 5EWGA 3VQAA 1C0MA 3UQ2A 3NF8A 1EETA 3AA4A 4PY5A 4OLBA 2Z1IA 1TKZA 5IIMA 4UBBA 4FLWA 3RJIA 3OS0A 4GC6A 3GV8B 3KLEA 2O4IA 5J2JA 4CHQA 4W5OA 1J9AA 4QZEA 3Q8SB 4FCYA 1S1TA 4M3WA 4EZ6A 3H8JA 1TKDA 1D9DA 4I2HA 1KLNA 3PW0A 7ICPA 3CFOA 1C7YA 3HT3A 2P51A 8ICQA 4FZXC 5J2GA 4CGIA 1QSLA 5L1KA 3LDAA 3C2MA 5KRSA 5HBMA 4OLAA 3T5HA 3E01A 3EPGA 3VN5A 1ZQVA 2E4LA 4KHNA 2ZE2A 2HMIA 4PA1A 4YR2A 4B9TA 3HPGA 1ZQFA 2VG7A 5DKWA 4Z4EA 1KVBA 4DOCA 3T5JA 4YD2A 1T8EA 4E0DA 5HMLA 1KLMA 1RDBA 1LB2B 3OJUA 4Z6EA 5TZVA 1BPYA 4RPXA 5JUMA 2HW3A 1UT8A 3PR4A 3AO1A 8ICYA 3GDXA 4YQWA 3Q8KA 4CHPA 3ITHA 1RNHA 3ORYA 4CIEA 4DTXA 9ICRA 3KHHA 1RT5A 4OVLA 1X9WA 3QLHA 4DFJA 4FLXA 2OPSA 2XY6A 2FMPA 3PR5B 4ECTA 7ICRA 3V9SA 3TAQA 1HUOA 1KDHA 4RW6A 1SKSA 9ICMA 4E7KA 3H8WA 3OYFA 3HVTA 4DQQA 1BHLA 1BPEA 1RDDA 3S3NA 1TL3A 4KHSA 7ICKA 3VQEA 1S1XA 5C42A 3NAEA 3VQPA 1CEZA 3DLGA 4H4OA 3K59A 3V7KA 3OYMA 3QZ7A 3UIQA 3NDKA 4RUAA 4YVZA 3QEAZ 2HNZA 1ZBFA 3HJFA 3CQ8A 1Z26A 3RMCA 4K8XA 3AVLA 2BCRA 5KT3A 2HVHA 3KK3A 4PQUA 1IXRA 4CGGA 4HCBA 3DLBA 5CZ1A 8ICKA 3DLRA 4M3TA 4M3UA 4PH5A 4CJKA 3AU6A 4HUEA 4JWMA 3I8DA 4GXKA 3K5MA 4HHTA 1HQEA 7ICQA 4DQSA 4KLHA 3C5GA 4O5CA 3ISNC 3O3FA 3P83D 4NY8A 4EP5A 8ICRA 2HHTA 3FFIA 2BPFA 1QSSA 1BCOA 4F91B 1JIHA 1S77D 4DU3A 4J9KA 1KRPA 1VSMA 1NK5A 1JX4A 2ZTCA 2BCQA 7ICSA 4K4HA 3NCIA 4DTMA 1Q9XA 4JV0A 3AVNA 2XHBA 3SQ2A 1ZETA 4N47A 4RU9A 3RRHA 4KLLA 2PFPA 4QCLA 4IRCA 4JK1A 4ZH4A 4KO0A 3T3FA 5K14A 1TVAA 3OYLA 3V6JA 2KQ2A 4KFBA 4R64A 3SJJA 3HSTB 4AHSA 5SWMA 3QEPA 1BI4B 1EP4A 1N5YA 3KHRA 4E7LA 3C6TA 4E7JA 5T7BA 3O3HA 7ICIA 3O4NA 3V9XA 5J2KA 3NTUA 1LWFA 4KLIA 2W8LA 1VSEA 2JZBA 2NRVA 2IBKA 3M9MB 1IKWA 4LZDA 5KFAA 7ICLA 4B9UA 4F2SA 3C5FA 1CUKA 3WNEA 4DSEA 4Z4HA 1ZQAA 3OYKA 2BPGA 1TVRA 4YXMA 4FZZA 4CFCA 4K8ZA 5J2NA 1HPZA 3S3MA 1FK9A 3AO5A 4OKJA 2Q0ZX 4FJLA 4YP3A 4RW7A 4FJMA 3QNOA 4BGDA 1KSPA 5HROA 4CJLA 4PUOA 2HHWA 3ZD9A 4I2GA 1O1WA 1TV6A 8ICTA 3K57A 1BPDA 2IAJA 3ISDA 3OYBA 3OSNA 3FDSA 4NLZA 3SV3A 4DQPA 8ICIA 9ICNA 1VSDA 2W9BB 3V1OA 3ULDA 4M3XA 1J53A 5BPCA 4P4PA 4M45A 2VA2A 1IG9A 4RQ3A 3V6KA 5KT6A 3V6HA 1TAQA 4C8LA 2HNDA 4DL2A 3QO9A 3JPRA 1Y97A 4AILC 4AHRA 4ECYA 3M8RA 4KLUA 3SPYA 3C2KA 1NK8A 2G8IA 4F4YA 1ZQMA 1PZNA 4M9JA 4O5KA 3LP1A 5D4BA 3CYMA 1REVA 5CYQA 4TQSA 2ATQA 4FK0A 2KW4A 5D46A 1W0HA 3F9KA 2OPPA 2IHMA 3RJHA 2HVIA 1ZQLA 2A1JB 4BDPA 2FLNA 5KG5A 2AGPA 1D9FA 5KG3A 3MXJA 3OYDA 3RAQA 1D8LA 2NRZA 1S0OA 4ED2A 4CERA 5J2CA 3PMNA 3L8BA 3O3GA 3ZDBA 3JPNA 1KFTA 3KHLA 3KHGA 1IKVA 1YTUA 4W5NA 4QZIA 1TL1A 3AO3A 3LWLA 5CJ7A 1DGSA 3MR5A 1NJYA 4I2JA 5KI6A 3P5JA 9ICJA 4CK1A 4Y1DA 3B6OA 4UB2A 4NM1A 3LWMA 4CHOA 2HB5A 1JXEA 3MGHA 3ZDCA 3MAQA 1WSEA 3PX0A 4HUFA 5BOMA 2XY5A 3RB3A 4MFFA 3WNHA 3ZSVA 3NH0A 2FLPA 2YNHA 3LZIA 4CF1A 4GXIA 3VQ8A 1WAJA 2Z1JA 3NFAA 3KLIA 2AU0A 5CYMA 4DSKA 2A1JA 3MEGA 1NOZA 4KB1A 4TQRA 4C8OA 5KTQA 1VSFA 5DBCA 3KTQA 1C1AA 4J9QA 1A5XA 1QS4A 5J0TA 7ICTA 4O3PA 1SL0A 3LANA 3JPSA 1ZBIA 4F93B 5KFKA 4CF2A 2FMSA 2KZMA 5KFUA 2GBZA 3H4BA 3E2EA 1TK5A 4MF2A 1U4BA 1L3UA 4O4GA 3FYHA 5HRPA 1VSJA 4B9LA 2B6AA 4FM1A 1IKYA 4GLXA 5KFVA 4PGQA 3RJEA 4DS5A 3LPTA 5JS1A 3ZSWA 1D8YA 1MQ3A 8ICXA 3V4IA 2V4RA 1N56A 4YR0A 5KFZA 1WSGA 4YMMA 4HCCA 1BCMA 4DU1A 1B43A 8ICJA 2R8KA 1NKBA 3DM2A 5I3UA 4B9SA 3UQ0A 8ICOA 3Q8QB 2E6LA 3EZ5A 3TANA 4M2YA 4B9VA 4LD0A 1Y88A 3SUNA 1W9HA 2C28A 1F21A 3KK2A 4KREA 9ICCA 4EYIB 3AVGA 3SCXA 1XHXA 2KZZA 1R0AA 4IKFA 5EWEA 5DQHA 1X2IA 1ZQPA 4CJFA 2IHNA 4ECQA 5J0PA 3G10A 3V9WA 2FMQA 1ZQSA 5CZ2A 2IGIA 2F1IA 4PWDA 1ITGA 4I2BA 2F8TA 2W9CA 4MEYA 4C8MA 4RQ2A 3HVRA 3PMLA 4KHQA 2BQUA 5J29A 3UXOA 1H38A 4M9GA 5HP1A 4KAZA 1U48A 2HHSA 1XWLA 2FPKA 4XUSA 3TFRA 2QKKA 2G8VA 3ALYA 3B0XA 5HLFA 3CM5A 3QEBZ 1ZBHA 4KLOA 3U6FA 1VRTA 3TAGA 4FLYA 3V72A 2P66A 4HYKA 4R65A 4BXOB 4Q44A 2KN7A 5IIIA 1HNVA 2YHAA 5J2MA 2VWKA 2O4GA 4CF0A 1WAFA 3MBYA 4I2FA 3ZT3A 3AVFA 4DTNA 4DS4A 2ZTEA 4KTWA 1RZTA 4JS5A 1WCLA 4RQ1A 7ICHA 3RMBA 4W5RA 1RBVA 2ALZA 3AVBA 3O4QA 1JXBA 3RWUA 4RQ8A 2A1SA 1YVUA 4YR3A 5EU7A 5DMRA 3TQ1A 1Z3EB 3HX0A 4Q45A 4RT2A 4IR1A 1HYSA 3NBPA 2DFEA 2R8HA 4Z4IA 3V1QA 1S9GA 1T03A 1RT6A 3SQ0A 9ICSA 9ICKA 5DDMA 4QZFA 1ZQOA 4RG8A 4Z4GA 3AA3A 1LV5A 4FO6A 4JV1A 1QQCA 1XSPA 4NM2A 5F9LA 1NK7A 4O9MA 3TR8A 5KFFA 4ELUA 4RPYA 3PNCA 2R8GA 4BXOA 1RTHA 5J0XA 1DTTA 5KFMA 1BIZA 4WE1A 2BQ3A 2QXFA 4UB4A 1CXQA 4IQTA 4O3SA 4DQRA 2D5RA 4E1MA 4DTRA 1VSIA 5J0RA 7ICGA 2A1RA 4OJRA 4DOAA 4CE9A 1RT1A 3SUOA 1FKOA 5DG8A 3RJFA 5KFTA 1ZBUA 2ASJA 4FXDA 3H4DA 9ICQA 4J9MA 3MXMA 3NHGA 4M9NA 3VQQA 3CM6A 2AGOA 1XC9A 1RBSA 1S6QA 1ZQDA 5BOLA 2PFOA 4CFDA 4I2EA 4J2DA 1XHZA 2W9AA 3QZ8A 1U47A 4QAGA 4FLZA 8ICCA 1ZQBA 2XY8A 4NCGA 3OYHA 2OZMA 4N41A 5CHGA 1Z25A 3DRSA 3G6YA 4CEAA 4FK2A 3UXNA 4CHZA 3OYEA 4CHYA 1CZBA 1NK6A 2NRTA 3MDAA 1CXUA 5IIKA 3HP9A 1EX4A 3HL8A 5DGAA 4G3IA 4AH9A 3RBEA 5J0UA 4CGFA 4KLTA 1NKCA 1TFRA 3VA3A 5KFWA 4Q8EA 4QW8A 3BJYA 5J2DA 3Q8RB 4DFKA 4R5PA 3ZSZA 3MXIA 3KD5E 3C95A 8ICLA 1HJPA 2AJQA 5KG2A 2G8KA 1KTQA 1WSFA 3AVIA 3M9OB 3LZJA 4RW8A 5I42A 4CJPA 2R8IA 3QESA 1LAVA 7ICEA 4UB5A 4JRPA 1ZQGA 1SKRA 2QKBA 3LP0A 4CEZA 7ICFA 1NOMA 1SV5A 2PI5A 1HYVA 3KIOA 3H8SA 2YKMA 3TWHA 4EYHB 2YNIA 5J0OA 3C6UA 2YNGA 5KT2A 4LSNA 4M3RA 4KN4A 4YFKA 2I9GA 2J6SA 3ZT2A 4ED1A 2WONA 2IC3A 1WCNA 2JZBB 5C5JA 3VQCA 3PW5A 2XY7A 3HYFA 4C8NA 1ZQUA 4QWBA 3ZDDA 4N76A 4ED8A 1KVCA 1BPBA 4M6WA 3OYAA 4PHAA 1HQUA 2BPCA 1T05A 5KG7A 2XGQA 3H40A 3KKSA 2EX3A 3K75D 3PVXA 2AQ0A 3GFKB 2R7YA 5HRSA 3GV5B 1CZ9A 4YXJA 3NGDA 8ICSA 1RBUA 1NJWA 1ZBLA 5JS2A 3IG1A 2V4QA 1A5WA 1X9SA 1JLGA 8ICMA 1U04A 1BVSA 4ECVA 3NF7A 1RDCA 4QW9A 1JLEA 4DL7A 2FPMA 3LK9A 1VK0A 1DTQA 2XGPA 4UAZA 3CG7A 3JPPA 4OGCA
chains in the Genus database with same CATH superfamily
3ZETB 1RKJA 2PEBA 3I96A 1GOAA 3OTDA 2KNJA 5BXIA 4A8QA 2JOQA 4P2SA 3HP6A 1QQOA 3THVA 5E84A 2ZBIA 1VMBA 3PEJA 3MM5B 4NX9A 4WTOB 2Q1LA 4DU7A 3ZSXA 2QARA 3WKBA 1Y0HA 2HGMA 2RVJA 1TELA 2EAMA 1L3SA 2QX0A 3G6VA 1RT2B 4CDIA 2VPYB 5DM7L 1WOQA 2KJVA 2EI5A 4H0TB 3AMZA 3IRXB 4PYAA 4BE1A 2JZ5A 5J2FA 2HFSA 3MCMA 4HAIA 3WNFA 3J7Z5 3WX4A 5AIBA 4Y2MA 4J8FA 5ELZA 4ICLA 1G7CB 5HMXA 4JD2A 2IYIA 3WK6A 3HHKA 1ZQYA 4GVMA 1OYDA 1HBNA 1Y64A 2KXFA 4NZ7A 4KLMA 2PYJA 1HBOB 1XR5A 3UDVA 2VHGA 2ZUBA 5AI0A 2V6AA 2BKPA 8ATCB 2R7RA 4JKFA 3SBTA 2F3NA 4CZMA 2J9CA 4DMNA 4AYBD 4CJVA 1VJQA 2DGZA 2F40A 2LXFA 3EX7B 4UY8O 4PGYA 2FC9A 1HNIA 3MHYA 3IO1A 5E5NA 7ICNA 4NLKA 2GWKA 1FF2A 3WC0A 4X5VA 1RWPB 2FVCA 1XI1A 3OUYA 3J80Y 4TSXA 3WEEA 1JJHA 4DZDA 1MWKA 2XO7A 3WDOA 2HFUA 5J1NA 4CRJA 5ALGA 2OSQA 2XMVA 1BL3A 3KWMA 2WB1C 5B0CA 2I1QA 2ROPA 1X9MA 4NEYA 2V8PA 3CCES 3QRPA 4NWIA 2Y1LB 5ETLA 2GZOA 2F1HA 4TU7A 4BR2A 2DH8A 2HHVA 1CJKB 3ZNUA 1QVFM 3IXQA 5JICA 4I6MA 2QLTA 1RU1A 1QQ5A 1UWAA 4OIXA 3QU4A 1GLEG 4PEOA 3VWSA 1IM6A 2B4OA 1IR1A 1VK8A 3IDHA 3T6BA 4CO0A 4DR5J 3L3UA 1ESVA 3K0SA 1U8SA 4PG7A 4FJKA 2H9ZA 2FVSA 4FW2A 4CHNA 4JV5F 4WCEL 1TAUA 4KH0B 3D66A 1GOCA 4YDUA 4H4KA 3PJXA 3IWLA 4BE2A 3HFZB 1Q5YA 2JEJA 4ZITA 1DAXA 2DNMA 2BABA 2X51A 1X9XA 5DG7A 4CM0A 4PGXA 2P9IA 1VLOA 3PUFA 2RD5C 3SZ2A 3BR8A 4RNMA 1F5SA 3AVAA 2H4YB 8ICPA 3HTVA 3LDNA 2VC1A 1M0SA 3G96A 2X1GA 1EXQA 3CPWR 3VQ7A 3OHAA 1LW2A 4ZVQB 3KKAA 4I28A 3M2UB 2V4JB 4LIRA 4Z7CA 3LALA 1JB0C 4KGMA 3EDQB 3HPHA 1NOYA 4PCQA 3FLCO 4KX3A 1WB9A 2KP7A 4OZLA 4QZGA 1TK8A 1T3QA 4EO6A 3K9KA 3QJLA 3JSRA 3NRBA 4V1Ak 5M1PA 3U1MA 4Q8FA 3DDHA 2E1CA 1PILA 1TKTA 2VG6B 4FYXB 1H2TZ 1R6YA 2ZIXB 2W9CB 4F5RA 4OCZA 2RNEA 4J9OA 4FKYA 3K2PA 2F4VF 2P9LB 2F44A 3CCEN 2V69A 3ZD8A 3W0LA 3N4MB 1ZQXA 1X60A 2FSNA 4JI2F 3RB6A 3VAJA 2A3ZA 3DOKA 4R8UB 2IYGA 4B08A 2YI1A 2R42A 5DB9A 4LSZB 3KK1B 4Z6FA 2CZ9A 9ICHA 4F67A 2E2QA 2X78A 4KHWA 3GJQB 5ETQA 2KIVA 4B17A 1SJQA 4W4MA 3S8SA 4USJC 2HNYA 3FGUA 3LDSA 4K42A 3K4GA 1K0VA 1RYSA 4ELVA 1HBUA 3MCPA 4LBHA 4KGKA 4PL2A 3LGHA 2WW4A 1WUUA 1JK9B 1C20A 3MGIA 1Q3UA 4OZ0A 1XO0A 2RRAA 4TUQA 2XYGB 2HS4A 4IFEA 3JYTA 4DR5K 3GR0A 4O44A 4ZPBA 4F3TA 5KFGA 5CR4A 2MAXA 4IG0A 1RT6B 1QE1A 3OL9A 2FC0A 1Y11A 1S1UB 3ZDAA 2HLTA 4ZVUB 2W2MP 2QW9A 2AYEA 4ELTA 4WKYA 1FJ7A 2B5JB 1RAGB 5J2QA 4JRQA 3PW4A 2VQEJ 3R9KA 3DWLA 3R6GB 2G5IB 4DFDA 2ITGA 3HLUA 1UVMA 3HSDA 5KG1A 1FNOA 2QWRA 5I4MA 4OJHA 1Z05A 1DLOB 2EPIA 3CC7N 2XNRA 4C2MA 4WE1B 2D3ZA 4C1NI 4F0MA 2IVNA 4P2HA 2K4EA 4ZPDA 3NCQA 2XMAA 4K2XA 3AQPA 3QEXA 1QH9A 4F92B 3PTWA 3C21A 4CO1A 3BSAA 3THPA 3VA0A 4UB3A 4DUTA 2CJ9A 4I9QA 4A8KA 1RXVA 4WFZA 3H5XA 2ASDA 1BHNA 8ICBA 4DQ8A 3SI6A 3P31A 2NYHA 2KKZA 3WBZA 4FZYA 2IRUA 4DR3J 1S0NA 3H7IA 2RN2A 3MECA 9ICUA 3Q23A 5FIIA 3M4XA 4PKHA 4FS1A 1A0OB 2P6UA 3T5LA 4OHVA 2UYTA 2B8PA 4YORA 2V51B 3HZGA 4TXSA 4BRAA 2WUSA 2ZD1A 3BR9A 1RT7B 4EENA 4ILGB 3RJKA 1Z1ZA 1JLQA 2NXJA 4HUGA 3SCKE 4JI8F 3CDUA 1S8OA 2Z4PA 2YKQA 3CJ2A 3L2WA 3AT1B 3ENVA 3GE9A 4ZVSB 4YG2A 1IH7A 2EEYA 1TL7B 5CQGA 1J6ZA 1GLCG 4JKHA 3NH2A 4J2BA 2GVZB 5LM7E 4IEIA 2AF6A 5DLFA 3V6DA 3CCWA 5EVZA 2CPYA 5AM0A 3ISCA 3NAHA 3Q8LA 3Q22A 4C3MA 1D4XA 5D0HA 1NH8A 4RWTA 1YUWA 5IT9U 4K4VA 1MA9B 4AHUA 3D68A 4FPIA 3DDKA 4O3NA 3MM8B 4RBUA 2I7NA 3WT0A 4CGDA 3P4IA 2KFZA 1JMSA 4YOXA 2JSXA 1DARA 4X66J 4DWIA 2DIVA 5I9EB 3RJGA 3PW7A 3ATVA 1V4TA 1XK8A 1K1SA 3AOBA 5AZIB 1PAEX 4DF4A 1TUVA 3C1ZA 2V8DA 2N3OA 4M5HA 2YX7A 3K5NA 3AV9A 1YRTA 2XS5A 3E9PA 1C4AA 5ALFA 2WONB 3MPWA 1F3FA 1KBRA 4JV5K 2Z57B 4L72B 2QMWA 4H54A 2W9MA 2OTLS 2JC1A 5CA5A 4DV2F 2ZQBA 1FXLA 3BGOP 4M6WB 3VQDA 4BRIA 1RCOB 5HI7A 4NLOA 1T3VA 3I8BA 3HJVA 5KFNA 1FWLA 1T4GA 3S6JA 1EQ0A 1R59O 3UDCA 4DV4J 3T79A 3KUEA 1ZM9A 4UAVA 4MEXA 4C23A 4NYFA 4O5FA 1VQ7S 3Q8PB 2BJEA 3PRVA 1RDAA 5AQWA 2MRLA 2PO4A 3IA0A 3PV8A 5KFSA 1RUSA 4K4YA 4MKAA 2U2FA 1Q86T 1IBKJ 4RL1A 4FJ7A 4J2AA 2HKEA 3FQLA 1ATRA 3UN5A 4EGLA 1DHMA 3C7NB 3IN5A 3CNHA 4H4MA 4J37A 4OPKA 1B0TA 3SQ4A 4I64A 3RVCA 5C2CA 1WLJA 4AL7A 3G8SA 1N60A 1NK9A 1C1CA 4U96A 1Y7PA 3MCSA 4R66A 1PBUA 4NRUA 4QPXA 5AM1A 1HIYA 2V2QA 2F4VK 4ED7A 1HI1A 2RF2B 2ESEA 5AKXA 1HNXJ 3QNMA 4JI2K 4OQJA 2DT9A 2CWXA 4P4MA 4Z6CA 4OJ1A 3OVSA 2BJ9A 1H73A 4XIUA 1WI6A 3L2VA 2YHXA 4F50A 3CVKA 1JLAB 3CFRA 3BY5A 4ZJQA 5AKJA 1LWXA 3JPOA 4A59A 1XNQF 2OTLN 2FZCB 3GYNA 4FJXA 2O8FB 5C25A 1R6VA 4LY7A 4QZBA 3PKYA 1PK3A 2LEPA 3ATUA 1S1WB 1HHQA 3DLKB 2LYHA 2KRRA 2P35A 1BPZA 2ZIVB 5FLXY 4F4KA 3DHWC 2ZJ8A 2W2OP 5KAFU 4RQMA 3L2QA 1PAUB 1VQ7N 1B7YB 1NB2A 4DJBA 3DYAB 5AK4A 3W2WA 8ICGA 4PKIA 9ICTA 4BDZA 2EBGA 3H5UA 5HHHA 1RTJB 1ZRMA 3M05A 5IWAF 4RJVA 2Q2RA 4F71A 1D8BA 3H2UB 3G6XA 3LDPA 1SQEA 4K4ZA 3ZDEA 4DCHA 5BJRA 3RH5A 3BS7A 2E88A 4K41A 4LF9J 3JPTA 5HAOA 5KL1B 4MT1A 3GIKA 2VDIA 3OYGA 2CPXA 1P8GA 1NMDA 1B4FA 4F4WA 4BQLA 1FVQA 9ICBA 3K7RA 4CCHA 1I3AA 3HSGA 1XS9D 4RLEA 1ZYQA 1VQ5S 3M1YA 3PYGA 1SKWA 4MO5A 2ZBPA 2IMOA 4XQ8A 4XK8C 4Z6DA 1HJRA 1Q95G 4B3RF 4ED6A 1RHQB 4DSIA 3A12A 3TSPA 2CN1A 3OBIA 2F9TA 1DK3A 2OPQA 4FJIA 4BJQA 3UMBA 3H08A 4Y2PA 4G65A 3FSYA 4DO9A 2RIJA 3BGRB 1LKZA 4MYUA 3AO2A 1RLCL 5HJXA 4P74A 3EGNA 4DR1F 1COOA 1RAAB 2C2DA 2WZ1A 2DR8A 6FD1A 3N7SC 1DXSA 3QBWA 3V1RA 1AB8A 2B4UA 4Y6IA 4JI8K 1UVJA 2ODGA 2ZJ5A 2LQJA 1IBMF 5DB6A 1KN5A 1K73T 4CJRA 3IS9B 4K4UA 4BX9C 1T6CA 2K06A 2OCEA 3HBTA 3VEWA 3M8QB 1K8KA 1M90T 2OTJS 4BR4A 4O3MA 4IFVA 1HA1A 3RRGA 1JLCA 4P9SA 4IG3B 3EKUA 2DRDA 1S0VA 2CVIA 5HHIA 1R0BG 2YNFB 5IT4A 2W42A 3GB0A 2LYBA 2E9ZA 2RHQB 4MDAA 4IRDA 4CZKA 3WKDA 1ZQJA 2QI2A 3J81U 3NS5A 5GAGU 2ZH7A 4KIAA 4PHDA 4I29A 4YFUA 4IH6A 3KBBA 1B0XA 2BCVA 2JWNA 1SZHA 2LPEA 1URJA 1S6PB 2YB1A 5M1NA 4F4ZA 3UPQA 4IKAA 3TR5A 3VCBA 1QZ6A 1MDUB 2WOMB 2H5IB 1KVAA 3A8KA 3FAHA 4JI5F 4ZVGA 3H2VE 3QIOA 4ANDA 4F5NA 1ZC6A 3ZEUA 3BF4A 3PZPA 2UVRA 3B8HA 2WFBA 4DV2K 4DTOA 4M42A 3H42A 2UXBJ 3IG5A 2E2OA 4ILJA 2P5OA 2RT3A 1LWCB 4CJSA 4QS7A 2HSTA 1S9FA 2ZVIA 3DRRA 1CLQA 4FS2A 1ZQRA 9ICGA 1RAOA 4FK4A 1RT3B 4PWWA 1ZAVA 4B3MJ 3C2LA 5ALEA 3H5YA 1ASVA 1QVFR 2IM2A 3H3OB 3I0SB 3CUNA 4LF2A 1P1LA 1R8PA 4EFHA 2OTJN 2I5JB 3RUBL 5G5GA 5A0YB 2JHDA 2KVIA 2XMKA 4M5GA 3VQ5A 4KH4A 5LJ3Y 1NG9A 3HJEA 3RMAA 3MFIA 7ICVA 3D9BA 4BR5A 1PK1B 1UHUA 3V2UC 3K89A 3PRDA 4B3RJ 2ZNYA 2MU2A 3R5BA 4AE5A 4FLVA 3DI6A 3O44A 4P4OA 3AB4B 2OFGX 1CULB 2DKZA 4DEZA 3NS6A 2A18A 3U1NA 2OPRA 3QEWA 2J0XA 1LVHA 2D7SA 1UA0A 1K73O 4QZAA 1U2RA 4DL0C 4M5LA 3CJ7A 4BACA 4OI1A 2GO7A 1YAGA 4DR1J 5HP4A 2DR9A 2WC9A 4CI6A 1N48A 2DQNB 2O66A 1XNQK 4DR2F 4OZ2A 1IUJA 3QAEA 1KD1O 2FC8A 2J5AA 4KI6A 2I8EA 4X4TA 4I7FB 5HN0A 4DTUA 3AVJA 4J2EA 4DCCA 1BC6A 4NLNA 1YRXA 1FKPB 1ZZFA 3OTBA 3PO5A 1Q46A 2D0CA 5K8PA 2LU1A 1VS3A 3KLEB 2KLAA 1ZAXA 1JALA 3VCDA 5CA7A 1SB3C 5FPDA 2OYQA 4YB7A 5IWAK 2V2VA 4OV6A 1KQFB 1VBXA 2Q97A 3VR1A 2QEXN 1SIJA 3OYCA 2PYLA 2O8EA 1VYAA 5J0SA 3GIIA 4CJ7A 2E1EA 1OPIA 4LVNP 3L3CA 2ZJPL 3SAGA 3MN6A 3CTRA 3CO0P 9ICWA 3SV4A 3MC1A 2J9DA 2LXIA 1S6UA 1UVNA 2UU9F 1LAWA 1RAEB 4PWUA 4DL4A 3MM6B 4FJNA 1S9EB 3CC4S 2UUWA 2LLZA 3ENQA 3OVNA 1L7MA 1YHQN 3NRZA 1TAMA 4BQZA 1C0MA 2PMZC 2NS1B 3KDNA 4DUYK 1EETA 2VPZB 1X40A 4PY5A 4W98A 5BPMA 4OLBA 2NXCA 3VAHA 1HKCA 3SQOP 4B3RK 4Y28C 3OS0A 5JVHQ 1X3NA 4RTFD 2O4IA 3KJVB 5BPNA 3O5TB 4XH1A 2P9SB 4P7TA 4DX6A 1TKDA 3D0IE 4I2HA 3N28A 1KLNA 4JI6F 3PCOB 1BXNA 4GO5X 3T1YF 4FWLA 4A8XA 1C7YA 3BH6B 4UOHA 4FZXC 4DR1K 3CJ8A 5U47A 1YG0A 4CGIA 2J76E 1QSLA 1FRJA 3LDAA 2YQ0A 5HBMA 2O8BB 4DUZJ 1NO8A 2NZTA 3EPGA 1S1XB 1NZPA 5C42B 4YHHF 2E4LA 3VN5A 3U26A 2D1CA 4DG1B 4PA1A 1E6YB 1IIPA 1IBMK 2D3DA 2CPFA 2YHWA 2VG7A 1OMSA 4GVLA 2A0FB 1CJTA 3DOMB 1RDBA 1LB2B 5TZVA 4RPXA 1BPYA 1F5AA 3L4BC 3AO1A 3FBCA 1NHVA 3Q8KA 4CHPA 4PQUB 4NZ6A 3ORYA 3Q7BA 4CIEA 3OPKA 4AQYJ 3T9ZA 1RT5A 1H7WA 3ICXA 1VBYA 4YY3F 3PR5B 2M5YA 1HUOA 5AQHA 3MZIA 4DR2J 3EEQA 5C12A 3UB5A 3DXKB 3M1FA 1HQEB 4E7KA 3H8WA 3ILJA 3AJ2A 1NZAA 1XQIA 3FFIB 1RDDA 2F4FA 4KHSA 7ICKA 3IR7B 2IJRA 4WU3A 1FVSA 4JI5K 3NCPA 3HVWA 1T3OA 3K59A 3V7KA 2IDEA 2CDQA 1FEHA 3OYMA 3UIQA 2J8AA 2Z30B 2H5JB 4YVZA 2V8VA 4DU8A 2EXUA 2KYZA 5DZ7A 1VR6A 1ZBFA 4Z2XA 1Z26A 4PRFA 4K8XA 5AJ3F 3EJMA 4CGGA 4HCBA 2CJXB 3BGLA 2PEHA 3MMBA 1T11A 4P52A 3HKZF 5CZ1A 3KG1A 4RBTA 3MURP 3CCUN 1WKJA 1G1XA 4HUEA 1IQZA 1DBDA 4IWVA 2VOOA 7ICQA 1Y10A 1LWFB 1RA7A 1TTHB 3AOCA 2CNOB 3H1QA 4F91B 2DKOB 3BKFA 1V4SA 1RTZA 4DU3A 1RB0A 2W2PP 3C66A 3BREA 1K9MO 2KMDA 4K4HA 2D4WA 3IBCB 2KFYA 4FNIA 4JV0A 4BG8A 1TVRB 3ZZRA 4JKGB 2XHBA 4ID8A 3SQ2A 3LH2S 5E3CA 1ZETA 1P7DA 5ALPA 1UZHA 4RU9A 3RRHA 2K1RB 2PFPA 4ZP7A 4NRTA 2RUGA 3CIMA 4JI1F 4JKEA 5K14A 3WU2U 1BY9A 2OLWA 1S72S 4YOEA 3CWJA 3N0VA 2OP5A 4QS8A 1BI4B 3OL7A 4CD3A 3VGKA 4KH5A 4E7LA 3MUMP 3C6TA 2XMTA 1IQTA 5CAAA 1HD1A 3MAAB 4DR2K 3O4NA 3V9XA 2EDUA 5J2KA 5AQRA 2CPEA 3B8AX 1KC8T 2QMUB 1VGYA 4Q0BB 3BGUA 3CIPA 2W8LA 2E5SA 2DNZA 1RKIA 4ES1A 2GHPA 3M9MB 3D6FB 5KFAA 4B9UA 2E1FA 3GJSB 1CUKA 3WNEA 4DSEA 2CNNB 4LRFA 3ILLA 1NSQA 4K7QA 1ZQAA 2OEHA 3OTQA 4LF1A 3R3TA 2FGCA 4CFCA 4K8ZA 1HPZA 4AFFA 4IJNA 1W7AA 3QICA 2W7AA 3QNOA 2BJ8A 3FCWA 1TV6A 1XTZA 1RLDA 3K57A 3HT0A 2IAJA 2LYVA 4I2PB 3OYBA 3M8PB 3M1VA 1ZH5A 3A4TA 1ZM4A 3OSNA 1UEVA 4I69A 4A57A 4HTJA 1MMLA 3SV3A 2C3OA 3PLAA 2Q1NA 3DHXA 1FD2A 2G0CA 3ZI4A 2W9BB 4EX6A 2EK1A 2GS8A 1J53A 2HZCA 3OTOJ 2UU9K 3FMWA 4LF8J 4RQ3A 2YPYA 3V6KA 3V6HA 3D2QA 3PEHA 1P27B 2DRAA 1TAQA 4AT1B 2J0WA 2WBRA 2HNDA 4C0ZA 4FYWB 1L7PA 3NWGA 3LPYA 3SQGA 2YXLA 4ECYA 4AHRA 1RYUA 2OHFA 1S72N 5BYSA 2RHSB 3HKZC 4KLUA 2ZWOA 2CGLA 5LSRA 3VHQA 3QJPA 2QWMA 3GJTB 4OJ6A 3QFPA 1ELOA 3LP1A 3FJ2A 4TYBA 4A8SA 2CADA 5CYQA 2O6KA 2ATQA 5D0EA 2XS7A 5M2RA 5F8NA 4ITSA 2D74B 4ZPAA 2KHCA 3F9KA 2OPPA 1VQKN 4JI6K 3ZXWA 1VQ9N 5B0DA 3T1YK 2XS2A 3QRQA 1ZQLA 2ASYA 3ZTPA 3ZO7A 2DPNA 4JB8B 3C6HA 1U02A 1NMEB 3OYDA 1D8LA 2NRZA 2L9DA 4ZVEA 5J2CA 4WKRA 4RR5A 4JKCA 3L8BA 2J9EA 2MA1A 3PXGa 2FI1A 2X3GA 3KHLA 4YHHK 1IKVA 1LXJA 3AO3A 5CJ7A 2IVPA 4I2JA 1NDPA 3NAIA 2KL8A 1OH6A 1GXUA 4C4RA 4Y1DA 1KC8O 2QTWA 1S4EA 4D3GA 4CHOA 2K8BB 2B6AB 5AHXA 5C2GA 4I56A 3PX0A 4HUFA 4IDKB 2XY5A 4MFFA 3M30B 3ZSVA 1NI3A 1FRLA 3VAGA 4OZ3A 5D15A 3LZIA 4CF1A 2NUHA 1WAJA 3T7ZA 3WXKA 4YY3K 2GHVC 2HRTA 5CYMA 5F3ZA 4DSKA 4WZMA 2P9GA 4O8KA 4A2AA 3IGNA 2PMHA 2V7YA 2KVSA 1RGVA 1U6ZA 2H3QA 5DBCA 4M5JA 4J9QA 1A5XA 2ZIUB 3D28A 2XYHB 4O3PA 3VAFA 4ZHRB 4F93B 2R7UA 3CSKA 2MZ1A 2FHKA 2HOIA 2XZTB 1R8CA 1K8AT 1TK5A 2H4WB 3R6LB 4OMFG 4O4GA 1CI4A 3FYHA 1P90A 1KEKA 1C0FA 4B9LA 1X5TA 1IKYA 5AJ3K 3RJEA 4CLZA 2J0QD 5E3QA 4LSLB 1I5OB 5F2RA 1OIAA 5HP1B 3I87A 5TKYA 1Q0NA 2NXNA 3BYRA 3V4IA 2DXFA 3IP0A 1SCJB 1U1PA 1WEXA 3WIUA 4YMMA 2O5DA 3KOOA 1VBKA 5FPNA 4DU1A 3NWRA 1B43A 2EKNA 1XQSC 3TADC 3DM2A 2HQIA 3QT7A 4QIGA 1V5IB 1JXVA 2QA2A 3Q8QB 3ULEA 3TANA 4P0PA 1HNVB 4Y2JA 4LD0A 2EZZA 1Y88A 2XIDA 2IVMA 2OD4A 3HDSA 2LKYA 1F21A 3ENAA 2ZBRA 3KK2A 3CMAS 2CQIA 4EYIB 1YBUA 4L75A 1KHVA 4FPBA 4IKFA 2CIMA 5DQHA 2F8HA 1X2IA 3OTEA 2M7SA 4CLUA 3O2IA 4OYPA 2IHNA 2SXLA 2ZM6J 1RQLA 5HMWA 5J0PA 3VEXA 3G8TA 2F1IA 2E1AA 4PWDA 4OHYA 7FD1A 1SAZA 4RQ2A 4JI1K 2HQFA 3HHNB 3R7SB 2HHSA 3H7HB 2BVZA 2M2BA 1LOTB 3THTA 4PG8A 4NLSA 3CM5A 1ZBHA 5IT9Y 3MR7A 4DV3J 4QYZJ 4FLYA 2YMLA 3V72A 2P66A 2FJDB 2AJ2A 1UMJA 2MSTA 4BXOB 4Q44A 1GK8A 2ZOFA 2YHAA 3SD7A 5J2MA 1DTTB 3CD5A 2P6TA 2LDIA 4GKKF 2CH5A 4I2FA 1VC5A 3CDAA 4ETXA 2F8LA 4DS4A 3MMAA 4KTWA 5AQJA 1RZTA 4JS5A 1WCLA 2HQCA 2ALZA 3DXSX 1MN9A 2PKEA 1B70B 3O4QA 2W1BA 1NCLA 1QDUB 4NI2B 3PKMA 3UKRA 4PZNA 2KE7A 4B1VA 3HX0A 3PIOQ 2OYYA 2JGAA 5IM0B 2F8KA 1HYSA 3E51A 2ZIWA 2P9CA 4BVPA 2WAQD 1FTCA 3ZTQA 1T03A 2DHGA 2L5YA 1K8AO 4BRKA 2KSOB 3CMAN 5DDMA 2MKJA 4RG8A 1PGZA 4H0PA 4P7VA 1WD6A 2QSWA 2WF7A 4JV1A 3OBWA 2VJUA 5F9LA 4O9MA 4ELUA 3PNCA 4QIWF 3DRSB 3BGFA 4DB3A 3DGVA 2KT5A 3NGRA 3QFUA 1Y00A 2ZITA 2A1AA 2ZXHA 2BQ3A 3MMCB 3CQYA 4RW6B 4O3SA 1RHKB 4E1MA 2HOQA 2UP1A 2GJIA 4ZVPB 2OO4A 2FYXA 2MMYA 2YQ1A 2FDRA 2R4FA 1N63A 3FZKA 2YBVA 3SUOA 2KG1A 5DG8A 2ASJA 2UZAA 3IAM9 1QD1A 1IWGA 1UVLA 3T9NA 2BEFA 2XVTA 2MXYA 3QGIA 4M9NA 3VQQA 3CM6A 1KW4A 4BR0A 2G13A 3T69A 2BA9A 4I2EA 4J2DA 4K0KF 3QZ8A 4QAGA 1YJ9S 4M1KA 1ZQBA 2XY8A 2NR0A 4NCGA 3OYHA 3I76A 1WOSA 5BR8F 2W55A 2VBWA 4QYZK 4NOHA 4USKA 2VICA 3TUIC 3VPZA 3CCQN 4Y2TA 5CZXA 5C15A 3FCHA 3UXNA 4CHZA 5ALUA 2WF6A 3OYEA 4CHYA 2NRTA 2IJNA 2QB1A 1EX4A 2MQLA 4ZP8A 2DH9A 4DV6F 1DT9A 5AKHA 1Q7LB 4MAKA 1FRXA 5J0UA 4U8YA 3C8YA 3IDWA 3MWBA 4F0KA 1TFRA 4HT5A 2IM1A 4Y0FA 4QW8A 3RAMA 4NL9C 4R5PA 2Q79A 4LMZA 2J7KA 4JAXA 2HI0A 4E1JA 2HBLA 3IG8A 2JHEA 4LR9A 1J5EF 2MQQA 5J8YA 1RFQA 2D3UA 3M9OB 3LZJA 2V50A 1DRZA 4QJFB 2XZWA 2ZJRQ 4DCJB 2QLXA 4UB5A 4GKKJ 2OELA 3VERA 2MSNA 2R7OA 1IG6A 2E20A 3LP0A 3QSIA 3K0JA 2PFDA 2V94A 4LF4F 1HYVA 2XLKA 4Y2YA 4XAKA 1CRXA 3C6UA 5KT2A 1YJ9N 3OVBA 4M3RA 2J6SA 3ZT2A 5EX5A 2E44A 2IC3A 1WCNA 5A8KB 4QIWC 1ZQUA 1HEKA 4ED8A 2L48A 4PHAA 4K2JA 4X4OA 5KG7A 1IKXB 4ZKAA 4EFAC 3H40A 3KKSA 3K75D 3PVXA 1CZ9A 3DMJB 4BR9A 1MU2B 2P2CB 2ADBA 3NGDA 4DR4J 2PE8A 5IZHA 3TAMB 5EE0A 3BN4A 2JJ4D 4PL7A 1MN8A 1X9SA 3THXB 1U04A 4OYBA 2B9YA 3TW0A 4DL7A 2FPMA 3A5MC 4RBVA 2BJ3A 3LK9A 1VK0A 3L3FX 4U8VA 4UW2A 2J7UA 1DTQA 4LVOP 4GY2B 3Q86A 4YN3B 4YS2A 3WKAA 4UAZA 3Q89A 4JBCA 3AXKA 3I5AA 1BQMB 3JPPA 3PACA 4OGCA 3MN5A 2XG8A 4U7UK 4DOZA 4U67L 1U1KA 1YTYA 3OR1B 3LDQA 3S1TA 1X4HA 5G0RB 5ALXA 2BE7D 3ZZZA 4TUPA 4LF6F 4FOEA 5FDLA 3AO4A 1QQNA 4K0KJ 1HLUA 3RJMB 3GCWP 3RH6A 1I3OB 3IM1A 1QCKA 4JEPA 5GMDA 5C2FA 3CC2N 2HAFA 1HBMA 4M04A 1E6VB 1QHAA 2HBZB 3OR2A 2QIFA 4FWPA 1X0FA 3R27A 2CQBA 2LM4A 5DJBA 5J1EA 1Z2LA 4GKKK 3HPOA 3MCNA 1JLBB 3ZFVA 5BN8A 3HW8A 1KONA 3H8MA 4TLRA 1U0HB 3A0BU 1CJVA 1JWWA 4QIFA 3RBXA 5ALMA 5M1QA 4WF9L 2IS3A 2EVZA 2EZYA 3MM5A 2NSCA 2HHUA 2ZDPA 3RSEB 2UVVA 2GVDB 2WVFA 2MQPA 4KRWA 1F1BB 1AFJA 4FFDA 2PFQA 5ALHA 3ASMA 1RT2A 2P8IA 1KEJA 3CE8A 5IV4A 1QTMA 4ILMA 1N5VA 3U27A 2UV8A 1NBWA 5AQMA 1KVKA 5ETKA 3KLFB 3G87A 3D45A 3IRXA 5C7PA 3NG8A 2ZZMA 4KX5A 1RHUB 4ES3A 4LF4J 2HFVA 2R7XA 2PIIA 2MY7A 4MMOA 3AU2A 1HMVA 1QHTA 3MEEA 3OSPA 3N5FA 4OX7A 1A77A 2KH9A 3MEGB 2CQDA 3RU0A 4MK7A 3MABA 5IFMA 2B9XA 1EXNA 2D0AA 1C1BB 4IDHA 4UATA 5EOYA 2HK3A 3KYLA 1TP7A 1Z4OA 3U02A 4FBUA 4RNNA 3BF1A 3SQ1A 4ID5B 5K8MA 4B3SF 3LGMA 4LH5A 2VJ5A 1N32J 2UUCF 5ALJA 1T7PA 2PI4A 4NLQA 3OYIA 2B0CA 4K0KK 3GSIA 5GAEP 3NL0A 1FXXA 3A8YA 5BR8K 4JI4F 1G15A 4W5TA 2OEJA 3HHDA 2CRLA 3BSCA 5T7LB 1T9XA 3A5LC 1YJUA 3K5PA 4G6VB 5ETPA 5E26A 4DSFA 5DO2A 3HSJA 3THWA 2WSCC 2NO4A 2G8HA 2OWOA 2C3MA 3CD6S 3P96A 3K5OA 4QZHA 5DRKA 3BO2A 4DV6K 3NLCA 5I3UB 2VASA 4X4UA 3E3XA 2XBPA 5KFDA 2AKWB 2FJAB 3OGUA 4WYBA 3RW6A 4KV8A 4LF6J 2BUNA 3TAFA 1DZ5A 3WXJA 2KVCA 3QQCD 3F2CA 1R0AB 3D4JA 1CJKA 1UWBB 4MIWA 1WSIA 4OJ3A 2EH9A 4PHPA 2ZXIA 1AXQA 1J5EK 2BOPA 3SSSA 1FNMA 2YH0A 4ZVFA 4UB1A 2Z2LA 3K9JA 3CCSN 1YT3A 4FJGA 3PNIA 2JR5A 5DB8A 2ATLA 1O51A 3M9NB 4E3SA 1YDLA 1PBAA 4LF4K 1GX5A 1RTDA 2F3JA 4BRQA 4GC7A 5F0WA 2BM1A 4J9RA 1NMNA 3CJQA 5B8HA 4DL3A 2K60A 2B43A 4HTUA 4LIWA 2FJEB 3VQ4A 1YXQA 3F73A 3V81A 5KFYA 3UVJB 1ZQTA 2WF5A 2B4VA 4PZVA 2DGOA 2WVDA 4KGXB 2F96A 3MR2A 5JVGQ 5ALKA 3HM9A 3BO3A 3CD6N 3QIPB 3CDWA 2VG6A 2BR0A 2HF4A 2ALYB 2ZIXA 1BWVA 2EFPA 3IBWA 4PKGA 2DIUA 2UVUA 1PJ5A 1T9WA 5B0GA 2IDOA 3G8QA 4ZJOA 1ZQNA 2D0BA 3DXBA 3D2WA 3VETA 2K3IA 4PPXA 3T6JA 3CDEA 4F3MA 4CYUB 4R8UA 3HFKA 4QS9A 1GMVA 1MWYA 3MEDB 3OYNA 3KK1A 4UF4A 4MF8A 4FZMA 1U2VB 3PIPQ 1DRGA 4Y2CA 4QOZB 5KFOA 1LXNA 4OYAA 1FEZA 4LF6K 3SNNA 2XSFA 4B3SJ 2DNNA 3KKRA 1XMBA 3GZFA 4ZN3A 4NLTA 1XEZA 2HSEB 2KK0A 1B3TA 1MC8A 1Y4ZB 1N34F 1RT1B 4DPWA 3TA1A 3ZCMA 2Y9UA 1FKOB 4B1YB 4YDXA 2AJ0A 3OYJA 4CLWA 3SI8A 3NGIA 1SBRA 4ZCMA 5GINA 1SUQB 4A8WA 7ICUA 4M9LA 1M1GA 4I6YA 4OZNA 1LKYA 4DFMA 3LOUA 4MFBB 2VONA 3MDQA 3CIZA 1S1UA 5B09A 3MM7B 5AK5A 3JTOA 2F2AB 2P9UB 2B5JA 1B22A 5H9FJ 4NLUA 3CMES 1GMWA 4CJWA 2HQDA 1RWMB 2V9WA 1WG4A 1U1OA 5HANA 1F9FA 2NRHA 1DLOA 4GNIA 2E2PA 2HFZA 3NGKA 5KT5A 2Y1JA 1NNLA 3CJ1A 4KLJA 4QR0A 1KQQA 3HZEA 3PFOA 4KPYA 4CK2A 1NH7A 3THYB 1WSVA 2VGNA 2YJFA 4CJEA 2V34A 3W7BA 1RILA 4MLEA 2RDIA 4M9HA 5F8GA 1OY6A 1U09A 5ALZA 4MN4C 4QZDA 3NMAA 4CF3A 3LDLA 2Y0BB 2IVOA 3CJ0A 2OZSA 7ICMA 4ZPCA 3RMDA 1RSCA 4RW8B 1RXOB 2MSSA 9ICVA 3DGPB 3QFHA 2HWHA 1FFWB 1NNDA 1WC5A 4L74A 3FZBA 3KFWX 2D69A 2MGZA 4USAA 1RT7A 5BYQA 2F77X 4B3TJ 3NRWA 4BRMA 2ZH8A 1M5OC 1TUGB 4B3SK 1HYZA 1Q18A 1NSAA 2QLWA 3M6KA 2YNIB 4LFAJ 4B8AB 2UUCK 2KDOA 2YNGB 4I6WA 4LSNB 4CNZA 4WFBQ 1D9AA 5AI5A 3OS1A 3KLVA 2RB7A 1Q9YA 1TL7A 3GP9A 4NCBA 4EBEA 1QAJA 4JI4K 4DTSA 1NEEA 3R8YA 3D7EO 4UQGA 3ISBA 5IIJA 5KRTA 2M9KA 1EX8A 3SIPB 5DDOC 5EDWA 5AQYA 1OY9A 2HWIA 2E5GA 4EUVA 4QZ9A 2X6NA 2G4BA 2HHHF 4XPCA 4JI3F 1WTBA 2FF3B 2MLZA 2ASLA 1YJTA 3CCRS 3HSCA 3TJ9A 1RWOB 1CJUB 1JLGB 2VIHA 3GIRA 1WN7A 3KG0A 1WC6A 3AOAA 3AAWB 8AT1B 4DPUA 2OA8A 3ONNA 1BLUA 2VD3A 3L95X 2AEJA 1KDNA 2CNKB 2BHNA 2DXDA 4FW1A 2MB0B 2GELA 2KKVA 4RX6A 3D6TB 5AZIA 3PSFA 2E5LJ 4CTAB 4O55A 2ERRA 5E0OA 2R8JA 2JEFA 5DB7A 1TK0A 4RQ7A 2JL9A 4RNFA 2JH1A 1V9OA 4HACA 3L4QA 5IOLA 2QARB 1GX6A 3IHQB 5IIOA 3D6RA 1WWVA 4ETZA 3DXMB 3L09A 3HD1A 3S3OA 4DTJA 4FWQA 3RG6A 2W54A 2BE2B 3HILA 3WX8A 3SR6A 4JOUA 3UMGA 1BG3A 4PL8A 2QTDA 1PJ7A 3PX6A 5EX3A 2PBDA 1FHTA 3OJSA 2E8MA 2HQGA 2Z2ZA 3AA5X 2OGUA 2H5XA 2ZHOA 4ATNA 2ZOMA 1CG2A 3P49B 4E19A 3PYDA 4J9LA 2FXUA 3ENWA 1OXJA 5KQDA 2C2RA 2W8KA 4CECA 5AE3A 4JD2B 1AROP 2K4IA 3A2FA 1GOBA 1RM6C 1FO4A 2CRXA 3ZT1A 3MPYA 1SXEA 3OHRA 4UB6U 2XI3A 4MQ3A 1RQ0A 1FFVA 3KKFA 4X65F 5DDRC 4WPAA 3QBXA 2BV3A 3CCRN 5L9XA 2FTRA 5CZVA 4EO8A 2UVWA 2JEIA 4FLTA 3J7AN 4FJJA 4XRHA 3NNHA 1KQSM 9ATCB 4Q43A 2YX1A 2DB1A 5J0QA 4NLYA 2KJ8A 5D3GA 2AYMA 3DLHA 1SL1A 1IO2A 3S6EA 2GO8A 1HWIA 4R63A 3IUCA 2IBOA 2W6KA 4M8LA 4I9LA 1YWXA 3ZX2A 3OUYB 1Q7YO 3WEEB 1FEEA 3CFPA 4HKQA 2YKNB 4FPRA 1S97A 4F04B 4CJ3A 3DLKA 3BZCA 5HSPA 1KBUA 5AQUA 1NJZA 2ZBQA 1N34K 3UO0A 3FBEA 2ZIVA 2IJFA 1WBBA 3FVYA 3B9JA 1NUEA 3ISND 4FF3A 4C1NK 1P6TA 3TZWA 5ALNA 4FM0A 5DK5A 3O3LA 4YOWA 3OFEA 7ICOA 1RTIA 4LRBA 3A8EA 3T1HF 1H2VZ 2WAQF 1ZRNA 3O5BA 4DV0J 1UQVA 1SH2A 1VCTA 2RJZA 2POKA 1K44A 3M7DA 2E7WA 1VQLS 2BYCA 2ZDOA 4O5BA 2HWTA 1WG5A 1SPBP 4CLPA 2QK9A 1PUZA 3H3NO 4QWCA 3MN9A 2MDAA 2B9WA 1X4CA 4LBPA 4S0MA 5F0XA 2D41A 4HT7A 3ADAC 4IO9Q 3QGGA 2VZ9A 3GJRB 1FNXH 2WMMA 4E7HA 4KHPJ 1ZJNA 4W5QA 1ZOLA 1U49A 1LW2B 1XMQJ 2RSQA 3RBDA 3NGUA 4USIA 4X62J 1BISA 5C2DA 2MLXA 2OAUA 2GNKA 2DNGA 1NK0A 5AQOA 4CEDA 4J9NA 1JNZB 4LFCF 1K1QA 1HW8A 1Q79A 4ICAA 5D49A 5CHCB 5LOQA 1YJRA 3ZT0A 5KFXA 4WP3A 2AYGA 3A13A 5ADXH 2LQ9A 1BA0A 4H5WA 1GO3F 5GIOA 3BGRA 1OH5A 3MD3A 3F44A 3HM8A 2FVQA 4B1WB 4PHEA 5HK4A 2KHVA 3DOKB 1HI0P 1HNWF 2FHJD 1RXWA 2VJ4A 1VLBA 2YY6A 3TZZA 4IR9A 5F8IA 5A2QU 4FVUA 4X65J 1A7GE 3JAMU 3KNAA 5KFIA 4J03A 2RPIA 3VQ9A 3TYTA 2FZKB 2DFHA 1S6OA 1F44A 5L1LA 2Q36A 1UVKA 4CNQA 1VQLN 4Q2MA 5AKLA 3FEZA 4EX7A 2HRYA 3M8QA 4P73A 4QBUA 4BREA 4A48A 3ICLA 3VQSA 4DCOB 1VQ4N 3QYPA 4IG3A 2IOCA 3SFGA 4G9ZA 1V38A 1BQXA 4WJBA 3UQSA 4JUZA 1OSCA 4MFCA 2RE2A 2HHHK 4JI3K 4CEQA 4YCXA 2DGTA 3MCAB 2NO5A 5CE3A 3IFRA 2E9RX 1NSPA 4IG0B 3D3BJ 5AM4A 4Y1CA 2A41A 4K4IA 3UXPA 1T3NA 2O3DA 1RGIA 3MM9B 1BIUA 3V7LA 3SYZA 2FBTA 2GX8A 5J2QB 4U9RA 4ZA1A 1S6PA 1Y9OA 2DPJA 2VL1A 1PYSB 2QJ3A 2GJFA 1FTRA 4M3YA 4X4NA 2NRRA 2ACMA 3W9JA 4QWAA 3TARA 2QLFB 2DY1A 4JWNA 3LA0A 1C4CA 3BSNA 2D0OA 1EKRA 2IA6A 3VGMA 1MSWD 5AXLA 2WBNA 2VBYA 3TKAA 1MNEA 5J0WA 1SZ2A 1AYEA 4E8UA 3S41A 4K50A 2DR5A 3MFHA 3I0RA 3AVCA 2BKEA 1YLXA 1QM9A 1XO1A 3QUTA 1ZQIA 2HHXA 3F9MA 2QGFB 3WK9A 3BQ2A 1VQYA 4O0IA 1Z6RA 4M3ZA 1BGXT 4TUSA 2V63A 1Q8LA 3GPAA 2I5JA 2JDJA 1ZTTA 4A62A 2EAPA 2B3TB 4DTPA 3JTNA 4CLLA 2QA4N 4NLGA 3H5SA 1QAYA 4X65K 4CF8A 2ZD1B 2MYFA 3QMLA 4DHVA 3DV9A 4F72A 1PK1A 4Z37A 4TYAA 3RH4A 3EE3A 1U1LA 2P9PB 1NRKA 2QXLA 4F5PA 4LBIA 1CULA 3AJ1A 2IOFK 5AKEA 1RU2A 2ACYA 3MR3A 4C7ZA 4KI4A 1ZZNA 1RWXB 4PYDA 3US5A 1S1TB 4LZGA 3J8AA 2BZ2A 5D78A 3NF9A 1Z19A 4DV7J 2WTFA 3L7UA 3V6DB 2HBYB 1XIQA 4TY8B 4G1PA 3HWTA 1DOQA 2F1FA 2X6SA 1OUQA 3OTCA 3CHWA 1N0UA 4URQU 1A76A 3UMCA 1KAYA 1C0TA 1U26A 2G08A 2GCFA 4KN7A 2ZE2B 2G2OA 2FJVA 5EWGA 5DDPC 5B0AA 3G9CA 3EL2A 3UQ2A 1WSRA 3NF8A 2Q66A 3AA4A 5IQQA 2KD1A 3G71S 2DKXA 2K89A 4LF5F 2GFFA 5IIMA 4UBBA 3O8WA 3WUHA 2DHHA 1RAHB 4CIOA 3KLEA 3T1HK 2E1RA 2YWHA 1O08A 3W63A 3FRYA 4NA1A 4KB7A 4A5BA 1J9AA 4QZEA 2LU2A 4EZ6A 1KWMA 3N6LA 1WYGA 4M63C 1F9HA 2DTJA 4M7XA 3A0HU 2I9SA 2DVIA 3FZHA 1KVIA 5AZJA 3VESA 1W97L 3MTKA 2YPZA 4Y2IA 1PVRA 2ZH6A 4DCPB 2CG8A 5GIPA 4YDDB 3NOCA 3FC9A 1WHXA 3EGVA 3GMGA 5KRSA 3H2LA 5ETMA 1HLWA 4OYOA 4KHNA 4H4OB 4GKJJ 5BPLA 3MXHP 1NGBA 4DX8H 2FUG9 4DOCA 4A8FA 4E0DA 3IAS9 4EWTA 3GWCA 3OJUA 4Z6EA 2A42A 3NNAA 1UT8A 3PR4A 8ICYA 4H4MB 2B9EA 3GDXA 4YQWA 4LFCK 1OQ6A 2GA7A 3TJAA 4DTXA 3ETMA 1X9WA 2P9SA 3I55S 7FDRA 4FLXA 2ZUGA 2XY6A 1NLKL 1Z2ZA 2FMPA 3DLLQ 2G07A 4FZVA 3TAQA 1KDHA 2P9NA 1SKSA 4ZMMA 1QQ7A 1NB7A 1W26A 1HNWK 4CZLA 2EK6A 2O8BA 4F4AA 4NJ8A 3GDQA 4OJPA 1S1XA 5C42A 1X4BA 5AFUH 4WJ3B 3CPEA 4NMXA 1S5ZA 3QZ7A 3CF5Q 5DS7A 2JRZA 4WYLA 2LHTA 2UUAJ 4HWIA 2XSJB 5GAGP 3CQ8A 4IO1A 3AVLA 3A3NB 2BCRA 5KT3A 4PQUA 1IXRA 1Q81O 2MZTA 4KFBB 3DLBA 1EP4B 3DLRA 2ASPA 1Y3KA 3W2WB 3LM2A 1X4GA 2CJBA 1NGFA 4CJKA 3DXKA 1HQEA 2CZ4A 4NY8A 4QR2A 3FFIA 1VJWA 2E29A 2Z7JA 1BCOA 3QWUA 4LQ9A 1JIHA 1XNRJ 4J9KA 1VSMA 1NK5A 1JX4A 3ID8A 1O5JA 3I55N 2A6OA 4UY85 1I6JA 1KQKA 3UCGA 1VHIA 1X66A 3TNVA 5EX0A 2LEAA 4PUOB 3ONQA 1RDFA 4KO0A 1TFWA 3T3FA 4NA3A 1TVAA 3CCTA 3OYLA 3V6JA 1KNZA 2KQ2A 3HSTB 3QEPA 2E8PA 2ZGYA 2H3ZA 3C6AA 5A0LA 2ILYA 1RK8A 5T7BA 3O3HA 4BRFA 5FPEA 2HFNA 3AGRA 2H5EA 2VWBA 2OPQB 4L3NA 2GOLA 2VYPA 1ZD2P 5AQSA 1LWFA 2I5HA 1GMWD 4ISEA 2W25A 2JZBA 2HOFA 4X64J 5ALRA 1PVPA 1FWKA 1DJ0A 1T9TA 3BF3A 1IKWA 1FJEB 5KPZA 4F2SA 4OYXA 3VTIA 4L6V3 4GIBA 2LQBA 2MHEA 3CCVS 3OYKA 4AM7A 1TVRA 4FZZA 2QLJB 3HHLC 3AO5A 2R9LA 2JWLA 1NNEA 2Q0ZX 4FJLA 5AKIA 4RW7A 1Q1KA 4LFBJ 4KHMA 2W01A 3BYPA 4CJLA 2B8QA 3ZD9A 4EU0A 1O1WA 8ICTA 3CJ3A 4K4WA 2RU3A 3CP8A 3VALA 4X4VA 2W7PA 2WF9A 3M2RA 1K8KB 2ZKTA 4XPEA 4IFVB 4DQPA 3C3LA 8ICIA 2YN4A 4JKBA 9ICNA 2W43A 4NB4A 4M3XA 3JQJA 5BPCA 4P4PA 1IG9A 1BE4A 2AD9A 2V67A 4JI0J 1H7XA 1HR0F 2EC0A 2W4CA 2YKPA 3M6VA 4DL2A 1P9QC 2VQFJ 3QO9A 1FD8A 2RQKA 1UFWA 3MMJA 3M8RA 1FRKA 3O8MA 5F8JA 1B0VA 1WHYA 2ILZA 2GIRA 1KQSR 3EWGA 2NPFA 4LF5K 3C2KA 3AB2B 5CCLA 2G09A 2G8IA 2XB2D 4M9JA 1H74A 4I68A 2H3IA 3UDEA 1ICEB 5JVHL 4TQSA 4FK0A 4BBYA 4PXEA 3QU7A 3VAIA 3ZEUB 2I7PA 2HZVA 2ZKUA 1PYTA 3F5AA 3LQVA 2IIRA 3MXJA 4XEIA 2KICA 5E3PA 5HMYA 1NDKA 1BD6A 4ED2A 3DRRB 4CO2A 2VQEF 2Y8YA 1B64A 3NY0A 3CCJS 3GSDA 3KHGA 1YTUA 3B78A 5D4NA 3FUYA 1MWMA 1DGSA 3MR5A 2XO6A 4ZVHA 3O9RA 4CLFA 2BMBA 3LWMA 1RDWX 2HB5A 3VGSA 3MGHA 3D2EA 4DBQA 3CJCA 3ISZA 3MAQA 2GUPA 3QJJA 3WNHA 2NYIA 3NH0A 2FLPA 1CS4A 3CCMS 1Y5LB 5AQXA 3TA2A 4GXIA 1QUPA 3KLIA 2AU0A 1PC5A 4DR3F 5EUHA 3M3ZA 5EY4A 3G86A 4OV1A 2R3VA 1TZ0A 5HR6A 1VSFA 4I0WA 4KBIA 3OVAA 3K17A 1QS4A 2BW7A 3AA9A 3JPSA 1ZBIA 5KFKA 2VV5A 2FMSA 3MX2A 4CZGA 1RHMB 2RQCA 3J80U 3E2EA 4MF2A 1WG8A 2B6AA 2RAQA 1DQAA 4PHTX 5JS1A 3ZSWA 5A6PA 4FZNA 1B4SA 3CCJN 4K8RA 2OM6A 2WB1D 1T02A 4HCCA 3NP5A 4WP9A 8ICJA 2R8KA 1UEKA 2VPWB 5C0YA 1NKBA 2I38A 1RISA 2YTCA 1FKAF 8ICOA 3R5DA 2Y3YA 3SUNA 1HR0J 2O8EB 4C8YA 1YK9A 5HR7A 2ZIUA 4U95A 4X66F 4KREA 9ICCA 1JJ4A 2H3GX 4AM6A 3CCMN 2EWSA 4FDFA 1OY8A 4URSA 3KZIU 2CQ1A 1LEOA 5GTIU 1TUWA 3Q0AA 1FXRA 1SKUB 1GEHA 1YX2A 3RZAA 3WXMB 2D8CA 2WF8A 3D5MA 2IGIA 5FJ4A 1ITGA 1S9GB 2GGPA 4M9GA 1X5PA 3DC2A 5HP1A 1U48A 5D4OA 3IP4B 2YWWA 2QKKA 4IOXA 1KVJA 1RDRA 4TNOA 5HLFA 1HPMA 2VKZG 4QQBA 4RCHA 4KLOA 2DHSA 3O9UA 3SAHA 1UW4A 2DISA 4XH5A 3TAGA 2MZQA 4DV4F 2PA3A 3SCIE 2DBYA 3AQFA 4H0YB 4R65A 4KH1B 5IIIA 2DGQA 1HNVA 3VGUA 3TTFA 4A46A 2Y0SF 2VWKA 4KR0B 2G06A 4OO1J 3MBYA 1GT8A 3A3PB 5AKZA 2E2NA 4ZN1A 3D6MB 2ZTEA 1Z4UA 1IBKF 4GVBB 2MTLA 1FRIA 3AXMA 3TWZA 3VEYA 3EDRB 1S7HA 3UE5A 2UXDJ 2A1SA 1QAIA 3ILOA 5EU7A 1Z3EB 4G9BA 4QZVB 4IR1A 3NBPA 5IT9O 1FWPA 3K1RB 3M8WA 1DURA 1TFYA 1RBLA 3FE1A 1IJJA 2HVEA 1NM2A 5HVFA 1S6QB 1RI7A 1WORA 1CJTB 4Z4GA 1HNXF 4A8YA 2RILA 5LSOA 4ZP6A 4H03B 1QQCA 1B0PA 1NK7A 1QUVA 2GX9A 2ABYA 1Y5IB 2HVDA 4N7TA 4M5NA 2R8GA 4BXOA 1RTHA 1RT5B 5E33A 1HR0K 1TL4A 1DTTA 2Z2YB 5A76A 4KAIA 1PO6A 4C3KA 5EE3A 4NXNF 4IYQA 3OLAA 4IQTA 4EIAA 4V19X 4DQRA 4WIIA 4DTRA 4YB5A 4BVOA 5J0RA 2YKOA 2A1RA 4C7YA 4DOAA 3SBMA 4FXVA 4NI2A 3A5NC 1BNPA 3EVWA 1VQ6S 5D6GA 3SSRA 1URNA 1ZBUA 4FXDA 3H4DA 2NQPA 9ICQA 3MXMA 3NHGA 3FR0A 1IG8A 3NS7B 2JV3A 1RBSA 2W9AA 4FO0A 2F63A 4TN2A 4UOCA 1H6KX 2OZMA 3HHLB 4RNHA 5AXNA 3DRSA 2VQEK 3CRXA 4CEAA 1CZBA 1NK6A 5F8MA 2KJ5A 4I6AA 4LF9F 3QNWB 1W25A 3HL8A 2YKMB 2IIHA 2HOEA 4G3IA 4OX9J 3FEXB 4CGFA 5BR9A 4KLTA 1NKCA 2F8MA 4WK1A 1ZM3A 2F7VA 3Q8RB 4DFKA 3H0PA 3BSOA 1WTFA 1HQUB 2Y0SC 5GAHI 5B0BA 4D3HA 4K5SA 1HJPA 1DGKN 3GZ7A 5ALTA 5KG2A 2HPUA 4C9DA 4R0JA 2VFRA 4DR3K 3MGVA 1K5OA 2CQGA 2DNQA 2YX8A 3IG1B 5I42A 2X1FA 4JK8A 2R8IA 5K14B 3SMVA 4AL6A 1VQ6N 1JLEB 3OLBA 1ZQGA 3O4WA 3TU5A 4JRPA 1SQFA 1SKRA 1B99A 2I2YA 2G1HA 4CEZA 4C4SA 2HK2A 2PI5A 3KUHA 4OI6A 3KIOA 3HZ6A 4EYHB 3FCVA 3ZC4A 5J0OA 4CZEA 3EICA 5FP0A 2ZUAA 4KN4A 4O23A 1VIXA 1WKLA 1YKWA 2DNLA 3CCZA 5K9FA 4QIVA 4ED1A 1DGJA 3RFAA 2NNWA 5C5JA 1H2UX 2XY7A 4C8NA 3GYGA 3ZDDA 2CPRA 3QU2A 1KVCA 1GLJO 1BPBA 1T05A 1NGEA 1FDDA 3IBPA 3NVVA 4M5DA 2AQ0A 1HPZB 4UARA 3W9HA 1GLAG 4YXJA 3R7BB 1JJ2M 3BN7A 2V4QA 1Q16B 1C0UB 1TV6B 3LM9A 3NF7A 1RDCA 1BO5O 4OJLA 2VODA 4NXNJ 4X66K 3HULA 3UD5A 3MD1A 1FT8A 4UT4A 1U25A 1N36J 1SQKA 2OMLA 1KOHA 1TKXB 2CXYA 5D8HB 5M1OA 2YHBA 1ZXIA 3OA9A 1SC3B 1Z4NA 1IR0A 2G8FA 3WXIA 4FYDA 3EW9A 2LFVA 5A8KA 3FZLA 3SQGB 4RUBA 3B54A 3EUNA 3FZ2A 3V5RA 1IKXA 4DR7J 2BKNA 3RRKA 1UA1A 1SWWA 3GG1A 2UXBF 3EE9A 3SUQA 4FN5A 4CLKA 2GMLA 1OVQA 3UDLA 1N6QB 3DMJA 5EXWA 1MU2A 2ZJQQ 3DAWA 3LP1B 3KD1E 4DV4K 4OPJA 3V9UA 3ETLA 3TAMA 2QC3A 9ICOA 2EFGA 1APSA 2DNHA 1HWJA 3O08A 3SUPA 3WHIA 1ZJMA 4I2IA 1U6FA 3THXA 4B3MF 4N8OA 4YOTA 3C16A 2C3UA 1IBKK 4NLVA 5HQMA 1N0VC 3QNNA 4RPZA 1BQMA 2V8GA 1JXLA 4OKEA 2X74A 3OR1A 1V3ZA 3T19A 5G0RA 2BCSA 4X84A 3HKWA 2EC2A 2DEIA 1XMOJ 3PIOL 1M5HA 2FSJA 2LECA 4IQUA 1FXDA 2XLIA 4MLHA 3J81O 2XM3A 4BY9C 1HNXK 4C8KA 2GLEA 1FE0A 3V7JA 3DRXA 3BS9A 3GONA 1LWEB 5FLXU 1TL5A 2PXIA 2OMOA 2NZCA 1E6VA 3QAUA 3A8IA 3H46O 1KKXA 3F41A 3LTOA 3EYZA 3PJWA 1YZ6A 3H98A 5CYMB 1JLBA 2DUYA 3O9SA 5AQQA 1M5PC 4HTLA 1U0HA 1NPRA 5HVGA 4JLHA 3C94A 4Y34A 2ZH4A 1NU0A 3LVWA 5AE2A 4F4XA 1RWNB 5LJ5Y 3TADA 2PFFB 4O8UA 3DDIA 3M8SA 1V97A 1CC8A 4I2DA 4DU4A 3D2FB 4H5TA 2R7WA 2EG1A 3BBCA 1YI2S 4J7CA 5AKGA 2MUTB 2M8HA 4RQ0A 1KD1T 4BGAA 1BU6O 3TABA 1O8BA 2A3JA 2LDYA 4CRXA 5CH7B 1OKJA 4PJ0U 4R0EA 3A3OB 1ZQWA 1K6YA 3KLFA 5F8LA 3OL8A 3NOGA 2GQ2A 3G0ZA 1VQ5N 4TVAB 2RP5A 3CI5A 1KOOA 2J6UA 3V4IB 2OFHX 1E4GT 1JL2A 1N4LA 4LF9K 1NJIT 4DFPA 3QB0A 5J2HA 1VSHA 5J2EA 2RKIA 3DM2B 1EJ7L 2AMCB 5HNKA 3D3CJ 1HNZJ 3TI0A 1XBWA 2ZH3A 2HIYA 1NU4A 4I2QB 2WFAA 1C1BA 4BLGA 2DR6A 1WUAA 5J2AA 3N79A 4BC9A 3KK2B 4L76A 2FJXA 3SEIA 1BUXA 3DFEA 4M7YA 4EP4A 2FBXA 2BANA 2VOPA 4ID5A 2FBYA 4DLGA 1IWAA 5AK3A 4FYYB 1GLBG 1YJNS 4BWMA 3J7YP 1U1MA 5ALQA 4QZ8A 1JKHA 1SXDA 1S1VA 3KLHB 4CLTA 1D3WA 1ZQZA 4GO7X 8ICEA 5T7LA 1SB6A 2ZJRL 4QWDA 4KSEB 5ETNA 2ZJAA 1YI2N 5DBBA 3T1AA 2M3DA 3D6JA 1RBRA 3KJQB 2F65A 2GWSA 4DUZF 4HL9A 1XN9A 2N7YA 5J2PB 2HGLA 4DLEA 1L8LA 4ZCLA 4KBOA 2G0AA 2BX6A 2BDPA 3KZBA 3RR7A 3Q24A 2BJDA 2E8NA 5E79U 1H72C 2RQ5A 2AJFE 1MG7A 4TURA 1UWBA 2ASMA 4NWBA 3E9LA 1RT4A 4EBDA 3W1YC 2JEGA 1TQLA 4DZ6A 1N54B 3SJHA 5LXYA 2CAJA 3NVZA 3UKRB 2XCPA 4WIQA 3ENOA 3FGVA 5F3XB 1HYSB 4AQYF 2ZIWB 5KFHA 3CXCR 5HMMA 4DF8A 5KPRA 2C3PA 3CJTA 3POTA 5IV3A 2DH7A 4P10A 4J9SA 3K58A 4CBWA 1VRUA 4IH5A 3NXZA 2IMWP 5D0GA 1VAZA 2BOAA 5FRNA 3JB9k 1NPPA 2R7QA 4CJ5A 2G2ZA 2RHKA 3PRBA 4IOCQ 4YD1A 2QA4G 3EWAA 1NJIO 3TAPA 3QSYB 3FSIA 2QT7A 3UVJA 5C24B 3WQTA 1R7IA 4ID1A 5AQKA 2A5XA